BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1371

Length=943
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009768280.1|  PREDICTED: dynamin-related protein 3A-like         275   9e-82   Nicotiana sylvestris
ref|XP_009599814.1|  PREDICTED: dynamin-related protein 3A-like         272   1e-80   Nicotiana tomentosiformis
ref|XP_006359369.1|  PREDICTED: dynamin-related protein 3A-like         271   2e-80   Solanum tuberosum [potatoes]
ref|XP_004250727.1|  PREDICTED: dynamin-related protein 3A-like i...    271   2e-80   Solanum lycopersicum
ref|XP_010313067.1|  PREDICTED: dynamin-related protein 3A-like i...    271   2e-80   Solanum lycopersicum
ref|XP_011087964.1|  PREDICTED: dynamin-related protein 3A              254   3e-76   Sesamum indicum [beniseed]
ref|XP_008382203.1|  PREDICTED: dynamin-related protein 3A              256   4e-76   
ref|XP_007199665.1|  hypothetical protein PRUPE_ppa001399mg             255   6e-76   Prunus persica
ref|XP_008237240.1|  PREDICTED: dynamin-related protein 3A              255   9e-76   Prunus mume [ume]
gb|KHG14620.1|  Dynamin-related 3A -like protein                        259   1e-75   Gossypium arboreum [tree cotton]
ref|XP_009368315.1|  PREDICTED: dynamin-related protein 3A-like         252   4e-75   Pyrus x bretschneideri [bai li]
emb|CDO97375.1|  unnamed protein product                                248   4e-75   Coffea canephora [robusta coffee]
gb|KJB79569.1|  hypothetical protein B456_013G054900                    257   4e-75   Gossypium raimondii
ref|XP_008373223.1|  PREDICTED: dynamin-related protein 3A-like         254   1e-74   Malus domestica [apple tree]
ref|XP_011092457.1|  PREDICTED: dynamin-related protein 3A-like         246   1e-74   Sesamum indicum [beniseed]
ref|XP_002532763.1|  dynamin, putative                                  254   1e-74   Ricinus communis
gb|EYU39106.1|  hypothetical protein MIMGU_mgv1a001369mg                245   3e-74   Erythranthe guttata [common monkey flower]
gb|KDO44154.1|  hypothetical protein CISIN_1g003355mg                   252   3e-74   Citrus sinensis [apfelsine]
ref|XP_010112241.1|  Dynamin-related protein 3A                         254   3e-74   Morus notabilis
gb|KDO44157.1|  hypothetical protein CISIN_1g003355mg                   251   5e-74   Citrus sinensis [apfelsine]
ref|XP_006487698.1|  PREDICTED: dynamin-related protein 3A-like         251   5e-74   Citrus sinensis [apfelsine]
ref|XP_009343811.1|  PREDICTED: dynamin-related protein 3A-like         252   5e-74   Pyrus x bretschneideri [bai li]
gb|KDO44155.1|  hypothetical protein CISIN_1g003355mg                   251   5e-74   Citrus sinensis [apfelsine]
gb|KDO44156.1|  hypothetical protein CISIN_1g003355mg                   251   5e-74   Citrus sinensis [apfelsine]
ref|XP_009366330.1|  PREDICTED: dynamin-related protein 3A-like         251   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_006423650.1|  hypothetical protein CICLE_v10027825mg             251   1e-73   Citrus clementina [clementine]
ref|XP_007042814.1|  Dynamin-related protein 3A isoform 2               251   9e-73   
ref|XP_010254582.1|  PREDICTED: dynamin-related protein 3A-like         251   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_007042813.1|  Dynamin-related protein 3A isoform 1               251   1e-72   Theobroma cacao [chocolate]
ref|XP_010029995.1|  PREDICTED: dynamin-related protein 3A isofor...    248   1e-72   Eucalyptus grandis [rose gum]
ref|XP_010029996.1|  PREDICTED: dynamin-related protein 3A isofor...    248   1e-72   Eucalyptus grandis [rose gum]
emb|CBI38239.3|  unnamed protein product                                245   1e-72   Vitis vinifera
ref|XP_010029997.1|  PREDICTED: dynamin-related protein 3A isofor...    248   1e-72   Eucalyptus grandis [rose gum]
ref|XP_010029998.1|  PREDICTED: dynamin-related protein 3A isofor...    248   1e-72   Eucalyptus grandis [rose gum]
gb|KJB32131.1|  hypothetical protein B456_005G226100                    243   1e-72   Gossypium raimondii
ref|XP_002269774.2|  PREDICTED: dynamin-related protein 3B isofor...    245   1e-72   Vitis vinifera
ref|XP_006351713.1|  PREDICTED: dynamin-related protein 3A-like         239   1e-72   Solanum tuberosum [potatoes]
ref|XP_010645184.1|  PREDICTED: dynamin-related protein 3B isofor...    245   1e-72   Vitis vinifera
ref|XP_010277557.1|  PREDICTED: dynamin-related protein 3A-like         247   4e-72   Nelumbo nucifera [Indian lotus]
gb|KJB32127.1|  hypothetical protein B456_005G226100                    242   1e-71   Gossypium raimondii
gb|KJB32130.1|  hypothetical protein B456_005G226100                    243   2e-71   Gossypium raimondii
gb|KJB32128.1|  hypothetical protein B456_005G226100                    243   2e-71   Gossypium raimondii
ref|XP_002309855.2|  hypothetical protein POPTR_0007s02960g             243   9e-71   
ref|XP_010691382.1|  PREDICTED: dynamin-related protein 3A isofor...    243   1e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010691383.1|  PREDICTED: dynamin-related protein 3A isofor...    243   1e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010315139.1|  PREDICTED: dynamin-related protein 3B-like         231   2e-70   Solanum lycopersicum
ref|XP_004292471.1|  PREDICTED: dynamin-related protein 3A              239   4e-70   Fragaria vesca subsp. vesca
ref|XP_012081387.1|  PREDICTED: dynamin-related protein 3A              238   4e-70   Jatropha curcas
gb|KJB32126.1|  hypothetical protein B456_005G226100                    242   5e-70   Gossypium raimondii
gb|KHF99511.1|  Dynamin-related 3A -like protein                        243   6e-70   Gossypium arboreum [tree cotton]
gb|KJB32129.1|  hypothetical protein B456_005G226100                    243   9e-70   Gossypium raimondii
ref|XP_011003246.1|  PREDICTED: dynamin-related protein 3A-like i...    240   1e-69   Populus euphratica
ref|XP_011003245.1|  PREDICTED: dynamin-related protein 3A-like i...    240   1e-69   Populus euphratica
gb|ABN05858.1|  Dynamin central region; Dynamin GTPase effector         235   1e-69   Medicago truncatula
gb|KJB47248.1|  hypothetical protein B456_008G017900                    241   2e-69   Gossypium raimondii
ref|XP_006373005.1|  hypothetical protein POPTR_0017s06930g             239   2e-69   
ref|XP_011006400.1|  PREDICTED: dynamin-related protein 3A-like i...    236   1e-68   Populus euphratica
emb|CAN69849.1|  hypothetical protein VITISV_007523                     231   2e-68   Vitis vinifera
ref|XP_009793686.1|  PREDICTED: dynamin-related protein 3B-like         225   6e-68   Nicotiana sylvestris
ref|XP_003593276.1|  Dynamin-related protein 3A                         236   2e-67   
ref|XP_003593275.1|  Dynamin-related protein 3A                         236   3e-67   
ref|XP_009590783.1|  PREDICTED: dynamin-related protein 3B-like i...    223   6e-67   Nicotiana tomentosiformis
ref|XP_006373004.1|  dynamin-like family protein                        226   2e-65   
ref|XP_010527014.1|  PREDICTED: dynamin-related protein 3A-like i...    226   7e-65   Tarenaya hassleriana [spider flower]
ref|XP_010527015.1|  PREDICTED: dynamin-related protein 3A-like i...    226   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_011006401.1|  PREDICTED: dynamin-related protein 3A-like i...    223   1e-64   Populus euphratica
ref|XP_010548840.1|  PREDICTED: dynamin-related protein 3A-like         225   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_008794571.1|  PREDICTED: dynamin-related protein 3A-like         223   6e-64   
ref|XP_004485614.1|  PREDICTED: dynamin-related protein 3A-like         223   9e-64   Cicer arietinum [garbanzo]
ref|XP_010927716.1|  PREDICTED: dynamin-related protein 3A-like         226   9e-64   Elaeis guineensis
ref|XP_006852885.1|  PREDICTED: dynamin-related protein 3A              218   4e-63   Amborella trichopoda
ref|XP_010926713.1|  PREDICTED: dynamin-related protein 3A-like         220   6e-63   Elaeis guineensis
ref|XP_008454460.1|  PREDICTED: dynamin-related protein 3A-like         223   1e-62   Cucumis melo [Oriental melon]
ref|XP_004147508.1|  PREDICTED: dynamin-related protein 3A              223   2e-62   Cucumis sativus [cucumbers]
ref|XP_010527016.1|  PREDICTED: dynamin-related protein 3A-like i...    218   3e-62   Tarenaya hassleriana [spider flower]
ref|XP_008455128.1|  PREDICTED: dynamin-related protein 3A-like i...    214   6e-62   Cucumis melo [Oriental melon]
ref|XP_008455130.1|  PREDICTED: dynamin-related protein 3A-like i...    214   8e-62   Cucumis melo [Oriental melon]
ref|XP_011658828.1|  PREDICTED: dynamin-related protein 3A isofor...    214   2e-61   Cucumis sativus [cucumbers]
ref|XP_008802260.1|  PREDICTED: dynamin-related protein 3A-like         213   3e-61   Phoenix dactylifera
gb|KHN19022.1|  Dynamin-related protein 3A                              210   9e-61   Glycine soja [wild soybean]
ref|XP_003543135.1|  PREDICTED: dynamin-related protein 3A-like         210   9e-61   Glycine max [soybeans]
ref|XP_009590784.1|  PREDICTED: dynamin-related protein 3B-like i...    201   1e-60   Nicotiana tomentosiformis
ref|XP_003545730.1|  PREDICTED: dynamin-related protein 3A-like i...    208   5e-60   Glycine max [soybeans]
gb|KHN33568.1|  Dynamin-related protein 3A                              207   8e-60   Glycine soja [wild soybean]
ref|XP_009411851.1|  PREDICTED: dynamin-related protein 3A-like         210   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007148356.1|  hypothetical protein PHAVU_006G201400g             204   4e-59   Phaseolus vulgaris [French bean]
ref|XP_006583773.1|  PREDICTED: dynamin-related protein 3A-like         209   8e-59   Glycine max [soybeans]
gb|KJB47250.1|  hypothetical protein B456_008G017900                    205   2e-58   Gossypium raimondii
gb|KJB47251.1|  hypothetical protein B456_008G017900                    205   2e-58   Gossypium raimondii
gb|KJB47249.1|  hypothetical protein B456_008G017900                    205   2e-58   Gossypium raimondii
gb|EYU18402.1|  hypothetical protein MIMGU_mgv1a001513mg                194   3e-58   Erythranthe guttata [common monkey flower]
gb|KGN53892.1|  hypothetical protein Csa_4G182230                       191   1e-56   Cucumis sativus [cucumbers]
ref|XP_007159159.1|  hypothetical protein PHAVU_002G213900g             191   1e-55   Phaseolus vulgaris [French bean]
ref|XP_011658829.1|  PREDICTED: dynamin-related protein 3A isofor...    191   9e-55   Cucumis sativus [cucumbers]
ref|XP_008455129.1|  PREDICTED: dynamin-related protein 3A-like i...    190   2e-54   Cucumis melo [Oriental melon]
ref|NP_001045220.1|  Os01g0920400                                       191   2e-53   
gb|EEE55903.1|  hypothetical protein OsJ_04571                          191   2e-53   Oryza sativa Japonica Group [Japonica rice]
gb|EPS68205.1|  hypothetical protein M569_06566                         179   3e-53   Genlisea aurea
ref|XP_006645242.1|  PREDICTED: dynamin-related protein 3A-like         189   9e-53   Oryza brachyantha
gb|EMS54655.1|  Dynamin-related protein 3A                              183   4e-51   Triticum urartu
emb|CDM85737.1|  unnamed protein product                                183   5e-51   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99253.1|  predicted protein                                      183   5e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009381334.1|  PREDICTED: LOW QUALITY PROTEIN: dynamin-rela...    182   5e-51   
gb|KHN34016.1|  Dynamin-related protein 3A                              181   8e-51   Glycine soja [wild soybean]
ref|XP_003522885.1|  PREDICTED: dynamin-related protein 3A-like         181   9e-51   Glycine max [soybeans]
ref|XP_003532597.1|  PREDICTED: dynamin-related protein 3A-like         179   2e-50   Glycine max [soybeans]
gb|KHN46250.1|  Dynamin-related protein 3A                              179   2e-50   Glycine soja [wild soybean]
ref|XP_003564945.1|  PREDICTED: dynamin-related protein 3B-like         184   2e-50   Brachypodium distachyon [annual false brome]
gb|EYU18412.1|  hypothetical protein MIMGU_mgv1a022072mg                171   3e-49   Erythranthe guttata [common monkey flower]
dbj|BAB85644.1|  dynamin like protein 2a                                167   8e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAC61784.1|  similar to dynamin-like protein encoded by GenBan...    167   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190906.1|  dynamin-related protein 3A                         167   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567931.1|  dynamin-related protein 3A                            167   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120554.1|  PREDICTED: dynamin-related protein 3A isofor...    169   2e-48   Brassica rapa
ref|XP_009120625.1|  PREDICTED: dynamin-related protein 3A isofor...    169   2e-48   Brassica rapa
gb|AID60088.1|  dynamin-like protein 2                                  169   2e-48   Brassica napus [oilseed rape]
emb|CDX75370.1|  BnaA01g03320D                                          169   2e-48   
emb|CDX68994.1|  BnaC01g04590D                                          169   2e-48   
gb|EEC72053.1|  hypothetical protein OsI_04962                          173   3e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_002869201.1|  hypothetical protein ARALYDRAFT_491315             166   4e-48   
ref|XP_006412330.1|  hypothetical protein EUTSA_v10024438mg             166   5e-48   Eutrema salsugineum [saltwater cress]
ref|XP_006845411.1|  PREDICTED: dynamin-related protein 3A              172   6e-48   Amborella trichopoda
gb|KFK29987.1|  hypothetical protein AALP_AA7G203100                    168   2e-47   Arabis alpina [alpine rockcress]
ref|XP_010437736.1|  PREDICTED: dynamin-related protein 3A isofor...    163   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010447213.1|  PREDICTED: dynamin-related protein 3A-like i...    163   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010447212.1|  PREDICTED: dynamin-related protein 3A-like i...    163   3e-47   Camelina sativa [gold-of-pleasure]
emb|CDY46101.1|  BnaA03g52670D                                          164   7e-47   Brassica napus [oilseed rape]
emb|CDX72418.1|  BnaC07g44400D                                          164   8e-47   
ref|XP_009138202.1|  PREDICTED: dynamin-related protein 3A-like         164   9e-47   Brassica rapa
ref|XP_006283135.1|  hypothetical protein CARUB_v10004162mg             163   1e-46   Capsella rubella
ref|XP_009108778.1|  PREDICTED: dynamin-related protein 3A-like i...    162   5e-46   Brassica rapa
ref|XP_009108779.1|  PREDICTED: dynamin-related protein 3A-like i...    162   5e-46   Brassica rapa
ref|XP_010680388.1|  PREDICTED: dynamin-related protein 3B-like         168   1e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008673232.1|  PREDICTED: uncharacterized protein LOC100383...    167   1e-45   
tpg|DAA56115.1|  TPA: hypothetical protein ZEAMMB73_205529              167   1e-45   
ref|XP_002458996.1|  hypothetical protein SORBIDRAFT_03g044010          165   2e-45   Sorghum bicolor [broomcorn]
ref|XP_004971078.1|  PREDICTED: dynamin-related protein 3A-like         164   3e-45   Setaria italica
ref|XP_008654834.1|  PREDICTED: uncharacterized protein LOC100279...    165   4e-45   
gb|AFW84149.1|  hypothetical protein ZEAMMB73_720282                    165   6e-45   
ref|NP_001146324.1|  uncharacterized protein LOC100279900               164   9e-45   
gb|KFK39955.1|  hypothetical protein AALP_AA3G311000                    163   1e-44   Arabis alpina [alpine rockcress]
ref|XP_008348877.1|  PREDICTED: dynamin-related protein 3A-like         158   5e-44   
gb|AES90601.2|  dynamin 3A-like protein                                 166   5e-44   Medicago truncatula
ref|XP_010467216.1|  PREDICTED: dynamin-related protein 3B-like         159   3e-43   
ref|NP_001154516.1|  dynamin-related protein 3B                         160   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409667.1|  hypothetical protein EUTSA_v10022566mg             160   4e-43   Eutrema salsugineum [saltwater cress]
ref|NP_565363.2|  dynamin-related protein 3B                            159   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565362.1|  dynamin-related protein 3B                            159   6e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20619.1|  dynamin-like protein                                    159   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518214.1|  PREDICTED: dynamin-related protein 3B isofor...    158   6e-43   Camelina sativa [gold-of-pleasure]
dbj|BAB85645.1|  dynamin like protein 2b                                159   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297027.1|  hypothetical protein CARUB_v10013019mg             158   6e-43   Capsella rubella
ref|XP_010488879.1|  PREDICTED: dynamin-related protein 3B-like         158   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_003608404.1|  Dynamin-related protein 3A                         162   8e-43   
ref|XP_002885904.1|  hypothetical protein ARALYDRAFT_480333             157   1e-42   
gb|EMT11624.1|  Dynamin-related protein 3B                              162   4e-42   
ref|XP_006653321.1|  PREDICTED: dynamin-related protein 3A-like         162   2e-41   Oryza brachyantha
dbj|BAK03569.1|  predicted protein                                      156   2e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010239798.1|  PREDICTED: dynamin-related protein 3A-like i...    158   1e-40   
gb|EAY93838.1|  hypothetical protein OsI_15615                          160   1e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_010239796.1|  PREDICTED: dynamin-related protein 3A-like i...    158   1e-40   Brachypodium distachyon [annual false brome]
ref|XP_010239797.1|  PREDICTED: dynamin-related protein 3A-like i...    158   1e-40   
gb|EEE60872.1|  hypothetical protein OsJ_14527                          157   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052600.1|  Os04g0381000                                       157   2e-39   
emb|CAE02157.2|  OSJNBa0072D21.2                                        157   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977934.1|  PREDICTED: dynamin-related protein 3A-like         154   3e-38   
emb|CDY48440.1|  BnaA08g11490D                                          135   7e-38   Brassica napus [oilseed rape]
emb|CDY28314.1|  BnaC03g66450D                                          134   2e-37   Brassica napus [oilseed rape]
ref|XP_008669526.1|  PREDICTED: dynamin-related protein 3A-like i...    145   3e-37   
ref|XP_008669525.1|  PREDICTED: dynamin-related protein 3A-like i...    145   3e-37   
ref|XP_001777446.1|  predicted protein                                  144   4e-37   
ref|XP_002960102.1|  hypothetical protein SELMODRAFT_437242             145   1e-36   
ref|NP_001170021.1|  uncharacterized protein LOC100383931               135   3e-35   
ref|XP_002963601.1|  hypothetical protein SELMODRAFT_404911             137   2e-34   
ref|XP_002515392.1|  dynamin, putative                                  128   2e-32   Ricinus communis
ref|XP_001775158.1|  predicted protein                                  127   2e-32   
ref|XP_010432531.1|  PREDICTED: dynamin-related protein 3A-like         127   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_001761534.1|  predicted protein                                  122   7e-31   
ref|XP_010268466.1|  PREDICTED: dynamin-related protein 3A-like i...    126   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010268464.1|  PREDICTED: dynamin-related protein 3A-like i...    126   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010268467.1|  PREDICTED: dynamin-related protein 3A-like i...    126   2e-30   Nelumbo nucifera [Indian lotus]
emb|CBI21170.3|  unnamed protein product                                118   3e-30   Vitis vinifera
ref|XP_002984035.1|  hypothetical protein SELMODRAFT_119205             123   3e-30   
ref|XP_007011677.1|  Dynamin-related protein 3A isoform 1               127   4e-30   
emb|CAN83903.1|  hypothetical protein VITISV_020250                     118   4e-30   Vitis vinifera
ref|XP_007011678.1|  Dynamin-related protein 3A isoform 2               127   6e-30   
gb|KFK29989.1|  hypothetical protein AALP_AA7G203400                    120   8e-30   Arabis alpina [alpine rockcress]
ref|XP_001766173.1|  predicted protein                                  121   2e-29   
gb|KJB55124.1|  hypothetical protein B456_009G064100                    123   5e-29   Gossypium raimondii
ref|XP_004291982.1|  PREDICTED: dynamin-related protein 3A-like         116   3e-28   Fragaria vesca subsp. vesca
gb|KHG17659.1|  Dynamin-related 3A -like protein                        120   4e-28   Gossypium arboreum [tree cotton]
ref|XP_012076390.1|  PREDICTED: dynamin-related protein 3A-like         118   1e-27   Jatropha curcas
ref|XP_008377478.1|  PREDICTED: dynamin-related protein 3A-like i...    107   3e-27   
ref|XP_008377481.1|  PREDICTED: dynamin-related protein 3A-like i...    107   3e-27   
ref|XP_008377475.1|  PREDICTED: dynamin-related protein 3A-like i...    107   3e-27   
ref|XP_008377477.1|  PREDICTED: dynamin-related protein 3A-like i...    107   3e-27   
ref|XP_008377480.1|  PREDICTED: dynamin-related protein 3A-like i...    107   3e-27   
ref|XP_008220636.1|  PREDICTED: dynamin-related protein 3A-like         113   3e-27   
ref|XP_008377476.1|  PREDICTED: dynamin-related protein 3A-like i...    107   3e-27   
ref|XP_009768872.1|  PREDICTED: dynamin-related protein 3A-like i...    115   4e-27   Nicotiana sylvestris
ref|XP_009768867.1|  PREDICTED: dynamin-related protein 3A-like i...    115   4e-27   Nicotiana sylvestris
ref|XP_009768868.1|  PREDICTED: dynamin-related protein 3A-like i...    115   4e-27   Nicotiana sylvestris
ref|XP_002974698.1|  hypothetical protein SELMODRAFT_101670             113   8e-27   
gb|EMS48857.1|  Dynamin-related protein 3B                              118   1e-26   Triticum urartu
gb|KDO67387.1|  hypothetical protein CISIN_1g045702mg                   114   2e-26   Citrus sinensis [apfelsine]
ref|XP_006483515.1|  PREDICTED: dynamin-related protein 3A-like i...    113   2e-26   Citrus sinensis [apfelsine]
ref|XP_006483516.1|  PREDICTED: dynamin-related protein 3A-like i...    113   3e-26   
ref|XP_009359079.1|  PREDICTED: dynamin-related protein 3A-like i...    104   8e-26   Pyrus x bretschneideri [bai li]
ref|XP_009359081.1|  PREDICTED: dynamin-related protein 3A-like i...    104   9e-26   Pyrus x bretschneideri [bai li]
ref|XP_009359080.1|  PREDICTED: dynamin-related protein 3A-like i...    104   9e-26   Pyrus x bretschneideri [bai li]
ref|XP_009359082.1|  PREDICTED: dynamin-related protein 3A-like i...    104   9e-26   Pyrus x bretschneideri [bai li]
ref|XP_009359077.1|  PREDICTED: dynamin-related protein 3A-like i...    104   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_009359078.1|  PREDICTED: dynamin-related protein 3A-like i...    104   1e-25   Pyrus x bretschneideri [bai li]
emb|CDP18852.1|  unnamed protein product                                107   1e-24   Coffea canephora [robusta coffee]
ref|XP_008379402.1|  PREDICTED: dynamin-related protein 3A-like       99.8    3e-24   Malus domestica [apple tree]
ref|XP_009363360.1|  PREDICTED: dynamin-related protein 3A-like         100   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_010324550.1|  PREDICTED: dynamin-related protein 3A-like i...    103   6e-23   Solanum lycopersicum
ref|XP_004244503.1|  PREDICTED: dynamin-related protein 3A-like i...    103   7e-23   Solanum lycopersicum
ref|XP_006357068.1|  PREDICTED: dynamin-related protein 3A-like         102   1e-22   Solanum tuberosum [potatoes]
ref|XP_010692951.1|  PREDICTED: dynamin-related protein 3A-like i...  89.0    3e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010692952.1|  PREDICTED: dynamin-related protein 3A-like i...  86.7    1e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009630896.1|  PREDICTED: dynamin-related protein 3A-like       82.0    4e-16   
gb|KDD75260.1|  dynamin                                               88.6    4e-16   Helicosporidium sp. ATCC 50920
emb|CDQ91233.1|  unnamed protein product                              83.2    4e-16   Oncorhynchus mykiss
ref|XP_010304441.1|  PREDICTED: dynamin-1-like protein                84.0    5e-16   Balearica regulorum gibbericeps
gb|EMP28527.1|  Dynamin-1-like protein                                83.2    6e-16   Chelonia mydas [green seaturtle]
gb|KIO24681.1|  hypothetical protein M407DRAFT_76640                  88.2    7e-16   Tulasnella calospora MUT 4182
gb|KIY51903.1|  hypothetical protein FISHEDRAFT_36290                 87.4    1e-15   Fistulina hepatica ATCC 64428
ref|XP_004348308.1|  dynamin central region family protein            87.4    1e-15   Capsaspora owczarzaki ATCC 30864
dbj|GAA28275.2|  dynamin GTPase                                       87.0    1e-15   Clonorchis sinensis [oriental liver fluke]
gb|AAD22412.1|  dynamin-like protein variant 4                        84.0    2e-15   Rattus norvegicus [brown rat]
gb|KDO44159.1|  hypothetical protein CISIN_1g003355mg                 55.5    2e-15   Citrus sinensis [apfelsine]
ref|XP_009176405.1|  hypothetical protein T265_11475                  87.0    2e-15   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_002594524.1|  hypothetical protein BRAFLDRAFT_87747            86.7    2e-15   Branchiostoma floridae
emb|CCA73280.1|  probable DNM1-dynamin-related GTPase                 86.7    2e-15   Serendipita indica DSM 11827
emb|CBJ26322.1|  Dnm1, dynamin-related GTPase involved in mitocho...  82.0    2e-15   Ectocarpus siliculosus
ref|XP_011400707.1|  Dynamin-1-like protein                           83.6    2e-15   Auxenochlorella protothecoides
gb|KDO44158.1|  hypothetical protein CISIN_1g003355mg                 55.1    3e-15   Citrus sinensis [apfelsine]
gb|EYC27799.1|  hypothetical protein Y032_0008g190                    80.5    3e-15   Ancylostoma ceylanicum
emb|CDH50084.1|  dynamin-a                                            86.3    3e-15   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS04791.1|  hypothetical protein LRAMOSA07321                    86.3    3e-15   Lichtheimia ramosa
ref|XP_007892869.1|  PREDICTED: dynamin-1-like protein isoform X1     85.9    4e-15   Callorhinchus milii [Australian ghost shark]
ref|XP_008827873.1|  PREDICTED: dynamin-1-like protein isoform X4     85.9    4e-15   Nannospalax galili
ref|XP_007892870.1|  PREDICTED: dynamin-1-like protein isoform X2     85.9    4e-15   Callorhinchus milii [Australian ghost shark]
ref|XP_007892871.1|  PREDICTED: dynamin-1-like protein isoform X3     85.9    4e-15   Callorhinchus milii [Australian ghost shark]
ref|XP_008827872.1|  PREDICTED: dynamin-1-like protein isoform X3     85.9    4e-15   Nannospalax galili
ref|XP_008827871.1|  PREDICTED: dynamin-1-like protein isoform X2     85.9    4e-15   Nannospalax galili
gb|EYC27797.1|  hypothetical protein Y032_0008g190                    80.5    4e-15   Ancylostoma ceylanicum
ref|XP_010858873.1|  PREDICTED: dynamin-1-like protein isoform X1     85.1    4e-15   Bison bison bison
gb|KJA22831.1|  hypothetical protein HYPSUDRAFT_201906                85.9    4e-15   Hypholoma sublateritium FD-334 SS-4
ref|XP_006002884.1|  PREDICTED: dynamin-1-like protein isoform X2     85.9    4e-15   
ref|XP_008827870.1|  PREDICTED: dynamin-1-like protein isoform X1     85.9    4e-15   Nannospalax galili
ref|XP_006002883.1|  PREDICTED: dynamin-1-like protein isoform X1     85.9    4e-15   
ref|XP_007892873.1|  PREDICTED: dynamin-1-like protein isoform X4     85.5    4e-15   Callorhinchus milii [Australian ghost shark]
ref|XP_008827877.1|  PREDICTED: dynamin-1-like protein isoform X8     85.5    5e-15   Nannospalax galili
gb|EYC27798.1|  hypothetical protein Y032_0008g190                    80.5    5e-15   Ancylostoma ceylanicum
ref|XP_006002886.1|  PREDICTED: dynamin-1-like protein isoform X4     85.5    5e-15   
ref|XP_006002885.1|  PREDICTED: dynamin-1-like protein isoform X3     85.5    5e-15   
ref|XP_008827875.1|  PREDICTED: dynamin-1-like protein isoform X6     85.5    5e-15   Nannospalax galili
gb|EHB07664.1|  Dynamin-1-like protein                                83.6    5e-15   Heterocephalus glaber [naked mole rat]
ref|XP_006423649.1|  hypothetical protein CICLE_v10027825mg           55.5    5e-15   
ref|XP_008827876.1|  PREDICTED: dynamin-1-like protein isoform X7     85.5    5e-15   Nannospalax galili
ref|XP_008310824.1|  PREDICTED: dynamin-1-like protein                85.5    5e-15   
ref|XP_004912363.1|  PREDICTED: dynamin-1-like protein isoform X4     85.5    5e-15   
ref|XP_004912362.1|  PREDICTED: dynamin-1-like protein isoform X3     85.5    5e-15   Xenopus tropicalis [western clawed frog]
ref|XP_008827874.1|  PREDICTED: dynamin-1-like protein isoform X5     85.5    6e-15   Nannospalax galili
gb|EGW08308.1|  Dynamin-1-like protein                                83.2    6e-15   Cricetulus griseus [Chinese hamsters]
gb|KDR80911.1|  hypothetical protein GALMADRAFT_241433                85.5    6e-15   Galerina marginata CBS 339.88
ref|XP_004912361.1|  PREDICTED: dynamin-1-like protein isoform X2     85.5    6e-15   Xenopus tropicalis [western clawed frog]
ref|XP_003484356.2|  PREDICTED: dynamin-1-like protein-like           84.7    6e-15   
ref|XP_010786280.1|  PREDICTED: dynamin-1-like protein isoform X1     85.1    6e-15   Notothenia coriiceps [yellowbelly rockcod]
gb|EPB69685.1|  dynamin GTPase effector domain protein                81.6    6e-15   Ancylostoma ceylanicum
ref|XP_004912366.1|  PREDICTED: dynamin-1-like protein isoform X7     85.1    6e-15   
ref|XP_010858874.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    6e-15   Bison bison bison
emb|CEF59341.1|  Dynamin-1-like protein                               85.1    6e-15   Strongyloides ratti
ref|XP_002942336.2|  PREDICTED: dynamin-1-like protein isoform X1     85.1    7e-15   Xenopus tropicalis [western clawed frog]
ref|XP_005816927.1|  PREDICTED: dynamin-1-like protein-like           85.1    7e-15   
gb|EDL77849.1|  dynamin 1-like, isoform CRA_a                         84.3    7e-15   Rattus norvegicus [brown rat]
ref|XP_008298800.1|  PREDICTED: dynamin-1-like protein isoform X1     85.1    7e-15   Stegastes partitus
ref|XP_004912364.1|  PREDICTED: dynamin-1-like protein isoform X5     85.1    7e-15   
ref|XP_004912365.1|  PREDICTED: dynamin-1-like protein isoform X6     85.1    7e-15   
ref|XP_004446657.1|  PREDICTED: dynamin-1-like protein-like           85.1    7e-15   
ref|XP_009424043.1|  PREDICTED: dynamin-1-like protein                85.1    7e-15   
ref|XP_009866960.1|  PREDICTED: dynamin-1-like protein                85.1    7e-15   
ref|XP_012030431.1|  PREDICTED: dynamin-1-like protein isoform X3     85.1    7e-15   
ref|XP_003277860.1|  PREDICTED: dynamin-1-like protein                85.1    7e-15   
ref|XP_005865744.1|  PREDICTED: dynamin-1-like protein                85.1    7e-15   
ref|XP_008314083.1|  PREDICTED: dynamin-1-like protein isoform X1     85.1    7e-15   
ref|XP_005680742.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    8e-15   
ref|XP_007531810.1|  PREDICTED: dynamin-1-like protein isoform X1     85.1    8e-15   
ref|XP_010786281.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    8e-15   
ref|XP_006522702.1|  PREDICTED: dynamin-1-like protein isoform X12    84.3    8e-15   
ref|XP_007531813.1|  PREDICTED: dynamin-1-like protein isoform X4     85.1    8e-15   
ref|XP_003972969.1|  PREDICTED: dynamin-1-like protein                84.7    8e-15   
ref|XP_012030430.1|  PREDICTED: dynamin-1-like protein isoform X2     85.1    8e-15   
ref|XP_007578538.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    8e-15   
ref|XP_005680740.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    8e-15   
ref|XP_007531812.1|  PREDICTED: dynamin-1-like protein isoform X3     85.1    8e-15   
ref|XP_007531811.1|  PREDICTED: dynamin-1-like protein isoform X2     85.1    8e-15   
emb|CDQ95304.1|  unnamed protein product                              83.6    8e-15   
ref|XP_012030429.1|  PREDICTED: dynamin-1-like protein isoform X1     85.1    8e-15   
ref|XP_008314086.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    8e-15   
ref|XP_005455634.1|  PREDICTED: dynamin-1-like protein-like isofo...  84.7    8e-15   
ref|XP_004611384.1|  PREDICTED: dynamin-1-like protein                84.7    8e-15   
ref|XP_009245887.1|  PREDICTED: dynamin-1-like protein                85.1    8e-15   
gb|ELK27172.1|  Dynamin-1-like protein                                84.7    8e-15   
ref|XP_004596483.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    9e-15   
ref|XP_010858875.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    9e-15   
ref|XP_008138764.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    9e-15   
gb|KCW56935.1|  hypothetical protein EUGRSUZ_I02611                   54.3    9e-15   
ref|XP_008399293.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    9e-15   
ref|XP_006767906.1|  PREDICTED: dynamin-1-like protein                84.7    9e-15   
ref|XP_004560889.1|  PREDICTED: dynamin-1-like protein-like isofo...  84.7    9e-15   
ref|XP_006874823.1|  PREDICTED: dynamin-1-like protein isoform X5     84.7    9e-15   
gb|EDL77851.1|  dynamin 1-like, isoform CRA_c                         84.0    9e-15   
ref|XP_004560887.1|  PREDICTED: dynamin-1-like protein-like isofo...  84.7    9e-15   
ref|XP_003792561.1|  PREDICTED: dynamin-1-like protein                84.7    9e-15   
ref|XP_006780668.1|  PREDICTED: dynamin-1-like protein-like isofo...  84.7    9e-15   
ref|XP_005570596.1|  PREDICTED: uncharacterized LOC101925205 isof...  84.3    9e-15   
ref|XP_005897057.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    9e-15   
ref|XP_005206906.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    9e-15   
ref|XP_006780670.1|  PREDICTED: dynamin-1-like protein-like isofo...  84.7    9e-15   
ref|XP_010594057.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    9e-15   
ref|XP_005968851.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    9e-15   
ref|XP_005334095.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    9e-15   
gb|KFP75906.1|  Dynamin-1-like                                        84.7    9e-15   
ref|XP_004560888.1|  PREDICTED: dynamin-1-like protein-like isofo...  84.7    9e-15   
ref|XP_012030433.1|  PREDICTED: dynamin-1-like protein isoform X5     84.7    9e-15   
ref|XP_008298801.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    9e-15   
dbj|GAN04998.1|  conserved hypothetical protein                       85.1    9e-15   
ref|XP_008257633.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    9e-15   
ref|XP_006055655.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    9e-15   
ref|XP_005897061.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    9e-15   
ref|XP_008257636.1|  PREDICTED: dynamin-1-like protein isoform X6     84.7    9e-15   
ref|XP_004675986.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    9e-15   
ref|XP_010747469.1|  PREDICTED: dynamin-1-like protein                84.7    9e-15   
ref|XP_007941354.1|  PREDICTED: dynamin-1-like protein isoform X5     84.7    9e-15   
ref|XP_003926689.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    9e-15   
ref|XP_005455635.1|  PREDICTED: dynamin-1-like protein-like isofo...  84.7    9e-15   
ref|XP_005725227.1|  PREDICTED: dynamin-1-like protein-like isofo...  84.7    9e-15   
ref|XP_004596481.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    9e-15   
ref|XP_006184314.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    9e-15   
ref|XP_005897054.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    9e-15   
ref|XP_012022128.1|  PREDICTED: dynamin-1-like protein isoform X9     84.7    1e-14   
ref|NP_001039959.1|  dynamin-1-like protein                           84.7    1e-14   
ref|XP_004700072.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_006874826.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    1e-14   
gb|EPZ36934.1|  Dynamin, GTPase domain-containing protein             82.8    1e-14   
ref|XP_006874820.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_005253340.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    1e-14   
ref|XP_010952406.1|  PREDICTED: LOW QUALITY PROTEIN: dynamin-1-li...  84.7    1e-14   
ref|XP_004596482.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_005725228.1|  PREDICTED: dynamin-1-like protein-like isofo...  84.7    1e-14   
ref|XP_004700071.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_005334092.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_009001901.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    1e-14   
ref|XP_007966316.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_005334094.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_003405760.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_011489225.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_007531815.1|  PREDICTED: dynamin-1-like protein isoform X6     84.7    1e-14   
ref|XP_012022124.1|  PREDICTED: dynamin-1-like protein isoform X6     84.7    1e-14   
ref|XP_008257632.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_007941353.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    1e-14   
ref|XP_006874821.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_006902244.1|  PREDICTED: dynamin-1-like protein                84.3    1e-14   
ref|XP_008257637.1|  PREDICTED: dynamin-1-like protein isoform X7     84.7    1e-14   
ref|XP_005897055.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_005206911.1|  PREDICTED: dynamin-1-like protein isoform X7     84.7    1e-14   
ref|XP_007941350.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_012022126.1|  PREDICTED: dynamin-1-like protein isoform X8     84.7    1e-14   
ref|XP_008138763.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_005897056.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_004390308.1|  PREDICTED: dynamin-1-like protein isoform 1      84.7    1e-14   
ref|XP_003926688.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_010335679.1|  PREDICTED: dynamin-1-like protein isoform X9     84.3    1e-14   
ref|XP_007941359.1|  PREDICTED: dynamin-1-like protein isoform X9     84.3    1e-14   
ref|XP_005680744.1|  PREDICTED: dynamin-1-like protein isoform X5     84.3    1e-14   
ref|XP_006055661.1|  PREDICTED: dynamin-1-like protein isoform X8     84.7    1e-14   
ref|XP_004326429.1|  PREDICTED: dynamin-1-like protein                84.3    1e-14   
gb|EDL77850.1|  dynamin 1-like, isoform CRA_b                         84.0    1e-14   
ref|XP_004700073.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    1e-14   
ref|XP_005968849.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_005077650.1|  PREDICTED: dynamin-1-like protein                84.3    1e-14   
ref|XP_010335676.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_004700070.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_003926692.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_006522701.1|  PREDICTED: dynamin-1-like protein isoform X11    84.3    1e-14   
gb|EHB12242.1|  Dynamin-1-like protein                                84.7    1e-14   
ref|XP_006055654.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_012022125.1|  PREDICTED: dynamin-1-like protein isoform X7     84.7    1e-14   
ref|XP_008138762.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_012030432.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    1e-14   
ref|XP_006874819.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_004596480.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_007531814.1|  PREDICTED: dynamin-1-like protein isoform X5     84.7    1e-14   
ref|XP_004675985.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_007966315.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_005968850.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
gb|EPQ07429.1|  Dynamin-1-like protein                                84.7    1e-14   
ref|XP_004675984.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_007941352.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_005334093.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_006055660.1|  PREDICTED: dynamin-1-like protein isoform X7     84.7    1e-14   
emb|CDQ79202.1|  unnamed protein product                              84.7    1e-14   
ref|XP_005206905.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
gb|EDK97416.1|  dynamin 1-like, isoform CRA_c                         84.7    1e-14   
ref|XP_007941351.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_007966317.1|  PREDICTED: dynamin-1-like protein isoform X4     84.7    1e-14   
ref|XP_011927369.1|  PREDICTED: dynamin-1-like protein isoform X9     84.3    1e-14   
ref|XP_005370418.1|  PREDICTED: dynamin-1-like protein isoform X3     84.7    1e-14   
ref|XP_005968848.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_010626814.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_006522698.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    1e-14   
ref|XP_007966314.1|  PREDICTED: dynamin-1-like protein isoform X1     84.7    1e-14   
ref|XP_008767068.1|  PREDICTED: dynamin-1-like protein isoform X13    84.3    1e-14   
ref|NP_001265392.1|  dynamin-1-like protein isoform 4                 84.3    1e-14   
ref|XP_006522695.1|  PREDICTED: dynamin-1-like protein isoform X5     84.3    1e-14   
ref|XP_008138761.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_008071936.1|  PREDICTED: dynamin-1-like protein                84.7    1e-14   
ref|XP_009178762.1|  PREDICTED: dynamin-1-like protein isoform X2     84.7    1e-14   
ref|XP_006168141.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_010972946.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_006874822.1|  PREDICTED: dynamin-1-like protein isoform X4     84.3    1e-14   
gb|EAW88521.1|  dynamin 1-like, isoform CRA_c                         84.7    1e-14   
dbj|BAE32388.1|  unnamed protein product                              84.3    1e-14   
ref|XP_007638111.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    1e-14   
ref|XP_005370417.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
gb|EDK97418.1|  dynamin 1-like, isoform CRA_e                         84.3    1e-14   
ref|XP_001086126.2|  PREDICTED: dynamin 1-like isoform 4              84.3    1e-14   
gb|EAW88522.1|  dynamin 1-like, isoform CRA_d                         84.3    1e-14   
ref|XP_006522693.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    1e-14   
ref|XP_006168146.1|  PREDICTED: dynamin-1-like protein isoform X7     84.3    1e-14   
gb|AAD39541.1|AF151685_1  dynamin-like protein DYNIV-11               84.3    1e-14   
ref|XP_006200047.1|  PREDICTED: dynamin-1-like protein isoform X4     84.3    1e-14   
ref|XP_004899316.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_005370424.1|  PREDICTED: dynamin-1-like protein isoform X9     84.3    1e-14   
ref|XP_006248779.1|  PREDICTED: dynamin-1-like protein isoform X5     84.3    1e-14   
ref|XP_003906240.2|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_007090787.1|  PREDICTED: dynamin-1-like protein                84.3    1e-14   
ref|XP_010972947.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_005407173.1|  PREDICTED: dynamin-1-like protein isoform X5     84.3    1e-14   
ref|XP_004663282.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    1e-14   
ref|XP_004441216.1|  PREDICTED: dynamin-1-like protein isoform 2      84.3    1e-14   
ref|XP_005968853.1|  PREDICTED: dynamin-1-like protein isoform X6     84.3    1e-14   
ref|XP_008138768.1|  PREDICTED: dynamin-1-like protein isoform X8     84.0    1e-14   
ref|XP_001086230.2|  PREDICTED: dynamin 1-like isoform 5              84.3    1e-14   
ref|XP_004663281.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_003926690.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    1e-14   
ref|XP_006086803.1|  PREDICTED: dynamin-1-like protein                84.0    1e-14   
ref|XP_006522691.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_007452252.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    1e-14   
ref|XP_008520048.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_006200046.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    1e-14   
ref|XP_008399295.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_007578529.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_010626820.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    1e-14   
ref|XP_008574873.1|  PREDICTED: dynamin-1-like protein isoform X4     84.3    1e-14   
ref|XP_012022132.1|  PREDICTED: dynamin-1-like protein isoform X13    84.3    1e-14   
ref|XP_004596486.1|  PREDICTED: dynamin-1-like protein isoform X7     84.3    1e-14   
ref|XP_006248777.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_005680743.1|  PREDICTED: dynamin-1-like protein isoform X4     84.3    1e-14   
ref|XP_006248781.1|  PREDICTED: dynamin-1-like protein isoform X9     84.3    1e-14   
ref|XP_005407171.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    1e-14   
ref|XP_004270916.1|  PREDICTED: dynamin-1-like protein isoform 3      84.3    1e-14   
ref|XP_010972953.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    1e-14   
ref|XP_005407170.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_008257635.1|  PREDICTED: dynamin-1-like protein isoform X5     84.3    1e-14   
ref|XP_007966319.1|  PREDICTED: dynamin-1-like protein isoform X6     84.3    1e-14   
ref|XP_004855236.1|  PREDICTED: dynamin-1-like protein                84.3    1e-14   
ref|XP_864886.1|  PREDICTED: dynamin 1-like isoformX3                 84.3    1e-14   
ref|XP_007638110.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_008520051.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    1e-14   
ref|XP_007638115.1|  PREDICTED: dynamin-1-like protein isoform X7     84.3    1e-14   
ref|XP_003733777.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_006874825.1|  PREDICTED: dynamin-1-like protein isoform X7     84.3    1e-14   
ref|XP_008767065.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    1e-14   
ref|XP_008574869.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_010626813.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_009001897.1|  PREDICTED: dynamin-1-like protein isoform X4     84.3    1e-14   
ref|XP_004632240.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_003466812.1|  PREDICTED: dynamin-1-like protein isoformX1      84.3    1e-14   
ref|XP_006200044.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_005407169.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_004663280.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_008138767.1|  PREDICTED: dynamin-1-like protein isoform X7     84.3    1e-14   
ref|XP_007941357.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    1e-14   
ref|XP_005897059.1|  PREDICTED: dynamin-1-like protein isoform X6     84.3    1e-14   
ref|XP_005370416.1|  PREDICTED: dynamin-1-like protein isoform X1     84.3    1e-14   
ref|XP_005611114.1|  PREDICTED: dynamin-1-like protein                84.3    1e-14   
ref|XP_011810543.1|  PREDICTED: dynamin-1-like protein isoform X5     84.3    1e-14   
ref|XP_008520050.1|  PREDICTED: dynamin-1-like protein isoform X2     84.3    1e-14   
ref|XP_004632241.1|  PREDICTED: dynamin-1-like protein isoform X3     84.3    1e-14   
ref|XP_011810542.1|  PREDICTED: dynamin-1-like protein isoform X4     84.3    1e-14   
ref|XP_006522696.1|  PREDICTED: dynamin-1-like protein isoform X6     84.3    1e-14   
ref|XP_006200049.1|  PREDICTED: dynamin-1-like protein isoform X6     84.3    1e-14   
ref|XP_004632247.1|  PREDICTED: dynamin-1-like protein isoform X9     84.3    1e-14   
ref|XP_007638114.1|  PREDICTED: dynamin-1-like protein isoform X6     84.3    1e-14   
ref|XP_005897060.1|  PREDICTED: dynamin-1-like protein isoform X7     84.3    1e-14   
ref|XP_005334099.1|  PREDICTED: dynamin-1-like protein isoform X8     84.3    1e-14   



