BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1362

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097926.1|  PREDICTED: probable galacturonosyltransferas...    225   5e-66   Sesamum indicum [beniseed]
ref|XP_006452153.1|  hypothetical protein CICLE_v10007975mg             221   7e-66   
ref|XP_009611117.1|  PREDICTED: probable galacturonosyltransferas...    223   2e-65   Nicotiana tomentosiformis
ref|XP_006352487.1|  PREDICTED: probable galacturonosyltransferas...    223   2e-65   Solanum tuberosum [potatoes]
ref|XP_004248332.1|  PREDICTED: probable galacturonosyltransferas...    223   3e-65   
gb|KDO46375.1|  hypothetical protein CISIN_1g007529mg                   221   4e-65   Citrus sinensis [apfelsine]
ref|XP_006452151.1|  hypothetical protein CICLE_v10007975mg             222   5e-65   
ref|XP_011650538.1|  PREDICTED: probable galacturonosyltransferas...    220   6e-65   Cucumis sativus [cucumbers]
ref|XP_012070727.1|  PREDICTED: probable galacturonosyltransferas...    221   1e-64   Jatropha curcas
ref|XP_002282637.2|  PREDICTED: probable galacturonosyltransferas...    221   1e-64   Vitis vinifera
emb|CAN78125.1|  hypothetical protein VITISV_028754                     221   1e-64   Vitis vinifera
gb|EYU19206.1|  hypothetical protein MIMGU_mgv1a004325mg                221   1e-64   Erythranthe guttata [common monkey flower]
ref|XP_011095315.1|  PREDICTED: probable galacturonosyltransferas...    221   2e-64   
ref|XP_008463444.1|  PREDICTED: probable galacturonosyltransferas...    221   2e-64   Cucumis melo [Oriental melon]
gb|KDO46374.1|  hypothetical protein CISIN_1g007529mg                   222   2e-64   Citrus sinensis [apfelsine]
ref|XP_011650537.1|  PREDICTED: probable galacturonosyltransferas...    221   2e-64   Cucumis sativus [cucumbers]
ref|XP_009794961.1|  PREDICTED: probable galacturonosyltransferas...    220   4e-64   Nicotiana sylvestris
ref|XP_011048284.1|  PREDICTED: probable galacturonosyltransferas...    219   6e-64   Populus euphratica
ref|XP_009792847.1|  PREDICTED: probable galacturonosyltransferas...    219   6e-64   Nicotiana sylvestris
gb|ABP65660.1|  secondary wall-associated glycosyltransferase fam...    218   2e-63   Populus tremula x Populus alba [gray poplar]
ref|XP_006370613.1|  hypothetical protein POPTR_0001s44250g             218   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_009597423.1|  PREDICTED: probable galacturonosyltransferas...    218   2e-63   Nicotiana tomentosiformis
ref|XP_009358091.1|  PREDICTED: probable galacturonosyltransferas...    218   3e-63   Pyrus x bretschneideri [bai li]
gb|ACJ83784.1|  unknown                                                 204   4e-63   Medicago truncatula
ref|XP_003543290.1|  PREDICTED: probable galacturonosyltransferas...    217   5e-63   Glycine max [soybeans]
ref|XP_003540419.1|  PREDICTED: probable galacturonosyltransferas...    216   8e-63   Glycine max [soybeans]
ref|XP_004294339.1|  PREDICTED: probable galacturonosyltransferas...    216   9e-63   Fragaria vesca subsp. vesca
ref|XP_007021085.1|  Glycosyltransferase, CAZy family GT8               216   1e-62   
ref|XP_010267797.1|  PREDICTED: probable galacturonosyltransferas...    216   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_004244158.1|  PREDICTED: probable galacturonosyltransferas...    215   2e-62   Solanum lycopersicum
ref|XP_010092313.1|  putative galacturonosyltransferase 12              215   2e-62   Morus notabilis
ref|XP_006360097.1|  PREDICTED: probable galacturonosyltransferas...    215   2e-62   Solanum tuberosum [potatoes]
emb|CDP05804.1|  unnamed protein product                                214   3e-62   Coffea canephora [robusta coffee]
gb|KHG21333.1|  putative galacturonosyltransferase 12 -like protein     214   6e-62   Gossypium arboreum [tree cotton]
ref|XP_010240964.1|  PREDICTED: probable galacturonosyltransferas...    214   6e-62   Nelumbo nucifera [Indian lotus]
gb|KJB13571.1|  hypothetical protein B456_002G082100                    214   6e-62   Gossypium raimondii
gb|EYU33598.1|  hypothetical protein MIMGU_mgv1a004326mg                214   7e-62   Erythranthe guttata [common monkey flower]
ref|XP_003596616.1|  Glycosyltransferase CAZy family GT8                210   1e-61   
ref|XP_007213904.1|  hypothetical protein PRUPE_ppa004043mg             213   1e-61   Prunus persica
ref|XP_008244342.1|  PREDICTED: probable galacturonosyltransferas...    213   2e-61   Prunus mume [ume]
ref|XP_007149694.1|  hypothetical protein PHAVU_005G091200g             213   2e-61   Phaseolus vulgaris [French bean]
ref|XP_004487615.1|  PREDICTED: probable galacturonosyltransferas...    212   3e-61   Cicer arietinum [garbanzo]
gb|KCW67211.1|  hypothetical protein EUGRSUZ_F00995                     210   4e-61   Eucalyptus grandis [rose gum]
ref|XP_003540035.1|  PREDICTED: probable galacturonosyltransferas...    211   5e-61   Glycine max [soybeans]
ref|XP_008365716.1|  PREDICTED: probable galacturonosyltransferas...    211   8e-61   
ref|XP_008349951.1|  PREDICTED: probable galacturonosyltransferas...    211   1e-60   
ref|XP_008386024.1|  PREDICTED: probable galacturonosyltransferas...    211   1e-60   
ref|XP_003596615.1|  Glycosyltransferase CAZy family GT8                211   1e-60   Medicago truncatula
gb|AFK39430.1|  unknown                                                 211   1e-60   Medicago truncatula
ref|XP_010060438.1|  PREDICTED: probable galacturonosyltransferas...    210   1e-60   Eucalyptus grandis [rose gum]
ref|XP_009355580.1|  PREDICTED: probable galacturonosyltransferas...    210   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_006582240.1|  PREDICTED: probable galacturonosyltransferas...    209   3e-60   Glycine max [soybeans]
gb|KJB81832.1|  hypothetical protein B456_013G164000                    209   3e-60   Gossypium raimondii
gb|KHG10223.1|  putative galacturonosyltransferase 12 -like protein     209   3e-60   Gossypium arboreum [tree cotton]
ref|XP_010931276.1|  PREDICTED: probable galacturonosyltransferas...    207   6e-60   Elaeis guineensis
ref|XP_002317564.1|  hypothetical protein POPTR_0011s13600g             207   3e-59   Populus trichocarpa [western balsam poplar]
ref|XP_011030886.1|  PREDICTED: probable galacturonosyltransferas...    206   3e-59   Populus euphratica
ref|XP_004505435.1|  PREDICTED: probable galacturonosyltransferas...    205   5e-59   
ref|XP_004505434.1|  PREDICTED: probable galacturonosyltransferas...    205   5e-59   Cicer arietinum [garbanzo]
ref|XP_008800493.1|  PREDICTED: probable galacturonosyltransferas...    205   7e-59   Phoenix dactylifera
ref|XP_010908149.1|  PREDICTED: probable galacturonosyltransferas...    206   8e-59   Elaeis guineensis
ref|XP_010448492.1|  PREDICTED: probable galacturonosyltransferas...    195   9e-59   Camelina sativa [gold-of-pleasure]
ref|XP_007132980.1|  hypothetical protein PHAVU_011G141200g             206   1e-58   Phaseolus vulgaris [French bean]
ref|XP_008775922.1|  PREDICTED: probable galacturonosyltransferas...    204   1e-58   Phoenix dactylifera
ref|XP_008775923.1|  PREDICTED: probable galacturonosyltransferas...    204   1e-58   Phoenix dactylifera
ref|XP_003610561.1|  Glycosyltransferase CAZy family GT8                203   3e-58   
gb|AES92758.2|  CAZy family GT8 glycosyltransferase                     203   3e-58   Medicago truncatula
ref|XP_009402871.1|  PREDICTED: probable galacturonosyltransferas...    202   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009402872.1|  PREDICTED: probable galacturonosyltransferas...    202   1e-57   
ref|XP_006281668.1|  hypothetical protein CARUB_v10027804mg             202   2e-57   Capsella rubella
ref|XP_010539273.1|  PREDICTED: probable galacturonosyltransferas...    202   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_002866055.1|  GAUT12/IRX8/LGT6                                   202   3e-57   Arabidopsis lyrata subsp. lyrata
ref|NP_200280.1|  probable galacturonosyltransferase 12                 202   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401545.1|  hypothetical protein EUTSA_v10013202mg             201   7e-57   Eutrema salsugineum [saltwater cress]
ref|XP_010443047.1|  PREDICTED: probable galacturonosyltransferas...    200   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010482877.1|  PREDICTED: probable galacturonosyltransferas...    199   2e-56   Camelina sativa [gold-of-pleasure]
emb|CDY42476.1|  BnaA10g08520D                                          199   2e-56   Brassica napus [oilseed rape]
gb|KFK27082.1|  hypothetical protein AALP_AA8G331600                    199   2e-56   Arabis alpina [alpine rockcress]
ref|XP_009120000.1|  PREDICTED: probable galacturonosyltransferas...    199   2e-56   Brassica rapa
emb|CDY47455.1|  BnaC09g31020D                                          199   2e-56   Brassica napus [oilseed rape]
emb|CDY28757.1|  BnaA02g09490D                                          199   3e-56   Brassica napus [oilseed rape]
ref|XP_010694261.1|  PREDICTED: probable galacturonosyltransferas...    197   1e-55   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY41005.1|  BnaA02g27950D                                          197   2e-55   Brassica napus [oilseed rape]
ref|XP_009397165.1|  PREDICTED: probable galacturonosyltransferas...    197   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009127073.1|  PREDICTED: probable galacturonosyltransferas...    197   2e-55   Brassica rapa
gb|ERM97875.1|  hypothetical protein AMTR_s00115p00091320               195   9e-55   Amborella trichopoda
ref|XP_006830459.2|  PREDICTED: probable galacturonosyltransferas...    194   1e-54   
gb|EPS70108.1|  hypothetical protein M569_04651                         186   1e-51   Genlisea aurea
emb|CAC01746.1|  putative protein                                       172   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011013393.1|  PREDICTED: probable galacturonosyltransferas...    172   4e-48   Populus euphratica
ref|NP_197051.2|  probable galacturonosyltransferase 14                 171   7e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305374.1|  hypothetical protein POPTR_0004s12340g             171   9e-48   
ref|XP_010453684.1|  PREDICTED: probable galacturonosyltransferas...    171   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010492387.1|  PREDICTED: probable galacturonosyltransferas...    171   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010259116.1|  PREDICTED: probable galacturonosyltransferas...    170   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_006287475.1|  hypothetical protein CARUB_v10000686mg             171   1e-47   
ref|XP_010258139.1|  PREDICTED: probable galacturonosyltransferas...    169   2e-47   Nelumbo nucifera [Indian lotus]
gb|KFK25790.1|  hypothetical protein AALP_AA8G160800                    171   2e-47   Arabis alpina [alpine rockcress]
ref|XP_010420207.1|  PREDICTED: probable galacturonosyltransferas...    171   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_011035850.1|  PREDICTED: probable galacturonosyltransferas...    169   3e-47   Populus euphratica
ref|XP_002324094.2|  glycosyl transferase family 8 family protein       169   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006400067.1|  hypothetical protein EUTSA_v10013218mg             169   4e-47   Eutrema salsugineum [saltwater cress]
ref|XP_002873726.1|  hypothetical protein ARALYDRAFT_326001             169   5e-47   
ref|XP_012084793.1|  PREDICTED: probable galacturonosyltransferas...    166   6e-47   
emb|CDX78631.1|  BnaA03g05430D                                          169   6e-47   
ref|XP_012084794.1|  PREDICTED: probable galacturonosyltransferas...    166   7e-47   Jatropha curcas
ref|XP_012084795.1|  PREDICTED: probable galacturonosyltransferas...    166   8e-47   Jatropha curcas
emb|CDX90990.1|  BnaC02g06070D                                          168   1e-46   
ref|XP_002884297.1|  GAUT13                                             167   1e-46   
ref|XP_010417209.1|  PREDICTED: probable galacturonosyltransferas...    166   1e-46   
ref|XP_009131467.1|  PREDICTED: probable galacturonosyltransferas...    167   2e-46   Brassica rapa
ref|XP_009365848.1|  PREDICTED: probable galacturonosyltransferas...    168   2e-46   Pyrus x bretschneideri [bai li]
emb|CDX85550.1|  BnaA02g02630D                                          167   2e-46   
ref|XP_009365847.1|  PREDICTED: probable galacturonosyltransferas...    168   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_007139505.1|  hypothetical protein PHAVU_008G035400g             166   3e-46   Phaseolus vulgaris [French bean]
ref|NP_186753.2|  putative galacturonosyltransferase 13                 166   3e-46   
ref|XP_006297411.1|  hypothetical protein CARUB_v10013435mg             166   3e-46   Capsella rubella
ref|NP_001118545.1|  putative galacturonosyltransferase 13              166   3e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAF26170.1|AC008261_27  unknown protein                              166   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011085730.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    167   4e-46   Sesamum indicum [beniseed]
ref|XP_009134640.1|  PREDICTED: probable galacturonosyltransferas...    167   5e-46   Brassica rapa
ref|XP_009134641.1|  PREDICTED: probable galacturonosyltransferas...    167   5e-46   Brassica rapa
emb|CDX74279.1|  BnaA03g27680D                                          167   6e-46   
gb|KJB75646.1|  hypothetical protein B456_012G049900                    164   7e-46   Gossypium raimondii
gb|KJB75644.1|  hypothetical protein B456_012G049900                    164   7e-46   Gossypium raimondii
ref|XP_011467906.1|  PREDICTED: probable galacturonosyltransferas...    165   7e-46   Fragaria vesca subsp. vesca
ref|XP_004304247.1|  PREDICTED: probable galacturonosyltransferas...    165   7e-46   Fragaria vesca subsp. vesca
ref|XP_008379401.1|  PREDICTED: probable galacturonosyltransferas...    166   7e-46   
ref|XP_002284273.1|  PREDICTED: probable galacturonosyltransferas...    166   8e-46   Vitis vinifera
ref|XP_008379400.1|  PREDICTED: probable galacturonosyltransferas...    166   8e-46   
ref|XP_002526079.1|  Glycosyltransferase QUASIMODO1, putative           166   8e-46   Ricinus communis
emb|CAN68963.1|  hypothetical protein VITISV_019278                     166   8e-46   Vitis vinifera
emb|CBI22287.3|  unnamed protein product                                166   8e-46   Vitis vinifera
ref|XP_010661124.1|  PREDICTED: probable galacturonosyltransferas...    166   9e-46   Vitis vinifera
ref|XP_010089605.1|  putative galacturonosyltransferase 14              167   1e-45   Morus notabilis
ref|XP_009147389.1|  PREDICTED: probable galacturonosyltransferas...    164   1e-45   Brassica rapa
ref|XP_006408454.1|  hypothetical protein EUTSA_v10020487mg             164   1e-45   Eutrema salsugineum [saltwater cress]
ref|XP_009121571.1|  PREDICTED: probable galacturonosyltransferas...    169   1e-45   Brassica rapa
ref|XP_009147387.1|  PREDICTED: probable galacturonosyltransferas...    164   1e-45   Brassica rapa
ref|XP_009121572.1|  PREDICTED: probable galacturonosyltransferas...    169   1e-45   Brassica rapa
gb|KHG03530.1|  putative galacturonosyltransferase 14 -like protein     164   1e-45   Gossypium arboreum [tree cotton]
ref|XP_011098715.1|  PREDICTED: probable galacturonosyltransferas...    164   1e-45   Sesamum indicum [beniseed]
ref|XP_006431227.1|  hypothetical protein CICLE_v10011444mg             164   1e-45   Citrus clementina [clementine]
ref|XP_010525101.1|  PREDICTED: probable galacturonosyltransferas...    164   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_010525102.1|  PREDICTED: probable galacturonosyltransferas...    164   1e-45   Tarenaya hassleriana [spider flower]
gb|KJB40878.1|  hypothetical protein B456_007G081500                    164   1e-45   Gossypium raimondii
emb|CDP02301.1|  unnamed protein product                                165   1e-45   Coffea canephora [robusta coffee]
emb|CDX91967.1|  BnaC03g32690D                                          166   1e-45   
gb|KJB40879.1|  hypothetical protein B456_007G081500                    164   1e-45   Gossypium raimondii
emb|CDX70612.1|  BnaC03g06960D                                          164   1e-45   
ref|XP_010467967.1|  PREDICTED: probable galacturonosyltransferas...    164   2e-45   
emb|CDY26424.1|  BnaC09g42440D                                          168   2e-45   Brassica napus [oilseed rape]