>ref|XP_009768280.1| PREDICTED: dynamin-related protein 3A-like [Nicotiana sylvestris]
Length=824

 Score =   275 bits (704),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 149/166 (90%), Gaps = 1/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNL EEMLQEPDE+A KRK
Sbjct  660  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLLEEMLQEPDEIALKRK  719

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAFKTLDELPLEAE+VERGYS+  DPTGLPKIHGLPTSSMYT SS     
Sbjct  720  RTRETLRVLQQAFKTLDELPLEAETVERGYSMGTDPTGLPKIHGLPTSSMYTISSGSIDS  779

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
              +PKNPRSRKSSHSGELQSPM Y G DSNG+GRNSLLGLYP +D 
Sbjct  780  YTAPKNPRSRKSSHSGELQSPM-YAGADSNGSGRNSLLGLYPIVDV  824


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            + IHLREPPSVLRP+ETH+DQETIEI VTK
Sbjct  627  AFIHLREPPSVLRPSETHSDQETIEIAVTK  656



>ref|XP_009599814.1| PREDICTED: dynamin-related protein 3A-like [Nicotiana tomentosiformis]
Length=826

 Score =   272 bits (696),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 149/167 (89%), Gaps = 2/167 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNL EEMLQEPDE+A KRK
Sbjct  661  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLLEEMLQEPDEIALKRK  720

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAFKTLDELPLEAE+VERGYS+  DPTGLPKIHGLPTSSMYT SS     
Sbjct  721  RTRETLRVLQQAFKTLDELPLEAETVERGYSMGTDPTGLPKIHGLPTSSMYTISSGSIES  780

Query  473  taS-PKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
              + PKNPRSRKSSHSGELQSPM Y G DSNG GRNSLLGLYPT+D 
Sbjct  781  YTAPPKNPRSRKSSHSGELQSPM-YAGADSNGGGRNSLLGLYPTVDV  826


 Score = 56.6 bits (135),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            + IHLREPPSVLRP+ETH+DQETIEI VTK
Sbjct  628  AFIHLREPPSVLRPSETHSDQETIEIAVTK  657



>ref|XP_006359369.1| PREDICTED: dynamin-related protein 3A-like [Solanum tuberosum]
Length=824

 Score =   271 bits (694),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 153/165 (93%), Gaps = 2/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNL EEMLQEPDEVA KRK
Sbjct  661  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLLEEMLQEPDEVALKRK  720

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAFKTLDELPLEAESVERGYS+  DPTGLPKIHGLPTSS+Y +S S DSY
Sbjct  721  RTRETLRVLQQAFKTLDELPLEAESVERGYSIGTDPTGLPKIHGLPTSSLYNSSGSTDSY  780

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            TASPKNPRSRKSSHSGELQSPM Y G DSNG GRNS LGLYPT+D
Sbjct  781  TASPKNPRSRKSSHSGELQSPM-YAGADSNGGGRNS-LGLYPTVD  823


 Score = 56.6 bits (135),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            + IHLREPPSVLRP+ETH+DQETIEI VTK
Sbjct  628  AFIHLREPPSVLRPSETHSDQETIEIAVTK  657



>ref|XP_004250727.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Solanum 
lycopersicum]
Length=826

 Score =   271 bits (693),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 153/165 (93%), Gaps = 2/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNL EEMLQEPDEVA KRK
Sbjct  663  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLLEEMLQEPDEVALKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAFKTLDELPLEAE+VERGYS+  DPTGLPKIHGLPTSS+Y +S S DSY
Sbjct  723  RTRETLRVLQQAFKTLDELPLEAETVERGYSIGTDPTGLPKIHGLPTSSVYNSSGSTDSY  782

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            TASPKNPRSRKSSHSGELQSPM Y G DSNG GRNS LGLYPT+D
Sbjct  783  TASPKNPRSRKSSHSGELQSPM-YAGADSNGGGRNS-LGLYPTVD  825


 Score = 56.6 bits (135),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            + IHLREPPSVLRP+ETH+DQETIEI VTK
Sbjct  630  AFIHLREPPSVLRPSETHSDQETIEIAVTK  659



>ref|XP_010313067.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Solanum 
lycopersicum]
Length=827

 Score =   271 bits (693),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 153/165 (93%), Gaps = 2/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNL EEMLQEPDEVA KRK
Sbjct  664  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLLEEMLQEPDEVALKRK  723

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAFKTLDELPLEAE+VERGYS+  DPTGLPKIHGLPTSS+Y +S S DSY
Sbjct  724  RTRETLRVLQQAFKTLDELPLEAETVERGYSIGTDPTGLPKIHGLPTSSVYNSSGSTDSY  783

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            TASPKNPRSRKSSHSGELQSPM Y G DSNG GRNS LGLYPT+D
Sbjct  784  TASPKNPRSRKSSHSGELQSPM-YAGADSNGGGRNS-LGLYPTVD  826


 Score = 56.6 bits (135),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            + IHLREPPSVLRP+ETH+DQETIEI VTK
Sbjct  631  AFIHLREPPSVLRPSETHSDQETIEIAVTK  660



>ref|XP_011087964.1| PREDICTED: dynamin-related protein 3A [Sesamum indicum]
Length=820

 Score =   254 bits (649),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 4/166 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEV+ KRK
Sbjct  657  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVSMKRK  716

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTRDTLRVLQQAF+TLDELPLEAE+VERGYS+  DPTGLPKIHGLPTSS+  T+S S +S
Sbjct  717  RTRDTLRVLQQAFRTLDELPLEAETVERGYSMGTDPTGLPKIHGLPTSSLYNTSSGSTES  776

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            Y+ASPK  + RKSSHSGEL SP+Y    D+NG GRNS+ GLYP+ID
Sbjct  777  YSASPKTSKPRKSSHSGELHSPLY---ADTNGGGRNSISGLYPSID  819


 Score = 59.7 bits (143),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            SMIHLREPPSVLRP+ETH+DQE IEITVTK
Sbjct  624  SMIHLREPPSVLRPSETHSDQEAIEITVTK  653



>ref|XP_008382203.1| PREDICTED: dynamin-related protein 3A [Malus domestica]
Length=837

 Score =   256 bits (653),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  673  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  732

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEA++VE+GYSL  DPTGLPKIHGLPTSSMY TSSS DSY
Sbjct  733  RTRETLRVLQQAFRTLDELPLEADTVEKGYSLGADPTGLPKIHGLPTSSMYNTSSSHDSY  792

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            TASPKN +SRKSSHSGEL SP +Y   DSNG+GR  + GLYPT+D
Sbjct  793  TASPKNTKSRKSSHSGELHSP-FYSNADSNGSGRMYMPGLYPTVD  836


 Score = 58.2 bits (139),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMIHLREPP+VLRPTE+H++QETIEI VTK
Sbjct  637  QAVSMIHLREPPTVLRPTESHSEQETIEIAVTK  669



>ref|XP_007199665.1| hypothetical protein PRUPE_ppa001399mg [Prunus persica]
 gb|EMJ00864.1| hypothetical protein PRUPE_ppa001399mg [Prunus persica]
Length=837

 Score =   255 bits (652),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  674  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  733

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VE+GYSL  DPTGLPKIHGLPTSSMY TSSS DSY
Sbjct  734  RTRETLRVLQQAFRTLDELPLEAETVEKGYSLGADPTGLPKIHGLPTSSMYNTSSSNDSY  793

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            +ASPKNP+ RKSSHSGEL SP +Y   DSNG+GR  + GLYP++D
Sbjct  794  SASPKNPKPRKSSHSGELHSP-FYANADSNGSGRMYMPGLYPSVD  837


 Score = 57.8 bits (138),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMIHLREPP+VLRPTE H++QETIEI VTK +
Sbjct  638  QAVSMIHLREPPTVLRPTENHSEQETIEIAVTKLL  672



>ref|XP_008237240.1| PREDICTED: dynamin-related protein 3A [Prunus mume]
Length=836

 Score =   255 bits (652),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  673  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  732

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VE+GYSL  DPTGLPKIHGLPTSSMY TSSS DSY
Sbjct  733  RTRETLRVLQQAFRTLDELPLEAETVEKGYSLGADPTGLPKIHGLPTSSMYNTSSSNDSY  792

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            +ASPKNP+ RKSSHSGEL SP +Y   DSNG+GR  + GLYP++D
Sbjct  793  SASPKNPKPRKSSHSGELHSP-FYANADSNGSGRMYMPGLYPSVD  836


 Score = 57.0 bits (136),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMIHLREPP++LRPTE H++QETIEI VTK
Sbjct  637  QAVSMIHLREPPTILRPTENHSEQETIEIAVTK  669



>gb|KHG14620.1| Dynamin-related 3A -like protein [Gossypium arboreum]
Length=823

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A+KRK
Sbjct  658  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIASKRK  717

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  DPTGLPKIHGLPTSS+Y+T  S D+Y
Sbjct  718  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDPTGLPKIHGLPTSSIYSTGGSDDAY  777

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             ASPKNP+SRKSSHSGEL +  Y    DSNG+GR+ + GLYPT+D
Sbjct  778  AASPKNPKSRKSSHSGELSTHSYANNTDSNGSGRSYMTGLYPTVD  822



>ref|XP_009368315.1| PREDICTED: dynamin-related protein 3A-like [Pyrus x bretschneideri]
Length=837

 Score =   252 bits (644),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  673  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  732

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEA++VE+GYSL  DPTGLPKIHGLPTSSMY TSSS DSY
Sbjct  733  RTRETLRVLQQAFRTLDELPLEADTVEKGYSLGADPTGLPKIHGLPTSSMYNTSSSHDSY  792

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            +ASP+N +SRKSSHSGEL SP +Y   DSNG+GR  + G YPT+D
Sbjct  793  SASPRNAKSRKSSHSGELHSP-FYSNADSNGSGRTYMPGQYPTVD  836


 Score = 58.2 bits (139),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMIHLREPP+VLRPTE+H++QETIEI VTK
Sbjct  637  QAVSMIHLREPPTVLRPTESHSEQETIEIAVTK  669



>emb|CDO97375.1| unnamed protein product [Coffea canephora]
Length=836

 Score =   248 bits (634),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 141/166 (85%), Gaps = 4/166 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDE+A KRK
Sbjct  675  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEIALKRK  734

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+TLRVLQQAF+ LDELPLEA++VERGYSLS DPTGLPKIHGLP+SS YTTSS     
Sbjct  735  RARETLRVLQQAFRVLDELPLEADTVERGYSLSTDPTGLPKIHGLPSSSFYTTSSGSTDS  794

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
              +PKN +SRKSSHSGEL SP +Y   DSNG GRN    LYP +D 
Sbjct  795  YTAPKNLKSRKSSHSGELHSP-FYGNADSNGGGRNY---LYPAVDV  836


 Score = 62.0 bits (149),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ SMIHLREPP+VLRP+ETH+DQE IEITVTK
Sbjct  639  HAFSMIHLREPPTVLRPSETHSDQEAIEITVTK  671



>gb|KJB79569.1| hypothetical protein B456_013G054900 [Gossypium raimondii]
Length=831

 Score =   257 bits (657),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A+KRK
Sbjct  666  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIASKRK  725

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  DPTGLPKIHGLPTSS+Y++  S D+Y
Sbjct  726  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDPTGLPKIHGLPTSSIYSSGGSDDAY  785

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            TASPKNP+SRKSSHSGEL +  Y    DSNG+GR+ + GLYPT+D
Sbjct  786  TASPKNPKSRKSSHSGELSTHSYANNTDSNGSGRSYMPGLYPTVD  830



>ref|XP_008373223.1| PREDICTED: dynamin-related protein 3A-like [Malus domestica]
Length=836

 Score =   254 bits (649),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  672  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  731

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEA++VE+GYSL  DPTGLPKIHGLPTSS+Y TSSS DSY
Sbjct  732  RTRETLRVLQQAFRTLDELPLEADTVEKGYSLGADPTGLPKIHGLPTSSLYNTSSSHDSY  791

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            ++SPKN +SRKSSHSGEL SP +Y   DSNG+GR  + GLYPT+D
Sbjct  792  SSSPKNTKSRKSSHSGELHSP-FYSNADSNGSGRMYMPGLYPTVD  835


 Score = 54.7 bits (130),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMIHL EPP++LRPTE+H++QETIEI VTK
Sbjct  636  QAVSMIHLSEPPTILRPTESHSEQETIEIAVTK  668



>ref|XP_011092457.1| PREDICTED: dynamin-related protein 3A-like [Sesamum indicum]
Length=828

 Score =   246 bits (629),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 147/166 (89%), Gaps = 5/166 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVA KRK
Sbjct  666  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVAMKRK  725

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTR+TLRVLQQAF+TLDELPLEA++VERGY L  D TGLPKIHGLPTSS+  T+S S ++
Sbjct  726  RTRETLRVLQQAFRTLDELPLEADTVERGYGLGTDTTGLPKIHGLPTSSLYNTSSGSAEA  785

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            Y ASPKN +SRKSSHSGEL SP Y    D NG GR+S+LG+YPTID
Sbjct  786  YGASPKNSKSRKSSHSGELHSPYY---SDFNG-GRSSMLGIYPTID  827


 Score = 62.0 bits (149),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
              ISMIHLREPPSVLRP+ETH+DQE IEITVTK
Sbjct  630  QGISMIHLREPPSVLRPSETHSDQEAIEITVTK  662



>ref|XP_002532763.1| dynamin, putative [Ricinus communis]
 gb|EEF29620.1| dynamin, putative [Ricinus communis]
Length=837

 Score =   254 bits (649),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+E+A KRK
Sbjct  673  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEIAMKRK  732

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLR+LQQA+KTLDELPLEAE+VERGYSL  DPTGLPKIHGLPTSS+Y+TSS    Y
Sbjct  733  RTRETLRILQQAYKTLDELPLEAETVERGYSLGADPTGLPKIHGLPTSSLYSTSSGSSDY  792

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            +ASPKNP+SRKSSHSGELQS  +YV  DSNG  R  + GLYPT+D
Sbjct  793  SASPKNPKSRKSSHSGELQS-HFYVNADSNGGSRPYMPGLYPTVD  836


 Score = 53.9 bits (128),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S+SMI+LREPP++LRP+E+H++QE+IEI VTK +
Sbjct  637  QSMSMIYLREPPTILRPSESHSEQESIEIAVTKLL  671



>gb|EYU39106.1| hypothetical protein MIMGU_mgv1a001369mg [Erythranthe guttata]
Length=832

 Score =   245 bits (625),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 148/167 (89%), Gaps = 5/167 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIED VPKAIMHFLVNHTKRELHNVFIKKLYRDN+FEEMLQEPDEVATKRK
Sbjct  668  RSYYDIVRKNIEDFVPKAIMHFLVNHTKRELHNVFIKKLYRDNMFEEMLQEPDEVATKRK  727

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYS+S D TGLPKIHGLPTSS+  T+S S DS
Sbjct  728  RTRETLRVLQQAFRTLDELPLEAETVERGYSVSTDQTGLPKIHGLPTSSLYNTSSGSNDS  787

Query  476  ytaSPKNPR-SRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            Y ASPKN R SRKSSHSGEL SP Y    D NG GR+S+ GLYP++D
Sbjct  788  YNASPKNQRGSRKSSHSGELHSPYY---ADFNGGGRSSMPGLYPSVD  831


 Score = 62.0 bits (149),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS SMIHLREPPSVLRP+ETH+DQE +EI VTK
Sbjct  632  HSFSMIHLREPPSVLRPSETHSDQEAVEIAVTK  664



>gb|KDO44154.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=767

 Score =   252 bits (643),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKA+MHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+EVA KRK
Sbjct  602  RSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRK  661

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTRDTLRVLQQAF+TLDELPLEA+SVERGY++S DPTGLPKIHGLPTSSM  T+S S DS
Sbjct  662  RTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDS  721

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            YTASPKNP+SRKSSHSGELQS ++    DSNG+GR  + GLYPT+D
Sbjct  722  YTASPKNPKSRKSSHSGELQSHLFS-NADSNGSGRMYMPGLYPTVD  766


 Score = 55.1 bits (131),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ +MIHLREPP++LRP+E+H++QE +EI VTK
Sbjct  566  HAFAMIHLREPPTILRPSESHSEQENVEIAVTK  598



>ref|XP_010112241.1| Dynamin-related protein 3A [Morus notabilis]
 gb|EXC32997.1| Dynamin-related protein 3A [Morus notabilis]
Length=840

 Score =   254 bits (650),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NL EEML EP+E+A+KRK
Sbjct  676  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLLEEMLAEPEEIASKRK  735

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTRDTLRVLQQAF+TLDELPLEAESVE+GYSL  D TGLPKIHGLPTSSMY+TSSS DSY
Sbjct  736  RTRDTLRVLQQAFRTLDELPLEAESVEKGYSLGGDATGLPKIHGLPTSSMYSTSSSNDSY  795

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            TASPKNP+SRKSSHSGEL SP Y V  DSNG GRN + GLYP++D
Sbjct  796  TASPKNPKSRKSSHSGELHSPFYGV-ADSNGGGRNYMTGLYPSVD  839


 Score = 52.4 bits (124),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             + SMI LREPP+VLRP+E H++QE+IEI VTK
Sbjct  640  QAFSMIQLREPPTVLRPSENHSEQESIEIAVTK  672



>gb|KDO44157.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=827

 Score =   251 bits (642),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKA+MHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+EVA KRK
Sbjct  662  RSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTRDTLRVLQQAF+TLDELPLEA+SVERGY++S DPTGLPKIHGLPTSSM  T+S S DS
Sbjct  722  RTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDS  781

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            YTASPKNP+SRKSSHSGELQS ++    DSNG+GR  + GLYPT+D
Sbjct  782  YTASPKNPKSRKSSHSGELQSHLFS-NADSNGSGRMYMPGLYPTVD  826


 Score = 55.1 bits (131),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ +MIHLREPP++LRP+E+H++QE +EI VTK
Sbjct  626  HAFAMIHLREPPTILRPSESHSEQENVEIAVTK  658



>ref|XP_006487698.1| PREDICTED: dynamin-related protein 3A-like [Citrus sinensis]
Length=850

 Score =   251 bits (642),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKA+MHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+EVA KRK
Sbjct  685  RSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRK  744

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTRDTLRVLQQAF+TLDELPLEA+SVERGY++S DPTGLPKIHGLPTSSM  T+S S DS
Sbjct  745  RTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDS  804

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            YTASPKNP+SRKSSHSGELQS ++    DSNG+GR  + GLYPT+D
Sbjct  805  YTASPKNPKSRKSSHSGELQSHLFS-NADSNGSGRMYMPGLYPTVD  849


 Score = 55.1 bits (131),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            H+ +MIHLREPP++LRP+E+H++QE +EI VTK +
Sbjct  649  HAFAMIHLREPPTILRPSESHSEQENVEIAVTKLL  683



>ref|XP_009343811.1| PREDICTED: dynamin-related protein 3A-like [Pyrus x bretschneideri]
Length=836

 Score =   252 bits (643),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  672  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  731

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEA++VE+GYSL  DPTGLPKIHGLPTSS+Y TSSS DSY
Sbjct  732  RTRETLRVLQQAFRTLDELPLEADTVEKGYSLGADPTGLPKIHGLPTSSLYNTSSSHDSY  791

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            ++SPKN +SRKSSHSGEL SP +Y   DSNG+GR  +  LYPT+D
Sbjct  792  SSSPKNTKSRKSSHSGELHSP-FYSNADSNGSGRMYMPSLYPTVD  835


 Score = 54.7 bits (130),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMIHL EPP++LRPTE+H++QETIEI VTK
Sbjct  636  QAVSMIHLSEPPTILRPTESHSEQETIEIAVTK  668



>gb|KDO44155.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=792

 Score =   251 bits (642),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKA+MHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+EVA KRK
Sbjct  627  RSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRK  686

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTRDTLRVLQQAF+TLDELPLEA+SVERGY++S DPTGLPKIHGLPTSSM  T+S S DS
Sbjct  687  RTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDS  746

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            YTASPKNP+SRKSSHSGELQS ++    DSNG+GR  + GLYPT+D
Sbjct  747  YTASPKNPKSRKSSHSGELQSHLFS-NADSNGSGRMYMPGLYPTVD  791


 Score = 55.1 bits (131),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ +MIHLREPP++LRP+E+H++QE +EI VTK
Sbjct  591  HAFAMIHLREPPTILRPSESHSEQENVEIAVTK  623



>gb|KDO44156.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=799

 Score =   251 bits (641),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKA+MHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+EVA KRK
Sbjct  634  RSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRK  693

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTRDTLRVLQQAF+TLDELPLEA+SVERGY++S DPTGLPKIHGLPTSSM  T+S S DS
Sbjct  694  RTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDS  753

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            YTASPKNP+SRKSSHSGELQS ++    DSNG+GR  + GLYPT+D
Sbjct  754  YTASPKNPKSRKSSHSGELQSHLFS-NADSNGSGRMYMPGLYPTVD  798


 Score = 55.1 bits (131),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ +MIHLREPP++LRP+E+H++QE +EI VTK
Sbjct  598  HAFAMIHLREPPTILRPSESHSEQENVEIAVTK  630



>ref|XP_009366330.1| PREDICTED: dynamin-related protein 3A-like [Pyrus x bretschneideri]
Length=836

 Score =   251 bits (640),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+DSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  672  RSYYDIVRKNIQDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  731

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEA++VE+GYSL  DPTGLPKIHGLPTSS+Y TSSS DSY
Sbjct  732  RTRETLRVLQQAFRTLDELPLEADTVEKGYSLGADPTGLPKIHGLPTSSLYNTSSSHDSY  791

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            ++SPKN +SRKSSHSGEL SP +Y   DSNG+GR  +  LYPT+D
Sbjct  792  SSSPKNTKSRKSSHSGELHSP-FYSNADSNGSGRMYMPSLYPTVD  835


 Score = 54.7 bits (130),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMIHL EPP++LRPTE+H++QETIEI VTK
Sbjct  636  QAVSMIHLSEPPTILRPTESHSEQETIEIAVTK  668



>ref|XP_006423650.1| hypothetical protein CICLE_v10027825mg [Citrus clementina]
 gb|ESR36890.1| hypothetical protein CICLE_v10027825mg [Citrus clementina]
Length=827

 Score =   251 bits (642),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKA+MHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+EVA KRK
Sbjct  662  RSYYDIVRKNIEDSIPKAVMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEVAMKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTRDTLRVLQQAF+TLDELPLEA+SVERGY++S DPTGLPKIHGLPTSSM  T+S S DS
Sbjct  722  RTRDTLRVLQQAFRTLDELPLEADSVERGYNMSADPTGLPKIHGLPTSSMYTTSSGSNDS  781

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            YTASPKNP+SRKSSHSGELQS ++    DSNG+GR  + GLYPT+D
Sbjct  782  YTASPKNPKSRKSSHSGELQSHLFS-NADSNGSGRMYMPGLYPTVD  826


 Score = 53.5 bits (127),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+  MIHLREPP++LRP+E+H++QE +EI VTK
Sbjct  626  HAFVMIHLREPPTILRPSESHSEQENVEIAVTK  658



>ref|XP_007042814.1| Dynamin-related protein 3A isoform 2 [Theobroma cacao]
 gb|EOX98645.1| Dynamin-related protein 3A isoform 2 [Theobroma cacao]
Length=828

 Score =   251 bits (641),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 149/166 (90%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+DSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+ATKRK
Sbjct  663  RSYYDIVRKNIDDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIATKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  DPTGLPKIHGLPTSSMY+TSS  +  
Sbjct  723  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDPTGLPKIHGLPTSSMYSTSSGSNDS  782

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
               SPKN +SRKSSHSGELQS +Y    DSNG+GR+ + GLYPT+D
Sbjct  783  YAVSPKNTKSRKSSHSGELQSHLYG-NADSNGSGRSFMPGLYPTVD  827



>ref|XP_010254582.1| PREDICTED: dynamin-related protein 3A-like [Nelumbo nucifera]
Length=828

 Score =   251 bits (641),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAI+HFLVNHTKREL NVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  663  RSYYDIVRKNIEDSVPKAIIHFLVNHTKRELRNVFIKKLYRENLFEEMLQEPDEVAMKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTR+TLRVLQQAF+TLDELPLEAE+VE+GYSL  DPTGLPKIHGLP+SS+  T++    S
Sbjct  723  RTRETLRVLQQAFRTLDELPLEAETVEKGYSLGTDPTGLPKIHGLPSSSLYGTSNDYSTS  782

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            Y ASPKNP+SRKSSHSGELQSP+ +   DSNG+GR+  LG YPT+D
Sbjct  783  YMASPKNPKSRKSSHSGELQSPL-HASADSNGSGRHFTLGSYPTVD  827


 Score = 51.2 bits (121),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS S I LREPP+VLRP+++HT+QE IEI VTK
Sbjct  627  HSFSTILLREPPTVLRPSDSHTEQEAIEIAVTK  659



>ref|XP_007042813.1| Dynamin-related protein 3A isoform 1 [Theobroma cacao]
 gb|EOX98644.1| Dynamin-related protein 3A isoform 1 [Theobroma cacao]
Length=827

 Score =   251 bits (641),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 149/166 (90%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+DSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+ATKRK
Sbjct  662  RSYYDIVRKNIDDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIATKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  DPTGLPKIHGLPTSSMY+TSS  +  
Sbjct  722  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDPTGLPKIHGLPTSSMYSTSSGSNDS  781

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
               SPKN +SRKSSHSGELQS +Y    DSNG+GR+ + GLYPT+D
Sbjct  782  YAVSPKNTKSRKSSHSGELQSHLYG-NADSNGSGRSFMPGLYPTVD  826



>ref|XP_010029995.1| PREDICTED: dynamin-related protein 3A isoform X1 [Eucalyptus 
grandis]
Length=839

 Score =   248 bits (633),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  673  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAMKRK  732

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsss--vd  480
            RTR+TLRVLQQAF+TLDELPLEAE+VE+GYSL  D TGLPKIHGLPTSSMYT+S S    
Sbjct  733  RTRETLRVLQQAFRTLDELPLEAETVEKGYSLGADRTGLPKIHGLPTSSMYTSSGSFGDS  792

Query  479  sytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
               ASP NP+SRKSSHSGELQSP +Y   DSNG+GR  +  LYPT+D
Sbjct  793  FGGASPNNPKSRKSSHSGELQSP-FYANADSNGSGRPHMPSLYPTLD  838


 Score = 54.3 bits (129),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  939  SISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            ++SMIHLREPP+VLRP+E H++QE IEI VTK +
Sbjct  638  AMSMIHLREPPTVLRPSEGHSEQEAIEIAVTKLL  671



>ref|XP_010029996.1| PREDICTED: dynamin-related protein 3A isoform X2 [Eucalyptus 
grandis]
 gb|KCW56934.1| hypothetical protein EUGRSUZ_I02611 [Eucalyptus grandis]
Length=837

 Score =   248 bits (633),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  671  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAMKRK  730

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsss--vd  480
            RTR+TLRVLQQAF+TLDELPLEAE+VE+GYSL  D TGLPKIHGLPTSSMYT+S S    
Sbjct  731  RTRETLRVLQQAFRTLDELPLEAETVEKGYSLGADRTGLPKIHGLPTSSMYTSSGSFGDS  790

Query  479  sytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
               ASP NP+SRKSSHSGELQSP +Y   DSNG+GR  +  LYPT+D
Sbjct  791  FGGASPNNPKSRKSSHSGELQSP-FYANADSNGSGRPHMPSLYPTLD  836


 Score = 54.3 bits (129),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  939  SISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            ++SMIHLREPP+VLRP+E H++QE IEI VTK +
Sbjct  636  AMSMIHLREPPTVLRPSEGHSEQEAIEIAVTKLL  669



>emb|CBI38239.3| unnamed protein product [Vitis vinifera]
Length=923

 Score =   245 bits (626),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 149/168 (89%), Gaps = 3/168 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIED+VPKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQEPDEVA KRK
Sbjct  757  RSYYDIVRKNIEDAVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEPDEVAMKRK  816

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSL-SPDPTGLPKIHGLPtssm-yttsssvd  480
            RT +TLRVLQQA +TLDELP EAE+VE+GYSL S DPTGLPKIHGLPTSS+  T+  S  
Sbjct  817  RTSETLRVLQQALRTLDELPQEAETVEKGYSLGSSDPTGLPKIHGLPTSSLYTTSGGSTQ  876

Query  479  sytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
            SYTASPKNP+SRKSSHSGELQSP ++   DSNG GR+ + GLYPT+DA
Sbjct  877  SYTASPKNPKSRKSSHSGELQSP-FHGNADSNGGGRSYMPGLYPTLDA  923


 Score = 56.6 bits (135),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HSISMIHL+EPP++L+P+E+H++QE IEI+VTK +
Sbjct  721  HSISMIHLKEPPTILKPSESHSEQEAIEISVTKLL  755



>ref|XP_010029997.1| PREDICTED: dynamin-related protein 3A isoform X3 [Eucalyptus 
grandis]
Length=836

 Score =   248 bits (632),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  670  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAMKRK  729

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsss--vd  480
            RTR+TLRVLQQAF+TLDELPLEAE+VE+GYSL  D TGLPKIHGLPTSSMYT+S S    
Sbjct  730  RTRETLRVLQQAFRTLDELPLEAETVEKGYSLGADRTGLPKIHGLPTSSMYTSSGSFGDS  789

Query  479  sytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
               ASP NP+SRKSSHSGELQSP +Y   DSNG+GR  +  LYPT+D
Sbjct  790  FGGASPNNPKSRKSSHSGELQSP-FYANADSNGSGRPHMPSLYPTLD  835


 Score = 54.3 bits (129),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  939  SISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            ++SMIHLREPP+VLRP+E H++QE IEI VTK +
Sbjct  635  AMSMIHLREPPTVLRPSEGHSEQEAIEIAVTKLL  668



>ref|XP_010029998.1| PREDICTED: dynamin-related protein 3A isoform X4 [Eucalyptus 
grandis]
Length=834

 Score =   248 bits (632),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  668  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAMKRK  727

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsss--vd  480
            RTR+TLRVLQQAF+TLDELPLEAE+VE+GYSL  D TGLPKIHGLPTSSMYT+S S    
Sbjct  728  RTRETLRVLQQAFRTLDELPLEAETVEKGYSLGADRTGLPKIHGLPTSSMYTSSGSFGDS  787

Query  479  sytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
               ASP NP+SRKSSHSGELQSP +Y   DSNG+GR  +  LYPT+D
Sbjct  788  FGGASPNNPKSRKSSHSGELQSP-FYANADSNGSGRPHMPSLYPTLD  833


 Score = 53.9 bits (128),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  939  SISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            ++SMIHLREPP+VLRP+E H++QE IEI VTK +
Sbjct  633  AMSMIHLREPPTVLRPSEGHSEQEAIEIAVTKLL  666



>gb|KJB32131.1| hypothetical protein B456_005G226100 [Gossypium raimondii]
Length=452

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNH+KRELHNVFI+KLYR+NLFEEMLQEPDE+A+KRK
Sbjct  287  RSYYDIVRKNIEDSVPKAIMHFLVNHSKRELHNVFIRKLYRENLFEEMLQEPDEIASKRK  346

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLPTSSMY+TSS  +  
Sbjct  347  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDLTGLPKIHGLPTSSMYSTSSGSNDS  406

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
              ASPK+ +SRKSSHSGELQS +Y   G SNGNGR+ + GLYP +D
Sbjct  407  YAASPKHTKSRKSSHSGELQSHVYASSG-SNGNGRSYMPGLYPAVD  451



>ref|XP_002269774.2| PREDICTED: dynamin-related protein 3B isoform X1 [Vitis vinifera]
Length=831

 Score =   245 bits (626),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 149/168 (89%), Gaps = 3/168 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIED+VPKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQEPDEVA KRK
Sbjct  665  RSYYDIVRKNIEDAVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEPDEVAMKRK  724

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSL-SPDPTGLPKIHGLPtssm-yttsssvd  480
            RT +TLRVLQQA +TLDELP EAE+VE+GYSL S DPTGLPKIHGLPTSS+  T+  S  
Sbjct  725  RTSETLRVLQQALRTLDELPQEAETVEKGYSLGSSDPTGLPKIHGLPTSSLYTTSGGSTQ  784

Query  479  sytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
            SYTASPKNP+SRKSSHSGELQSP ++   DSNG GR+ + GLYPT+DA
Sbjct  785  SYTASPKNPKSRKSSHSGELQSP-FHGNADSNGGGRSYMPGLYPTLDA  831


 Score = 56.6 bits (135),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HSISMIHL+EPP++L+P+E+H++QE IEI+VTK
Sbjct  629  HSISMIHLKEPPTILKPSESHSEQEAIEISVTK  661



>ref|XP_006351713.1| PREDICTED: dynamin-related protein 3A-like [Solanum tuberosum]
Length=830

 Score =   239 bits (610),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 147/165 (89%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYD+VRKNIEDSVPKAIMHFLVNHTKR+LHNVFIKKLYR+NL EEMLQEPDE+A KRK
Sbjct  667  RSYYDVVRKNIEDSVPKAIMHFLVNHTKRDLHNVFIKKLYRENLLEEMLQEPDEIAMKRK  726

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTR+TLRVLQQAFKTL+ELPL+AE+VERGYSL  DPTGLPKIHGLPTSSM  T+S S DS
Sbjct  727  RTRETLRVLQQAFKTLEELPLDAETVERGYSLGTDPTGLPKIHGLPTSSMYTTSSGSTDS  786

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTI  342
            YT+SPKN R R +SHSGELQ PMY  G DSNG+G N  +G++PT+
Sbjct  787  YTSSPKNSRLRNASHSGELQLPMYG-GADSNGSGHN--VGIFPTV  828


 Score = 62.8 bits (151),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ SMIHLREPPSVLRP+ETH+DQETIEI +TK
Sbjct  631  HAFSMIHLREPPSVLRPSETHSDQETIEIAITK  663



>ref|XP_010645184.1| PREDICTED: dynamin-related protein 3B isoform X2 [Vitis vinifera]
Length=826

 Score =   245 bits (626),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 149/168 (89%), Gaps = 3/168 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIED+VPKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQEPDEVA KRK
Sbjct  660  RSYYDIVRKNIEDAVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEPDEVAMKRK  719

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSL-SPDPTGLPKIHGLPtssm-yttsssvd  480
            RT +TLRVLQQA +TLDELP EAE+VE+GYSL S DPTGLPKIHGLPTSS+  T+  S  
Sbjct  720  RTSETLRVLQQALRTLDELPQEAETVEKGYSLGSSDPTGLPKIHGLPTSSLYTTSGGSTQ  779

Query  479  sytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
            SYTASPKNP+SRKSSHSGELQSP ++   DSNG GR+ + GLYPT+DA
Sbjct  780  SYTASPKNPKSRKSSHSGELQSP-FHGNADSNGGGRSYMPGLYPTLDA  826


 Score = 56.2 bits (134),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HSISMIHL+EPP++L+P+E+H++QE IEI+VTK +
Sbjct  624  HSISMIHLKEPPTILKPSESHSEQEAIEISVTKLL  658



>ref|XP_010277557.1| PREDICTED: dynamin-related protein 3A-like [Nelumbo nucifera]
Length=829

 Score =   247 bits (631),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKREL NVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  664  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELRNVFIKKLYRENLFEEMLQEPDEIAMKRK  723

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            R+R+ LRVLQQAF+TLDELPLEAE+VE+GYSL  DPTGLPKIHGL +SS+  T +    S
Sbjct  724  RSREMLRVLQQAFRTLDELPLEAETVEKGYSLGTDPTGLPKIHGLTSSSLYSTGNDYGTS  783

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            YTASPKNP+SRKSSHSGELQSP+ +   DSNG+GR+S LG YPT+D
Sbjct  784  YTASPKNPKSRKSSHSGELQSPL-HASADSNGSGRHSTLGAYPTVD  828


 Score = 52.4 bits (124),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS+SMI L+EPP VL+P++THT+QE IE+ VTK
Sbjct  628  HSLSMIQLKEPPVVLKPSDTHTEQEAIEVAVTK  660



>gb|KJB32127.1| hypothetical protein B456_005G226100 [Gossypium raimondii]
Length=522

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNH+KRELHNVFI+KLYR+NLFEEMLQEPDE+A+KRK
Sbjct  357  RSYYDIVRKNIEDSVPKAIMHFLVNHSKRELHNVFIRKLYRENLFEEMLQEPDEIASKRK  416

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLPTSSMY+TSS  +  
Sbjct  417  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDLTGLPKIHGLPTSSMYSTSSGSNDS  476

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
              ASPK+ +SRKSSHSGELQS +Y   G SNGNGR+ + GLYP +D
Sbjct  477  YAASPKHTKSRKSSHSGELQSHVYASSG-SNGNGRSYMPGLYPAVD  521



>gb|KJB32130.1| hypothetical protein B456_005G226100 [Gossypium raimondii]
Length=604

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNH+KRELHNVFI+KLYR+NLFEEMLQEPDE+A+KRK
Sbjct  439  RSYYDIVRKNIEDSVPKAIMHFLVNHSKRELHNVFIRKLYRENLFEEMLQEPDEIASKRK  498

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLPTSSMY+TSS  +  
Sbjct  499  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDLTGLPKIHGLPTSSMYSTSSGSNDS  558

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
              ASPK+ +SRKSSHSGELQS +Y   G SNGNGR+ + GLYP +D
Sbjct  559  YAASPKHTKSRKSSHSGELQSHVYASSG-SNGNGRSYMPGLYPAVD  603



>gb|KJB32128.1| hypothetical protein B456_005G226100 [Gossypium raimondii]
Length=613

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNH+KRELHNVFI+KLYR+NLFEEMLQEPDE+A+KRK
Sbjct  448  RSYYDIVRKNIEDSVPKAIMHFLVNHSKRELHNVFIRKLYRENLFEEMLQEPDEIASKRK  507

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLPTSSMY+TSS  +  
Sbjct  508  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDLTGLPKIHGLPTSSMYSTSSGSNDS  567

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
              ASPK+ +SRKSSHSGELQS +Y   G SNGNGR+ + GLYP +D
Sbjct  568  YAASPKHTKSRKSSHSGELQSHVYASSG-SNGNGRSYMPGLYPAVD  612



>ref|XP_002309855.2| hypothetical protein POPTR_0007s02960g [Populus trichocarpa]
 gb|EEE90305.2| hypothetical protein POPTR_0007s02960g [Populus trichocarpa]
Length=835

 Score =   243 bits (621),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQEPDE+A KRK
Sbjct  674  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEPDEIAMKRK  733

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            +TR+ LRVLQQAF+TLDELPLEAE+VERGYSLS D TGLPKIHGLP +S   +S S DSY
Sbjct  734  QTREQLRVLQQAFRTLDELPLEAETVERGYSLSSDSTGLPKIHGLP-TSTMYSSGSSDSY  792

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            TASPKNP+SRKSSHSGELQ  +Y    DSNG+G   + GLYPT+D
Sbjct  793  TASPKNPKSRKSSHSGELQPHLY---ADSNGSGHAYMPGLYPTVD  834


 Score = 52.0 bits (123),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S+S+IHLREPP+VLRP+E H++ E+IEI VTK +
Sbjct  638  QSLSLIHLREPPTVLRPSENHSEHESIEIAVTKLL  672



>ref|XP_010691382.1| PREDICTED: dynamin-related protein 3A isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=827

 Score =   243 bits (620),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+EDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVATKRK
Sbjct  663  KSYYDIVRKNVEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVATKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            +TRD LR+L QAF+ LDELPLEA++VE+GYSL  D TGLPKI+GL +    T+S S DSY
Sbjct  723  QTRDKLRILNQAFRVLDELPLEADTVEKGYSLGTDATGLPKINGLLSPGYSTSSHSSDSY  782

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTI  342
            +ASPKN +SRKSSHSGELQSP +Y   DSNGNGR SL GLYPTI
Sbjct  783  SASPKNHKSRKSSHSGELQSP-FYGNADSNGNGRGSLPGLYPTI  825


 Score = 52.4 bits (124),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ SMI L+EPP++LRP ETHT+ E IEITVTK
Sbjct  627  HAFSMILLKEPPTILRPAETHTESEAIEITVTK  659



>ref|XP_010691383.1| PREDICTED: dynamin-related protein 3A isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=825

 Score =   243 bits (620),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+EDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVATKRK
Sbjct  661  KSYYDIVRKNVEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVATKRK  720

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            +TRD LR+L QAF+ LDELPLEA++VE+GYSL  D TGLPKI+GL +    T+S S DSY
Sbjct  721  QTRDKLRILNQAFRVLDELPLEADTVEKGYSLGTDATGLPKINGLLSPGYSTSSHSSDSY  780

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTI  342
            +ASPKN +SRKSSHSGELQSP +Y   DSNGNGR SL GLYPTI
Sbjct  781  SASPKNHKSRKSSHSGELQSP-FYGNADSNGNGRGSLPGLYPTI  823


 Score = 52.4 bits (124),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ SMI L+EPP++LRP ETHT+ E IEITVTK
Sbjct  625  HAFSMILLKEPPTILRPAETHTESEAIEITVTK  657



>ref|XP_010315139.1| PREDICTED: dynamin-related protein 3B-like [Solanum lycopersicum]
Length=822

 Score =   231 bits (590),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYD+VRKNIEDSVPKAIMHFLVNHTKR+LHNVFIKKLYR+NL EEMLQEPDE+A KRK
Sbjct  659  RSYYDVVRKNIEDSVPKAIMHFLVNHTKRDLHNVFIKKLYRENLLEEMLQEPDEIAMKRK  718

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssm-yttsssvds  477
            RTR+TLRVLQQAFKTL+ELPL+AE+VERGYSL  D TGLPKIHGLP+SSM  T+S S  S
Sbjct  719  RTRETLRVLQQAFKTLEELPLDAETVERGYSLGTDLTGLPKIHGLPSSSMYTTSSGSTGS  778

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTI  342
            +T+SPK+ R R +SHSGELQ PMY  G DSNG G N+  G+YPT+
Sbjct  779  HTSSPKSSRLRNASHSGELQLPMYG-GVDSNGGGHNA--GIYPTV  820


 Score = 62.8 bits (151),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            H+ SMIHLREPPSVLRP+ETH+DQETIEI +TK +
Sbjct  623  HAFSMIHLREPPSVLRPSETHSDQETIEIAITKLL  657



>ref|XP_004292471.1| PREDICTED: dynamin-related protein 3A [Fragaria vesca subsp. 
vesca]
Length=827

 Score =   239 bits (610),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 143/166 (86%), Gaps = 3/166 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEV+ KRK
Sbjct  663  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVSMKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSL-SPDPTGLPKIHGLPtssmyttsssvds  477
            RTR+TLRVLQQAF+TLDELPLEAE+VE+GYS+ + D TGLPKIHGL  +S   ++ S + 
Sbjct  723  RTRETLRVLQQAFRTLDELPLEAETVEKGYSMGAADTTGLPKIHGL-HTSSMYSTGSPND  781

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
              +SPKNP+ RKSSHSGEL SP +Y   DSNG+GR  + GLYP++D
Sbjct  782  SYSSPKNPKPRKSSHSGELNSP-FYANADSNGSGRMYMPGLYPSVD  826


 Score = 54.3 bits (129),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             +ISMI LREPP+VL+PTE H++QETIEI VTK
Sbjct  627  QAISMIQLREPPTVLKPTENHSEQETIEIAVTK  659



>ref|XP_012081387.1| PREDICTED: dynamin-related protein 3A [Jatropha curcas]
 gb|KDP30000.1| hypothetical protein JCGZ_18767 [Jatropha curcas]
Length=829

 Score =   238 bits (606),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 3/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+ATKRK
Sbjct  668  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIATKRK  727

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
             TRD LRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKI GLPTSSMY+ SS    Y
Sbjct  728  HTRDKLRVLQQAFRTLDELPLEAETVERGYSLGADTTGLPKIRGLPTSSMYSISSGSSEY  787

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            +ASP+N +SRKSSHSGELQS  +Y   +SNG+G+  +  LYPT+D
Sbjct  788  SASPRNTKSRKSSHSGELQS-HFYANAESNGSGQPYV--LYPTVD  829


 Score = 55.8 bits (133),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S SMIHLREPP+VLRP+E+H++QE IEI VTK +
Sbjct  632  QSFSMIHLREPPTVLRPSESHSEQEAIEIAVTKLL  666



>gb|KJB32126.1| hypothetical protein B456_005G226100 [Gossypium raimondii]
Length=737

 Score =   242 bits (618),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNH+KRELHNVFI+KLYR+NLFEEMLQEPDE+A+KRK
Sbjct  572  RSYYDIVRKNIEDSVPKAIMHFLVNHSKRELHNVFIRKLYRENLFEEMLQEPDEIASKRK  631

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLPTSSMY+TSS  +  
Sbjct  632  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDLTGLPKIHGLPTSSMYSTSSGSNDS  691

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
              ASPK+ +SRKSSHSGELQS +Y   G SNGNGR+ + GLYP +D
Sbjct  692  YAASPKHTKSRKSSHSGELQSHVYASSG-SNGNGRSYMPGLYPAVD  736



>gb|KHF99511.1| Dynamin-related 3A -like protein [Gossypium arboreum]
Length=785

 Score =   243 bits (620),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLF+EMLQEPDE+A+KRK
Sbjct  620  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFQEMLQEPDEIASKRK  679

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQ AF+TLDELPLEAE+VERGYSL  DPTGLPKIHGLPTSSMY+ SS  +  
Sbjct  680  RTRETLRVLQLAFRTLDELPLEAETVERGYSLGSDPTGLPKIHGLPTSSMYSISSGSNDS  739

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             TAS KN + RKS+HSGELQS + Y   DSNGNGR+ + GLYPT+D
Sbjct  740  YTASSKNLKPRKSAHSGELQSHL-YANADSNGNGRHYMPGLYPTVD  784



>gb|KJB32129.1| hypothetical protein B456_005G226100 [Gossypium raimondii]
Length=828

 Score =   243 bits (620),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNH+KRELHNVFI+KLYR+NLFEEMLQEPDE+A+KRK
Sbjct  663  RSYYDIVRKNIEDSVPKAIMHFLVNHSKRELHNVFIRKLYRENLFEEMLQEPDEIASKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLPTSSMY+TSS  +  
Sbjct  723  RTRETLRVLQQAFRTLDELPLEAETVERGYSLGSDLTGLPKIHGLPTSSMYSTSSGSNDS  782

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
              ASPK+ +SRKSSHSGELQS +Y   G SNGNGR+ + GLYP +D
Sbjct  783  YAASPKHTKSRKSSHSGELQSHVYASSG-SNGNGRSYMPGLYPAVD  827



>ref|XP_011003246.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Populus 
euphratica]
Length=826

 Score =   240 bits (613),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQEPDE+A KRK
Sbjct  665  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEPDEIAMKRK  724

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            +TR+ LRVLQQAF+TLDELPLEAE+VERGYSLS D TGLPKIHGLP +S   +S S DSY
Sbjct  725  QTREQLRVLQQAFRTLDELPLEAETVERGYSLSSDSTGLPKIHGLP-TSTMYSSGSSDSY  783

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            TASPKNP+SRKSSH GELQ  +Y    DSNG+G   + GLYPT+D
Sbjct  784  TASPKNPKSRKSSHLGELQPHLY---ADSNGSGHAYMPGLYPTVD  825


 Score = 51.6 bits (122),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S+S+IHLREPP+VLRP+E H++ E+IEI VTK +
Sbjct  629  QSLSLIHLREPPTVLRPSENHSEHESIEIVVTKLL  663



>ref|XP_011003245.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Populus 
euphratica]
Length=827

 Score =   240 bits (613),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQEPDE+A KRK
Sbjct  666  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEPDEIAMKRK  725

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            +TR+ LRVLQQAF+TLDELPLEAE+VERGYSLS D TGLPKIHGLP +S   +S S DSY
Sbjct  726  QTREQLRVLQQAFRTLDELPLEAETVERGYSLSSDSTGLPKIHGLP-TSTMYSSGSSDSY  784

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            TASPKNP+SRKSSH GELQ  +Y    DSNG+G   + GLYPT+D
Sbjct  785  TASPKNPKSRKSSHLGELQPHLY---ADSNGSGHAYMPGLYPTVD  826


 Score = 51.6 bits (122),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S+S+IHLREPP+VLRP+E H++ E+IEI VTK +
Sbjct  630  QSLSLIHLREPPTVLRPSENHSEHESIEIVVTKLL  664