ref|XP_010485434.1|  PREDICTED: probable galacturonosyltransferas...    163   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010485435.1|  PREDICTED: probable galacturonosyltransferas...    163   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009126049.1|  PREDICTED: probable galacturonosyltransferas...    165   2e-45   Brassica rapa
ref|XP_009126048.1|  PREDICTED: probable galacturonosyltransferas...    165   2e-45   Brassica rapa
ref|XP_008661159.1|  PREDICTED: probable galacturonosyltransferas...    160   2e-45   Zea mays [maize]
gb|KJB40877.1|  hypothetical protein B456_007G081500                    163   2e-45   Gossypium raimondii
ref|XP_002443426.1|  hypothetical protein SORBIDRAFT_08g019260          160   2e-45   Sorghum bicolor [broomcorn]
ref|XP_008459373.1|  PREDICTED: probable galacturonosyltransferas...    164   3e-45   Cucumis melo [Oriental melon]
emb|CDX69522.1|  BnaA10g18710D                                          167   3e-45   
gb|KFK37568.1|  hypothetical protein AALP_AA3G000200                    163   3e-45   Arabis alpina [alpine rockcress]
ref|XP_006482685.1|  PREDICTED: probable galacturonosyltransferas...    163   3e-45   Citrus sinensis [apfelsine]
gb|KFK37569.1|  hypothetical protein AALP_AA3G000200                    163   3e-45   Arabis alpina [alpine rockcress]
ref|XP_008459374.1|  PREDICTED: probable galacturonosyltransferas...    164   3e-45   Cucumis melo [Oriental melon]
gb|KDO72667.1|  hypothetical protein CISIN_1g009348mg                   162   3e-45   Citrus sinensis [apfelsine]
ref|XP_009609798.1|  PREDICTED: probable galacturonosyltransferas...    163   3e-45   Nicotiana tomentosiformis
ref|XP_007032681.1|  Galacturonosyltransferase 13 isoform 1             164   4e-45   Theobroma cacao [chocolate]
ref|NP_001145771.1|  uncharacterized protein LOC100279278               160   5e-45   Zea mays [maize]
ref|XP_010317115.1|  PREDICTED: probable galacturonosyltransferas...    163   5e-45   Solanum lycopersicum
ref|XP_004233377.1|  PREDICTED: probable galacturonosyltransferas...    163   5e-45   Solanum lycopersicum
ref|XP_009789618.1|  PREDICTED: probable galacturonosyltransferas...    164   6e-45   Nicotiana sylvestris
ref|XP_009789619.1|  PREDICTED: probable galacturonosyltransferas...    164   6e-45   Nicotiana sylvestris
gb|AES74845.2|  CAZy family GT8 glycosyltransferase                     162   6e-45   Medicago truncatula
ref|XP_009587641.1|  PREDICTED: probable galacturonosyltransferas...    166   6e-45   Nicotiana tomentosiformis
ref|XP_003618627.1|  Glycosyltransferase CAZy family GT8                162   6e-45   
ref|XP_008341637.1|  PREDICTED: probable galacturonosyltransferas...    163   6e-45   Malus domestica [apple tree]
ref|XP_009587642.1|  PREDICTED: probable galacturonosyltransferas...    166   6e-45   Nicotiana tomentosiformis
ref|XP_008341638.1|  PREDICTED: probable galacturonosyltransferas...    163   6e-45   Malus domestica [apple tree]
ref|XP_004141462.1|  PREDICTED: probable galacturonosyltransferas...    162   7e-45   Cucumis sativus [cucumbers]
ref|XP_011656007.1|  PREDICTED: probable galacturonosyltransferas...    162   7e-45   Cucumis sativus [cucumbers]
ref|XP_003552555.1|  PREDICTED: probable galacturonosyltransferas...    162   7e-45   Glycine max [soybeans]
gb|KHN13575.1|  Putative galacturonosyltransferase 14                   162   7e-45   Glycine soja [wild soybean]
ref|XP_008341635.1|  PREDICTED: probable galacturonosyltransferas...    162   7e-45   Malus domestica [apple tree]
ref|XP_008341636.1|  PREDICTED: probable galacturonosyltransferas...    162   8e-45   Malus domestica [apple tree]
ref|XP_004491881.1|  PREDICTED: probable galacturonosyltransferas...    164   8e-45   Cicer arietinum [garbanzo]
dbj|BAJ86151.1|  predicted protein                                      164   9e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009360555.1|  PREDICTED: probable galacturonosyltransferas...    162   1e-44   
ref|XP_009360552.1|  PREDICTED: probable galacturonosyltransferas...    162   1e-44   
ref|XP_009360554.1|  PREDICTED: probable galacturonosyltransferas...    162   1e-44   
ref|XP_003531845.1|  PREDICTED: probable galacturonosyltransferas...    161   1e-44   Glycine max [soybeans]
ref|XP_008658926.1|  PREDICTED: uncharacterized protein LOC100384...    160   1e-44   Zea mays [maize]
gb|KHG04367.1|  putative galacturonosyltransferase 13 -like protein     160   1e-44   Gossypium arboreum [tree cotton]
ref|XP_010550020.1|  PREDICTED: probable galacturonosyltransferas...    160   1e-44   Tarenaya hassleriana [spider flower]
ref|XP_006363419.1|  PREDICTED: probable galacturonosyltransferas...    162   1e-44   Solanum tuberosum [potatoes]
ref|XP_010550021.1|  PREDICTED: probable galacturonosyltransferas...    160   1e-44   Tarenaya hassleriana [spider flower]
ref|XP_008658925.1|  PREDICTED: uncharacterized protein LOC100384...    160   1e-44   
ref|XP_006363420.1|  PREDICTED: probable galacturonosyltransferas...    161   2e-44   Solanum tuberosum [potatoes]
ref|XP_010551819.1|  PREDICTED: probable galacturonosyltransferas...    164   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_003558510.1|  PREDICTED: probable galacturonosyltransferas...    163   2e-44   Brachypodium distachyon [annual false brome]
ref|XP_010551820.1|  PREDICTED: probable galacturonosyltransferas...    164   2e-44   Tarenaya hassleriana [spider flower]
gb|ABF94604.1|  Glycosyl transferase family 8 protein, expressed        160   2e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009629907.1|  PREDICTED: probable galacturonosyltransferas...    162   2e-44   Nicotiana tomentosiformis
ref|XP_009629908.1|  PREDICTED: probable galacturonosyltransferas...    162   2e-44   Nicotiana tomentosiformis
gb|EEC74744.1|  hypothetical protein OsI_10497                          160   2e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_006338386.1|  PREDICTED: probable galacturonosyltransferas...    163   2e-44   Solanum tuberosum [potatoes]
ref|XP_004149844.2|  PREDICTED: probable galacturonosyltransferas...    162   3e-44   Cucumis sativus [cucumbers]
ref|XP_009790355.1|  PREDICTED: probable galacturonosyltransferas...    163   3e-44   Nicotiana sylvestris
ref|XP_009790357.1|  PREDICTED: probable galacturonosyltransferas...    163   3e-44   Nicotiana sylvestris
ref|XP_004234296.1|  PREDICTED: probable galacturonosyltransferas...    159   3e-44   Solanum lycopersicum
ref|XP_010317525.1|  PREDICTED: probable galacturonosyltransferas...    159   3e-44   Solanum lycopersicum
ref|XP_004232177.1|  PREDICTED: probable galacturonosyltransferas...    163   3e-44   Solanum lycopersicum
ref|XP_006651162.1|  PREDICTED: probable galacturonosyltransferas...    159   3e-44   
ref|XP_008792744.1|  PREDICTED: probable galacturonosyltransferas...    159   3e-44   Phoenix dactylifera
ref|XP_006837044.1|  PREDICTED: probable galacturonosyltransferas...    160   4e-44   Amborella trichopoda
ref|XP_008230851.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    159   4e-44   
gb|EYU44171.1|  hypothetical protein MIMGU_mgv1a004225mg                166   5e-44   Erythranthe guttata [common monkey flower]
ref|XP_008792745.1|  PREDICTED: probable galacturonosyltransferas...    158   5e-44   
ref|XP_004962991.1|  PREDICTED: probable galacturonosyltransferas...    158   5e-44   Setaria italica
gb|EMS53278.1|  putative galacturonosyltransferase 13                   159   6e-44   Triticum urartu
gb|EYU34622.1|  hypothetical protein MIMGU_mgv1a004198mg                161   6e-44   Erythranthe guttata [common monkey flower]
ref|XP_008450151.1|  PREDICTED: probable galacturonosyltransferas...    161   6e-44   Cucumis melo [Oriental melon]
ref|XP_010936345.1|  PREDICTED: probable galacturonosyltransferas...    157   6e-44   Elaeis guineensis
gb|KHF97963.1|  putative galacturonosyltransferase 14 -like protein     159   7e-44   Gossypium arboreum [tree cotton]
ref|XP_006363745.1|  PREDICTED: probable galacturonosyltransferas...    159   7e-44   Solanum tuberosum [potatoes]
ref|NP_001170288.1|  uncharacterized protein LOC100384251               159   7e-44   
gb|EMT08056.1|  Glycosyltransferase QUASIMODO1                          159   7e-44   