>gb|ABN05858.1| Dynamin central region; Dynamin GTPase effector [Medicago truncatula]
Length=470

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFIKKLYRDNLFEEMLQEPDE+A+KRK
Sbjct  307  KSYYDIVRKNVEDFVPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPDEIASKRK  366

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELP+EAE++ERGYSL P+ TGLPKIHGLPTSSMY+T+SS D Y
Sbjct  367  RCRELLRAYQQAFKDLEELPMEAETLERGYSL-PETTGLPKIHGLPTSSMYSTNSSGDYY  425

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             ASPK+P+S++SSHSGELQSP +Y   DSNGNG+ S  G YPT+D
Sbjct  426  GASPKHPKSKRSSHSGELQSP-FYANADSNGNGKQSASGFYPTLD  469



>gb|KJB47248.1| hypothetical protein B456_008G017900 [Gossypium raimondii]
Length=828

 Score =   241 bits (615),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A+KRK
Sbjct  663  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIASKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQ AF+TLDELPLEAE+VERGYSL  DPTGLP+IHGLPTSSMY+ SSS +  
Sbjct  723  RTRETLRVLQLAFRTLDELPLEAETVERGYSLGSDPTGLPEIHGLPTSSMYSISSSSNDS  782

Query  473  -taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTI  342
             TAS KNP+ RKS+HSGELQS ++    DSNGNGR+ + GLYPT+
Sbjct  783  YTASSKNPKPRKSAHSGELQSHLFD-NADSNGNGRHYMPGLYPTV  826


 Score = 49.7 bits (117),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS SMIHLREPP+VLRP+E  ++ + IEI +TK +
Sbjct  627  HSFSMIHLREPPTVLRPSEDRSETQAIEIAITKLL  661



>ref|XP_006373005.1| hypothetical protein POPTR_0017s06930g [Populus trichocarpa]
 gb|ERP50802.1| hypothetical protein POPTR_0017s06930g [Populus trichocarpa]
Length=821

 Score =   239 bits (610),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 143/165 (87%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQE DE+A KRK
Sbjct  660  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEHDEIAMKRK  719

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            +TR++LRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLP +S      S DSY
Sbjct  720  QTRESLRVLQQAFRTLDELPLEAETVERGYSLGSDSTGLPKIHGLP-TSTMHGVGSSDSY  778

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            +ASPKNP+SR+SSHSGELQ  +Y    DSNG+GR  + GLYPT+D
Sbjct  779  SASPKNPKSRRSSHSGELQPHLY---SDSNGSGRTYMPGLYPTVD  820


 Score = 52.0 bits (123),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            SMIHLREPP+VLRP+E+H++ E+IEI VTK +
Sbjct  627  SMIHLREPPTVLRPSESHSENESIEIAVTKLL  658



>ref|XP_011006400.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Populus 
euphratica]
Length=831

 Score =   236 bits (603),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 143/165 (87%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQE DE+A KRK
Sbjct  670  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEHDEIALKRK  729

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            +TR++LRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLP +S      S DSY
Sbjct  730  QTRESLRVLQQAFRTLDELPLEAETVERGYSLGSDSTGLPKIHGLP-TSTMHGVGSSDSY  788

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            +ASPKN +SR+SSHSGELQ P  YV  DSNG+GR  + GLYPT+D
Sbjct  789  SASPKNSKSRRSSHSGELQ-PHLYV--DSNGSGRTYMPGLYPTVD  830


 Score = 52.0 bits (123),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            SMIHLREPP+VLRP+E+H++ E+IEI VTK
Sbjct  637  SMIHLREPPTVLRPSESHSENESIEIAVTK  666



>emb|CAN69849.1| hypothetical protein VITISV_007523 [Vitis vinifera]
Length=909

 Score =   231 bits (590),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 149/193 (77%), Gaps = 28/193 (15%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFL-------------------------VNHTKRELHNVF  729
            RSYYDIVRKNIED+VPKAIMHFL                         VNHTKRELHNVF
Sbjct  718  RSYYDIVRKNIEDAVPKAIMHFLTLEACEIVNMRHYFGTLLGLQISALVNHTKRELHNVF  777

Query  728  IKKLYRDNLFEEMLQEPDEVATKRKRTRDTLRVLQQAFKTLDELPLEAESVERGYSL-SP  552
            I+KLYR+NLFEEMLQEPDEVA KRKRT +TLRVLQQA +TLDELP EAE+VE+GYSL S 
Sbjct  778  IRKLYRENLFEEMLQEPDEVAMKRKRTSETLRVLQQALRTLDELPQEAETVEKGYSLGSS  837

Query  551  DPTGLPKIHGLPtssm-yttsssvdsytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
            DPTGLPKIHGLPTSS+  T+  S  SYTASPKNP+SRKSSHSGELQSP ++   DSNG G
Sbjct  838  DPTGLPKIHGLPTSSLYTTSGGSTQSYTASPKNPKSRKSSHSGELQSP-FHGNADSNGGG  896

Query  374  RNSLLGLYPTIDA  336
            R+ + GLYPT+DA
Sbjct  897  RSYMPGLYPTLDA  909


 Score = 56.2 bits (134),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HSISMIHL+EPP++L+P+E+H++QE IEI+VTK +
Sbjct  682  HSISMIHLKEPPTILKPSESHSEQEAIEISVTKLL  716



>ref|XP_009793686.1| PREDICTED: dynamin-related protein 3B-like [Nicotiana sylvestris]
Length=828

 Score =   225 bits (574),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVN TKR+LHNVFI+KLYRDNLFEEMLQEPDE+ATKRK
Sbjct  669  RSYYDIVRKNIEDSIPKAIMHFLVNQTKRDLHNVFIEKLYRDNLFEEMLQEPDEIATKRK  728

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQA KTL+ELPL+ E+VERGYSL  D TGLP+IHGLPTSSMY TSS     
Sbjct  729  RTRETLRVLQQASKTLEELPLDTETVERGYSLGTDQTGLPRIHGLPTSSMYNTSSGSTDS  788

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLY  351
              +  N RS  +SHSGEL SPMY  G DSNG G N   GLY
Sbjct  789  YTTSPNSRSHYASHSGELWSPMYG-GADSNGGGHN--FGLY  826


 Score = 60.8 bits (146),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ SMI+LREPPSVLRP+ETH+DQETIEI +TK
Sbjct  633  HAFSMIYLREPPSVLRPSETHSDQETIEIAITK  665



>ref|XP_003593276.1| Dynamin-related protein 3A [Medicago truncatula]
 gb|AES63527.1| dynamin 3A-like protein [Medicago truncatula]
Length=824

 Score =   236 bits (603),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFIKKLYRDNLFEEMLQEPDE+A+KRK
Sbjct  661  KSYYDIVRKNVEDFVPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPDEIASKRK  720

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELP+EAE++ERGYSL P+ TGLPKIHGLPTSSMY+T+SS D Y
Sbjct  721  RCRELLRAYQQAFKDLEELPMEAETLERGYSL-PETTGLPKIHGLPTSSMYSTNSSGDYY  779

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             ASPK+P+S++SSHSGELQSP +Y   DSNGNG+ S  G YPT+D
Sbjct  780  GASPKHPKSKRSSHSGELQSP-FYANADSNGNGKQSASGFYPTLD  823



>ref|XP_003593275.1| Dynamin-related protein 3A [Medicago truncatula]
Length=852

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFIKKLYRDNLFEEMLQEPDE+A+KRK
Sbjct  689  KSYYDIVRKNVEDFVPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPDEIASKRK  748

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELP+EAE++ERGYSL P+ TGLPKIHGLPTSSMY+T+SS D Y
Sbjct  749  RCRELLRAYQQAFKDLEELPMEAETLERGYSL-PETTGLPKIHGLPTSSMYSTNSSGDYY  807

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             ASPK+P+S++SSHSGELQSP +Y   DSNGNG+ S  G YPT+D
Sbjct  808  GASPKHPKSKRSSHSGELQSP-FYANADSNGNGKQSASGFYPTLD  851



>ref|XP_009590783.1| PREDICTED: dynamin-related protein 3B-like isoform X1 [Nicotiana 
tomentosiformis]
Length=825

 Score =   223 bits (568),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVN TKR+LHNVFI+KLYRDNL EEMLQEPDE+ATKRK
Sbjct  666  RSYYDIVRKNIEDSIPKAIMHFLVNQTKRDLHNVFIEKLYRDNLLEEMLQEPDEIATKRK  725

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQA KTL+ELPL+ E+VERGYSL  D TGLP+IHGLPTSSMY TSS     
Sbjct  726  RTRETLRVLQQASKTLEELPLDTETVERGYSLGTDQTGLPRIHGLPTSSMYNTSSGSTDS  785

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLY  351
              +  N RSR +SHSGEL+ PMY  G DSNG G N   GLY
Sbjct  786  YTTSPNSRSRYASHSGELRLPMYG-GADSNGGGHN--FGLY  823


 Score = 60.1 bits (144),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            H  SMI+LREPPSVLRP ETH+DQETIEI VTK +
Sbjct  630  HDFSMIYLREPPSVLRPLETHSDQETIEIAVTKLL  664



>ref|XP_006373004.1| dynamin-like family protein [Populus trichocarpa]
 gb|ERP50801.1| dynamin-like family protein [Populus trichocarpa]
Length=815

 Score =   226 bits (576),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 135/155 (87%), Gaps = 4/155 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQE DE+A KRK
Sbjct  660  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEHDEIAMKRK  719

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            +TR++LRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLP +S      S DSY
Sbjct  720  QTRESLRVLQQAFRTLDELPLEAETVERGYSLGSDSTGLPKIHGLP-TSTMHGVGSSDSY  778

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRN  369
            +ASPKNP+SR+SSHSGELQ  +Y    DSNG+GR 
Sbjct  779  SASPKNPKSRRSSHSGELQPHLY---SDSNGSGRT  810


 Score = 52.0 bits (123),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            SMIHLREPP+VLRP+E+H++ E+IEI VTK +
Sbjct  627  SMIHLREPPTVLRPSESHSENESIEIAVTKLL  658



>ref|XP_010527014.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Tarenaya 
hassleriana]
Length=841

 Score =   226 bits (576),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 138/165 (84%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIED +PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  680  RSYYDIVRKNIEDFIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  739

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTRDTLR+LQQA++TLDELPLEAESVERGY+L PD TGLPK+HGLPTSSMY+TSS     
Sbjct  740  RTRDTLRILQQAYRTLDELPLEAESVERGYNLGPDATGLPKVHGLPTSSMYSTSSGSLDS  799

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             +SPK  RSRK   SGE Q    Y   DSNG+GR  + GLYP+ D
Sbjct  800  YSSPKTVRSRK---SGE-QHQNLYGSMDSNGHGRLQMPGLYPSHD  840


 Score = 49.7 bits (117),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI L+EPP+VLRP ETH++QE IEI +TK +
Sbjct  644  QNLSMIFLKEPPTVLRPPETHSEQEAIEIAITKLL  678



>ref|XP_010527015.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Tarenaya 
hassleriana]
Length=840

 Score =   226 bits (576),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 138/165 (84%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIED +PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  679  RSYYDIVRKNIEDFIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  738

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTRDTLR+LQQA++TLDELPLEAESVERGY+L PD TGLPK+HGLPTSSMY+TSS     
Sbjct  739  RTRDTLRILQQAYRTLDELPLEAESVERGYNLGPDATGLPKVHGLPTSSMYSTSSGSLDS  798

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             +SPK  RSRK   SGE Q    Y   DSNG+GR  + GLYP+ D
Sbjct  799  YSSPKTVRSRK---SGE-QHQNLYGSMDSNGHGRLQMPGLYPSHD  839


 Score = 49.7 bits (117),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI L+EPP+VLRP ETH++QE IEI +TK +
Sbjct  643  QNLSMIFLKEPPTVLRPPETHSEQEAIEIAITKLL  677



>ref|XP_011006401.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Populus 
euphratica]
Length=825

 Score =   223 bits (569),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 135/155 (87%), Gaps = 4/155 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQE DE+A KRK
Sbjct  670  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQEHDEIALKRK  729

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            +TR++LRVLQQAF+TLDELPLEAE+VERGYSL  D TGLPKIHGLP +S      S DSY
Sbjct  730  QTRESLRVLQQAFRTLDELPLEAETVERGYSLGSDSTGLPKIHGLP-TSTMHGVGSSDSY  788

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRN  369
            +ASPKN +SR+SSHSGELQ P  YV  DSNG+GR 
Sbjct  789  SASPKNSKSRRSSHSGELQ-PHLYV--DSNGSGRT  820


 Score = 52.0 bits (123),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            SMIHLREPP+VLRP+E+H++ E+IEI VTK
Sbjct  637  SMIHLREPPTVLRPSESHSENESIEIAVTK  666



>ref|XP_010548840.1| PREDICTED: dynamin-related protein 3A-like, partial [Tarenaya 
hassleriana]
Length=840

 Score =   225 bits (573),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 139/165 (84%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  679  RSYYDIVRKNIEDSIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  738

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTRDTLRVLQQA++TLDELPLEAESVERGY+L PD TGLPK+HGLP+SS+Y+TSS     
Sbjct  739  RTRDTLRVLQQAYRTLDELPLEAESVERGYNLGPDATGLPKVHGLPSSSIYSTSSGSLDS  798

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             +SPK  RSRK   SGE Q    +   DSNG+GR+ +  LYP+ D
Sbjct  799  FSSPKPTRSRK---SGE-QHQNLFGNMDSNGHGRSHVSSLYPSHD  839


 Score = 49.3 bits (116),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI L+EPP+VLRP ETH++QE +EI +TK +
Sbjct  643  QNLSMIFLKEPPTVLRPPETHSEQEAVEIAITKLL  677



>ref|XP_008794571.1| PREDICTED: dynamin-related protein 3A-like [Phoenix dactylifera]
Length=832

 Score =   223 bits (569),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 137/166 (83%), Gaps = 8/166 (5%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNH KRELHNVFI+KLYR+NLFE+ML+EPD++  KRK
Sbjct  675  KSYYDIVRKNIEDSVPKAIMHFLVNHMKRELHNVFIRKLYRENLFEDMLREPDDITAKRK  734

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+TLRVLQQA++TLDE+PLEAE+VE+GY+L  D TGLPK HGLP SS Y T+    SY
Sbjct  735  RIRETLRVLQQAYRTLDEIPLEAETVEKGYTLDADGTGLPKFHGLP-SSFYATNDYSTSY  793

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             ASPKNPRSRKS+HSGE  SP +Y   D+NG      LG YPTIDA
Sbjct  794  AASPKNPRSRKSAHSGEQSSP-WYSNADANG------LGSYPTIDA  832


 Score = 49.7 bits (117),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS+SMI LREPP +L+P+E  T+QE +EI +TK
Sbjct  639  HSLSMIQLREPPIILKPSENQTEQEALEIAITK  671



>ref|XP_004485614.1| PREDICTED: dynamin-related protein 3A-like [Cicer arietinum]
Length=824

 Score =   223 bits (568),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFIKKLYRDNLFEEMLQEPDE+A KRK
Sbjct  661  KSYYDIVRKNVEDLVPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPDEIAFKRK  720

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELP++AE+VE+GYSL P+ TGLPKI+GLP SSMY+TSSS D Y
Sbjct  721  RCRELLRAYQQAFKDLEELPMDAETVEKGYSL-PETTGLPKINGLPASSMYSTSSSGDYY  779

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             ASPK+P+S++SSHSGELQS  +Y   DSNGNG+ S  G YP +D
Sbjct  780  AASPKHPKSKRSSHSGELQS-QFYSNADSNGNGKLSTSGFYPALD  823


 Score = 49.3 bits (116),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             S SMIHL EPPS+LRP++T+++ E +EITVTK
Sbjct  625  QSFSMIHLTEPPSILRPSDTNSETEAVEITVTK  657



>ref|XP_010927716.1| PREDICTED: dynamin-related protein 3A-like [Elaeis guineensis]
Length=827

 Score =   226 bits (575),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 140/166 (84%), Gaps = 8/166 (5%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFE+ML+EPD++  KRK
Sbjct  670  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEDMLREPDDITAKRK  729

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+TLRVLQQA++TLDE+P+EAE++E+GY+L  D TGLPKIHGLP SS Y ++    SY
Sbjct  730  RIRETLRVLQQAYRTLDEIPIEAETIEKGYTLDTDGTGLPKIHGLP-SSFYASNDYSTSY  788

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             ASPKNPRSRKS+HSGE  SP+Y    ++N NG    LG YPTIDA
Sbjct  789  AASPKNPRSRKSAHSGEQSSPLY---SNANSNG----LGSYPTIDA  827


 Score = 46.6 bits (109),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS+S I LREPP +L+P+E  T+QE +EI +TK +
Sbjct  634  HSLSTIQLREPPIILKPSENQTEQEALEIAITKLL  668



>ref|XP_006852885.1| PREDICTED: dynamin-related protein 3A [Amborella trichopoda]
 gb|ERN14352.1| hypothetical protein AMTR_s00033p00216190 [Amborella trichopoda]
Length=829

 Score =   218 bits (555),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+D VPKAIMHFLVNH KRELHNVFI+KLYR+N+FEEMLQEP+E+ATKRK
Sbjct  664  RSYYDIVRKNIQDYVPKAIMHFLVNHAKRELHNVFIRKLYRENIFEEMLQEPEEIATKRK  723

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R+R+ LRVLQQAF+TLDELPLE +S+ +G S + D TGLPKIHGLP+S     +     Y
Sbjct  724  RSREILRVLQQAFRTLDELPLETDSILKGSSTATDATGLPKIHGLPSSYYTVPNGDFTPY  783

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLG-LYPTID  339
              SPKNPRSRKSSHSGE  SP +    ++NG+G +S  G  YPTID
Sbjct  784  MGSPKNPRSRKSSHSGEQPSP-FNTSSEANGSGHHSGQGSAYPTID  828


 Score = 52.0 bits (123),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            +S SMI L+EPPS+LRP+ET T+QE +EI VTK
Sbjct  628  NSFSMIQLKEPPSILRPSETQTEQEAVEIGVTK  660



>ref|XP_010926713.1| PREDICTED: dynamin-related protein 3A-like [Elaeis guineensis]
Length=828

 Score =   220 bits (560),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 138/166 (83%), Gaps = 8/166 (5%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFE+ML+EPD++  KRK
Sbjct  671  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEDMLREPDDITAKRK  730

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+TLRVLQQA++TLDE+PLEAE+VE+GY L  D TGLPKIHGLP SS YT++    SY
Sbjct  731  RIRETLRVLQQAYRTLDEIPLEAETVEKGYILDTDGTGLPKIHGLP-SSFYTSNDYSTSY  789

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             ASPKNPRSRKS+HSGE  SP+Y    D+NG      LG YP +DA
Sbjct  790  AASPKNPRSRKSAHSGEQPSPLYS-NADANG------LGSYPRMDA  828


 Score = 49.3 bits (116),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS++MI LREPP VL+P+E  T+QE +EI +TK +
Sbjct  635  HSLTMIQLREPPVVLKPSENQTEQEALEIAITKML  669



>ref|XP_008454460.1| PREDICTED: dynamin-related protein 3A-like [Cucumis melo]
Length=822

 Score =   223 bits (568),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 5/165 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVR NI+D VPK+IMHFLVNHTK+E+HNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  662  RSYYDIVRNNIKDLVPKSIMHFLVNHTKQEMHNVFIKKLYRENLFEEMLQEPDEVAMKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
             TR+TLRVLQQAF+TLDELPLEAESVERG     DPTGLP++HG+PTSSMY+T+SS DS+
Sbjct  722  HTRETLRVLQQAFRTLDELPLEAESVERG----DDPTGLPRMHGMPTSSMYSTTSSNDSF  777

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            + SPKNP+ RKSS+SGELQ P+Y    DSNGNGR+ +  LYP +D
Sbjct  778  SPSPKNPKPRKSSYSGELQVPVYG-NSDSNGNGRSFMPSLYPKLD  821



>ref|XP_004147508.1| PREDICTED: dynamin-related protein 3A [Cucumis sativus]
Length=822

 Score =   223 bits (567),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 5/165 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVR N++D VPK+IMHFLVNHTK+E+HNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  662  RSYYDIVRNNVKDLVPKSIMHFLVNHTKQEMHNVFIKKLYRENLFEEMLQEPDEVAMKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
             TR+TLRVLQQAF+TLDELPLEAESVERG     DPTGLP++HG+PTSS+Y+T SS DS+
Sbjct  722  HTRETLRVLQQAFRTLDELPLEAESVERG----DDPTGLPRMHGMPTSSVYSTISSNDSF  777

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            + SPKNP+ RKSS+SGELQ P+Y    DSNGN R+ +  LYP +D
Sbjct  778  SPSPKNPKPRKSSYSGELQVPLYG-NSDSNGNSRSFMPSLYPKLD  821



>ref|XP_010527016.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Tarenaya 
hassleriana]
Length=839

 Score =   218 bits (554),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 131/154 (85%), Gaps = 4/154 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIED +PKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  680  RSYYDIVRKNIEDFIPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEVAMKRK  739

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTRDTLR+LQQA++TLDELPLEAESVERGY+L PD TGLPK+HGLPTSSMY+TSS     
Sbjct  740  RTRDTLRILQQAYRTLDELPLEAESVERGYNLGPDATGLPKVHGLPTSSMYSTSSGSLDS  799

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGR  372
             +SPK  RSRK   SGE Q    Y   DSNG+GR
Sbjct  800  YSSPKTVRSRK---SGE-QHQNLYGSMDSNGHGR  829


 Score = 49.7 bits (117),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI L+EPP+VLRP ETH++QE IEI +TK +
Sbjct  644  QNLSMIFLKEPPTVLRPPETHSEQEAIEIAITKLL  678



>ref|XP_008455128.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Cucumis 
melo]
Length=812

 Score =   214 bits (546),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+D VPKAIM+FLV H KR+LHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  659  RSYYDIVRKNIQDYVPKAIMNFLVVHAKRDLHNVFIKKLYRENLFEEMLQEPDEVAMKRK  718

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLE E+VE+GY++  DPTGLP+IHGLPTSSMY+TSSS DSY
Sbjct  719  RTRETLRVLQQAFRTLDELPLETETVEKGYNVGADPTGLPRIHGLPTSSMYSTSSSGDSY  778

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
            +ASP++ +SRKSSHSGEL S  ++   DSNGNG
Sbjct  779  SASPRHLKSRKSSHSGELLS-TFHPNADSNGNG  810


 Score = 51.6 bits (122),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S SMIHLREPP+VLRP+E  T+QE +EI +TK +
Sbjct  623  QSFSMIHLREPPAVLRPSENLTEQEAMEIAITKLL  657



>ref|XP_008455130.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Cucumis 
melo]
Length=780

 Score =   214 bits (546),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+D VPKAIM+FLV H KR+LHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  627  RSYYDIVRKNIQDYVPKAIMNFLVVHAKRDLHNVFIKKLYRENLFEEMLQEPDEVAMKRK  686

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLE E+VE+GY++  DPTGLP+IHGLPTSSMY+TSSS DSY
Sbjct  687  RTRETLRVLQQAFRTLDELPLETETVEKGYNVGADPTGLPRIHGLPTSSMYSTSSSGDSY  746

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
            +ASP++ +SRKSSHSGEL S  ++   DSNGNG
Sbjct  747  SASPRHLKSRKSSHSGELLS-TFHPNADSNGNG  778


 Score = 51.6 bits (122),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S SMIHLREPP+VLRP+E  T+QE +EI +TK +
Sbjct  591  QSFSMIHLREPPAVLRPSENLTEQEAMEIAITKLL  625



>ref|XP_011658828.1| PREDICTED: dynamin-related protein 3A isoform X1 [Cucumis sativus]
Length=813

 Score =   214 bits (544),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+D +PKAIM+FLV H KR+LHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  660  RSYYDIVRKNIQDYIPKAIMNFLVVHAKRDLHNVFIKKLYRENLFEEMLQEPDEVAMKRK  719

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQAF+TLDELPLE E+VE+GYS+  DPTGLP+IHGLPTSSMY+TSSS DSY
Sbjct  720  RTRETLRVLQQAFRTLDELPLETETVEKGYSVGADPTGLPRIHGLPTSSMYSTSSSGDSY  779

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
            +ASP++ +SRKSSHSGEL S  ++   DS+GNG
Sbjct  780  SASPRHLKSRKSSHSGELLS-TFHPNADSHGNG  811


 Score = 50.8 bits (120),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S +MIHLREPP+VLRP+E+ T+QE +EI +TK +
Sbjct  624  QSFAMIHLREPPAVLRPSESLTEQEAMEIAITKLL  658



>ref|XP_008802260.1| PREDICTED: dynamin-related protein 3A-like [Phoenix dactylifera]
Length=828

 Score =   213 bits (541),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 137/166 (83%), Gaps = 8/166 (5%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFE+ML+EPD++A KRK
Sbjct  671  KSYYDIVRKSIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEDMLREPDDIAAKRK  730

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+TL+VLQQA++TLDE+PLEAE+VE+GY L  D TGLPKIHGLP SS YT +    SY
Sbjct  731  RIRETLKVLQQAYRTLDEIPLEAETVEKGYILDTDGTGLPKIHGLP-SSFYTNNDYSASY  789

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             ASPKNPRSRK ++SGE  S +Y    +S+ NG    LG YP IDA
Sbjct  790  AASPKNPRSRKIAYSGEQPSSLY---SNSDANG----LGSYPRIDA  828


 Score = 50.8 bits (120),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS++MI LREPP +L+P+E  TDQE +EI +TK +
Sbjct  635  HSLTMIQLREPPVILKPSENQTDQEALEIAITKLL  669



>gb|KHN19022.1| Dynamin-related protein 3A [Glycine soja]
Length=828

 Score =   210 bits (535),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYY IVRKN+ED +PKAIMHFLVN+TKRELHNVFIKKLYRDNLFEEMLQEPDE+A KRK
Sbjct  665  RSYYGIVRKNVEDLIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPDEIAVKRK  724

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELPLEAE+VERGYSL P+ +GLPKIHGLPTSSMY+TSSS D Y
Sbjct  725  RCRELLRAYQQAFKDLEELPLEAETVERGYSL-PETSGLPKIHGLPTSSMYSTSSSGDYY  783

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             ASPK+ RS++SSHSGELQSP+ +   DSNG+GR  + G YPT+DA
Sbjct  784  AASPKHSRSKRSSHSGELQSPL-HANADSNGSGRPFMSGFYPTVDA  828


 Score = 52.0 bits (123),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             SISMIHLREPP +LRP+E++++ E IEITVTK +
Sbjct  629  QSISMIHLREPPPILRPSESNSETEAIEITVTKLL  663



>ref|XP_003543135.1| PREDICTED: dynamin-related protein 3A-like [Glycine max]
Length=826

 Score =   210 bits (535),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYY IVRKN+ED +PKAIMHFLVN+TKRELHNVFIKKLYRDNLFEEMLQEPDE+A KRK
Sbjct  663  RSYYGIVRKNVEDLIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPDEIAVKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELPLEAE+VERGYSL P+ +GLPKIHGLPTSSMY+TSSS D Y
Sbjct  723  RCRELLRAYQQAFKDLEELPLEAETVERGYSL-PETSGLPKIHGLPTSSMYSTSSSGDYY  781

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             ASPK+ RS++SSHSGELQSP+ +   DSNG+GR  + G YPT+DA
Sbjct  782  AASPKHSRSKRSSHSGELQSPL-HANADSNGSGRPFMSGFYPTVDA  826


 Score = 52.0 bits (123),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             SISMIHLREPP +LRP+E++++ E IEITVTK +
Sbjct  627  QSISMIHLREPPPILRPSESNSETEAIEITVTKLL  661



>ref|XP_009590784.1| PREDICTED: dynamin-related protein 3B-like isoform X2 [Nicotiana 
tomentosiformis]
Length=802

 Score =   201 bits (512),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDS+PKAIMHFLVN TKR+LHNVFI+KLYRDNL EEMLQEPDE+ATKRK
Sbjct  666  RSYYDIVRKNIEDSIPKAIMHFLVNQTKRDLHNVFIEKLYRDNLLEEMLQEPDEIATKRK  725

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RTR+TLRVLQQA KTL+ELPL+ E+VERGYSL  D TGLP+IHGLPTSSMY TSS     
Sbjct  726  RTRETLRVLQQASKTLEELPLDTETVERGYSLGTDQTGLPRIHGLPTSSMYNTSSGSTDS  785

Query  473  taSPKNPRSRKSSHSG  426
              +  N RSR +SHSG
Sbjct  786  YTTSPNSRSRYASHSG  801


 Score = 60.1 bits (144),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            H  SMI+LREPPSVLRP ETH+DQETIEI VTK +
Sbjct  630  HDFSMIYLREPPSVLRPLETHSDQETIEIAVTKLL  664



>ref|XP_003545730.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Glycine 
max]
Length=823

 Score =   208 bits (530),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYY IVRKN+ED +PKAIMHFLVN+TKRELHNVFIKKLYRDNLFEEMLQEPDE+A KRK
Sbjct  660  RSYYGIVRKNVEDLIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPDEIAVKRK  719

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELPLEAE+VERGYSL P+ +GLPKIHGLPTSSMY+TSSS D Y
Sbjct  720  RCRELLRAYQQAFKDLEELPLEAETVERGYSL-PETSGLPKIHGLPTSSMYSTSSSGDYY  778

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             ASPK+ RS++SSHSGELQSP+ +   DSNG+GR  + G YP +DA
Sbjct  779  AASPKHSRSKRSSHSGELQSPL-HANADSNGSGRPFMSGFYPMVDA  823


 Score = 51.6 bits (122),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S+SMIHLREPP +LRP+E++++ E IEITVTK +
Sbjct  624  QSVSMIHLREPPPILRPSESNSETEAIEITVTKLL  658



>gb|KHN33568.1| Dynamin-related protein 3A [Glycine soja]
Length=720

 Score =   207 bits (528),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYY IVRKN+ED +PKAIMHFLVN+TKRELHNVFIKKLYRDNLFEEMLQEPDE+A KRK
Sbjct  557  RSYYGIVRKNVEDLIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPDEIAVKRK  616

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELPLEAE+VERGYSL P+ +GLPKIHGLPTSSMY+TSSS D Y
Sbjct  617  RCRELLRAYQQAFKDLEELPLEAETVERGYSL-PETSGLPKIHGLPTSSMYSTSSSGDYY  675

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             ASPK+ RS++SSHSGELQSP+ +   DSNG+GR  + G YP +DA
Sbjct  676  AASPKHSRSKRSSHSGELQSPL-HANADSNGSGRPFMSGFYPMVDA  720


 Score = 51.2 bits (121),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S+SMIHLREPP +LRP+E++++ E IEITVTK +
Sbjct  521  QSVSMIHLREPPPILRPSESNSETEAIEITVTKLL  555



>ref|XP_009411851.1| PREDICTED: dynamin-related protein 3A-like [Musa acuminata subsp. 
malaccensis]
Length=821

 Score =   210 bits (535),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 130/166 (78%), Gaps = 7/166 (4%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFE++L+EPD++  +RK
Sbjct  663  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEDLLREPDDITARRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+TL VLQQA+KT+DE+PLEAES+E+GY+L  DPTGLPKIH  P+S     +     Y
Sbjct  723  RIRETLWVLQQAYKTIDEIPLEAESIEKGYTLDADPTGLPKIHVHPSSFYAGNNDLTSQY  782

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
            +ASPKNPR RKS+HSGE   P++     S  NG    LG YPT D 
Sbjct  783  SASPKNPRPRKSAHSGEQPPPLF---SSSVANG----LGSYPTFDV  821


 Score = 46.6 bits (109),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  939  SISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            S+SMI LREPP +L+P+E  T+QE +EI +TK +
Sbjct  628  SLSMIQLREPPIILKPSENQTEQEALEIAITKLL  661



>ref|XP_007148356.1| hypothetical protein PHAVU_006G201400g [Phaseolus vulgaris]
 gb|ESW20350.1| hypothetical protein PHAVU_006G201400g [Phaseolus vulgaris]
Length=828

 Score =   204 bits (518),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKN+ED +PKAIMHFLVN+TKRELHNVFIKKLYRDNLFEEMLQEPDE+A KRK
Sbjct  665  RSYYDIVRKNVEDLIPKAIMHFLVNNTKRELHNVFIKKLYRDNLFEEMLQEPDEIALKRK  724

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELP+EAE+VERGYSL P+ TGLPKIHGLPTSSMY+TSSS D Y
Sbjct  725  RCRELLRAYQQAFKDLEELPMEAETVERGYSL-PETTGLPKIHGLPTSSMYSTSSSGDYY  783

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             ASPK+ +S++SSHSGE QSPM+ +  DSNG+GR    G YPT++ 
Sbjct  784  AASPKHSKSKRSSHSGEFQSPMHAI-PDSNGSGRPFTSGFYPTLEG  828


 Score = 52.8 bits (125),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS SMIHLREPP +LRP+E++++ E IEITVTK
Sbjct  629  HSFSMIHLREPPPILRPSESNSETEVIEITVTK  661



>ref|XP_006583773.1| PREDICTED: dynamin-related protein 3A-like [Glycine max]
Length=812

 Score =   209 bits (532),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 132/165 (80%), Gaps = 4/165 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFI+KLYR++LFEEMLQEP+EVA KRK
Sbjct  651  KSYYDIVRKNVEDLVPKAIMHFLVNNTKRELHNVFIEKLYREDLFEEMLQEPEEVAKKRK  710

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
              R+ LR  QQAFK L+ELPLEAE+VERGYSL    TGLPKI GLPTSSMY+T S  D Y
Sbjct  711  HCRELLRAYQQAFKDLNELPLEAETVERGYSLPETTTGLPKIRGLPTSSMYSTGSLGDYY  770

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
             ASPKN +SRKSSHSGELQSP +    DSNGNG     G  P  D
Sbjct  771  EASPKNTKSRKSSHSGELQSPFH----DSNGNGGPYTSGFNPMAD  811


 Score = 46.6 bits (109),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             S S IHLREPP VLRP E++++ E +EITVTK
Sbjct  615  QSFSTIHLREPPPVLRPLESNSETEAVEITVTK  647



>gb|KJB47250.1| hypothetical protein B456_008G017900 [Gossypium raimondii]
Length=813

 Score =   205 bits (521),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A+KRK
Sbjct  663  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIASKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TLRVLQ AF+TLDELPLEAE+VERGYSL  DPTGLP+IHGLP
Sbjct  723  RTRETLRVLQLAFRTLDELPLEAETVERGYSLGSDPTGLPEIHGLP  768


 Score = 49.7 bits (117),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS SMIHLREPP+VLRP+E  ++ + IEI +TK +
Sbjct  627  HSFSMIHLREPPTVLRPSEDRSETQAIEIAITKLL  661



>gb|KJB47251.1| hypothetical protein B456_008G017900 [Gossypium raimondii]
Length=819

 Score =   205 bits (521),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A+KRK
Sbjct  663  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIASKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TLRVLQ AF+TLDELPLEAE+VERGYSL  DPTGLP+IHGLP
Sbjct  723  RTRETLRVLQLAFRTLDELPLEAETVERGYSLGSDPTGLPEIHGLP  768


 Score = 49.7 bits (117),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS SMIHLREPP+VLRP+E  ++ + IEI +TK +
Sbjct  627  HSFSMIHLREPPTVLRPSEDRSETQAIEIAITKLL  661



>gb|KJB47249.1| hypothetical protein B456_008G017900 [Gossypium raimondii]
Length=810

 Score =   205 bits (521),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A+KRK
Sbjct  663  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIASKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TLRVLQ AF+TLDELPLEAE+VERGYSL  DPTGLP+IHGLP
Sbjct  723  RTRETLRVLQLAFRTLDELPLEAETVERGYSLGSDPTGLPEIHGLP  768


 Score = 49.7 bits (117),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS SMIHLREPP+VLRP+E  ++ + IEI +TK +
Sbjct  627  HSFSMIHLREPPTVLRPSEDRSETQAIEIAITKLL  661



>gb|EYU18402.1| hypothetical protein MIMGU_mgv1a001513mg [Erythranthe guttata]
Length=804

 Score =   194 bits (494),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 120/161 (75%), Gaps = 20/161 (12%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+N+ E+MLQEPDE++ KRK
Sbjct  662  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENMLEKMLQEPDEISIKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            RT +TLRVL QAF+TLDELPLEAESVERGYS S DPTGLPKI+GLPTSS           
Sbjct  722  RTHETLRVLHQAFRTLDELPLEAESVERGYSPSTDPTGLPKINGLPTSS-----------  770

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLY  351
                        S+S   Q+P Y     +NG GRNSL G Y
Sbjct  771  -------SYSTDSYSASSQNPFY--PDTNNGGGRNSLAGHY  802


 Score = 59.3 bits (142),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
              +SMIHLREPPSVLRP++TH+DQE IEIT+TK
Sbjct  626  QGVSMIHLREPPSVLRPSDTHSDQEAIEITITK  658



>gb|KGN53892.1| hypothetical protein Csa_4G182230 [Cucumis sativus]
Length=142

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 125/146 (86%), Gaps = 5/146 (3%)
 Frame = -3

Query  776  MHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKRTRDTLRVLQQAFKTLDEL  597
            MHFLVNHTK+E+HNVFIKKLYR+NLFEEMLQEPDEVA KRK TR+TLRVLQQAF+TLDEL
Sbjct  1    MHFLVNHTKQEMHNVFIKKLYRENLFEEMLQEPDEVAMKRKHTRETLRVLQQAFRTLDEL  60

Query  596  PLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsytaSPKNPRSRKSSHSGELQ  417
            PLEAESVERG     DPTGLP++HG+PTSS+Y+T SS DS++ SPKNP+ RKSS+SGELQ
Sbjct  61   PLEAESVERG----DDPTGLPRMHGMPTSSVYSTISSNDSFSPSPKNPKPRKSSYSGELQ  116

Query  416  SPMYYVGGDSNGNGRNSLLGLYPTID  339
             P+ Y   DSNGN R+ +  LYP +D
Sbjct  117  VPL-YGNSDSNGNSRSFMPSLYPKLD  141



>ref|XP_007159159.1| hypothetical protein PHAVU_002G213900g [Phaseolus vulgaris]
 gb|ESW31153.1| hypothetical protein PHAVU_002G213900g [Phaseolus vulgaris]
Length=798

 Score =   191 bits (484),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 122/150 (81%), Gaps = 1/150 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFI+KLYR++LFEEMLQEPDE+A KRK
Sbjct  650  KSYYDIVRKNVEDLVPKAIMHFLVNNTKRELHNVFIEKLYREDLFEEMLQEPDEIAKKRK  709

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
              R+ LR  QQAFK LDELPLEAE+VERGY L    T LP I GLPTSS+ +T SS D Y
Sbjct  710  HCRELLRAYQQAFKDLDELPLEAETVERGYGLPETATDLPIIRGLPTSSLSSTGSSGDYY  769

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSN  384
             ASPKN  S +SSHSGELQSP ++   DSN
Sbjct  770  EASPKNTESIRSSHSGELQSP-WHENMDSN  798


 Score = 54.3 bits (129),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
             S S+IHLREPPSVLRP E+++D ET+EITVTK + +
Sbjct  614  QSFSLIHLREPPSVLRPLESNSDTETVEITVTKLLVK  650



>ref|XP_011658829.1| PREDICTED: dynamin-related protein 3A isoform X2 [Cucumis sativus]
 gb|KGN43774.1| hypothetical protein Csa_7G066310 [Cucumis sativus]
Length=796

 Score =   191 bits (485),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+D +PKAIM+FLV H KR+LHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  660  RSYYDIVRKNIQDYIPKAIMNFLVVHAKRDLHNVFIKKLYRENLFEEMLQEPDEVAMKRK  719

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TLRVLQQAF+TLDELPLE E+VE+GYS+  DPTGLP+IHGLP
Sbjct  720  RTRETLRVLQQAFRTLDELPLETETVEKGYSVGADPTGLPRIHGLP  765


 Score = 50.8 bits (120),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S +MIHLREPP+VLRP+E+ T+QE +EI +TK +
Sbjct  624  QSFAMIHLREPPAVLRPSESLTEQEAMEIAITKLL  658



>ref|XP_008455129.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Cucumis 
melo]
Length=795

 Score =   190 bits (482),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+D VPKAIM+FLV H KR+LHNVFIKKLYR+NLFEEMLQEPDEVA KRK
Sbjct  659  RSYYDIVRKNIQDYVPKAIMNFLVVHAKRDLHNVFIKKLYRENLFEEMLQEPDEVAMKRK  718

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TLRVLQQAF+TLDELPLE E+VE+GY++  DPTGLP+IHGLP
Sbjct  719  RTRETLRVLQQAFRTLDELPLETETVEKGYNVGADPTGLPRIHGLP  764


 Score = 51.6 bits (122),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S SMIHLREPP+VLRP+E  T+QE +EI +TK +
Sbjct  623  QSFSMIHLREPPAVLRPSENLTEQEAMEIAITKLL  657



>ref|NP_001045220.1| Os01g0920400 [Oryza sativa Japonica Group]
 dbj|BAD88362.1| putative dynamin like protein 2a [Oryza sativa Japonica Group]
 dbj|BAD87638.1| putative dynamin like protein 2a [Oryza sativa Japonica Group]
 dbj|BAF07134.1| Os01g0920400 [Oryza sativa Japonica Group]
Length=818

 Score =   191 bits (484),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 9/153 (6%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED VPKAIMHFLVNHTKRELHN  I KLYRD+LF +ML+EPDE+  KR+
Sbjct  674  KSYYNIVRKNVEDFVPKAIMHFLVNHTKRELHNYLITKLYRDDLFADMLREPDEITIKRR  733

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            + RDTL+VLQQA+KTLDE+PLEA++VERGYSL  D TGLP+ HGL      ++     S 
Sbjct  734  QIRDTLKVLQQAYKTLDEIPLEADTVERGYSLDADATGLPRAHGL-----SSSFQDGSSP  788

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
             ++PK PRSRKSSHSGE Q P      D++GNG
Sbjct  789  YSTPKQPRSRKSSHSGE-QLPF---NPDASGNG  817


 Score = 47.0 bits (110),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS+S I LREPP VL+P+E+ ++QE +EI +TK
Sbjct  638  HSLSTIQLREPPVVLKPSESQSEQEALEIAITK  670



>gb|EEE55903.1| hypothetical protein OsJ_04571 [Oryza sativa Japonica Group]
Length=818

 Score =   191 bits (484),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 9/153 (6%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED VPKAIMHFLVNHTKRELHN  I KLYRD+LF +ML+EPDE+  KR+
Sbjct  674  KSYYNIVRKNVEDFVPKAIMHFLVNHTKRELHNYLITKLYRDDLFADMLREPDEITIKRR  733

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            + RDTL+VLQQA+KTLDE+PLEA++VERGYSL  D TGLP+ HGL      ++     S 
Sbjct  734  QIRDTLKVLQQAYKTLDEIPLEADTVERGYSLDADATGLPRAHGL-----SSSFQDGSSP  788

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
             ++PK PRSRKSSHSGE Q P      D++GNG
Sbjct  789  YSTPKQPRSRKSSHSGE-QLPF---NPDASGNG  817


 Score = 47.0 bits (110),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS+S I LREPP VL+P+E+ ++QE +EI +TK
Sbjct  638  HSLSTIQLREPPVVLKPSESQSEQEALEIAITK  670



>gb|EPS68205.1| hypothetical protein M569_06566, partial [Genlisea aurea]
Length=726

 Score =   179 bits (454),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 118/165 (72%), Gaps = 25/165 (15%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR-------------------  711
            RSYYDIVRKNIED VPKAIMHFLVNHTKRELHNVFIKKLYR                   
Sbjct  563  RSYYDIVRKNIEDCVPKAIMHFLVNHTKRELHNVFIKKLYRHVVCFSSSESISSKTFLLL  622

Query  710  ----DNLFEEMLQEPDEVATKRKRTRDTLRVLQQAFKTLDELPLEAESVERGYS-LSPDP  546
                DNLFEEMLQEPDEV+ KRKR R+ LRVLQQA++TLDELPLEAE+ ERGY   S D 
Sbjct  623  LLFRDNLFEEMLQEPDEVSIKRKRAREMLRVLQQAWRTLDELPLEAEAAERGYDRTSTDT  682

Query  545  TGLPKIHGLPtssmyttsssvdsytaSPKNPRSRKSSHSGELQSP  411
            TGLPKIHGLP SS+Y +SSS +  + S  +P+  KS  SGEL  P
Sbjct  683  TGLPKIHGLPISSLYNSSSSSNDSSYS-ASPKPVKSRKSGELNKP  726


 Score = 58.2 bits (139),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            SMIHLREPPSVLRP+ETH+DQE IEI VTK +
Sbjct  530  SMIHLREPPSVLRPSETHSDQEAIEIAVTKLL  561



>ref|XP_006645242.1| PREDICTED: dynamin-related protein 3A-like [Oryza brachyantha]
Length=819

 Score =   189 bits (481),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 9/153 (6%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED VPKAIMHFLVNHTKRELHN  I KLYRD+LF +ML+EP+E+  KR+
Sbjct  675  KSYYNIVRKNVEDFVPKAIMHFLVNHTKRELHNYLITKLYRDDLFADMLREPEEITIKRR  734

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            + RDTL+VLQQA+KTLDE+PLEA++VERGYSL  D TGLP+ HGL      ++     S 
Sbjct  735  QIRDTLKVLQQAYKTLDEIPLEADTVERGYSLDSDATGLPRAHGL-----SSSFHDGSSP  789

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
             ++PK PRSRKSSHSGE Q P      D++GNG
Sbjct  790  YSTPKQPRSRKSSHSGE-QPPF---NSDASGNG  818


 Score = 45.8 bits (107),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H++S I LREPP VL+P+E+ ++QE +EI +TK
Sbjct  639  HALSTIQLREPPVVLKPSESQSEQEALEIAITK  671



>gb|EMS54655.1| Dynamin-related protein 3A [Triticum urartu]
Length=757

 Score =   183 bits (465),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 16/153 (10%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED VPKAIMHFLVNHTKRELHN  I  LYR+ LF ++L+EPDE+ TKR+
Sbjct  620  QSYYNIVRKNVEDFVPKAIMHFLVNHTKRELHNFLITTLYREELFGDILREPDEITTKRR  679

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            + RDTL+VLQQA+KTLDE+PLEAE+VERGYSL  D TGLP++HG+             S 
Sbjct  680  QIRDTLKVLQQAYKTLDEIPLEAETVERGYSLDSDATGLPRVHGV---------YDGSSP  730

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
             ++PK  R RKSSHSGE Q P        +GNG
Sbjct  731  YSTPKQTRPRKSSHSGEQQQPF-------SGNG  756


 Score = 47.0 bits (110),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS S I L+EPP VL+P+E+H++QE +EI +TK
Sbjct  584  HSFSSIQLKEPPLVLKPSESHSEQEDLEIAITK  616



>emb|CDM85737.1| unnamed protein product [Triticum aestivum]
Length=813

 Score =   183 bits (464),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 16/153 (10%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED VPKAIMHFLVNHTKRELHN  I  LYR+ LF ++L+EPDE+ TKR+
Sbjct  676  QSYYNIVRKNVEDFVPKAIMHFLVNHTKRELHNFLITTLYREELFGDILREPDEITTKRR  735

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            + RDTL+VLQQA+KTLDE+PLEAE+VERGYSL  D TGLP++HG+             S 
Sbjct  736  QIRDTLKVLQQAYKTLDEIPLEAETVERGYSLDSDATGLPRVHGV---------YDGSSP  786

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
             ++PK  R RKSSHSGE Q P        +GNG
Sbjct  787  YSTPKQTRPRKSSHSGEQQQPF-------SGNG  812


 Score = 46.6 bits (109),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS S I L+EPP VL+P+E+H++QE +EI +TK + +
Sbjct  640  HSFSSIQLKEPPLVLKPSESHSEQEDLEIAITKLLLQ  676



>dbj|BAJ99253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score =   183 bits (464),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 16/153 (10%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED VPKAIMHFLVNHTKRELHN  I  LYR+ LF ++L+EPDE+ TKR+
Sbjct  677  QSYYNIVRKNVEDFVPKAIMHFLVNHTKRELHNFLITTLYREELFGDILREPDEITTKRR  736

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            + RDTL+VLQQA+KTLDE+PLEAE+VERGYSL  D TGLP++HG+             S 
Sbjct  737  QIRDTLKVLQQAYKTLDEIPLEAETVERGYSLDSDATGLPRVHGV---------YDGSSP  787

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
             ++PK  R RKSSHSGE Q P        +GNG
Sbjct  788  YSTPKQTRPRKSSHSGEQQQPF-------SGNG  813


 Score = 46.6 bits (109),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS S I L+EPP VL+P+E H++QE +EI +TK + +
Sbjct  641  HSFSSIQLKEPPLVLKPSENHSEQEDLEIAITKLLLQ  677



>ref|XP_009381334.1| PREDICTED: LOW QUALITY PROTEIN: dynamin-related protein 3B-like 
[Musa acuminata subsp. malaccensis]
Length=835

 Score =   182 bits (461),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 121/163 (74%), Gaps = 9/163 (6%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI +LY D  F+EML+EPD++  KRK
Sbjct  678  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIMQLYSDGKFDEMLKEPDDITAKRK  737

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R  +TLRVLQQA KTLD +PLEAE+VE+GYSL    TG PKI+ LP     T +    SY
Sbjct  738  RLSETLRVLQQAHKTLDNIPLEAENVEKGYSLE-SXTGPPKINELP-PFYATANDLGSSY  795

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPT  345
              SP+N RSR+S+HSGE  SP+Y    +S  NG    LG YP+
Sbjct  796  AXSPRNTRSRRSAHSGEQPSPLYC---NSVANG----LGSYPS  831


 Score = 47.8 bits (112),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS SMI LREPP VL+P+E  T++E +EI +TK
Sbjct  642  HSFSMIQLREPPIVLKPSENQTEREALEIAITK  674



>gb|KHN34016.1| Dynamin-related protein 3A [Glycine soja]
Length=819

 Score =   181 bits (460),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKN+ED VPKAIM+FLV+  K ELHNVFIKKLYRDNLFEEML+EPDE+A KRK
Sbjct  664  RSYYDIVRKNVEDLVPKAIMYFLVDKAKGELHNVFIKKLYRDNLFEEMLREPDEIALKRK  723

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELPLEA++VERGY L P+ TGLPKI+GLPTSSMY+ SSS D Y
Sbjct  724  RCRELLRAYQQAFKDLEELPLEADTVERGYGL-PEKTGLPKINGLPTSSMYSASSSGDYY  782

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGR  372
             A  K P+S+KSSHSGELQSP+ +   DSNG+GR
Sbjct  783  AAFSKYPKSKKSSHSGELQSPL-HADADSNGSGR  815


 Score = 47.4 bits (111),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             S SMIHLREPP VLR +E++++ E I+ITVTK +
Sbjct  628  QSFSMIHLREPPPVLRSSESYSETEAIDITVTKLL  662



>ref|XP_003522885.1| PREDICTED: dynamin-related protein 3A-like [Glycine max]
Length=817

 Score =   181 bits (460),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKN+ED VPKAIM+FLV+  K ELHNVFIKKLYRDNLFEEML+EPDE+A KRK
Sbjct  662  RSYYDIVRKNVEDLVPKAIMYFLVDKAKGELHNVFIKKLYRDNLFEEMLREPDEIALKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            R R+ LR  QQAFK L+ELPLEA++VERGY L P+ TGLPKI+GLPTSSMY+ SSS D Y
Sbjct  722  RCRELLRAYQQAFKDLEELPLEADTVERGYGL-PEKTGLPKINGLPTSSMYSASSSGDYY  780

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGR  372
             A  K P+S+KSSHSGELQSP+ +   DSNG+GR
Sbjct  781  AAFSKYPKSKKSSHSGELQSPL-HADADSNGSGR  813


 Score = 47.4 bits (111),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             S SMIHLREPP VLR +E++++ E I+ITVTK
Sbjct  626  QSFSMIHLREPPPVLRSSESYSETEAIDITVTK  658



>ref|XP_003532597.1| PREDICTED: dynamin-related protein 3A-like [Glycine max]
Length=814

 Score =   179 bits (453),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 128/155 (83%), Gaps = 6/155 (4%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFI+KLYR++LFEEMLQEP+EVA KRK
Sbjct  652  KSYYDIVRKNVEDLVPKAIMHFLVNNTKRELHNVFIEKLYREDLFEEMLQEPEEVAKKRK  711

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
              R+ LR  QQAFK L+ELPLEAE+VERGYSL    TGLPKI GLPTSSMY+TSSS D Y
Sbjct  712  NCRELLRAYQQAFKDLNELPLEAETVERGYSLPEITTGLPKIRGLPTSSMYSTSSSGDYY  771

Query  473  taSP--KNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
             ASP     +++KSSHSGELQSP      DSNGNG
Sbjct  772  EASPKNTKSKNKKSSHSGELQSPFQ----DSNGNG  802


 Score = 48.9 bits (115),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             S S IHLREPPSVLRP E++++ E +EITVTK
Sbjct  616  QSFSTIHLREPPSVLRPLESNSETEAVEITVTK  648



>gb|KHN46250.1| Dynamin-related protein 3A [Glycine soja]
Length=815

 Score =   179 bits (453),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 128/155 (83%), Gaps = 6/155 (4%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFI+KLYR++LFEEMLQEP+EVA KRK
Sbjct  653  KSYYDIVRKNVEDLVPKAIMHFLVNNTKRELHNVFIEKLYREDLFEEMLQEPEEVAKKRK  712

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
              R+ LR  QQAFK L+ELPLEAE+VERGYSL    TGLPKI GLPTSSMY+TSSS D Y
Sbjct  713  NCRELLRAYQQAFKDLNELPLEAETVERGYSLPEITTGLPKIRGLPTSSMYSTSSSGDYY  772

Query  473  taSP--KNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
             ASP     +++KSSHSGELQSP      DSNGNG
Sbjct  773  EASPKNTKSKNKKSSHSGELQSPFQ----DSNGNG  803


 Score = 48.9 bits (115),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             S S IHLREPPSVLRP E++++ E +EITVTK
Sbjct  617  QSFSTIHLREPPSVLRPLESNSETEAVEITVTK  649



>ref|XP_003564945.1| PREDICTED: dynamin-related protein 3B-like [Brachypodium distachyon]
Length=818

 Score =   184 bits (467),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 120/153 (78%), Gaps = 6/153 (4%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED VPKAIMHFLVNHTKRELHN  I  LYR+ LF E+L+EPDE+ TKRK
Sbjct  671  QSYYNIVRKNVEDFVPKAIMHFLVNHTKRELHNFLITTLYREELFGEILREPDEITTKRK  730

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPtssmyttsssvdsy  474
            + RDTL+VLQQA+KTLDE+PLEAE+VERGYSL  D TGLP++HG+  SS +  ++   S 
Sbjct  731  QIRDTLKVLQQAYKTLDEIPLEAETVERGYSLDSDATGLPRVHGV--SSSFHGTNDGSSP  788

Query  473  taSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
             ++PK  RSRKSSHSGE Q P       ++GNG
Sbjct  789  YSTPKQTRSRKSSHSGE-QPPF---NPSASGNG  817


 Score = 43.5 bits (101),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            +SIS I L+EPP VL+P+E  ++QE +EI +TK + +
Sbjct  635  NSISSIQLKEPPLVLKPSENQSEQEALEIAITKLLLQ  671



>gb|EYU18412.1| hypothetical protein MIMGU_mgv1a022072mg [Erythranthe guttata]
Length=774

 Score =   171 bits (432),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SYYDIVRK IEDSVPKAIMHFLVN TKRELHNVFI+KLYRDNL EE+LQEP+E++ KRKR
Sbjct  666  SYYDIVRKKIEDSVPKAIMHFLVNRTKRELHNVFIQKLYRDNLLEEILQEPEEISIKRKR  725

Query  650  TRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            T +TLR+L++A +TLDE P+E  +VE GY LS DPTGLP+IH LP
Sbjct  726  TTNTLRILEEALRTLDEFPVEVGTVEGGYRLSTDPTGLPEIHRLP  770


 Score = 53.1 bits (126),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            +MI LR+PPSVL+P+ETH+DQE IEITVTK
Sbjct  632  NMIRLRQPPSVLKPSETHSDQEAIEITVTK  661



>dbj|BAB85644.1| dynamin like protein 2a [Arabidopsis thaliana]
Length=808

 Score =   167 bits (423),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  678  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  737

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYS  561
            RT++TL VLQQA++TLDELPLEA+SV  G S
Sbjct  738  RTQETLHVLQQAYRTLDELPLEADSVSAGMS  768


 Score = 55.1 bits (131),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H++SMI+L+EPP+VLRPTETH++QE +EI +TK
Sbjct  642  HNLSMIYLKEPPAVLRPTETHSEQEAVEIQITK  674



>gb|AAC61784.1| similar to dynamin-like protein encoded by GenBank Accession 
Number X99669 [Arabidopsis thaliana]
Length=809

 Score =   167 bits (423),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  679  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  738

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYS  561
            RT++TL VLQQA++TLDELPLEA+SV  G S
Sbjct  739  RTQETLHVLQQAYRTLDELPLEADSVSAGMS  769


 Score = 55.1 bits (131),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H++SMI+L+EPP+VLRPTETH++QE +EI +TK
Sbjct  643  HNLSMIYLKEPPAVLRPTETHSEQEAVEIQITK  675



>ref|NP_001190906.1| dynamin-related protein 3A [Arabidopsis thaliana]
 gb|AEE86261.1| dynamin-related protein 3A [Arabidopsis thaliana]
Length=809

 Score =   167 bits (423),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  679  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  738

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYS  561
            RT++TL VLQQA++TLDELPLEA+SV  G S
Sbjct  739  RTQETLHVLQQAYRTLDELPLEADSVSAGMS  769


 Score = 55.1 bits (131),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H++SMI+L+EPP+VLRPTETH++QE +EI +TK
Sbjct  643  HNLSMIYLKEPPAVLRPTETHSEQEAVEIQITK  675



>ref|NP_567931.1| dynamin-related protein 3A [Arabidopsis thaliana]
 sp|Q8S944.2|DRP3A_ARATH RecName: Full=Dynamin-related protein 3A; AltName: Full=Dynamin-like 
protein 2; AltName: Full=Dynamin-like protein 2a [Arabidopsis 
thaliana]
 emb|CAA20578.1| Arabidopsis dynamin-like protein ADL2 [Arabidopsis thaliana]
 emb|CAB80082.1| Arabidopsis dynamin-like protein ADL2 [Arabidopsis thaliana]
 dbj|BAB85643.1| dynamin like protein 2a [Arabidopsis thaliana]
 gb|AEE86260.1| dynamin-related protein 3A [Arabidopsis thaliana]
Length=808

 Score =   167 bits (423),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  678  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  737

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYS  561
            RT++TL VLQQA++TLDELPLEA+SV  G S
Sbjct  738  RTQETLHVLQQAYRTLDELPLEADSVSAGMS  768


 Score = 55.1 bits (131),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H++SMI+L+EPP+VLRPTETH++QE +EI +TK
Sbjct  642  HNLSMIYLKEPPAVLRPTETHSEQEAVEIQITK  674



>ref|XP_009120554.1| PREDICTED: dynamin-related protein 3A isoform X1 [Brassica rapa]
Length=808

 Score =   169 bits (428),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  670  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  729

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TL +LQQA++TLDELP+EAESV  G +   D TG+ K   LP
Sbjct  730  RTRETLHILQQAYRTLDELPMEAESVCSGGT---DTTGVSKHLDLP  772


 Score = 52.0 bits (123),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI+L+EPP+VLRP+ETH++QE IEI +TK +
Sbjct  634  QNLSMIYLKEPPAVLRPSETHSEQEDIEIQITKLL  668



>ref|XP_009120625.1| PREDICTED: dynamin-related protein 3A isoform X2 [Brassica rapa]
Length=807

 Score =   169 bits (428),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  669  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  728

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TL +LQQA++TLDELP+EAESV  G +   D TG+ K   LP
Sbjct  729  RTRETLHILQQAYRTLDELPMEAESVCSGGT---DTTGVSKHLDLP  771


 Score = 52.0 bits (123),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI+L+EPP+VLRP+ETH++QE IEI +TK +
Sbjct  633  QNLSMIYLKEPPAVLRPSETHSEQEDIEIQITKLL  667



>gb|AID60088.1| dynamin-like protein 2 [Brassica napus]
Length=809

 Score =   169 bits (428),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  671  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  730

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TL +LQQA++TLDELP+EAESV  G +   D TG+ K   LP
Sbjct  731  RTRETLHILQQAYRTLDELPMEAESVCSGGT---DTTGVSKHLDLP  773


 Score = 52.0 bits (123),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI+L+EPP+VLRP+ETH++QE IEI +TK +
Sbjct  635  QNLSMIYLKEPPAVLRPSETHSEQEDIEIQITKLL  669



>emb|CDX75370.1| BnaA01g03320D [Brassica napus]
Length=840

 Score =   169 bits (428),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  702  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  761

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TL +LQQA++TLDELP+EAESV  G +   D TG+ K   LP
Sbjct  762  RTRETLHILQQAYRTLDELPMEAESVCSGGT---DTTGVSKHLDLP  804


 Score = 52.0 bits (123),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI+L+EPP+VLRP+ETH++QE IEI +TK +
Sbjct  666  QNLSMIYLKEPPAVLRPSETHSEQEDIEIQITKLL  700



>emb|CDX68994.1| BnaC01g04590D [Brassica napus]
Length=813

 Score =   169 bits (427),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  675  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  734

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RTR+TL +LQQA++TLDELP+EAESV  G +   D TG+ K   LP
Sbjct  735  RTRETLHILQQAYRTLDELPMEAESVCSGGT---DTTGVSKHLDLP  777


 Score = 52.0 bits (123),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI+L+EPP+VLRP+ETH++QE IEI +TK +
Sbjct  639  QNLSMIYLKEPPAVLRPSETHSEQEDIEIQITKLL  673



>gb|EEC72053.1| hypothetical protein OsI_04962 [Oryza sativa Indica Group]
Length=857

 Score =   173 bits (439),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED VPKAIMHFLVNHTKRELHN  I KLYRD+LF +ML+EPDE+  KR+
Sbjct  676  KSYYNIVRKNVEDFVPKAIMHFLVNHTKRELHNYLITKLYRDDLFADMLREPDEITIKRR  735

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            + RDTL+VLQQA+KTLDE+PLEA++VERGYSL  D TGLP+ HGL
Sbjct  736  QIRDTLKVLQQAYKTLDEIPLEADTVERGYSLDADATGLPRAHGL  780


 Score = 47.0 bits (110),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS+S I LREPP VL+P+E+ ++QE +EI +TK
Sbjct  640  HSLSTIQLREPPVVLKPSESQSEQEALEIAITK  672



>ref|XP_002869201.1| hypothetical protein ARALYDRAFT_491315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45460.1| hypothetical protein ARALYDRAFT_491315 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   166 bits (419),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  678  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  737

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYS  561
            RT++TL VLQQA++TLDELPLEA+SV  G S
Sbjct  738  RTQETLHVLQQAYRTLDELPLEADSVSAGMS  768


 Score = 53.9 bits (128),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H++SMI+L+EPP+VLRP+ETH++QE +EI +TK
Sbjct  642  HNLSMIYLKEPPAVLRPSETHSEQEAVEIQITK  674



>ref|XP_006412330.1| hypothetical protein EUTSA_v10024438mg [Eutrema salsugineum]
 gb|ESQ53783.1| hypothetical protein EUTSA_v10024438mg [Eutrema salsugineum]
Length=813

 Score =   166 bits (420),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  676  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  735