ref|XP_006363746.1|  PREDICTED: probable galacturonosyltransferas...    159   8e-44   Solanum tuberosum [potatoes]
ref|XP_007151294.1|  hypothetical protein PHAVU_004G034200g             160   8e-44   Phaseolus vulgaris [French bean]
ref|XP_007151295.1|  hypothetical protein PHAVU_004G034200g             160   9e-44   Phaseolus vulgaris [French bean]
dbj|BAJ97300.1|  predicted protein                                      158   1e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006363750.1|  PREDICTED: probable galacturonosyltransferas...    158   1e-43   Solanum tuberosum [potatoes]
ref|XP_007217256.1|  hypothetical protein PRUPE_ppa004045mg             157   2e-43   Prunus persica
ref|XP_006603903.1|  PREDICTED: probable galacturonosyltransferas...    159   2e-43   Glycine max [soybeans]
ref|XP_003554778.1|  PREDICTED: probable galacturonosyltransferas...    159   2e-43   Glycine max [soybeans]
ref|XP_008646847.1|  PREDICTED: uncharacterized protein LOC100501...    156   2e-43   
ref|XP_006603900.1|  PREDICTED: probable galacturonosyltransferas...    159   2e-43   Glycine max [soybeans]
ref|XP_001755223.1|  predicted protein                                  162   3e-43   
ref|XP_009603903.1|  PREDICTED: probable galacturonosyltransferas...    159   3e-43   Nicotiana tomentosiformis
ref|XP_006603901.1|  PREDICTED: probable galacturonosyltransferas...    158   3e-43   Glycine max [soybeans]
ref|XP_006603902.1|  PREDICTED: probable galacturonosyltransferas...    158   3e-43   Glycine max [soybeans]
ref|XP_010032534.1|  PREDICTED: probable galacturonosyltransferas...    157   4e-43   Eucalyptus grandis [rose gum]
ref|XP_004985228.1|  PREDICTED: probable galacturonosyltransferas...    157   4e-43   Setaria italica
ref|XP_008805098.1|  PREDICTED: probable galacturonosyltransferas...    157   5e-43   Phoenix dactylifera
ref|XP_003543923.1|  PREDICTED: probable galacturonosyltransferas...    157   5e-43   
ref|XP_006593688.1|  PREDICTED: probable galacturonosyltransferas...    157   5e-43   Glycine max [soybeans]
ref|XP_008785954.1|  PREDICTED: probable galacturonosyltransferas...    156   9e-43   Phoenix dactylifera
ref|XP_010670180.1|  PREDICTED: probable galacturonosyltransferas...    157   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010904951.1|  PREDICTED: probable galacturonosyltransferas...    152   1e-42   Elaeis guineensis
ref|XP_010670179.1|  PREDICTED: probable galacturonosyltransferas...    157   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010904952.1|  PREDICTED: probable galacturonosyltransferas...    152   1e-42   Elaeis guineensis
ref|XP_006664673.1|  PREDICTED: probable galacturonosyltransferas...    158   1e-42   
ref|XP_009786493.1|  PREDICTED: probable galacturonosyltransferas...    156   1e-42   Nicotiana sylvestris
ref|XP_002983680.1|  galacturonosyltransferase GAUT12/13/14/15-li...    156   2e-42   
ref|NP_001182871.1|  uncharacterized protein LOC100501135               155   2e-42   
ref|XP_010923584.1|  PREDICTED: probable galacturonosyltransferas...    154   3e-42   Elaeis guineensis
ref|XP_010939115.1|  PREDICTED: probable galacturonosyltransferas...    153   5e-42   
ref|XP_010939106.1|  PREDICTED: probable galacturonosyltransferas...    153   5e-42   Elaeis guineensis
ref|XP_003621361.1|  Glycosyltransferase CAZy family GT8                152   6e-42   
ref|XP_011628840.1|  PREDICTED: probable galacturonosyltransferas...    159   1e-41   
ref|XP_010029326.1|  PREDICTED: probable galacturonosyltransferas...    152   1e-41   Eucalyptus grandis [rose gum]
gb|EPS71758.1|  hypothetical protein M569_02993                         154   1e-41   Genlisea aurea
gb|ERN20473.1|  hypothetical protein AMTR_s00068p00156710               159   2e-41   Amborella trichopoda
ref|XP_009388912.1|  PREDICTED: probable galacturonosyltransferas...    151   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001755587.1|  predicted protein                                  155   4e-41   
ref|XP_009399119.1|  PREDICTED: probable galacturonosyltransferas...    151   4e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399120.1|  PREDICTED: probable galacturonosyltransferas...    151   5e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001753633.1|  predicted protein                                  152   7e-41   
gb|EAY83641.1|  hypothetical protein OsI_38869                          156   7e-41   Oryza sativa Indica Group [Indian rice]
gb|EYU34623.1|  hypothetical protein MIMGU_mgv1a004198mg                150   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_009397279.1|  PREDICTED: probable galacturonosyltransferas...    151   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397278.1|  PREDICTED: probable galacturonosyltransferas...    151   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001067123.1|  Os12g0578500                                       156   2e-40   
ref|XP_003578583.1|  PREDICTED: probable galacturonosyltransferas...    155   4e-40   Brachypodium distachyon [annual false brome]
ref|XP_009398279.1|  PREDICTED: probable galacturonosyltransferas...    153   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB75645.1|  hypothetical protein B456_012G049900                    142   5e-39   Gossypium raimondii
gb|EMS58544.1|  putative galacturonosyltransferase 14                   143   7e-39   Triticum urartu
gb|AES77579.2|  CAZy family GT8 glycosyltransferase                     144   7e-39   Medicago truncatula
gb|EMT07847.1|  Glycosyltransferase QUASIMODO1                          143   9e-39   
gb|EPS70077.1|  hypothetical protein M569_04673                         145   1e-38   
ref|XP_006363747.1|  PREDICTED: probable galacturonosyltransferas...    140   3e-38   
ref|XP_002279893.1|  PREDICTED: probable galacturonosyltransferas...    142   7e-36   
ref|XP_010656938.1|  PREDICTED: probable galacturonosyltransferas...    142   7e-36   
ref|XP_010656939.1|  PREDICTED: probable galacturonosyltransferas...    142   7e-36   
ref|XP_010656940.1|  PREDICTED: probable galacturonosyltransferas...    142   7e-36   
gb|AEW07688.1|  hypothetical protein 0_8844_01                          134   1e-35   
gb|KHN11952.1|  Putative galacturonosyltransferase 15                   142   1e-35   
ref|XP_003545139.1|  PREDICTED: probable galacturonosyltransferas...    142   1e-35   
ref|XP_010272676.1|  PREDICTED: probable galacturonosyltransferas...    142   1e-35   
gb|AEW07687.1|  hypothetical protein 0_8844_01                          134   2e-35   
gb|AFB33053.1|  hypothetical protein 0_8844_01                          134   2e-35   
emb|CDY46691.1|  BnaA03g48170D                                          132   2e-35   
emb|CDX81485.1|  BnaC02g17890D                                          131   4e-35   
ref|XP_008229394.1|  PREDICTED: probable galacturonosyltransferas...    135   5e-35   
gb|AFB33057.1|  hypothetical protein 0_8844_01                          132   6e-35   
gb|AFG60469.1|  hypothetical protein 0_8844_01                          132   6e-35   
ref|XP_007048827.1|  Galacturonosyltransferase 15                       140   7e-35   
gb|AFG60465.1|  hypothetical protein 0_8844_01                          132   8e-35   
ref|XP_009407928.1|  PREDICTED: probable galacturonosyltransferase 4    130   2e-34   
gb|AFG60473.1|  hypothetical protein 0_8844_01                          130   2e-34   
ref|XP_007215390.1|  hypothetical protein PRUPE_ppa005810mg             134   4e-34   
gb|EPS68595.1|  hypothetical protein M569_06174                         129   4e-34   
gb|ABR25403.1|  transferase (transferring glycosyl group)               126   5e-34   
gb|KHG22010.1|  putative galacturonosyltransferase 15 -like protein     137   5e-34   
ref|XP_003518517.1|  PREDICTED: probable galacturonosyltransferas...    137   6e-34   
ref|XP_009802396.1|  PREDICTED: probable galacturonosyltransferas...    126   6e-34   
ref|XP_009802392.1|  PREDICTED: probable galacturonosyltransferas...    126   7e-34   
gb|KHN38308.1|  Putative galacturonosyltransferase 15                   137   7e-34   
gb|KHM99621.1|  Putative galacturonosyltransferase 15                   136   8e-34   
ref|XP_002520380.1|  Glycosyltransferase QUASIMODO1, putative           135   1e-33   