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RT++TL +LQQA++TLDELPLEAESV   Y+   D T + K   LP
Sbjct  736  RTQETLHILQQAYRTLDELPLEAESV---YNRGADTTSVSKHLDLP  778


 Score = 53.5 bits (127),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++SMI+L+EPP+VLRP+ETH++QET+EI +TK +
Sbjct  640  QNLSMIYLKEPPAVLRPSETHSEQETVEIKITKLL  674



>ref|XP_006845411.1| PREDICTED: dynamin-related protein 3A [Amborella trichopoda]
 gb|ERN07086.1| hypothetical protein AMTR_s00019p00077820 [Amborella trichopoda]
Length=836

 Score =   172 bits (435),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 119/167 (71%), Gaps = 12/167 (7%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D+VPKAIMHFLVNH KRELHNVFI+KLYR+NLFEE+LQE +EVA+KRK
Sbjct  681  KSYYDIVRKNVQDAVPKAIMHFLVNHVKRELHNVFIRKLYRENLFEELLQEYEEVASKRK  740

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHG-LPtssmyttsssvds  477
            R R+ L VLQQA  TL+ LPLEAE V R    S D TGLPK    LP+ S       V S
Sbjct  741  RCRELLHVLQQAVWTLEVLPLEAEMVTR--DASTDATGLPKGQDLLPSFSSSQNGDFVWS  798

Query  476  ytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTIDA  336
             +AS +NPRS+KSS+SGEL SP          N  NS+   YPTI+ 
Sbjct  799  SSASSRNPRSKKSSYSGELFSPH---------NPINSIPARYPTIEV  836


 Score = 47.8 bits (112),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS S+I LREPP+VLRP+E  T+QE IEI VTK +
Sbjct  646  HSFSLIQLREPPAVLRPSEA-TEQEAIEIEVTKML  679



>gb|KFK29987.1| hypothetical protein AALP_AA7G203100 [Arabis alpina]
Length=813

 Score =   168 bits (425),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  676  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRK  735

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RT++TL +LQQA++TLDELPLEAESV   Y+   D TG+ K   LP
Sbjct  736  RTQETLHILQQAYRTLDELPLEAESV---YNHGTDTTGVSKHLDLP  778


 Score = 49.7 bits (117),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -2

Query  939  SISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            ++SMI+L+EPP+VLRP+ET+++QE +EI +TK +
Sbjct  641  NLSMIYLKEPPAVLRPSETYSEQEVVEIQITKLL  674



>ref|XP_010437736.1| PREDICTED: dynamin-related protein 3A isoform X1 [Camelina sativa]
 ref|XP_010437737.1| PREDICTED: dynamin-related protein 3A isoform X2 [Camelina sativa]
Length=804

 Score =   163 bits (413),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+E+A KRK
Sbjct  674  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEIAGKRK  733

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYS  561
            RT++TL VLQQA++TLDELPLEA+SV  G S
Sbjct  734  RTQETLHVLQQAYRTLDELPLEADSVSAGMS  764


 Score = 53.9 bits (128),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H++SMI+L+EPP+VLRP+ETH++QE +EI +TK
Sbjct  638  HNLSMIYLKEPPAVLRPSETHSEQEAVEIQITK  670



>ref|XP_010447213.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Camelina 
sativa]
Length=804

 Score =   163 bits (413),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+E+A KRK
Sbjct  673  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEIAGKRK  732

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYS  561
            RT++TL VLQQA++TLDELPLEA+SV  G S
Sbjct  733  RTQETLHVLQQAYRTLDELPLEADSVSAGMS  763


 Score = 53.9 bits (128),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H++SMI+L+EPP+VLRP+ETH++QE +EI +TK
Sbjct  637  HNLSMIYLKEPPAVLRPSETHSEQEAVEIQITK  669



>ref|XP_010447212.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Camelina 
sativa]
Length=805

 Score =   163 bits (413),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+E+A KRK
Sbjct  674  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEIAGKRK  733

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYS  561
            RT++TL VLQQA++TLDELPLEA+SV  G S
Sbjct  734  RTQETLHVLQQAYRTLDELPLEADSVSAGMS  764


 Score = 53.9 bits (128),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H++SMI+L+EPP+VLRP+ETH++QE +EI +TK
Sbjct  638  HNLSMIYLKEPPAVLRPSETHSEQEAVEIQITK  670



>emb|CDY46101.1| BnaA03g52670D [Brassica napus]
Length=803

 Score =   164 bits (415),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIED VPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  665  KSYYDIVRKNIEDLVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAGKRK  724

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RT++TL +LQQA++TLDELPLEA SV  G +   D TG+ K   LP
Sbjct  725  RTQETLHILQQAYRTLDELPLEAGSVSNGGT---DTTGVSKYLDLP  767


 Score = 51.6 bits (122),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            SMI+L+EPP+VLRP+ETHT+QE IEI +TK +
Sbjct  632  SMIYLKEPPAVLRPSETHTEQEDIEIQITKLL  663



>emb|CDX72418.1| BnaC07g44400D [Brassica napus]
Length=831

 Score =   164 bits (415),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIED VPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  693  KSYYDIVRKNIEDLVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAGKRK  752

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RT++TL +LQQA++TLDELPLEA SV  G +   D TG+ K   LP
Sbjct  753  RTQETLHILQQAYRTLDELPLEAGSVSNGGT---DTTGVSKYLDLP  795


 Score = 51.6 bits (122),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            SMI+L+EPP+VLRP+ETHT+QE IEI +TK +
Sbjct  660  SMIYLKEPPAVLRPSETHTEQEDIEIQITKLL  691



>ref|XP_009138202.1| PREDICTED: dynamin-related protein 3A-like [Brassica rapa]
Length=807

 Score =   164 bits (415),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIED VPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRK
Sbjct  669  KSYYDIVRKNIEDLVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAGKRK  728

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RT++TL +LQQA++TLDELPLEA SV  G +   D TG+ K   LP
Sbjct  729  RTQETLHILQQAYRTLDELPLEAGSVSNGGT---DTTGVSKYLDLP  771


 Score = 51.2 bits (121),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            SMI+L+EPP+VLRP+ETHT+QE IEI +TK
Sbjct  636  SMIYLKEPPAVLRPSETHTEQEDIEIQITK  665



>ref|XP_006283135.1| hypothetical protein CARUB_v10004162mg [Capsella rubella]
 gb|EOA16033.1| hypothetical protein CARUB_v10004162mg [Capsella rubella]
Length=806

 Score =   163 bits (413),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+E+A KRK
Sbjct  676  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEIAGKRK  735

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYS  561
            RT++TL VLQQA++TLDELPLEA+SV  G S
Sbjct  736  RTQETLHVLQQAYRTLDELPLEADSVSAGMS  766


 Score = 51.6 bits (122),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMI+L+EPP+VLRP+ETH++QE +EI +TK
Sbjct  640  QNLSMIYLKEPPAVLRPSETHSEQEAVEIQITK  672



>ref|XP_009108778.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Brassica 
rapa]
Length=817

 Score =   162 bits (411),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQE DE+A KRK
Sbjct  679  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQETDEIAVKRK  738

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RT+ TL VLQQA++TLDELPLEAESV   ++   D TG+ K   LP
Sbjct  739  RTQATLHVLQQAYRTLDELPLEAESV---HNHGTDTTGVSKYLDLP  781


 Score = 50.1 bits (118),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMI+L+EPP+VLRP+ETH++Q+ +EI +TK
Sbjct  643  QNLSMIYLKEPPTVLRPSETHSEQQAVEIQITK  675



>ref|XP_009108779.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Brassica 
rapa]
Length=816

 Score =   162 bits (411),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFI+KLYR+NLFEEMLQE DE+A KRK
Sbjct  678  KSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIRKLYRENLFEEMLQETDEIAVKRK  737

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RT+ TL VLQQA++TLDELPLEAESV   ++   D TG+ K   LP
Sbjct  738  RTQATLHVLQQAYRTLDELPLEAESV---HNHGTDTTGVSKYLDLP  780


 Score = 50.1 bits (118),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMI+L+EPP+VLRP+ETH++Q+ +EI +TK
Sbjct  642  QNLSMIYLKEPPTVLRPSETHSEQQAVEIQITK  674



>ref|XP_010680388.1| PREDICTED: dynamin-related protein 3B-like [Beta vulgaris subsp. 
vulgaris]
Length=785

 Score =   168 bits (425),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SY+DIVRK IEDSVPKAIMHFLVNHTKR+LHNV I+KLYR+ LFEEMLQEP EVA KR+ 
Sbjct  672  SYFDIVRKIIEDSVPKAIMHFLVNHTKRQLHNVLIQKLYREKLFEEMLQEPGEVAVKREH  731

Query  650  TRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
             R+TL+VL QAF+TLDELPLEAE++ERGY L  D  GLP+  GL
Sbjct  732  ARETLKVLHQAFQTLDELPLEAETIERGYGLGTDSIGLPRTRGL  775


 Score = 43.9 bits (102),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ S+IHLREPP++LR +ET ++QE  EI  TK
Sbjct  635  HTSSIIHLREPPAILRSSETFSEQEITEIAATK  667



>ref|XP_008673232.1| PREDICTED: uncharacterized protein LOC100383931 isoform X1 [Zea 
mays]
 tpg|DAA56114.1| TPA: hypothetical protein ZEAMMB73_205529 [Zea mays]
Length=817

 Score =   167 bits (423),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED +PKA+MHFLVNHTKR LHN  I KLYRD+L E++L+EPDE+  KRK
Sbjct  669  KSYYNIVRKNVEDLIPKAVMHFLVNHTKRALHNYLITKLYRDDLLEDLLKEPDEITIKRK  728

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVER-GYSLSPDPTGLPKIHGLPtssmyttsssvds  477
            + R+ L+VLQQA+KTLDE+PL+AE+VER GYSL  D  GLP+ HGL  SS     +   S
Sbjct  729  QIRENLKVLQQAYKTLDEIPLDAEAVERGGYSLDSDAIGLPRAHGL--SSSLHGFNDGSS  786

Query  476  ytaSPKNPRSRKSSHSGE  423
              ++PK  RSR+S+HSGE
Sbjct  787  PYSTPKQSRSRRSNHSGE  804


 Score = 44.7 bits (104),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS S I LREPP VL+P+E  ++QE +EI +TK +
Sbjct  633  HSFSTIQLREPPVVLKPSEHQSEQEALEIAITKLL  667



>tpg|DAA56115.1| TPA: hypothetical protein ZEAMMB73_205529 [Zea mays]
Length=506

 Score =   167 bits (423),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED +PKA+MHFLVNHTKR LHN  I KLYRD+L E++L+EPDE+  KRK
Sbjct  358  KSYYNIVRKNVEDLIPKAVMHFLVNHTKRALHNYLITKLYRDDLLEDLLKEPDEITIKRK  417

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVER-GYSLSPDPTGLPKIHGLPtssmyttsssvds  477
            + R+ L+VLQQA+KTLDE+PL+AE+VER GYSL  D  GLP+ HGL  SS     +   S
Sbjct  418  QIRENLKVLQQAYKTLDEIPLDAEAVERGGYSLDSDAIGLPRAHGL--SSSLHGFNDGSS  475

Query  476  ytaSPKNPRSRKSSHSGE  423
              ++PK  RSR+S+HSGE
Sbjct  476  PYSTPKQSRSRRSNHSGE  493


 Score = 44.7 bits (104),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS S I LREPP VL+P+E  ++QE +EI +TK +
Sbjct  322  HSFSTIQLREPPVVLKPSEHQSEQEALEIAITKLL  356



>ref|XP_002458996.1| hypothetical protein SORBIDRAFT_03g044010 [Sorghum bicolor]
 gb|EES04116.1| hypothetical protein SORBIDRAFT_03g044010 [Sorghum bicolor]
Length=819

 Score =   165 bits (417),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 4/139 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED +PKAIMHFLVNHTKR LHN  I KLYRD+L E++L+EPDEV  KRK
Sbjct  670  KSYYNIVRKNVEDFIPKAIMHFLVNHTKRALHNYLITKLYRDDLLEDLLKEPDEVTIKRK  729

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERG--YSLSPDPTGLPKIHGLPtssmyttsssvd  480
            + R+ L+VLQQA+KTLDE+PL+AE+VERG   SL  D  GLP+ HGL  SS     +   
Sbjct  730  QIRENLKVLQQAYKTLDEIPLDAEAVERGGYSSLDSDAIGLPRAHGL--SSSLHGFNDGS  787

Query  479  sytaSPKNPRSRKSSHSGE  423
            S  ++PK  RSR+S+HSGE
Sbjct  788  SPYSTPKQSRSRRSNHSGE  806


 Score = 45.8 bits (107),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS+S I LREPP VL+P E  +DQE +EI +TK +
Sbjct  634  HSLSTIQLREPPVVLKPLEHQSDQEVLEIAITKLL  668



>ref|XP_004971078.1| PREDICTED: dynamin-related protein 3A-like [Setaria italica]
Length=823

 Score =   164 bits (416),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED +PKAIMHFLVNHTKR LHN  I KLYR++L E++L+EPDE+  KRK
Sbjct  675  KSYYNIVRKNVEDFIPKAIMHFLVNHTKRALHNYLITKLYREDLLEDLLKEPDEITIKRK  734

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVER-GYSLSPDPTGLPKIHGLPtssmyttsssvds  477
            + R+ L+VLQQA+KTLDE+PL+AE+VER G+SL  D  GLP+ HGL  SS     +   S
Sbjct  735  QIRENLKVLQQAYKTLDEIPLDAEAVERGGFSLESDVIGLPRAHGL--SSSLHGFNDGSS  792

Query  476  ytaSPKNPRSRKSSHSGE  423
              ++PK  RSR+S+HSGE
Sbjct  793  PYSTPKQSRSRRSNHSGE  810


 Score = 46.2 bits (108),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS S I LREPP+VL+P+E  ++QE +EI +TK
Sbjct  639  HSFSTIQLREPPAVLKPSEHQSEQEALEIAITK  671



>ref|XP_008654834.1| PREDICTED: uncharacterized protein LOC100279900 isoform X1 [Zea 
mays]
 gb|AFW84147.1| hypothetical protein ZEAMMB73_720282 [Zea mays]
Length=821

 Score =   165 bits (418),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 107/139 (77%), Gaps = 4/139 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED +PKAIMHFLVNHTKR LHN  I KLYRD+L E++L+EPDE+  KRK
Sbjct  672  KSYYNIVRKNVEDFIPKAIMHFLVNHTKRALHNYLITKLYRDDLLEDLLKEPDELTIKRK  731

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVER--GYSLSPDPTGLPKIHGLPtssmyttsssvd  480
            + R+ L+VLQQA+KTLDE+PL+AE+VER  GYSL  D  GLP+ HGL  SS     +   
Sbjct  732  QIRENLKVLQQAYKTLDEIPLDAEAVERGGGYSLDSDAIGLPRAHGL--SSSLHGFNDGS  789

Query  479  sytaSPKNPRSRKSSHSGE  423
            S  ++PK  RSR+ +HSGE
Sbjct  790  SSYSTPKQSRSRRPNHSGE  808


 Score = 44.7 bits (104),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS S I LREPP VL+P+E  ++QE +EI +TK
Sbjct  636  HSFSTIQLREPPVVLKPSEHQSEQEALEIAITK  668



>gb|AFW84149.1| hypothetical protein ZEAMMB73_720282 [Zea mays]
Length=458

 Score =   165 bits (418),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 114/155 (74%), Gaps = 8/155 (5%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED +PKAIMHFLVNHTKR LHN  I KLYRD+L E++L+EPDE+  KRK
Sbjct  309  KSYYNIVRKNVEDFIPKAIMHFLVNHTKRALHNYLITKLYRDDLLEDLLKEPDELTIKRK  368

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVER--GYSLSPDPTGLPKIHGLPtssmyttsssvd  480
            + R+ L+VLQQA+KTLDE+PL+AE+VER  GYSL  D  GLP+ HGL  SS     +   
Sbjct  369  QIRENLKVLQQAYKTLDEIPLDAEAVERGGGYSLDSDAIGLPRAHGL--SSSLHGFNDGS  426

Query  479  sytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNG  375
            S  ++PK  RSR+ +HSGE Q P       ++GNG
Sbjct  427  SSYSTPKQSRSRRPNHSGE-QLPF---NPATSGNG  457


 Score = 44.3 bits (103),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS S I LREPP VL+P+E  ++QE +EI +TK
Sbjct  273  HSFSTIQLREPPVVLKPSEHQSEQEALEIAITK  305



>ref|NP_001146324.1| uncharacterized protein LOC100279900 [Zea mays]
 gb|ACL53694.1| unknown [Zea mays]
Length=355

 Score =   164 bits (416),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 107/139 (77%), Gaps = 4/139 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED +PKAIMHFLVNHTKR LHN  I KLYRD+L E++L+EPDE+  KRK
Sbjct  206  KSYYNIVRKNVEDFIPKAIMHFLVNHTKRALHNYLITKLYRDDLLEDLLKEPDELTIKRK  265

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVER--GYSLSPDPTGLPKIHGLPtssmyttsssvd  480
            + R+ L+VLQQA+KTLDE+PL+AE+VER  GYSL  D  GLP+ HGL  SS     +   
Sbjct  266  QIRENLKVLQQAYKTLDEIPLDAEAVERGGGYSLDSDAIGLPRAHGL--SSSLHGFNDGS  323

Query  479  sytaSPKNPRSRKSSHSGE  423
            S  ++PK  RSR+ +HSGE
Sbjct  324  SSYSTPKQSRSRRPNHSGE  342


 Score = 44.3 bits (103),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS S I LREPP VL+P+E  ++QE +EI +TK
Sbjct  170  HSFSTIQLREPPVVLKPSEHQSEQEALEIAITK  202



>gb|KFK39955.1| hypothetical protein AALP_AA3G311000 [Arabis alpina]
Length=780

 Score =   163 bits (412),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIED VPKAIMHFLVN++KRELHNVFI+KLYR+N+ EE+L+EPDE+A KRK
Sbjct  660  KSYYDIVRKNIEDLVPKAIMHFLVNYSKRELHNVFIEKLYRENMIEELLKEPDEIAIKRK  719

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP  546
            RTR+TLR+LQQA +TLDELPLEAESVERGY +  +P
Sbjct  720  RTRETLRILQQAKRTLDELPLEAESVERGYRMGSEP  755


 Score = 45.4 bits (106),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++S I+L+EPP++LR +ETH++QE IEI +TK +
Sbjct  624  QNLSTIYLKEPPTILRSSETHSEQEAIEIQITKLL  658



>ref|XP_008348877.1| PREDICTED: dynamin-related protein 3A-like [Malus domestica]
Length=118

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = -3

Query  692  MLQEPDEVATKRKRTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLPt  513
            MLQEPDEVA KRKRTR+TLRVLQQAF+TLDELPLEA++VE+GYSL  DPTGLPKIHGLPT
Sbjct  1    MLQEPDEVAMKRKRTRETLRVLQQAFRTLDELPLEADTVEKGYSLGADPTGLPKIHGLPT  60

Query  512  ssmyttsssvdsytaSPKNPRSRKSSHSGELQSPMYYVGGDSNGNGRNSLLGLYPTID  339
            SSMY TSSS DSYTASPKN +SRKSSHSGEL SP +Y   DSNG+GR  + GLYPT+D
Sbjct  61   SSMYNTSSSHDSYTASPKNTKSRKSSHSGELHSP-FYSNADSNGSGRMYMPGLYPTVD  117



>gb|AES90601.2| dynamin 3A-like protein [Medicago truncatula]
Length=760

 Score =   166 bits (421),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYY+IVRKN+ED +PKAIMHFLVN+TKRELHNVFI  LYRD+LFEEMLQEP+E+A KRK
Sbjct  649  RSYYEIVRKNVEDLIPKAIMHFLVNNTKRELHNVFIANLYRDDLFEEMLQEPNEIAVKRK  708

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R R+ LR  QQAF+ LDELPLEAE+ E G+S SP+ TGLPKI GL
Sbjct  709  RCRELLRAYQQAFRDLDELPLEAETAEWGHS-SPETTGLPKIRGL  752


 Score = 40.0 bits (92),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            S IHLREPP+VLRP+E  ++   +EI VTK
Sbjct  616  STIHLREPPTVLRPSERSSETLAVEIAVTK  645



>ref|XP_010467216.1| PREDICTED: dynamin-related protein 3B-like [Camelina sativa]
Length=274

 Score =   159 bits (402),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN++KRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  158  KSYYDIVRKNVEDLVPKAIMHFLVNYSKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  217

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD  549
            RT++TLR+LQQA +TLDELPLEAESVERGY +  +
Sbjct  218  RTQETLRILQQANRTLDELPLEAESVERGYRIGSE  252


 Score = 44.7 bits (104),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++S I+L+EPP+VLR +E H++QE++EI +TK
Sbjct  122  QNLSTIYLKEPPTVLRSSENHSEQESVEIQITK  154



>ref|NP_001154516.1| dynamin-related protein 3B [Arabidopsis thaliana]
 gb|AEC06284.1| dynamin-related protein 3B [Arabidopsis thaliana]
Length=809

 Score =   160 bits (404),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  691  KSYYDIVRKNVEDLVPKAIMHFLVNYTKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  750

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD  549
            RT++TLR+LQQA +TLDELPLEAESVERGY +  +
Sbjct  751  RTQETLRILQQANRTLDELPLEAESVERGYKIGSE  785


 Score = 43.5 bits (101),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++S I+L+EPP++L+ +ETH++QE++EI +TK
Sbjct  655  QNLSTIYLKEPPTILKSSETHSEQESVEIEITK  687



>ref|XP_006409667.1| hypothetical protein EUTSA_v10022566mg [Eutrema salsugineum]
 gb|ESQ51120.1| hypothetical protein EUTSA_v10022566mg [Eutrema salsugineum]
Length=779

 Score =   160 bits (406),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN++KRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  661  KSYYDIVRKNVEDLVPKAIMHFLVNYSKRELHNVFIEKLYRENLIEELLKEPDEIAIKRK  720

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP  546
            R R+TL +LQQA +TLDELPLEAESVERGY   P+P
Sbjct  721  RARETLHILQQANRTLDELPLEAESVERGYRTGPEP  756


 Score = 42.4 bits (98),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++S I+L+EPP+VL+ +E H++QE +EI +TK +
Sbjct  625  QNLSTIYLKEPPTVLKSSENHSEQEAVEIKITKLL  659



>ref|NP_565363.2| dynamin-related protein 3B [Arabidopsis thaliana]
 gb|AEC06283.1| dynamin-related protein 3B [Arabidopsis thaliana]
Length=780

 Score =   159 bits (403),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  662  KSYYDIVRKNVEDLVPKAIMHFLVNYTKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD  549
            RT++TLR+LQQA +TLDELPLEAESVERGY +  +
Sbjct  722  RTQETLRILQQANRTLDELPLEAESVERGYKIGSE  756


 Score = 43.1 bits (100),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++S I+L+EPP++L+ +ETH++QE++EI +TK
Sbjct  626  QNLSTIYLKEPPTILKSSETHSEQESVEIEITK  658



>ref|NP_565362.1| dynamin-related protein 3B [Arabidopsis thaliana]
 sp|Q8LFT2.2|DRP3B_ARATH RecName: Full=Dynamin-related protein 3B; AltName: Full=Dynamin-like 
protein 2b [Arabidopsis thaliana]
 gb|AAM15450.1| dynamin-like protein [Arabidopsis thaliana]
 gb|AEC06282.1| dynamin-related protein 3B [Arabidopsis thaliana]
Length=780

 Score =   159 bits (403),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  662  KSYYDIVRKNVEDLVPKAIMHFLVNYTKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD  549
            RT++TLR+LQQA +TLDELPLEAESVERGY +  +
Sbjct  722  RTQETLRILQQANRTLDELPLEAESVERGYKIGSE  756


 Score = 43.1 bits (100),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++S I+L+EPP++L+ +ETH++QE++EI +TK
Sbjct  626  QNLSTIYLKEPPTILKSSETHSEQESVEIEITK  658



>gb|AAM20619.1| dynamin-like protein [Arabidopsis thaliana]
Length=780

 Score =   159 bits (403),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  662  KSYYDIVRKNVEDLVPKAIMHFLVNYTKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD  549
            RT++TLR+LQQA +TLDELPLEAESVERGY +  +
Sbjct  722  RTQETLRILQQANRTLDELPLEAESVERGYKIGSE  756


 Score = 43.1 bits (100),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++S I+L+EPP++L+ +ETH++QE++EI +TK
Sbjct  626  QNLSTIYLKEPPTILKSSETHSEQESVEIEITK  658



>ref|XP_010518214.1| PREDICTED: dynamin-related protein 3B isoform X1 [Camelina sativa]
 ref|XP_010518222.1| PREDICTED: dynamin-related protein 3B isoform X2 [Camelina sativa]
Length=778

 Score =   158 bits (400),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN++KRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  662  KSYYDIVRKNVEDLVPKAIMHFLVNYSKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD  549
            RT++TLR+LQQA +TLDELPLEAESVERGY +  +
Sbjct  722  RTQETLRILQQANRTLDELPLEAESVERGYRIGSE  756


 Score = 44.3 bits (103),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
             ++S I+L+EPP+VLR +E H++QE++EI +TK +
Sbjct  626  QNLSTIYLKEPPTVLRSSENHSEQESVEIQITKLL  660



>dbj|BAB85645.1| dynamin like protein 2b [Arabidopsis thaliana]
Length=780

 Score =   159 bits (403),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN+TKRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  662  KSYYDIVRKNVEDLVPKAIMHFLVNYTKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD  549
            RT++TLR+LQQA +TLDELPLEAESVERGY +  +
Sbjct  722  RTQETLRILQQANRTLDELPLEAESVERGYKIGSE  756


 Score = 43.1 bits (100),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++S I+L+EPP++L+ +ETH++QE++EI +TK
Sbjct  626  QNLSTIYLKEPPTILKSSETHSEQESVEIEITK  658



>ref|XP_006297027.1| hypothetical protein CARUB_v10013019mg [Capsella rubella]
 gb|EOA29925.1| hypothetical protein CARUB_v10013019mg [Capsella rubella]
Length=781

 Score =   158 bits (400),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN++KRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  663  KSYYDIVRKNVEDLVPKAIMHFLVNYSKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD  549
            RT++TLR+LQQA +TLDELPLEAESVERGY +  +
Sbjct  723  RTQETLRILQQANRTLDELPLEAESVERGYRIGSE  757


 Score = 44.3 bits (103),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++S I+L+EPP+VLR +E H++QE++EI +TK
Sbjct  627  QNLSTIYLKEPPTVLRSSENHSEQESVEIQITK  659



>ref|XP_010488879.1| PREDICTED: dynamin-related protein 3B-like [Camelina sativa]
Length=779

 Score =   158 bits (399),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPKAIMHFLVN++KRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  663  KSYYDIVRKNVEDLVPKAIMHFLVNYSKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  722

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLS  555
            RT++TLR+LQQA +TLDELPLEAESVERGY + 
Sbjct  723  RTQETLRILQQANRTLDELPLEAESVERGYRIG  755


 Score = 44.3 bits (103),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++S I+L+EPP+VLR +E H++QE++EI +TK
Sbjct  627  QNLSTIYLKEPPTVLRSSENHSEQESVEIQITK  659



>ref|XP_003608404.1| Dynamin-related protein 3A [Medicago truncatula]
Length=759

 Score =   162 bits (410),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 2/106 (2%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYY+IVRKN+ED +PKAIMHFLVN+TKRELHNVFI  LYRD+LFEEMLQEP+E+A KRK
Sbjct  647  RSYYEIVRKNVEDLIPKAIMHFLVNNTKRELHNVFIANLYRDDLFEEMLQEPNEIAVKRK  706

Query  653  RTRDTLRVLQQAFKT-LDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R R+ LR  QQAF+  LDELPLEAE+ E G+S SP+ TGLPKI GL
Sbjct  707  RCRELLRAYQQAFRADLDELPLEAETAEWGHS-SPETTGLPKIRGL  751


 Score = 40.0 bits (92),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            S IHLREPP+VLRP+E  ++   +EI VTK
Sbjct  614  STIHLREPPTVLRPSERSSETLAVEIAVTK  643



>ref|XP_002885904.1| hypothetical protein ARALYDRAFT_480333 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62163.1| hypothetical protein ARALYDRAFT_480333 [Arabidopsis lyrata subsp. 
lyrata]
Length=776

 Score =   157 bits (397),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN+ED VPK IMHFLVN+TKRELHNVFI+KLYR+NL EE+L+EPDE+A KRK
Sbjct  658  KSYYDIVRKNVEDLVPKTIMHFLVNYTKRELHNVFIEKLYRENLIEELLKEPDELAIKRK  717

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD  549
            RT++TLR+LQQA +TLDELPLEAESVERGY +  +
Sbjct  718  RTQETLRILQQANRTLDELPLEAESVERGYRIGSE  752


 Score = 44.7 bits (104),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++S I+L+EPP++LR +ETH++QE +EI +TK
Sbjct  622  QNLSTIYLKEPPTILRSSETHSEQEAVEIQITK  654



>gb|EMT11624.1| Dynamin-related protein 3B [Aegilops tauschii]
Length=808

 Score =   162 bits (411),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKN+ED VPKAIMHFLVNHTKRELHN  I  LYR+ LF ++L+EPDE+ TKR+
Sbjct  533  QSYYNIVRKNVEDFVPKAIMHFLVNHTKRELHNFLITTLYREELFGDILREPDEITTKRR  592

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPK  531
            + RDTL+VLQQA+KTLDE+PLEAE+VERGYSL  D TGLP+
Sbjct  593  QIRDTLKVLQQAYKTLDEIPLEAETVERGYSLDSDATGLPR  633


 Score = 37.4 bits (85),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -2

Query  918  REPPSVLRPTETHTDQETIEITVTKTVAE  832
            +EPP VL+P+E+H++QE +EI +TK + +
Sbjct  505  QEPPLVLKPSESHSEQEDLEIAITKLLLQ  533



>ref|XP_006653321.1| PREDICTED: dynamin-related protein 3A-like, partial [Oryza brachyantha]
Length=730

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED+VPKAIMHFLVNHTKRELHNV I+KLYR+NL +EML+E DEV  +R+
Sbjct  583  KSYYDIVRKSIEDAVPKAIMHFLVNHTKRELHNVLIRKLYRENLLDEMLRETDEVIIRRQ  642

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL+VL+QA +TL+E PLEAE VE+GYSL    TGLPKIHGL
Sbjct  643  RIQETLQVLEQAHRTLEEFPLEAEKVEKGYSLGEYATGLPKIHGL  687



>dbj|BAK03569.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   156 bits (394),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED+VPKAIMHFLVNHTKRELHNV I+KLYR++L ++ML+E DEV  +R+
Sbjct  657  KSYYDIVRKSIEDAVPKAIMHFLVNHTKRELHNVLIRKLYRESLLDDMLRETDEVLIRRQ  716

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL+VL+QA +TL+E PLEAE +ERGYSLS   TGLPKI GL
Sbjct  717  RIQETLQVLEQAHRTLEEFPLEAEKLERGYSLSEYGTGLPKIPGL  761


 Score = 41.2 bits (95),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            SMI LREPPS L+P+E  TD++  EI + K + +
Sbjct  624  SMIRLREPPSTLKPSENKTDRDRTEIAIVKLLVK  657



>ref|XP_010239798.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Brachypodium 
distachyon]
Length=476

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED+VPKAIMHFLVNHTKRELHN+ I+KLYR+NL +EML+E DEV  +R+
Sbjct  357  KSYYDIVRKSIEDAVPKAIMHFLVNHTKRELHNILIRKLYRENLLDEMLRETDEVLIRRQ  416

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL+VL+QA +TL+E PLEAE V++GYSLS   TGLPKI GL
Sbjct  417  RIQETLQVLEQAHRTLEEFPLEAEKVDKGYSLSEYTTGLPKIPGL  461



>gb|EAY93838.1| hypothetical protein OsI_15615 [Oryza sativa Indica Group]
Length=692

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED+VPKAIMHFLVNHTKRELHNV I+KLYR+NL +EML+E DEV  +R+
Sbjct  541  KSYYDIVRKSIEDAVPKAIMHFLVNHTKRELHNVLIRKLYRENLLDEMLRETDEVIIRRQ  600

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL+VL+QA +TL+E PLEAE VE+GYS +   TGLPKIHGL
Sbjct  601  RIQETLQVLEQAHRTLEEFPLEAEKVEKGYSPAEYATGLPKIHGL  645



>ref|XP_010239796.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Brachypodium 
distachyon]
Length=772

 Score =   158 bits (399),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED+VPKAIMHFLVNHTKRELHN+ I+KLYR+NL +EML+E DEV  +R+
Sbjct  653  KSYYDIVRKSIEDAVPKAIMHFLVNHTKRELHNILIRKLYRENLLDEMLRETDEVLIRRQ  712

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL+VL+QA +TL+E PLEAE V++GYSLS   TGLPKI GL
Sbjct  713  RIQETLQVLEQAHRTLEEFPLEAEKVDKGYSLSEYTTGLPKIPGL  757


 Score = 36.6 bits (83),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            SM+ LREPP  L+P+E  ++Q+  EI + K + +
Sbjct  620  SMVRLREPPITLKPSENKSNQDLTEIAIVKLLVK  653



>ref|XP_010239797.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Brachypodium 
distachyon]
Length=769

 Score =   158 bits (399),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED+VPKAIMHFLVNHTKRELHN+ I+KLYR+NL +EML+E DEV  +R+
Sbjct  650  KSYYDIVRKSIEDAVPKAIMHFLVNHTKRELHNILIRKLYRENLLDEMLRETDEVLIRRQ  709

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL+VL+QA +TL+E PLEAE V++GYSLS   TGLPKI GL
Sbjct  710  RIQETLQVLEQAHRTLEEFPLEAEKVDKGYSLSEYTTGLPKIPGL  754


 Score = 36.6 bits (83),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            SM+ LREPP  L+P+E  ++Q+  EI + K + +
Sbjct  617  SMVRLREPPITLKPSENKSNQDLTEIAIVKLLVK  650



>gb|EEE60872.1| hypothetical protein OsJ_14527 [Oryza sativa Japonica Group]
Length=739

 Score =   157 bits (396),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED+VPKAIMHFLVNHTKRELHNV I+KLYR+NL +EML+E DEV  +R+
Sbjct  588  KSYYDIVRKSIEDAVPKAIMHFLVNHTKRELHNVLIRKLYRENLLDEMLRETDEVIIRRQ  647

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL+VL+QA +TL+E  LEAE VE+GYS +   TGLPKIHGL
Sbjct  648  RIQETLQVLEQAHRTLEEFSLEAEKVEKGYSPAEYATGLPKIHGL  692


 Score = 34.3 bits (77),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -2

Query  936  ISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            IS+I LREPP  L+P+E    Q+  E+ + K
Sbjct  554  ISIIQLREPPITLKPSENQPAQDATEVAIVK  584



>ref|NP_001052600.1| Os04g0381000 [Oryza sativa Japonica Group]
 dbj|BAF14514.1| Os04g0381000 [Oryza sativa Japonica Group]
 dbj|BAG97247.1| unnamed protein product [Oryza sativa Japonica Group]
Length=797

 Score =   157 bits (396),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED+VPKAIMHFLVNHTKRELHNV I+KLYR+NL +EML+E DEV  +R+
Sbjct  646  KSYYDIVRKSIEDAVPKAIMHFLVNHTKRELHNVLIRKLYRENLLDEMLRETDEVIIRRQ  705

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL+VL+QA +TL+E  LEAE VE+GYS +   TGLPKIHGL
Sbjct  706  RIQETLQVLEQAHRTLEEFSLEAEKVEKGYSPAEYATGLPKIHGL  750


 Score = 34.3 bits (77),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -2

Query  936  ISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            IS+I LREPP  L+P+E    Q+  E+ + K
Sbjct  612  ISIIQLREPPITLKPSENQPAQDATEVAIVK  642



>emb|CAE02157.2| OSJNBa0072D21.2 [Oryza sativa Japonica Group]
Length=800

 Score =   157 bits (396),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED+VPKAIMHFLVNHTKRELHNV I+KLYR+NL +EML+E DEV  +R+
Sbjct  649  KSYYDIVRKSIEDAVPKAIMHFLVNHTKRELHNVLIRKLYRENLLDEMLRETDEVIIRRQ  708

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL+VL+QA +TL+E  LEAE VE+GYS +   TGLPKIHGL
Sbjct  709  RIQETLQVLEQAHRTLEEFSLEAEKVEKGYSPAEYATGLPKIHGL  753


 Score = 34.3 bits (77),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -2

Query  936  ISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            IS+I LREPP  L+P+E    Q+  E+ + K
Sbjct  615  ISIIQLREPPITLKPSENQPAQDATEVAIVK  645



>ref|XP_004977934.1| PREDICTED: dynamin-related protein 3A-like [Setaria italica]
Length=735

 Score =   154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRK+IED++PKA+MHFLVNHTKR+LHN  I+KLYR+NL  E+++E DEV  +R+
Sbjct  605  KSYYDIVRKSIEDAIPKAVMHFLVNHTKRDLHNFLIRKLYRENLLNELMRETDEVLIRRQ  664

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++TL VL+QA +TL+E PLEAE +E+GY L+   TGLPKIHGL
Sbjct  665  RIQETLEVLEQAHRTLEEFPLEAEKIEKGYDLAEHATGLPKIHGL  709



>emb|CDY48440.1| BnaA08g11490D [Brassica napus]
Length=807

 Score =   135 bits (341),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 82/106 (77%), Gaps = 12/106 (11%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIEDSV         NHTKRELHNVFI+KLYR+NLFEEMLQE DE+A KRK
Sbjct  678  KSYYDIVRKNIEDSV---------NHTKRELHNVFIRKLYRENLFEEMLQETDEIAVKRK  728

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RT+ TL VLQQA++TLDELPLEAESV   ++   D TG+ K   LP
Sbjct  729  RTQATLHVLQQAYRTLDELPLEAESV---HNHGTDTTGVSKYLDLP  771


 Score = 50.1 bits (118),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMI+L+EPP+VLRP+ETH++Q+ +EI +TK
Sbjct  642  QNLSMIYLKEPPTVLRPSETHSEQQAVEIQITK  674



>emb|CDY28314.1| BnaC03g66450D [Brassica napus]
Length=806

 Score =   134 bits (336),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 82/106 (77%), Gaps = 12/106 (11%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKNIEDSV         NHTKRELHNVFI+KLYR+NLFEEMLQE DE+A KRK
Sbjct  677  KSYYNIVRKNIEDSV---------NHTKRELHNVFIRKLYRENLFEEMLQETDEIAVKRK  727

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGLP  516
            RT+ TL VLQQA++TLDELPLEAESV   ++   D TG+ K   LP
Sbjct  728  RTQATLHVLQQAYRTLDELPLEAESV---HNHGTDTTGVSKYLDLP  770


 Score = 50.4 bits (119),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
             ++SMI+L+EPP+VLRP+ETH++Q+ +EI +TK
Sbjct  641  QNLSMIYLKEPPTVLRPSETHSEQQAVEIQITK  673



>ref|XP_008669526.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Zea mays]
Length=267

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIED++PKA+MHFLVNHTKR+LHN  I+KLYR+NL  E+++E DEV  +R+
Sbjct  137  KSYYDIVRKNIEDAIPKAVMHFLVNHTKRDLHNFLIRKLYRENLLNELMRETDEVLMRRQ  196

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++ L +L+QA +TL+E P E + +E+GY+L+   TGL KIHG+
Sbjct  197  RIQEMLEILEQAHRTLEEFPFEVDKLEKGYNLTEHATGLSKIHGV  241



>ref|XP_008669525.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Zea mays]
Length=272

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNIED++PKA+MHFLVNHTKR+LHN  I+KLYR+NL  E+++E DEV  +R+
Sbjct  142  KSYYDIVRKNIEDAIPKAVMHFLVNHTKRDLHNFLIRKLYRENLLNELMRETDEVLMRRQ  201

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            R ++ L +L+QA +TL+E P E + +E+GY+L+   TGL KIHG+
Sbjct  202  RIQEMLEILEQAHRTLEEFPFEVDKLEKGYNLTEHATGLSKIHGV  246



>ref|XP_001777446.1| predicted protein [Physcomitrella patens]
 gb|EDQ57733.1| predicted protein [Physcomitrella patens]
Length=872

 Score =   144 bits (362),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNI+D VPK IMHFLVNH KRELH+VFI+KLYR+NLFEEMLQE +++A KRK
Sbjct  701  KSYYDIVRKNIQDLVPKTIMHFLVNHVKRELHSVFIRKLYRENLFEEMLQEKEDIAVKRK  760

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLP  534
            R ++ LRVLQQA  T++ELPLE ES  R  S S D TGLP
Sbjct  761  RCKEILRVLQQANWTIEELPLEFESASRPAS-SFDATGLP  799


 Score = 39.3 bits (90),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -2

Query  936  ISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            +S I LREPP+ LR  +  ++QET+EI VT+
Sbjct  667  LSSIQLREPPATLRANDAQSEQETVEIAVTR  697



>ref|XP_002960102.1| hypothetical protein SELMODRAFT_437242 [Selaginella moellendorffii]
 gb|EFJ37641.1| hypothetical protein SELMODRAFT_437242 [Selaginella moellendorffii]
Length=929

 Score =   145 bits (366),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNI+DSVPKAIMHFLVNH KRELHNVFI+KLYR+ +FEE+LQE +E+A KRK
Sbjct  662  KSYYDIVRKNIQDSVPKAIMHFLVNHAKRELHNVFIRKLYREAMFEELLQEREEIAIKRK  721

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLP-KIHGLP  516
            R ++ L+VLQQA  T++ELPLE E   R    + D TGLP ++ G+P
Sbjct  722  RCKEVLKVLQQAAWTIEELPLEYEFPSRATLSASDATGLPSRLGGVP  768


 Score = 36.6 bits (83),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  927  IHLREPPSVLRPTETHTDQETIEITVTK  844
            I LREPP VLR ++  T+QE+ EI VT+
Sbjct  631  IRLREPPLVLRASDAQTEQESTEIVVTR  658



>ref|NP_001170021.1| uncharacterized protein LOC100383931 [Zea mays]
 gb|ACN35555.1| unknown [Zea mays]
Length=130

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = -3

Query  776  MHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKRTRDTLRVLQQAFKTLDEL  597
            MHFLVNHTKR LHN  I KLYRD+L E++L+EPDE+  KRK+ R+ L+VLQQA+KTLDE+
Sbjct  1    MHFLVNHTKRALHNYLITKLYRDDLLEDLLKEPDEITIKRKQIRENLKVLQQAYKTLDEI  60

Query  596  PLEAESVER-GYSLSPDPTGLPKIHGLPtssmyttsssvdsytaSPKNPRSRKSSHSGE  423
            PL+AE+VER GYSL  D  GLP+ HGL  SS     +   S  ++PK  RSR+S+HSGE
Sbjct  61   PLDAEAVERGGYSLDSDAIGLPRAHGL--SSSLHGFNDGSSPYSTPKQSRSRRSNHSGE  117



>ref|XP_002963601.1| hypothetical protein SELMODRAFT_404911 [Selaginella moellendorffii]
 gb|EFJ35472.1| hypothetical protein SELMODRAFT_404911 [Selaginella moellendorffii]
Length=985

 Score =   137 bits (346),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKNI+D+VPKAIMHFLV H KREL N+ IKKLYR+ LFEEMLQE D++A++RK
Sbjct  816  KSYYEIVRKNIQDAVPKAIMHFLVGHVKRELLNLLIKKLYREVLFEEMLQERDDIASRRK  875

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVER-GYSLSPDPTGLPKIHGL  519
              R+ LRVLQQA  TL++LP++A++  R G +L  D TGLPK  G+
Sbjct  876  HCREVLRVLQQAVVTLEDLPVDADAHSRPGQALFQDSTGLPKPQGV  921


 Score = 36.6 bits (83),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            S I L+EPP +LR T+  T+QE +E+ VT+ +
Sbjct  783  STIILKEPPGILRATDAQTEQERVEVAVTRLL  814



>ref|XP_002515392.1| dynamin, putative [Ricinus communis]
 gb|EEF46841.1| dynamin, putative [Ricinus communis]
Length=797

 Score =   128 bits (321),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (76%), Gaps = 5/103 (5%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+D VPKAIMHFLVN+TKRELHN FI+KLYR++LFEE+LQE DEV  KRK
Sbjct  652  RSYYDIVRKNIQDLVPKAIMHFLVNYTKRELHNTFIQKLYRESLFEELLQEQDEVIAKRK  711

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD---PTGLP  534
              R+   VLQQA +TLDE  +E++   R    S D    TGLP
Sbjct  712  HAREVFHVLQQAVQTLDE--VESDVSSRCSYSSVDTGSTTGLP  752


 Score = 39.7 bits (91),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 24/33 (73%), Gaps = 1/33 (3%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            HS S I LREPPS+LRP E  T+Q  +EI VTK
Sbjct  617  HSSSTIQLREPPSILRPPEL-TEQGAVEIIVTK  648



>ref|XP_001775158.1| predicted protein [Physcomitrella patens]
 gb|EDQ60019.1| predicted protein [Physcomitrella patens]
Length=766

 Score =   127 bits (320),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNI+D VPKAIMHFLVNH KRELH VFI+KLYR+NLFEEMLQE +++A KRK
Sbjct  675  KSYYDIVRKNIQDLVPKAIMHFLVNHVKRELHTVFIRKLYRENLFEEMLQEKEDIAVKRK  734

Query  653  RTRDTLRVLQQAFKTLDELP  594
            R ++ LRVLQQA   L+ LP
Sbjct  735  RCKEILRVLQQAAWVLNFLP  754


 Score = 40.0 bits (92),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  939  SISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            S S I LREPP+ LR ++   +QET+EI VT+ +
Sbjct  640  SFSSIQLREPPATLRASDAQGEQETLEIAVTRLL  673



>ref|XP_010432531.1| PREDICTED: dynamin-related protein 3A-like [Camelina sativa]
Length=112

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -3

Query  776  MHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKRTRDTLRVLQQAFKTLDEL  597
            MHFLVNHTKRELHNVFIKKLYR+NLFEEMLQEP+E+A KRKRT++TL VLQQA++TLDEL
Sbjct  1    MHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPEEIAGKRKRTQETLHVLQQAYRTLDEL  60

Query  596  PLEAESVERGYS  561
            PLEA+SV  G S
Sbjct  61   PLEADSVSAGMS  72



>ref|XP_001761534.1| predicted protein [Physcomitrella patens]
 gb|EDQ73602.1| predicted protein [Physcomitrella patens]
Length=766

 Score =   122 bits (307),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNI+D VPKAIMHFLVNH KRELH+VFI+KLYR+NLFEE+LQE +E+A KRK
Sbjct  677  KSYYDIVRKNIQDLVPKAIMHFLVNHVKRELHSVFIRKLYRENLFEEVLQEKEEIAVKRK  736

Query  653  RTRDTLRVLQQAFKTL  606
            R ++ LRVLQQ    L
Sbjct  737  RCKEILRVLQQGAWVL  752


 Score = 39.7 bits (91),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  939  SISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            S S I LREPP+ LR ++   +QE++EI VT+ +
Sbjct  642  SFSGIQLREPPATLRASDAQGEQESVEIAVTRLL  675



>ref|XP_010268466.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Nelumbo 
nucifera]
Length=806

 Score =   126 bits (317),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRK I+D VPKAIMHFLVNHTKR L + FI+KLYR+NLFEEML   D+   KRK
Sbjct  669  RSYYDIVRKKIQDFVPKAIMHFLVNHTKRNLLSTFIQKLYRENLFEEMLHVQDDTVVKRK  728

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKIHGL  519
            RTR+  +VLQQA +TL+E+  E  S     S S D  TGLPKI GL
Sbjct  729  RTREMFQVLQQAVQTLEEVDSEVTSRSSISSSSIDTATGLPKIQGL  774


 Score = 34.7 bits (78),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  927  IHLREPPSVLRPTETHTDQETIEITVTK  844
            + LREPP++LR +  HT+Q+ +EI V K
Sbjct  638  VQLREPPALLRLSGVHTEQQELEIIVIK  665



>ref|XP_010268464.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Nelumbo 
nucifera]
Length=811

 Score =   126 bits (317),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRK I+D VPKAIMHFLVNHTKR L + FI+KLYR+NLFEEML   D+   KRK
Sbjct  674  RSYYDIVRKKIQDFVPKAIMHFLVNHTKRNLLSTFIQKLYRENLFEEMLHVQDDTVVKRK  733

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKIHGL  519
            RTR+  +VLQQA +TL+E+  E  S     S S D  TGLPKI GL
Sbjct  734  RTREMFQVLQQAVQTLEEVDSEVTSRSSISSSSIDTATGLPKIQGL  779


 Score = 34.7 bits (78),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  927  IHLREPPSVLRPTETHTDQETIEITVTK  844
            + LREPP++LR +  HT+Q+ +EI V K
Sbjct  643  VQLREPPALLRLSGVHTEQQELEIIVIK  670



>ref|XP_010268467.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Nelumbo 
nucifera]
Length=766

 Score =   126 bits (316),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRK I+D VPKAIMHFLVNHTKR L + FI+KLYR+NLFEEML   D+   KRK
Sbjct  629  RSYYDIVRKKIQDFVPKAIMHFLVNHTKRNLLSTFIQKLYRENLFEEMLHVQDDTVVKRK  688

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKIHGL  519
            RTR+  +VLQQA +TL+E+  E  S     S S D  TGLPKI GL
Sbjct  689  RTREMFQVLQQAVQTLEEVDSEVTSRSSISSSSIDTATGLPKIQGL  734


 Score = 34.7 bits (78),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  927  IHLREPPSVLRPTETHTDQETIEITVTK  844
            + LREPP++LR +  HT+Q+ +EI V K
Sbjct  598  VQLREPPALLRLSGVHTEQQELEIIVIK  625



>emb|CBI21170.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   118 bits (296),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKN++D VPKAIMHFLVNHTKR+L N F++KLYR+NLF+EML+E D+V  KRK
Sbjct  588  RSYYDIVRKNVQDFVPKAIMHFLVNHTKRDLLNAFVQKLYRENLFKEMLREQDDVILKRK  647

Query  653  RTRDTLRVLQQAFKTLDEL  597
            R+++   VLQQA + +DE+
Sbjct  648  RSQEMFCVLQQAIQAIDEV  666


 Score = 42.0 bits (97),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            SMI LR+PP +L+P ET T++E +E+ VTK +
Sbjct  555  SMIQLRDPPPILKPLETQTEREAVEVIVTKLL  586



>ref|XP_002984035.1| hypothetical protein SELMODRAFT_119205 [Selaginella moellendorffii]
 gb|EFJ15047.1| hypothetical protein SELMODRAFT_119205 [Selaginella moellendorffii]
Length=748

 Score =   123 bits (309),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNI+DSVPKAIMHFLVNH KRELHNVFI+KLYR+ +FEE+LQE +E+A KRK
Sbjct  664  KSYYDIVRKNIQDSVPKAIMHFLVNHAKRELHNVFIRKLYREAMFEELLQEREEIAIKRK  723

Query  653  RTRDTLRVLQQA  618
            R ++ L+VLQQA
Sbjct  724  RCKEVLKVLQQA  735


 Score = 36.6 bits (83),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  927  IHLREPPSVLRPTETHTDQETIEITVTK  844
            I LREPP VLR ++  T+QE+ EI VT+
Sbjct  633  IRLREPPLVLRASDAQTEQESTEIVVTR  660



>ref|XP_007011677.1| Dynamin-related protein 3A isoform 1 [Theobroma cacao]
 gb|EOY29296.1| Dynamin-related protein 3A isoform 1 [Theobroma cacao]
Length=832

 Score =   127 bits (319),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+D+VRKNI+D VPKAIMHFLVNHTKR LHN FI+ LY++NLFEE+LQE DEV  +RK
Sbjct  688  QSYFDLVRKNIQDLVPKAIMHFLVNHTKRNLHNTFIQILYKENLFEELLQEQDEVVARRK  747

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPK  531
              ++ LRVL+QA K L E+  + ES  R  +  PD  TGLP+
Sbjct  748  HAQEMLRVLRQAVKMLGEVDSDVESQHRTTNSGPDVSTGLPR  789


 Score = 32.7 bits (73),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 1/34 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            S I L EPPS+LRP E  ++ E  EI +TK + +
Sbjct  656  STIQLSEPPSILRPLEM-SENEATEIIITKLLVQ  688



>emb|CAN83903.1| hypothetical protein VITISV_020250 [Vitis vinifera]
Length=635

 Score =   118 bits (295),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKN++D VPKAIMHFLVNHTKR+L N F++KLYR+NLF+EML+E D+V  KRK
Sbjct  526  RSYYDIVRKNVQDFVPKAIMHFLVNHTKRDLLNAFVQKLYRENLFKEMLREQDDVVLKRK  585

Query  653  RTRDTLRVLQQAFKTLDEL  597
            R+++   VLQQA + +DE+
Sbjct  586  RSQEMFCVLQQAIQAIDEV  604


 Score = 42.0 bits (97),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            SMI LR+PP +L+P ET T++E +E+ VTK
Sbjct  493  SMIQLRDPPPILKPLETQTEREAVEVIVTK  522



>ref|XP_007011678.1| Dynamin-related protein 3A isoform 2 [Theobroma cacao]
 gb|EOY29297.1| Dynamin-related protein 3A isoform 2 [Theobroma cacao]
Length=801

 Score =   127 bits (319),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+D+VRKNI+D VPKAIMHFLVNHTKR LHN FI+ LY++NLFEE+LQE DEV  +RK
Sbjct  657  QSYFDLVRKNIQDLVPKAIMHFLVNHTKRNLHNTFIQILYKENLFEELLQEQDEVVARRK  716

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPK  531
              ++ LRVL+QA K L E+  + ES  R  +  PD  TGLP+
Sbjct  717  HAQEMLRVLRQAVKMLGEVDSDVESQHRTTNSGPDVSTGLPR  758


 Score = 32.0 bits (71),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 1/34 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            S I L EPPS+LRP E  ++ E  EI +TK + +
Sbjct  625  STIQLSEPPSILRPLEM-SENEATEIIITKLLVQ  657



>gb|KFK29989.1| hypothetical protein AALP_AA7G203400 [Arabis alpina]
Length=118

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = -3

Query  770  FLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKRTRDTLRVLQQAFKTLDELPL  591
             LVNHTKRELHNVFIKKLYR+NLFEEMLQEPDE+A KRKRT +TL +LQQA+ TL+ELPL
Sbjct  2    LLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRKRTHETLHILQQAYSTLEELPL  61

Query  590  EAESVERGYSLSPDPTGLPKIHGLP  516
            EAESV   Y+   D TG+ K   LP
Sbjct  62   EAESV---YNHGTDTTGVSKHLDLP  83



>ref|XP_001766173.1| predicted protein [Physcomitrella patens]
 gb|EDQ69022.1| predicted protein [Physcomitrella patens]
Length=778

 Score =   121 bits (303),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SYYDI RKNI+DSVPKAIMHFLVNH++REL +VFI+KLYR+N+FEEMLQE +E+A KRKR
Sbjct  659  SYYDIARKNIQDSVPKAIMHFLVNHSRRELQSVFIRKLYRENMFEEMLQEKEEIAAKRKR  718

Query  650  TRDTLRVLQQA  618
             ++ LRVLQQA
Sbjct  719  CKEILRVLQQA  729


 Score = 36.6 bits (83),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  939  SISMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            S + I LREPP VLR  +  T+ E++EI+VT+ +
Sbjct  623  SYACIQLREPPLVLRVNDVQTEHESVEISVTRLL  656



>gb|KJB55124.1| hypothetical protein B456_009G064100 [Gossypium raimondii]
Length=800

 Score =   123 bits (308),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+DIVRKNI+D VPKAIMHFLVNHTKR LHN FI+ LYR+ LFEE+LQE DEV  +RK
Sbjct  656  KSYFDIVRKNIQDLVPKAIMHFLVNHTKRNLHNTFIQILYREILFEELLQEQDEVVARRK  715

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPT  543
              ++ LRVL+QA KTL+E+  + E   R  +L  D +
Sbjct  716  HAKEVLRVLRQAVKTLNEVESDVEFQHRTTNLGTDAS  752


 Score = 33.1 bits (74),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            S I LREPPS+LRP E  ++ E  EI +T+ + +
Sbjct  624  STIQLREPPSILRPLEM-SENEATEIIITRILVK  656



>ref|XP_004291982.1| PREDICTED: dynamin-related protein 3A-like [Fragaria vesca subsp. 
vesca]
Length=762

 Score =   116 bits (290),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+D VPKAIMHFLVN TKR LH  FI+ LYR+NLFEE+LQE D +  KRK
Sbjct  634  RSYYDIVRKNIQDLVPKAIMHFLVNLTKRTLHRTFIQNLYRENLFEELLQEQDALVLKRK  693

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP-TGLPKI  528
            R ++ LRVL+Q+ +TL++  +E++   R  SL  +  T LP+I
Sbjct  694  RNQELLRVLEQSVQTLEK--VESDVSSRTSSLIFEASTELPRI  734


 Score = 37.7 bits (86),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 1/30 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTK  844
            S+I LREPPSVLRP E  T+ + +EI VTK
Sbjct  602  SVIQLREPPSVLRPVEV-TEHKAVEIIVTK  630



>gb|KHG17659.1| Dynamin-related 3A -like protein [Gossypium arboreum]
Length=811

 Score =   120 bits (302),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+DIVRKNI+D VPKAIMHFLVNHTKR LHN  I+ LYR+ LFEE+LQE DEV  +RK
Sbjct  667  KSYFDIVRKNIQDLVPKAIMHFLVNHTKRNLHNTLIQILYREILFEELLQEQDEVVARRK  726

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPT-GLP  534
              ++ L VL+QA KTL+E+  + E   R  +L  D + GLP
Sbjct  727  HAKEVLHVLRQAVKTLNEVESDVEFQHRTTNLGTDASPGLP  767


 Score = 32.3 bits (72),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 1/34 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            S I LREPPS+LRP E   + E  EI +T+ + +
Sbjct  635  STIQLREPPSILRPLEM-LENEATEIIITRILVK  667



>ref|XP_012076390.1| PREDICTED: dynamin-related protein 3A-like [Jatropha curcas]
Length=747

 Score =   118 bits (295),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNI+D VPK IMHFLVNHTKRE+H+ FI+KLYR++LFEE+L E DEV  KRK
Sbjct  618  QSYYDIVRKNIQDLVPKTIMHFLVNHTKREIHDTFIQKLYRESLFEELLHEQDEVVKKRK  677

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP-TGLP  534
              R+   VLQ+  + LDE+  +  S     S+  D  TGLP
Sbjct  678  HAREVFHVLQETVQMLDEVESDVSSRHPYSSMCTDSTTGLP  718


 Score = 33.5 bits (75),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            S I L EPPS+LRP E  T+ E +EI VTK + +
Sbjct  586  SAIQLIEPPSILRPLEM-TEHEAVEIIVTKLLFQ  618



>ref|XP_008377478.1| PREDICTED: dynamin-related protein 3A-like isoform X4 [Malus 
domestica]
Length=779

 Score =   107 bits (268),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLYR+N+F+E+L+E DE+ +KRK
Sbjct  648  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYRENMFDELLKEHDELVSKRK  707

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  708  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  748


 Score = 42.7 bits (99),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRPTET TD E  EI +TK + +
Sbjct  610  HSESMPSTINLREPPSILRPTET-TDNEAAEIIITKLLLQ  648



>ref|XP_008377481.1| PREDICTED: dynamin-related protein 3A-like isoform X6 [Malus 
domestica]
Length=765

 Score =   107 bits (268),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLYR+N+F+E+L+E DE+ +KRK
Sbjct  634  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYRENMFDELLKEHDELVSKRK  693

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  694  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  734


 Score = 42.7 bits (99),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRPTET TD E  EI +TK + +
Sbjct  596  HSESMPSTINLREPPSILRPTET-TDNEAAEIIITKLLLQ  634



>ref|XP_008377475.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Malus 
domestica]
Length=840

 Score =   107 bits (268),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLYR+N+F+E+L+E DE+ +KRK
Sbjct  709  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYRENMFDELLKEHDELVSKRK  768

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  769  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  809


 Score = 42.7 bits (99),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRPTET TD E  EI +TK + +
Sbjct  671  HSESMPSTINLREPPSILRPTET-TDNEAAEIIITKLLLQ  709



>ref|XP_008377477.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Malus 
domestica]
Length=788

 Score =   107 bits (268),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLYR+N+F+E+L+E DE+ +KRK
Sbjct  657  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYRENMFDELLKEHDELVSKRK  716

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  717  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  757


 Score = 42.7 bits (99),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRPTET TD E  EI +TK + +
Sbjct  619  HSESMPSTINLREPPSILRPTET-TDNEAAEIIITKLLLQ  657



>ref|XP_008377480.1| PREDICTED: dynamin-related protein 3A-like isoform X5 [Malus 
domestica]
Length=774

 Score =   107 bits (268),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLYR+N+F+E+L+E DE+ +KRK
Sbjct  643  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYRENMFDELLKEHDELVSKRK  702

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  703  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  743


 Score = 42.7 bits (99),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRPTET TD E  EI +TK + +
Sbjct  605  HSESMPSTINLREPPSILRPTET-TDNEAAEIIITKLLLQ  643



>ref|XP_008220636.1| PREDICTED: dynamin-related protein 3A-like [Prunus mume]
Length=789

 Score =   113 bits (282),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSYYDIVRKNI+D VPKAIMHFLVN TKR LH  FI+KLYR+NLFEE+LQE D   ++RK
Sbjct  656  RSYYDIVRKNIQDLVPKAIMHFLVNLTKRNLHRTFIQKLYRENLFEELLQEHDAHVSQRK  715

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPT-GLPKI  528
            R ++  +VL+Q+ + L+++  +  S  +  +L  D + GLP+I
Sbjct  716  RNQELFKVLEQSVQALEKVDFDVSS--QTSNLGTDASIGLPRI  756


 Score = 37.0 bits (84),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            S+IHLREPPS LRP +  T+ + +EI VTK +
Sbjct  624  SIIHLREPPSSLRPVQM-TENKAVEIIVTKLL  654



>ref|XP_008377476.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Malus 
domestica]
Length=826

 Score =   107 bits (267),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLYR+N+F+E+L+E DE+ +KRK
Sbjct  695  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYRENMFDELLKEHDELVSKRK  754

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  755  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  795


 Score = 42.4 bits (98),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRPTET TD E  EI +TK + +
Sbjct  657  HSESMPSTINLREPPSILRPTET-TDNEAAEIIITKLLLQ  695



>ref|XP_009768872.1| PREDICTED: dynamin-related protein 3A-like isoform X5 [Nicotiana 
sylvestris]
Length=571

 Score =   115 bits (289),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SYYDIVR+NI+D VPKAIMH+LVNH KR L   FI+KLYR+NLFE++LQE DEV TKR+R
Sbjct  462  SYYDIVRRNIQDLVPKAIMHYLVNHAKRHLLGTFIEKLYRENLFEDLLQEQDEVVTKRRR  521

Query  650  TRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP  546
            T +    LQQA +TLDE   +  +     S++  P
Sbjct  522  TVEMCHALQQAVETLDEFVADISTQRSSDSMNASP  556


 Score = 33.9 bits (76),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 1/30 (3%)
 Frame = -2

Query  927  IHLREPPSVLRPTETHTDQETIEITVTKTV  838
            I L+ PPS+LRP ET T+ + +EI VTK +
Sbjct  431  IQLKNPPSILRPGETETEYQ-VEIVVTKIL  459



>ref|XP_009768867.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Nicotiana 
sylvestris]
Length=767