ref|XP_010272524.1|  PREDICTED: probable galacturonosyltransferase 4    124   1e-33   
ref|XP_007146361.1|  hypothetical protein PHAVU_006G034100g             132   1e-33   
ref|XP_002882224.1|  hypothetical protein ARALYDRAFT_477468             127   1e-33   
ref|XP_003532100.1|  PREDICTED: probable galacturonosyltransferas...    137   1e-33   
ref|XP_008235436.1|  PREDICTED: galacturonosyltransferase 8             129   1e-33   
gb|KJB75454.1|  hypothetical protein B456_012G042500                    135   1e-33   
ref|XP_006348942.1|  PREDICTED: probable galacturonosyltransferas...    137   1e-33   
ref|XP_009379995.1|  PREDICTED: galacturonosyltransferase 8-like        130   1e-33   
gb|KJB75449.1|  hypothetical protein B456_012G042500                    135   1e-33   
gb|KJB75453.1|  hypothetical protein B456_012G042500                    135   1e-33   
ref|XP_007201169.1|  hypothetical protein PRUPE_ppa003603mg             129   1e-33   
gb|KJB75455.1|  hypothetical protein B456_012G042500                    135   1e-33   
gb|EYU33824.1|  hypothetical protein MIMGU_mgv1a002625mg                128   2e-33   
gb|KJB75448.1|  hypothetical protein B456_012G042500                    136   2e-33   
ref|XP_004243233.1|  PREDICTED: probable galacturonosyltransferas...    136   2e-33   
ref|XP_009762631.1|  PREDICTED: probable galacturonosyltransferas...    135   2e-33   
ref|XP_010246719.1|  PREDICTED: galacturonosyltransferase 8             131   2e-33   
ref|XP_009762630.1|  PREDICTED: probable galacturonosyltransferas...    136   2e-33   
ref|XP_009134662.1|  PREDICTED: probable galacturonosyltransferas...    126   2e-33   
ref|XP_008365620.1|  PREDICTED: probable galacturonosyltransferas...    132   3e-33   
emb|CDX74263.1|  BnaA03g27840D                                          125   3e-33   
emb|CDX91987.1|  BnaC03g32890D                                          125   3e-33   
ref|XP_009377684.1|  PREDICTED: probable galacturonosyltransferas...    132   3e-33   
ref|XP_009134660.1|  PREDICTED: probable galacturonosyltransferas...    125   3e-33   
gb|KDO60918.1|  hypothetical protein CISIN_1g0094682mg                  133   3e-33   
ref|XP_006437201.1|  hypothetical protein CICLE_v10031200mg             133   3e-33   
ref|XP_006484832.1|  PREDICTED: probable galacturonosyltransferas...    133   3e-33   
ref|XP_006408424.1|  hypothetical protein EUTSA_v10020416mg             125   3e-33   
ref|XP_009356653.1|  PREDICTED: probable galacturonosyltransferas...    131   4e-33   
emb|CDP04556.1|  unnamed protein product                                126   4e-33   
ref|XP_010476066.1|  PREDICTED: probable galacturonosyltransferase 9    125   4e-33   
ref|XP_010463640.1|  PREDICTED: probable galacturonosyltransferase 9    125   5e-33   
gb|KDO60919.1|  hypothetical protein CISIN_1g0094682mg                  133   5e-33   
emb|CDY34723.1|  BnaA01g33020D                                          125   5e-33   
gb|KDO65982.1|  hypothetical protein CISIN_1g008561mg                   129   5e-33   
ref|XP_010549958.1|  PREDICTED: probable galacturonosyltransferas...    124   5e-33   
ref|XP_003551912.1|  PREDICTED: probable galacturonosyltransferas...    130   6e-33   
ref|XP_008778166.1|  PREDICTED: galacturonosyltransferase 8-like        130   6e-33   
ref|XP_006479231.1|  PREDICTED: galacturonosyltransferase 8-like        129   6e-33   
ref|XP_008457595.1|  PREDICTED: galacturonosyltransferase 8-like        127   6e-33   
ref|XP_011086294.1|  PREDICTED: probable galacturonosyltransferase 4    124   6e-33   
ref|XP_009117942.1|  PREDICTED: probable galacturonosyltransferase 9    124   7e-33   
gb|KFK37701.1|  hypothetical protein AALP_AA3G017600                    124   7e-33   
gb|EPS62143.1|  hypothetical protein M569_12650                         123   7e-33   
ref|XP_008803497.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    130   7e-33   
ref|XP_010273413.1|  PREDICTED: probable galacturonosyltransferas...    133   8e-33   
ref|XP_010273414.1|  PREDICTED: probable galacturonosyltransferas...    133   8e-33   
ref|XP_011089660.1|  PREDICTED: galacturonosyltransferase 8-like        129   9e-33   
ref|XP_007141382.1|  hypothetical protein PHAVU_008G190700g             132   9e-33   
ref|XP_007141381.1|  hypothetical protein PHAVU_008G190700g             132   9e-33   
ref|XP_009775386.1|  PREDICTED: galacturonosyltransferase 8             128   9e-33   
ref|XP_006437203.1|  hypothetical protein CICLE_v10031200mg             132   9e-33   
gb|KJB10200.1|  hypothetical protein B456_001G188500                    127   9e-33   
ref|XP_011658097.1|  PREDICTED: probable galacturonosyltransferase 4    121   9e-33   
ref|XP_009614844.1|  PREDICTED: galacturonosyltransferase 8             128   9e-33   
ref|XP_010104168.1|  Galacturonosyltransferase 8                        128   9e-33   
gb|KHN18104.1|  Putative galacturonosyltransferase 15                   129   9e-33   
gb|KJB10199.1|  hypothetical protein B456_001G188500                    127   1e-32   
ref|XP_003594361.1|  Galacturonosyltransferase                          119   1e-32   
gb|KJB10198.1|  hypothetical protein B456_001G188500                    127   1e-32   
gb|ABN08854.1|  Glycosyl transferase, family 8                          119   1e-32   
ref|XP_011016525.1|  PREDICTED: probable galacturonosyltransferase 4    122   1e-32   
ref|XP_008458050.1|  PREDICTED: galacturonosyltransferase 8             126   1e-32   
gb|AHL38785.1|  glycosyltransferase                                     127   1e-32   
ref|XP_004149774.1|  PREDICTED: galacturonosyltransferase 8             126   1e-32   
gb|KHG21596.1|  Galacturonosyltransferase 8 -like protein               127   1e-32   
ref|XP_004974813.1|  PREDICTED: probable galacturonosyltransferas...    125   1e-32   
ref|NP_566170.1|  putative galacturonosyltransferase 9                  127   1e-32   
ref|XP_011040102.1|  PREDICTED: probable galacturonosyltransferase 4    122   1e-32   
gb|ABD96904.1|  hypothetical protein                                    124   1e-32   
ref|XP_009612076.1|  PREDICTED: probable galacturonosyltransferas...    134   1e-32   
ref|XP_009612077.1|  PREDICTED: probable galacturonosyltransferas...    133   1e-32   
ref|XP_010558537.1|  PREDICTED: probable galacturonosyltransferase 9    123   1e-32   
gb|EMT19760.1|  Glycosyltransferase QUASIMODO1                          124   1e-32   
ref|XP_012085051.1|  PREDICTED: galacturonosyltransferase 8             127   2e-32   
ref|XP_010908797.1|  PREDICTED: galacturonosyltransferase 8-like        129   2e-32   
gb|KDO78641.1|  hypothetical protein CISIN_1g005035mg                   120   2e-32   
ref|XP_006597630.1|  PREDICTED: probable galacturonosyltransferas...    121   2e-32   
ref|XP_002321071.1|  hypothetical protein POPTR_0014s13860g             132   2e-32   
ref|XP_010052503.1|  PREDICTED: probable galacturonosyltransferas...    122   2e-32   
ref|XP_009610681.1|  PREDICTED: probable galacturonosyltransferase 4    126   2e-32   
ref|XP_009372029.1|  PREDICTED: galacturonosyltransferase 8-like        125   2e-32   
ref|XP_006449975.1|  hypothetical protein CICLE_v10014426mg             120   2e-32   
gb|KJB10196.1|  hypothetical protein B456_001G188500                    127   2e-32   
ref|XP_010052506.1|  PREDICTED: probable galacturonosyltransferas...    122   2e-32   
ref|XP_010661600.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    120   2e-32   
ref|XP_010052508.1|  PREDICTED: probable galacturonosyltransferas...    122   2e-32   
emb|CDY61793.1|  BnaC02g46110D                                          124   2e-32   
ref|XP_010913084.1|  PREDICTED: galacturonosyltransferase 8             129   2e-32   
ref|XP_007032943.1|  Glycosyltransferase isoform 1                      125   2e-32   
gb|KHG16505.1|  Galacturonosyltransferase 8 -like protein               126   2e-32   
ref|XP_008372509.1|  PREDICTED: galacturonosyltransferase 8             125   2e-32   
ref|XP_006339506.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    121   2e-32   
ref|XP_002301803.1|  hypothetical protein POPTR_0002s24790g             127   2e-32   
ref|XP_004229870.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    121   2e-32   
ref|XP_011024611.1|  PREDICTED: galacturonosyltransferase 8             127   2e-32   
ref|XP_007032944.1|  Glycosyltransferase isoform 2                      125   2e-32   
ref|XP_009404224.1|  PREDICTED: galacturonosyltransferase 8-like        128   2e-32   
ref|XP_003572545.1|  PREDICTED: galacturonosyltransferase 8-like        126   2e-32   
ref|XP_010488624.1|  PREDICTED: galacturonosyltransferase 8-like        127   2e-32   
gb|ABK92560.1|  unknown                                                 126   2e-32   
ref|XP_010513952.1|  PREDICTED: galacturonosyltransferase 8-like        127   2e-32   
ref|XP_006297346.1|  hypothetical protein CARUB_v10013365mg             125   2e-32   
emb|CDY61593.1|  BnaC03g74220D                                          126   3e-32   
ref|XP_010466934.1|  PREDICTED: galacturonosyltransferase 8             127   3e-32   
emb|CDX93049.1|  BnaA03g37710D                                          126   3e-32   
ref|XP_002863088.1|  hypothetical protein ARALYDRAFT_497166             127   3e-32   
ref|XP_006418657.1|  hypothetical protein EUTSA_v10002465mg             126   3e-32   
ref|NP_189150.1|  Galacturonosyltransferase 8                           126   3e-32   
ref|XP_006297348.1|  hypothetical protein CARUB_v10013367mg             126   3e-32   
ref|XP_010485478.1|  PREDICTED: probable galacturonosyltransferase 9    125   3e-32   
ref|XP_009589124.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    120   3e-32   
ref|XP_009136103.1|  PREDICTED: galacturonosyltransferase 8             126   3e-32   
gb|EMS51766.1|  Galacturonosyltransferase 8                             127   3e-32   
ref|XP_007026430.1|  Galacturonosyltransferase 4 isoform 1              121   3e-32   
gb|EYU40627.1|  hypothetical protein MIMGU_mgv1a003761mg                127   3e-32   
ref|XP_010319211.1|  PREDICTED: probable galacturonosyltransferas...    124   3e-32   
ref|XP_004236640.1|  PREDICTED: probable galacturonosyltransferas...    124   3e-32   
ref|XP_007026431.1|  Galacturonosyltransferase 4 isoform 2              121   3e-32   
ref|NP_001046899.1|  Os02g0498700                                       125   4e-32   
ref|XP_010036787.1|  PREDICTED: galacturonosyltransferase 8             126   4e-32   
ref|XP_011460082.1|  PREDICTED: probable galacturonosyltransferas...    121   4e-32   
ref|XP_011460081.1|  PREDICTED: probable galacturonosyltransferas...    121   4e-32   
gb|EEC73220.1|  hypothetical protein OsI_07307                          125   4e-32   
ref|XP_006350232.1|  PREDICTED: probable galacturonosyltransferas...    122   4e-32   
ref|XP_006350235.1|  PREDICTED: probable galacturonosyltransferas...    122   4e-32   
ref|XP_011460080.1|  PREDICTED: probable galacturonosyltransferas...    121   4e-32   
dbj|BAD23465.1|  putative glycosyl transferase                          125   4e-32   
ref|XP_004290178.1|  PREDICTED: galacturonosyltransferase 8             124   4e-32   
ref|XP_006648647.1|  PREDICTED: galacturonosyltransferase 8-like        125   5e-32   
ref|XP_004486385.1|  PREDICTED: probable galacturonosyltransferas...    120   5e-32   
dbj|BAD94466.1|  hypothetical protein                                   126   5e-32   
ref|XP_009107093.1|  PREDICTED: probable galacturonosyltransferase 4    121   5e-32   
ref|XP_008382600.1|  PREDICTED: galacturonosyltransferase 8-like        125   6e-32   
gb|EYU27625.1|  hypothetical protein MIMGU_mgv1a004359mg                124   6e-32   
emb|CDX77366.1|  BnaA07g05040D                                          125   6e-32   
ref|XP_004952528.1|  PREDICTED: galacturonosyltransferase 8-like        126   6e-32   
emb|CDP08918.1|  unnamed protein product                                118   6e-32   
ref|XP_006352682.1|  PREDICTED: galacturonosyltransferase 8-like        125   7e-32   
gb|KJB09887.1|  hypothetical protein B456_001G172800                    121   7e-32   
dbj|BAK03588.1|  predicted protein                                      125   7e-32   
ref|XP_003552108.1|  PREDICTED: galacturonosyltransferase 8-like        126   7e-32   
gb|KJB08802.1|  hypothetical protein B456_001G104800                    124   7e-32   
ref|NP_001242612.1|  uncharacterized protein LOC100817076               126   7e-32   
gb|KHG01394.1|  Alpha-1,4-galacturonosyltransferase 1                   120   7e-32   
ref|XP_010549955.1|  PREDICTED: probable galacturonosyltransferas...    120   8e-32   
ref|XP_009372229.1|  PREDICTED: galacturonosyltransferase 8-like        125   8e-32   
ref|XP_009102430.1|  PREDICTED: galacturonosyltransferase 8-like        125   8e-32   
gb|AFW71494.1|  hypothetical protein ZEAMMB73_252708                    125   8e-32   
ref|XP_006584621.1|  PREDICTED: uncharacterized protein LOC100817...    125   8e-32   
ref|XP_008775901.1|  PREDICTED: probable galacturonosyltransferase 4    120   8e-32   
ref|XP_009398760.1|  PREDICTED: probable galacturonosyltransferas...    119   8e-32   
ref|XP_010056256.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    119   8e-32   
ref|XP_012066530.1|  PREDICTED: probable galacturonosyltransferas...    127   9e-32   
ref|XP_009785495.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    119   9e-32   
ref|XP_006467237.1|  PREDICTED: probable galacturonosyltransferas...    120   9e-32   
ref|XP_012066531.1|  PREDICTED: probable galacturonosyltransferas...    126   9e-32   
gb|KDO78642.1|  hypothetical protein CISIN_1g005035mg                   119   9e-32   
ref|XP_002453869.1|  hypothetical protein SORBIDRAFT_04g020140          125   9e-32   
ref|XP_002530802.1|  Glycosyltransferase QUASIMODO1, putative           123   9e-32   
gb|KDO78639.1|  hypothetical protein CISIN_1g005035mg                   120   9e-32   
ref|XP_010532909.1|  PREDICTED: galacturonosyltransferase 8-like        125   9e-32   
ref|XP_009398761.1|  PREDICTED: probable galacturonosyltransferas...    119   1e-31   
gb|ABD65461.1|  transferring glycosyl protein                           125   1e-31   
ref|XP_009616855.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    117   1e-31   
ref|XP_006449976.1|  hypothetical protein CICLE_v10014426mg             119   1e-31   
gb|KJB08801.1|  hypothetical protein B456_001G104800                    124   1e-31   
ref|XP_003535002.1|  PREDICTED: probable galacturonosyltransferas...    119   1e-31   
ref|XP_010527263.1|  PREDICTED: galacturonosyltransferase 8             124   1e-31   
gb|KHN40761.1|  Putative galacturonosyltransferase 4                    119   1e-31   
ref|XP_007142473.1|  hypothetical protein PHAVU_008G283600g             125   1e-31   
ref|XP_007049694.1|  Nucleotide-diphospho-sugar transferases supe...    124   1e-31   
ref|XP_007140673.1|  hypothetical protein PHAVU_008G132200g             125   1e-31   
ref|XP_011074569.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    119   1e-31   
ref|XP_010942295.1|  PREDICTED: probable galacturonosyltransferase 4    117   1e-31   
ref|XP_009777396.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    116   1e-31   
ref|XP_002444200.1|  hypothetical protein SORBIDRAFT_07g014890          120   1e-31   
gb|KHG01393.1|  Alpha-1,4-galacturonosyltransferase 1                   120   1e-31   
ref|NP_001168623.1|  uncharacterized protein LOC100382408               125   1e-31   
ref|XP_002882844.1|  hypothetical protein ARALYDRAFT_478777             119   1e-31   
ref|XP_011033733.1|  PREDICTED: probable galacturonosyltransferas...    129   1e-31   
ref|XP_002532733.1|  Glycosyltransferase QUASIMODO1, putative           124   2e-31   
ref|XP_007147564.1|  hypothetical protein PHAVU_006G135100g             117   2e-31   
ref|XP_010538434.1|  PREDICTED: probable galacturonosyltransferase 4    119   2e-31   
ref|XP_008464310.1|  PREDICTED: probable galacturonosyltransferase 4    121   2e-31   
gb|AID53187.1|  galacturonosyltransferase 8-like protein                123   2e-31   
gb|KJB24654.1|  hypothetical protein B456_004G155600                    119   2e-31   
ref|XP_008232829.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    118   2e-31   
gb|KJB24655.1|  hypothetical protein B456_004G155600                    119   2e-31   
ref|XP_006445203.1|  hypothetical protein CICLE_v10019146mg             117   2e-31   