 Score =   115 bits (289),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SYYDIVR+NI+D VPKAIMH+LVNH KR L   FI+KLYR+NLFE++LQE DEV TKR+R
Sbjct  658  SYYDIVRRNIQDLVPKAIMHYLVNHAKRHLLGTFIEKLYRENLFEDLLQEQDEVVTKRRR  717

Query  650  TRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP  546
            T +    LQQA +TLDE   +  +     S++  P
Sbjct  718  TVEMCHALQQAVETLDEFVADISTQRSSDSMNASP  752


 Score = 34.3 bits (77),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (4%)
 Frame = -2

Query  927  IHLREPPSVLRPTETHTDQETIEITVTK  844
            I L+ PPS+LRP ET T+ + +EI VTK
Sbjct  627  IQLKNPPSILRPGETETEYQ-VEIVVTK  653



>ref|XP_009768868.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Nicotiana 
sylvestris]
Length=736

 Score =   115 bits (288),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SYYDIVR+NI+D VPKAIMH+LVNH KR L   FI+KLYR+NLFE++LQE DEV TKR+R
Sbjct  627  SYYDIVRRNIQDLVPKAIMHYLVNHAKRHLLGTFIEKLYRENLFEDLLQEQDEVVTKRRR  686

Query  650  TRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP  546
            T +    LQQA +TLDE   +  +     S++  P
Sbjct  687  TVEMCHALQQAVETLDEFVADISTQRSSDSMNASP  721


 Score = 34.3 bits (77),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (4%)
 Frame = -2

Query  927  IHLREPPSVLRPTETHTDQETIEITVTK  844
            I L+ PPS+LRP ET T+ + +EI VTK
Sbjct  596  IQLKNPPSILRPGETETEYQ-VEIVVTK  622



>ref|XP_002974698.1| hypothetical protein SELMODRAFT_101670 [Selaginella moellendorffii]
 gb|EFJ24218.1| hypothetical protein SELMODRAFT_101670 [Selaginella moellendorffii]
Length=800

 Score =   113 bits (283),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYY+IVRKNI+D+VPKAIMHFLV H KREL N+ IKKLYR+ LFEEMLQE D++A++RK
Sbjct  672  KSYYEIVRKNIQDAVPKAIMHFLVGHVKRELLNLLIKKLYREALFEEMLQERDDIASRRK  731

Query  653  RTRDTLRVLQQA  618
              R+ LRVLQQA
Sbjct  732  HCREVLRVLQQA  743


 Score = 35.0 bits (79),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            S I L+EPP  LR T+  T+QE +E+ VT+ +
Sbjct  639  STIILKEPPGTLRATDAQTEQERVEVAVTRLL  670



>gb|EMS48857.1| Dynamin-related protein 3B [Triticum urartu]
Length=1002

 Score =   118 bits (296),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVN-HTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKR  657
            +SYYDIVRK+IED+VPKAIMHFL+  + +  L+N  +  + R++L ++ML+E DEV  +R
Sbjct  889  KSYYDIVRKSIEDAVPKAIMHFLITFYLEESLYNDDL--VCRESLLDDMLRETDEVLIRR  946

Query  656  KRTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIHGL  519
            +R ++TL+VL+QA +TL+E PLEAE VERGYSLS   TGLP I GL
Sbjct  947  QRIQETLQVLEQAHRTLEEFPLEAEKVERGYSLSEYGTGLPNIPGL  992


 Score = 29.6 bits (65),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = -2

Query  912  PPSVLRPTETHTDQETIEITVTKTVAE  832
            PPS L+P+E  TD++  EI + K + +
Sbjct  863  PPSTLKPSENKTDRDRTEIAIVKLLVK  889



>gb|KDO67387.1| hypothetical protein CISIN_1g045702mg [Citrus sinensis]
Length=728

 Score =   114 bits (284),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYD+VRKN++D VPK+IMHFLVNH KR LHN FI+KLYR+N  EE+LQE DEVA  R+
Sbjct  642  QSYYDVVRKNVQDLVPKSIMHFLVNHAKRNLHNTFIQKLYRENHVEELLQEHDEVAANRR  701

Query  653  RTRDTLRVLQQAFKTLDELPLE  588
            + ++   VLQQA +TLDE+  E
Sbjct  702  QVKEVSLVLQQAVQTLDEVESE  723


 Score = 33.5 bits (75),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            S I L EPPS+L P E  T+QE +EI VTK + +
Sbjct  610  STIQLTEPPSILGPLEM-TEQEAVEILVTKLLLQ  642



>ref|XP_006483515.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Citrus 
sinensis]
Length=728

 Score =   113 bits (283),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYD+VRKN++D VPK+IMHFLVNH KR LHN FI+KLYR+N  EE+LQE DEVA  R+
Sbjct  642  QSYYDVVRKNVQDLVPKSIMHFLVNHAKRNLHNTFIQKLYRENHVEELLQEHDEVAANRR  701

Query  653  RTRDTLRVLQQAFKTLDELPLE  588
            + ++   VLQQA +TLDE+  E
Sbjct  702  QVKEVSLVLQQAVQTLDEVESE  723


 Score = 33.5 bits (75),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            S I L EPPS+L P E  T+QE +EI VTK + +
Sbjct  610  STIQLTEPPSILGPLEM-TEQEAVEILVTKLLLQ  642



>ref|XP_006483516.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Citrus 
sinensis]
Length=706

 Score =   113 bits (283),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYD+VRKN++D VPK+IMHFLVNH KR LHN FI+KLYR+N  EE+LQE DEVA  R+
Sbjct  620  QSYYDVVRKNVQDLVPKSIMHFLVNHAKRNLHNTFIQKLYRENHVEELLQEHDEVAANRR  679

Query  653  RTRDTLRVLQQAFKTLDELPLE  588
            + ++   VLQQA +TLDE+  E
Sbjct  680  QVKEVSLVLQQAVQTLDEVESE  701


 Score = 33.5 bits (75),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 1/34 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            S I L EPPS+L P E  T+QE +EI VTK + +
Sbjct  588  STIQLTEPPSILGPLEM-TEQEAVEILVTKLLLQ  620



>ref|XP_009359079.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009359154.1| PREDICTED: dynamin-related protein 3A-like isoform X3 [Pyrus 
x bretschneideri]
Length=788

 Score =   104 bits (260),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLY +N+F+E+L+E DE+ +KRK
Sbjct  657  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYIENMFDELLKEHDELVSKRK  716

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  717  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  757


 Score = 40.4 bits (93),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRP ET TD E  EI +TK + +
Sbjct  619  HSESMPSTINLREPPSILRPIET-TDNEAAEIIITKLLLQ  657



>ref|XP_009359081.1| PREDICTED: dynamin-related protein 3A-like isoform X5 [Pyrus 
x bretschneideri]
 ref|XP_009359156.1| PREDICTED: dynamin-related protein 3A-like isoform X5 [Pyrus 
x bretschneideri]
Length=774

 Score =   104 bits (260),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLY +N+F+E+L+E DE+ +KRK
Sbjct  643  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYIENMFDELLKEHDELVSKRK  702

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  703  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  743


 Score = 40.8 bits (94),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRP ET TD E  EI +TK + +
Sbjct  605  HSESMPSTINLREPPSILRPIET-TDNEAAEIIITKLLLQ  643



>ref|XP_009359080.1| PREDICTED: dynamin-related protein 3A-like isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009359155.1| PREDICTED: dynamin-related protein 3A-like isoform X4 [Pyrus 
x bretschneideri]
Length=779

 Score =   104 bits (260),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLY +N+F+E+L+E DE+ +KRK
Sbjct  648  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYIENMFDELLKEHDELVSKRK  707

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  708  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  748


 Score = 40.4 bits (93),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRP ET TD E  EI +TK + +
Sbjct  610  HSESMPSTINLREPPSILRPIET-TDNEAAEIIITKLLLQ  648



>ref|XP_009359082.1| PREDICTED: dynamin-related protein 3A-like isoform X6 [Pyrus 
x bretschneideri]
 ref|XP_009359157.1| PREDICTED: dynamin-related protein 3A-like isoform X6 [Pyrus 
x bretschneideri]
Length=765

 Score =   104 bits (260),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLY +N+F+E+L+E DE+ +KRK
Sbjct  634  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYIENMFDELLKEHDELVSKRK  693

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  694  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  734


 Score = 40.8 bits (94),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRP ET TD E  EI +TK + +
Sbjct  596  HSESMPSTINLREPPSILRPIET-TDNEAAEIIITKLLLQ  634



>ref|XP_009359077.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009359152.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Pyrus 
x bretschneideri]
Length=840

 Score =   104 bits (259),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLY +N+F+E+L+E DE+ +KRK
Sbjct  709  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYIENMFDELLKEHDELVSKRK  768

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  769  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  809


 Score = 40.4 bits (93),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRP ET TD E  EI +TK + +
Sbjct  671  HSESMPSTINLREPPSILRPIET-TDNEAAEIIITKLLLQ  709



>ref|XP_009359078.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009359153.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Pyrus 
x bretschneideri]
Length=826

 Score =   104 bits (259),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN TK+ L   FI+KLY +N+F+E+L+E DE+ +KRK
Sbjct  695  QSYYDIVRKNMQDLVPKAIMHFLVNSTKQNLQTAFIQKLYIENMFDELLKEHDELVSKRK  754

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPD-PTGLPKI  528
            R      V +Q+ +TL+++  +  S  +  SL  D   GLP+I
Sbjct  755  RNEKLFEVFKQSLQTLEKVEFDVSS--QTSSLGTDFSVGLPRI  795


 Score = 40.4 bits (93),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 4/40 (10%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            HS SM   I+LREPPS+LRP ET TD E  EI +TK + +
Sbjct  657  HSESMPSTINLREPPSILRPIET-TDNEAAEIIITKLLLQ  695



>emb|CDP18852.1| unnamed protein product [Coffea canephora]
Length=774

 Score =   107 bits (267),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKN++D VPKAIMHFLVN  +R+L  +FIKKLYR++LFEE+LQE D+   KRK
Sbjct  673  QSYYDIVRKNVQDLVPKAIMHFLVNDIRRDLLGIFIKKLYRESLFEELLQEHDDDVMKRK  732

Query  653  RTRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDPTGLPKIH  525
            +T +   +LQQA +TL ++  +  S     S + D + LP+ H
Sbjct  733  QTGEMFLILQQAIQTLGKVVADVSSTTPS-SDTDDASILPRFH  774


 Score = 33.9 bits (76),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTVAE  832
            S+IHL EPPS+LRP E  T+ +T EI V K + +
Sbjct  641  SIIHLTEPPSLLRPLERGTEYQT-EIIVMKLLLQ  673



>ref|XP_008379402.1| PREDICTED: dynamin-related protein 3A-like [Malus domestica]
Length=703

 Score = 99.8 bits (247),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNI+D VPKAIMHFLVN T + L   FI+KLYR+NLFEE+L+E DE+ +KRK
Sbjct  617  KSYYDIVRKNIQDLVPKAIMHFLVNSTIKNLQTGFIQKLYRENLFEELLKEHDELDSKRK  676

Query  653  RTRDTLRVLQQAFKTLDELPLEAES  579
              +    VL+Q+ +TL+++  +  +
Sbjct  677  CDQKLYEVLKQSLQTLEKVEFDVST  701


 Score = 40.0 bits (92),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 4/38 (11%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS SM   I+LREPPS+LRP ET T+ E  EI VTK++
Sbjct  579  HSESMPSTINLREPPSILRPVET-TENEAAEIIVTKSL  615



>ref|XP_009363360.1| PREDICTED: dynamin-related protein 3A-like [Pyrus x bretschneideri]
Length=703

 Score =   100 bits (250),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SYYDIVRKNI+D VPKAIMHFLVN T + L   FI+KLYR+NLFEE+L+E DE+ +KRK
Sbjct  617  KSYYDIVRKNIQDLVPKAIMHFLVNSTIKNLQTGFIQKLYRENLFEELLKEHDELDSKRK  676

Query  653  RTRDTLRVLQQAFKTLDELPLEAES  579
              +    VL+Q+ +TL+++  +  +
Sbjct  677  CDQKLFEVLKQSLQTLEKVEFDVST  701


 Score = 39.3 bits (90),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 4/38 (11%)
 Frame = -2

Query  942  HSISM---IHLREPPSVLRPTETHTDQETIEITVTKTV  838
            HS SM   I+LREPPS+LRP ET T+ E  EI VTK +
Sbjct  579  HSESMPPTINLREPPSILRPVET-TENEAAEIIVTKLL  615



>ref|XP_010324550.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Solanum 
lycopersicum]
Length=772

 Score =   103 bits (257),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SYYDIVR+NI+D VPKAIMH+LVNH KR L   FI+KLYR+NL+E++L+E D+V  +R+ 
Sbjct  663  SYYDIVRRNIQDLVPKAIMHYLVNHAKRNLLGTFIEKLYRENLYEDLLREHDDVVIQRRT  722

Query  650  TRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP  546
            T +    L+QA +TLDE   +  ++    S+   P
Sbjct  723  TAEMCNALRQAVETLDEFVADVSTLSSSDSMDALP  757


 Score = 32.0 bits (71),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -2

Query  930  MIHLREPPSVLRPTETHTDQETIEITVTK  844
            +I L+ PP VLRP ET T+ + +EI VTK
Sbjct  631  VIQLKNPPLVLRPGETETEYQ-VEIIVTK  658



>ref|XP_004244503.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Solanum 
lycopersicum]
Length=740

 Score =   103 bits (257),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SYYDIVR+NI+D VPKAIMH+LVNH KR L   FI+KLYR+NL+E++L+E D+V  +R+ 
Sbjct  631  SYYDIVRRNIQDLVPKAIMHYLVNHAKRNLLGTFIEKLYRENLYEDLLREHDDVVIQRRT  690

Query  650  TRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP  546
            T +    L+QA +TLDE   +  ++    S+   P
Sbjct  691  TAEMCNALRQAVETLDEFVADVSTLSSSDSMDALP  725


 Score = 32.0 bits (71),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -2

Query  930  MIHLREPPSVLRPTETHTDQETIEITVTK  844
            +I L+ PP VLRP ET T+ + +EI VTK
Sbjct  599  VIQLKNPPLVLRPGETETEYQ-VEIIVTK  626



>ref|XP_006357068.1| PREDICTED: dynamin-related protein 3A-like [Solanum tuberosum]
Length=740

 Score =   102 bits (255),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SYYDIVR+NI+D VPKAIMH+LVNH KR L   FI+KLYR+NL+E++L+E D+V  +R+ 
Sbjct  631  SYYDIVRRNIQDLVPKAIMHYLVNHAKRNLLGTFIEKLYRENLYEDLLREHDDVVIQRRT  690

Query  650  TRDTLRVLQQAFKTLDELPLEAESVERGYSLSPDP  546
            T +    L+QA +TLDE   +  ++    S+   P
Sbjct  691  TVEMCNALRQAVETLDEFVADVSTLSSSDSMDALP  725


 Score = 32.0 bits (71),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -2

Query  930  MIHLREPPSVLRPTETHTDQETIEITVTK  844
            +I L+ PP VLRP ET T+ + +EI VTK
Sbjct  599  VIQLKNPPPVLRPGETETEYQ-VEIIVTK  626



>ref|XP_010692951.1| PREDICTED: dynamin-related protein 3A-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=807

 Score = 89.0 bits (219),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+DIVRK +ED VPKAIMHF+V+H KR LH+ FI+ +YR+ LFEE+LQE  E   KR+
Sbjct  684  KSYFDIVRKKVEDDVPKAIMHFVVHHLKRGLHSTFIRAIYREELFEELLQENSEFMEKRE  743

Query  653  RTRDTLRVLQQAFKTLDELPLEA-ESVERGYSLSPDPTGLPKIHGLP  516
            RT +  RVLQ+A +TLDE       S    Y   P  T   K+ G+P
Sbjct  744  RTSEMYRVLQKAVQTLDEFESNIPASNPASYRSQPQQTSSNKLSGVP  790


 Score = 34.7 bits (78),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            S+I L+EP + +RPTE  T+ E  ++ VTKT+
Sbjct  651  SLIQLKEPSATIRPTEAPTEDEQTQVLVTKTL  682



>ref|XP_010692952.1| PREDICTED: dynamin-related protein 3A-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=797

 Score = 86.7 bits (213),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+DIVRK +ED VPKAIMHF+V+H KR LH+ FI+ +YR+ LFEE+LQE  E   KR+
Sbjct  684  KSYFDIVRKKVEDDVPKAIMHFVVHHLKRGLHSTFIRAIYREELFEELLQENSEFMEKRE  743

Query  653  RTRDTLRVLQQAFKTLDEL  597
            RT +  RVLQ+A +TLDE 
Sbjct  744  RTSEMYRVLQKAVQTLDEF  762


 Score = 34.7 bits (78),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -2

Query  933  SMIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            S+I L+EP + +RPTE  T+ E  ++ VTKT+
Sbjct  651  SLIQLKEPSATIRPTEAPTEDEQTQVLVTKTL  682



>ref|XP_009630896.1| PREDICTED: dynamin-related protein 3A-like [Nicotiana tomentosiformis]
Length=92

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 54/82 (66%), Gaps = 4/82 (5%)
 Frame = -3

Query  776  MHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKRTRDTLRVLQQAFKTLDEL  597
            MH+LVNH KR L   FI+KLYR+NLFE+++QE DEV TKR+RT +    LQQA +TLDE 
Sbjct  1    MHYLVNHAKRHLLGTFIEKLYRENLFEDLVQEQDEVVTKRRRTVEMCHALQQAVETLDEF  60

Query  596  PLEAESVERGYSLSPDPTGLPK  531
              +  S +R    S     LPK
Sbjct  61   VADI-STQRS---SDSMDALPK  78



>gb|KDD75260.1| dynamin, partial [Helicosporidium sp. ATCC 50920]
Length=559

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SY+D+VRKN++D VPKA+M F+V H +R+L    I+ LYR+ LF E++ E  +VA+KR  
Sbjct  391  SYFDVVRKNLQDMVPKALMLFMVGHVQRDLQQHLIRSLYREELFAELMTERQDVASKRSH  450

Query  650  TRDTLRVLQQAFKTLDELPLE  588
             +  L+ L+ A  TL+ LP E
Sbjct  451  CQRALKALRAALGTLEALPQE  471



>emb|CDQ91233.1| unnamed protein product [Oncorhynchus mykiss]
Length=129

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+  L +++L E +++A +R 
Sbjct  45   KSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKAGLLDDLLTESEDMAQRRN  104

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ+A + + E+
Sbjct  105  EAADMLKALQKASQVIAEI  123



>ref|XP_010304441.1| PREDICTED: dynamin-1-like protein, partial [Balearica regulorum 
gibbericeps]
Length=183

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+  L +++L E +++A +RK
Sbjct  99   KSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSLLLDDLLTESEDMAQRRK  158

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ+A + + E+
Sbjct  159  EAADMLKALQRASQIIAEI  177



>gb|EMP28527.1| Dynamin-1-like protein [Chelonia mydas]
Length=145

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+  L +++L E +++A +RK
Sbjct  61   KSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSLLLDDLLTESEDMAQRRK  120

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ+A + + E+
Sbjct  121  EAADMLKALQRASQIIAEI  139



>gb|KIO24681.1| hypothetical protein M407DRAFT_76640 [Tulasnella calospora MUT 
4182]
Length=810

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SY+ IVR+ I+D VPKAIMH LVNHT +++ N  +  LY+ +LF E+L E D +AT+R R
Sbjct  728  SYFAIVRQTIQDLVPKAIMHLLVNHTSQQVQNRLVSTLYKPDLFAELLHEDDAIATERAR  787

Query  650  TRDTLRVLQQAFKTLDELPLEA  585
             +  L   ++AFKTL E+ L +
Sbjct  788  VKALLDAYKEAFKTLAEVNLTS  809



>gb|KIY51903.1| hypothetical protein FISHEDRAFT_36290 [Fistulina hepatica ATCC 
64428]
Length=766

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -3

Query  827  YYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKRT  648
            Y+DIVR+ I+D VPKAIMHFLVNH  RE+ N  ++ LY+ +LF EML E   +A++R R 
Sbjct  684  YFDIVRQTIQDLVPKAIMHFLVNHASREVQNRLVQSLYKPDLFSEMLNEDPSLASERARV  743

Query  647  RDTLRVLQQAFKTLDELPL  591
            +  L   ++AF+TL ++ +
Sbjct  744  KALLSAYKEAFRTLSDVSV  762



>ref|XP_004348308.1| dynamin central region family protein [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE93730.1| dynamin central region family protein [Capsaspora owczarzaki 
ATCC 30864]
Length=823

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            +Y+ IVRKNI+D+VPKAIMHFLVN  K  + +  + +LYR++LFE ML+E   +A KRK+
Sbjct  739  NYFKIVRKNIQDTVPKAIMHFLVNWIKEHIQSELVSQLYREDLFETMLEESVHIAVKRKQ  798

Query  650  TRDTLRVLQQAFKTLDELPLEAESV  576
              + L  L++A K L E+  +A  V
Sbjct  799  AAEMLSALKRAAKVLVEIRADANVV  823



>dbj|GAA28275.2| dynamin GTPase [Clonorchis sinensis]
Length=691

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSY+ IVRKNI+D+VPKAIMHFLVN+ K  L +  + KLYR + ++ +LQE D VA +R+
Sbjct  607  RSYFLIVRKNIQDTVPKAIMHFLVNYVKDNLQSELVSKLYRQDQYDILLQESDRVAQRRR  666

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ+A + + E+
Sbjct  667  EAADMLKALQKASQIIGEI  685



>gb|AAD22412.1| dynamin-like protein variant 4 [Rattus norvegicus]
Length=252

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+ +L +++L E +++A +RK
Sbjct  168  KSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRK  227

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ A + + E+
Sbjct  228  EAADMLKALQGASQIIAEI  246



>gb|KDO44159.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=699

 Score = 55.5 bits (132),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVN  759
            RSYYDIVRKNIEDS+PKA+MHFLVN
Sbjct  662  RSYYDIVRKNIEDSIPKAVMHFLVN  686


 Score = 55.1 bits (131),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ +MIHLREPP++LRP+E+H++QE +EI VTK
Sbjct  626  HAFAMIHLREPPTILRPSESHSEQENVEIAVTK  658



>ref|XP_009176405.1| hypothetical protein T265_11475 [Opisthorchis viverrini]
 gb|KER19845.1| hypothetical protein T265_11475 [Opisthorchis viverrini]
Length=991

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSY+ IVRKNI+D+VPKAIMHFLVN+ K  L +  + KLYR   ++ +LQE D VA +R+
Sbjct  607  RSYFLIVRKNIQDTVPKAIMHFLVNYVKDNLQSELVSKLYRQEEYDTLLQESDRVAQRRR  666

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ+A + + E+
Sbjct  667  EAADMLKALQKASQIIGEI  685



>ref|XP_002594524.1| hypothetical protein BRAFLDRAFT_87747 [Branchiostoma floridae]
 gb|EEN50535.1| hypothetical protein BRAFLDRAFT_87747 [Branchiostoma floridae]
Length=707

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKAIMHFLVN  K  L +  + +LY+ + F ++LQE D++ T+RK
Sbjct  623  KSYFLIVRKNIQDSVPKAIMHFLVNFVKDNLQSELVSQLYKTDFFSDLLQESDQIGTRRK  682

Query  653  RTRDTLRVLQQAFKTLDEL  597
               + L+ LQ+A   + E+
Sbjct  683  EAAEMLKALQKAGHIISEI  701



>emb|CCA73280.1| probable DNM1-dynamin-related GTPase [Piriformospora indica DSM 
11827]
Length=788

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVR++I+D VPKAIMHFLVNHT +++ N  +  LY+ ++F E+L E + + T+R+
Sbjct  705  KSYFGIVRQSIQDLVPKAIMHFLVNHTSQQVQNRLVSSLYKPDMFVELLHEDETIVTERE  764

Query  653  RTRDTLRVLQQAFKTLDELPLE  588
            R +  L   ++AFKTL E+ ++
Sbjct  765  RVKALLDAYKEAFKTLSEVSVK  786



>emb|CBJ26322.1| Dnm1, dynamin-related GTPase involved in mitochondrial division 
[Ectocarpus siliculosus]
Length=847

 Score = 82.0 bits (201),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            RSY+DI RKN +D VPK IMHFLVN     L N  + KLY+++L  E+++E D+VA +R+
Sbjct  761  RSYFDIARKNFQDLVPKTIMHFLVNDVINMLQNELVSKLYKEDLTGELMRETDDVAERRR  820

Query  653  RTRDTLRVLQQAFKTLDEL  597
             +RD L +L++A   + E+
Sbjct  821  ISRDMLSLLKKAVGIVSEV  839


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -2

Query  930  MIHLREPPSVLRPTETHTDQETIEITVTKTV  838
            M+ L +PP  +R ++  TD+E  E+ + K++
Sbjct  729  MVKLPQPPETMRQSDEPTDRERCEMEIIKSL  759



>ref|XP_011400707.1| Dynamin-1-like protein [Auxenochlorella protothecoides]
 gb|KFM27720.1| Dynamin-1-like protein [Auxenochlorella protothecoides]
Length=604

 Score = 83.6 bits (205),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SY++IVR+N++D VPKA+M FLVN+ +R L    I  LYR+ LFEE++ E ++VA KR  
Sbjct  478  SYFNIVRRNMQDLVPKALMLFLVNNLQRGLQQHLIHTLYREELFEELMTEREDVAAKRSG  537

Query  650  TRDTLRVLQQAFKTLDELPLE  588
                LR L+ A  TL+ LP E
Sbjct  538  CLSALRALRAALVTLEGLPGE  558


 Score = 26.6 bits (57),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = -2

Query  921  LREPPSVLRPTETHTDQETIEITVTKTV  838
            L  PP+ LR     +DQE +++ VT+ +
Sbjct  448  LARPPATLRVPAAMSDQEAVQVDVTRLL  475



>gb|KDO44158.1| hypothetical protein CISIN_1g003355mg [Citrus sinensis]
Length=710

 Score = 55.1 bits (131),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  942  HSISMIHLREPPSVLRPTETHTDQETIEITVTK  844
            H+ +MIHLREPP++LRP+E+H++QE +EI VTK
Sbjct  626  HAFAMIHLREPPTILRPSESHSEQENVEIAVTK  658


 Score = 55.1 bits (131),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHT  753
            RSYYDIVRKNIEDS+PKA+MHFLV+ T
Sbjct  662  RSYYDIVRKNIEDSIPKAVMHFLVSGT  688



>gb|EYC27799.1| hypothetical protein Y032_0008g190 [Ancylostoma ceylanicum]
Length=125

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            R Y+ IVRKN++DSVPKAIMHFLVN+ +  L +  +++LY+ +L E++L E  ++A +RK
Sbjct  41   RKYFMIVRKNVQDSVPKAIMHFLVNYVRDNLQSELVRQLYKPDLLEDLLAETADMAQRRK  100

Query  653  RTRDTLRVLQQAFKTLDEL  597
             T +T++ L QA   + E+
Sbjct  101  ETLETMKALNQASLIISEV  119



>emb|CDH50084.1| dynamin-a [Lichtheimia corymbifera JMRC:FSU:9682]
Length=725

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SY++IVRKNI+D VPKAIMH LVNH++  + N  +  LY++++F +MLQE + VA +R++
Sbjct  647  SYFNIVRKNIQDLVPKAIMHLLVNHSRESVQNRLVASLYKEDIFNDMLQEDENVAAEREK  706

Query  650  TRDTLRVLQQAFKTLD  603
             +  L V +QAF+ ++
Sbjct  707  CKTMLDVYKQAFEIVN  722



>emb|CDS04791.1| hypothetical protein LRAMOSA07321 [Absidia idahoensis var. thermophila]
Length=726

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SY++IVRKNI+D VPKAIMH LVNH++  + N  +  LY++++F +MLQE + VA +R++
Sbjct  648  SYFNIVRKNIQDLVPKAIMHLLVNHSRESVQNRLVASLYKEDIFNDMLQEDENVAAEREK  707

Query  650  TRDTLRVLQQAFKTLD  603
             +  L V +QAF+ ++
Sbjct  708  CKTMLDVYKQAFEIVN  723



>ref|XP_007892869.1| PREDICTED: dynamin-1-like protein isoform X1 [Callorhinchus milii]
Length=730

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+  L E++L E +++A +RK
Sbjct  646  KSYFLIVRKNIQDSVPKAVMHFLVNHVKDNLQSELVGQLYKSMLLEDLLTESEDMAQRRK  705

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ+A + + E+
Sbjct  706  EAADMLKALQRASQVIAEV  724



>ref|XP_008827873.1| PREDICTED: dynamin-1-like protein isoform X4 [Nannospalax galili]
Length=725

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+ +L E++L E +++A +RK
Sbjct  641  KSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLEDLLTESEDMAQRRK  700

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ A + + E+
Sbjct  701  EAADMLKALQGASQIIAEI  719



>ref|XP_007892870.1| PREDICTED: dynamin-1-like protein isoform X2 [Callorhinchus milii]
Length=717

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+  L E++L E +++A +RK
Sbjct  633  KSYFLIVRKNIQDSVPKAVMHFLVNHVKDNLQSELVGQLYKSMLLEDLLTESEDMAQRRK  692

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ+A + + E+
Sbjct  693  EAADMLKALQRASQVIAEV  711



>ref|XP_007892871.1| PREDICTED: dynamin-1-like protein isoform X3 [Callorhinchus milii]
Length=712

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+  L E++L E +++A +RK
Sbjct  628  KSYFLIVRKNIQDSVPKAVMHFLVNHVKDNLQSELVGQLYKSMLLEDLLTESEDMAQRRK  687

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ+A + + E+
Sbjct  688  EAADMLKALQRASQVIAEV  706



>ref|XP_008827872.1| PREDICTED: dynamin-1-like protein isoform X3 [Nannospalax galili]
Length=736

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+ +L E++L E +++A +RK
Sbjct  652  KSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLEDLLTESEDMAQRRK  711

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ A + + E+
Sbjct  712  EAADMLKALQGASQIIAEI  730



>ref|XP_008827871.1| PREDICTED: dynamin-1-like protein isoform X2 [Nannospalax galili]
Length=738

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+ +L E++L E +++A +RK
Sbjct  654  KSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLEDLLTESEDMAQRRK  713

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ A + + E+
Sbjct  714  EAADMLKALQGASQIIAEI  732



>gb|EYC27797.1| hypothetical protein Y032_0008g190 [Ancylostoma ceylanicum]
Length=139

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            R Y+ IVRKN++DSVPKAIMHFLVN+ +  L +  +++LY+ +L E++L E  ++A +RK
Sbjct  55   RKYFMIVRKNVQDSVPKAIMHFLVNYVRDNLQSELVRQLYKPDLLEDLLAETADMAQRRK  114

Query  653  RTRDTLRVLQQAFKTLDEL  597
             T +T++ L QA   + E+
Sbjct  115  ETLETMKALNQASLIISEV  133



>ref|XP_010858873.1| PREDICTED: dynamin-1-like protein isoform X1 [Bison bison bison]
Length=432

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  833  RSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRK  654
            +SY+ IVRKNI+DSVPKA+MHFLVNH K  L +  + +LY+ +L +++L E +++A +RK
Sbjct  348  KSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRK  407

Query  653  RTRDTLRVLQQAFKTLDEL  597
               D L+ LQ A + + E+
Sbjct  408  EAADMLKALQGASQIIAEI  426



>gb|KJA22831.1| hypothetical protein HYPSUDRAFT_201906 [Hypholoma sublateritium 
FD-334 SS-4]
Length=830

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  830  SYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRDNLFEEMLQEPDEVATKRKR  651
            SY++IVR++I+D +PKAIMHFLVNHT +++ N  +  LY+ +LF +ML E + +  +R R
Sbjct  748  SYFNIVRQSIQDIIPKAIMHFLVNHTAQQVQNRLVSSLYKPDLFADMLNEDEALVAERTR  807

Query  650  TRDTLRVLQQAFKTLDELPLEA  585
             +  L   ++AFKTL ++ L++
Sbjct  808  VKALLDAYKEAFKTLSDVSLKS  829



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2254929346230