>ref|XP_011097926.1| PREDICTED: probable galacturonosyltransferase 12 [Sesamum indicum]
Length=533

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWRRTNI+RTYH+W+E+NLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQD
Sbjct  421  LEAWRRTNITRTYHYWIEENLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQD  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+IADA+SAGV+HFNGRAKPWLDIAFPQLR LWTKYV+FSD +IKSCHI AS
Sbjct  481  NTTIADAESAGVIHFNGRAKPWLDIAFPQLRPLWTKYVDFSDRYIKSCHIRAS  533



>ref|XP_006452153.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
 gb|ESR65393.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
Length=389

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS+TYH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  277  LEAWRKTNISQTYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  336

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS ADA+SAGV+HFNGRAKPWLDIAFP+LR LW+KY+NFSD FIKSCHI AS
Sbjct  337  NTSFADAESAGVIHFNGRAKPWLDIAFPKLRPLWSKYINFSDKFIKSCHIRAS  389



>ref|XP_009611117.1| PREDICTED: probable galacturonosyltransferase 12 [Nicotiana tomentosiformis]
Length=537

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS+TYH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVH ID FWHMLGLGYQD
Sbjct  425  LEAWRKTNISQTYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHAIDPFWHMLGLGYQD  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT++A+A++AGV+HFNGRAKPWLDIAFPQLR LWTKYVNFSD FIKSCHI AS
Sbjct  485  NTTVAEAQNAGVIHFNGRAKPWLDIAFPQLRPLWTKYVNFSDKFIKSCHIRAS  537



>ref|XP_006352487.1| PREDICTED: probable galacturonosyltransferase 12-like [Solanum 
tuberosum]
Length=533

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR TNIS  YH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVH ID FWHMLGLGYQD
Sbjct  421  LEAWRETNISEAYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHAIDPFWHMLGLGYQD  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTSI DAKSAGV+HFNGRAKPWLDIAFPQLRSLWTKYVNFSD FI++CHI A+
Sbjct  481  NTSIPDAKSAGVIHFNGRAKPWLDIAFPQLRSLWTKYVNFSDKFIRTCHIRAT  533


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+K+FDPNECAWAYGMNIFD
Sbjct  399  PLISKNFDPNECAWAYGMNIFD  420



>ref|XP_004248332.1| PREDICTED: probable galacturonosyltransferase 12 [Solanum lycopersicum]
Length=537

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR TNIS  YH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVH ID FWHMLGLGYQD
Sbjct  425  LEAWRETNISEAYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHAIDPFWHMLGLGYQD  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTSI DAKSAGV+HFNGRAKPWLDIAFPQLRSLWTKYVNFSD FI++CHI A+
Sbjct  485  NTSIPDAKSAGVIHFNGRAKPWLDIAFPQLRSLWTKYVNFSDKFIRTCHIRAT  537



>gb|KDO46375.1| hypothetical protein CISIN_1g007529mg [Citrus sinensis]
Length=474

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS+TYH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  362  LEAWRKTNISQTYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  421

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS ADA+SAGV+HFNGRAKPWLDIAFP+LR LW+KY+NFSD FIKSCHI AS
Sbjct  422  NTSFADAESAGVIHFNGRAKPWLDIAFPKLRPLWSKYINFSDKFIKSCHIRAS  474



>ref|XP_006452151.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
 ref|XP_006475304.1| PREDICTED: probable galacturonosyltransferase 12-like [Citrus 
sinensis]
 gb|ESR65391.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
Length=533

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS+TYH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISQTYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS ADA+SAGV+HFNGRAKPWLDIAFP+LR LW+KY+NFSD FIKSCHI AS
Sbjct  481  NTSFADAESAGVIHFNGRAKPWLDIAFPKLRPLWSKYINFSDKFIKSCHIRAS  533



>ref|XP_011650538.1| PREDICTED: probable galacturonosyltransferase 12 isoform X2 [Cucumis 
sativus]
Length=441

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVH+ID FWHMLGLGYQ+
Sbjct  329  LEAWRKTNISLTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPFWHMLGLGYQE  388

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS ADA++AGV+HFNGRAKPWL+IAFPQLR LWTKY++FSD FIKSCHI AS
Sbjct  389  NTSFADAETAGVIHFNGRAKPWLEIAFPQLRPLWTKYISFSDKFIKSCHIRAS  441


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++FDPNECAWAYGMNIFD
Sbjct  307  PLIAETFDPNECAWAYGMNIFD  328



>ref|XP_012070727.1| PREDICTED: probable galacturonosyltransferase 12 [Jatropha curcas]
 gb|KDP39045.1| hypothetical protein JCGZ_00802 [Jatropha curcas]
Length=532

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYH WLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  420  LEAWRKTNISLTYHSWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  479

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS+ADA+SAGV+HFNGRAKPWLDIAFPQLR LWTKY+NFSD FI SCHI AS
Sbjct  480  NTSLADAESAGVIHFNGRAKPWLDIAFPQLRPLWTKYINFSDKFINSCHIRAS  532



>ref|XP_002282637.2| PREDICTED: probable galacturonosyltransferase 12 [Vitis vinifera]
 emb|CBI20502.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNISRTYH WL++NLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQD
Sbjct  421  LEAWRKTNISRTYHSWLQENLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQD  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS+ADA+SAGVVHFNGRAKPWL+IAFPQLR LW KYV+FSD FIKSCHI AS
Sbjct  481  NTSLADAESAGVVHFNGRAKPWLEIAFPQLRPLWAKYVDFSDKFIKSCHIRAS  533


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+FDPNECAWAYGMNIFD
Sbjct  399  PLIAKNFDPNECAWAYGMNIFD  420



>emb|CAN78125.1| hypothetical protein VITISV_028754 [Vitis vinifera]
Length=553

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNISRTYH WL++NLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQD
Sbjct  441  LEAWRKTNISRTYHSWLQENLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQD  500

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS+ADA+SAGVVHFNGRAKPWL+IAFPQLR LW KYV+FSD FIKSCHI AS
Sbjct  501  NTSLADAESAGVVHFNGRAKPWLEIAFPQLRPLWAKYVDFSDKFIKSCHIRAS  553


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+FDPNECAWAYGMNIFD
Sbjct  419  PLIAKNFDPNECAWAYGMNIFD  440



>gb|EYU19206.1| hypothetical protein MIMGU_mgv1a004325mg [Erythranthe guttata]
Length=533

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWRRTNISRTYH WLE+NLKSDLSLWQLGTLPPGLIAFHGHVHVI+ FWHMLGLGYQD
Sbjct  421  LEAWRRTNISRTYHFWLEENLKSDLSLWQLGTLPPGLIAFHGHVHVINPFWHMLGLGYQD  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+IADA+SAGVVHFNGRAKPWLDIAFP+LR LWTKYV+FSD FIKSCH+  S
Sbjct  481  NTTIADAESAGVVHFNGRAKPWLDIAFPRLRPLWTKYVDFSDRFIKSCHLRES  533



>ref|XP_011095315.1| PREDICTED: probable galacturonosyltransferase 12 [Sesamum indicum]
Length=534

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNISRTYH WLE+NLKSDLSLWQLGTLPPGLIAFHGHVH+I+ FWHMLGLGYQD
Sbjct  422  LEAWRKTNISRTYHFWLEENLKSDLSLWQLGTLPPGLIAFHGHVHIINPFWHMLGLGYQD  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+I DA+SAGV+HFNGRAKPWLDIAFPQLR LWTKYV+FSD FIKSCHI AS
Sbjct  482  NTTIEDAESAGVIHFNGRAKPWLDIAFPQLRPLWTKYVDFSDRFIKSCHIRAS  534


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA SFDPNECAWAYGMNIFD
Sbjct  400  PLIANSFDPNECAWAYGMNIFD  421



>ref|XP_008463444.1| PREDICTED: probable galacturonosyltransferase 12 [Cucumis melo]
Length=534

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVH+ID FWHMLGLGYQ+
Sbjct  422  LEAWRKTNISLTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHIIDQFWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS ADA++AGV+HFNGRAKPWL+IAFPQLR LWTKY++FSD FIKSCHI AS
Sbjct  482  NTSFADAETAGVIHFNGRAKPWLEIAFPQLRPLWTKYISFSDKFIKSCHIRAS  534


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++FDPNECAWAYGMNIFD
Sbjct  400  PLIAEAFDPNECAWAYGMNIFD  421



>gb|KDO46374.1| hypothetical protein CISIN_1g007529mg [Citrus sinensis]
Length=600

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS+TYH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  488  LEAWRKTNISQTYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  547

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS ADA+SAGV+HFNGRAKPWLDIAFP+LR LW+KY+NFSD FIKSCHI AS
Sbjct  548  NTSFADAESAGVIHFNGRAKPWLDIAFPKLRPLWSKYINFSDKFIKSCHIRAS  600



>ref|XP_011650537.1| PREDICTED: probable galacturonosyltransferase 12 isoform X1 [Cucumis 
sativus]
 gb|KGN56159.1| hypothetical protein Csa_3G081360 [Cucumis sativus]
Length=534

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVH+ID FWHMLGLGYQ+
Sbjct  422  LEAWRKTNISLTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPFWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS ADA++AGV+HFNGRAKPWL+IAFPQLR LWTKY++FSD FIKSCHI AS
Sbjct  482  NTSFADAETAGVIHFNGRAKPWLEIAFPQLRPLWTKYISFSDKFIKSCHIRAS  534


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++FDPNECAWAYGMNIFD
Sbjct  400  PLIAETFDPNECAWAYGMNIFD  421



>ref|XP_009794961.1| PREDICTED: probable galacturonosyltransferase 12 [Nicotiana sylvestris]
Length=537

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS+TYH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVH ID FWHMLGLGYQD
Sbjct  425  LEAWRKTNISQTYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHAIDPFWHMLGLGYQD  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT++A+A++AGV+HFNGRAKPWLDIAFPQLR LWTKYVN SD FIKSCHI A+
Sbjct  485  NTTVAEAQNAGVIHFNGRAKPWLDIAFPQLRPLWTKYVNLSDKFIKSCHIRAT  537



>ref|XP_011048284.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
Length=533

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS+TYHHW+E+NLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISKTYHHWVEENLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS+ADA++AGV+HFNGRAKPWLDIAFPQLR LW KY+NFSD FIK CHI  S
Sbjct  481  NTSLADAETAGVIHFNGRAKPWLDIAFPQLRPLWAKYINFSDKFIKGCHIRPS  533



>ref|XP_009792847.1| PREDICTED: probable galacturonosyltransferase 12 [Nicotiana sylvestris]
Length=537

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR TNIS+ Y +WLEQNLKSDLSLWQLGTLPPGLIAFHGHVH IDSFWHMLGLGYQD
Sbjct  425  LEAWRETNISQAYQYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHAIDSFWHMLGLGYQD  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NTSIADA+SAGV+HFNGRAKPWLDIAFPQLR LWTKYVNFSD FI SCHI
Sbjct  485  NTSIADAQSAGVIHFNGRAKPWLDIAFPQLRPLWTKYVNFSDKFINSCHI  534



>gb|ABP65660.1| secondary wall-associated glycosyltransferase family 8D [Populus 
tremula x Populus alba]
Length=533

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYHHW+E+NLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISTTYHHWVEENLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS+ADA++AGV+HFNGRAKPWLDIAFPQLR LW KY+NFSD FIK CHI  S
Sbjct  481  NTSLADAETAGVIHFNGRAKPWLDIAFPQLRPLWAKYINFSDKFIKGCHIRPS  533



>ref|XP_006370613.1| hypothetical protein POPTR_0001s44250g [Populus trichocarpa]
 gb|ERP67182.1| hypothetical protein POPTR_0001s44250g [Populus trichocarpa]
Length=533

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYHHW+E+NLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISTTYHHWVEENLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS+ADA++AGV+HFNGRAKPWLDIAFPQLR LW KY+NFSD FIK CHI  S
Sbjct  481  NTSLADAETAGVIHFNGRAKPWLDIAFPQLRPLWAKYINFSDKFIKGCHIRPS  533



>ref|XP_009597423.1| PREDICTED: probable galacturonosyltransferase 12 [Nicotiana tomentosiformis]
Length=537

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR TNIS+ Y +WLEQNLKSDLSLWQLGTLPPGLIAFHGHVH I+SFWHMLGLGYQD
Sbjct  425  LEAWRETNISQAYQYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHAIESFWHMLGLGYQD  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NTSIADA+SAGV+HFNGRAKPWLDIAFPQLR LWTKYVNFSD FI SCHI
Sbjct  485  NTSIADAQSAGVIHFNGRAKPWLDIAFPQLRPLWTKYVNFSDKFINSCHI  534



>ref|XP_009358091.1| PREDICTED: probable galacturonosyltransferase 12 [Pyrus x bretschneideri]
Length=532

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  420  LDAWRKTNISLTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  479

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS AD KSAGV+HFNGRAKPWLDIAFP+LR  W KYVNFSD FIK CHITA+
Sbjct  480  NTSSADVKSAGVIHFNGRAKPWLDIAFPKLRPFWAKYVNFSDKFIKGCHITAT  532



>gb|ACJ83784.1| unknown [Medicago truncatula]
Length=117

 Score =   204 bits (520),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWRRTNIS  YHHW+ QN+KSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  6    LEAWRRTNISNKYHHWVAQNIKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  65

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT++ D ++AGV+HFNGRAKPWLDIAFP+LRSLWTKYV+FSD FIKSC+I A
Sbjct  66   NTNVDDVENAGVIHFNGRAKPWLDIAFPELRSLWTKYVDFSDKFIKSCNIRA  117



>ref|XP_003543290.1| PREDICTED: probable galacturonosyltransferase 12-like [Glycine 
max]
 gb|KHN36732.1| Putative galacturonosyltransferase 12 [Glycine soja]
Length=533

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS  YH+W+EQN+KSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISNVYHYWVEQNIKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS  DA+SAGVVHFNGRAKPWL+IAFPQLR LWTKYV+FSD FIKSCHI AS
Sbjct  481  NTSFGDAESAGVVHFNGRAKPWLEIAFPQLRKLWTKYVDFSDKFIKSCHIRAS  533



>ref|XP_003540419.1| PREDICTED: probable galacturonosyltransferase 12-like [Glycine 
max]
 gb|KHN27977.1| Putative galacturonosyltransferase 12 [Glycine soja]
Length=533

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS  YH+W+EQN+KSDLSLWQLGTLPPGLIAFHG+VHVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISNVYHYWVEQNIKSDLSLWQLGTLPPGLIAFHGYVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS ADA+SAGV+HFNGRAKPWL+IAFPQLR LWTKYV+FSD FIKSCHI AS
Sbjct  481  NTSFADAESAGVIHFNGRAKPWLEIAFPQLRKLWTKYVDFSDKFIKSCHIRAS  533



>ref|XP_004294339.1| PREDICTED: probable galacturonosyltransferase 12 [Fragaria vesca 
subsp. vesca]
Length=533

 Score =   216 bits (550),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNISRTYH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLG GYQ+
Sbjct  421  LEAWRKTNISRTYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGFGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS ADAKSAGV+HFNGRAKPWL+IAFP+LR LW KYV+FSD FIK CHI  S
Sbjct  481  NTSAADAKSAGVIHFNGRAKPWLEIAFPKLRPLWAKYVDFSDKFIKGCHIRES  533



>ref|XP_007021085.1| Glycosyltransferase, CAZy family GT8 [Theobroma cacao]
 gb|EOY12610.1| Glycosyltransferase, CAZy family GT8 [Theobroma cacao]
Length=533

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TY+HWLEQNLK+DLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQD
Sbjct  421  LEAWRKTNISLTYYHWLEQNLKTDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQD  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT++ DA++AGV+HFNGRAKPWLDIAFPQLR LW KY++FSD FIK CHI AS
Sbjct  481  NTTLLDAETAGVIHFNGRAKPWLDIAFPQLRPLWAKYIDFSDKFIKGCHIRAS  533


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IAK+FDPNECAWAYGMNIFD
Sbjct  399  PMIAKNFDPNECAWAYGMNIFD  420



>ref|XP_010267797.1| PREDICTED: probable galacturonosyltransferase 12 [Nelumbo nucifera]
Length=535

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNISRTYH+WL +NLKSDLSLWQLGTLPPGLIAFHGHVH+ID FWHMLGLGYQ+
Sbjct  423  LEAWRKTNISRTYHYWLRKNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NTSIADA+ AGV+HFNGRAKPWL+IAFPQLR LW KYV+FSD FIK+CHI A
Sbjct  483  NTSIADAEKAGVIHFNGRAKPWLEIAFPQLRPLWAKYVDFSDKFIKTCHIKA  534



>ref|XP_004244158.1| PREDICTED: probable galacturonosyltransferase 12 [Solanum lycopersicum]
Length=533

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LE WR+TNIS TY++WL+QNLKSDLSLWQLGTLPPGLIAFHGHVH ID FWHMLGLGYQD
Sbjct  421  LEEWRKTNISHTYYYWLQQNLKSDLSLWQLGTLPPGLIAFHGHVHTIDPFWHMLGLGYQD  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT++A+A+SAGV+HFNGRAKPWLDIAFPQLR LWTKYVNFSD  IKSCHI AS
Sbjct  481  NTTLAEAQSAGVIHFNGRAKPWLDIAFPQLRPLWTKYVNFSDKLIKSCHIRAS  533



>ref|XP_010092313.1| putative galacturonosyltransferase 12 [Morus notabilis]
 gb|EXB50947.1| putative galacturonosyltransferase 12 [Morus notabilis]
Length=533

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYHHW+EQNLKSDLSLWQLGTLPPGLIAFHGHV VID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISHTYHHWVEQNLKSDLSLWQLGTLPPGLIAFHGHVQVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+ ADA+SAGV+HFNGRAKPWLDIAFP LR LW KY++FSD FIKSCHI AS
Sbjct  481  NTTFADAESAGVIHFNGRAKPWLDIAFPNLRPLWAKYIDFSDKFIKSCHIRAS  533



>ref|XP_006360097.1| PREDICTED: probable galacturonosyltransferase 12-like [Solanum 
tuberosum]
Length=537

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LE WR+TNIS TY++WL+QNLKSDLSLWQLGTLPPGLIAFHGHVH ID FWHMLGLGYQD
Sbjct  425  LEEWRKTNISHTYYYWLQQNLKSDLSLWQLGTLPPGLIAFHGHVHTIDPFWHMLGLGYQD  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT++A+A+SAGV+HFNGRAKPWLDIAFPQLR LWTKYVNFSD  IKSCHI AS
Sbjct  485  NTTLAEAQSAGVIHFNGRAKPWLDIAFPQLRPLWTKYVNFSDKLIKSCHIRAS  537



>emb|CDP05804.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   214 bits (544),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+T IS+TYH+WL++NLKSDLSLWQLGTLPPGLIAFHGH+HVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTTISQTYHYWLDENLKSDLSLWQLGTLPPGLIAFHGHIHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+I  A++AGV+HFNGRAKPWLDIAFPQLR LWTKY+NFSD FIKSCHI AS
Sbjct  481  NTTIETAENAGVIHFNGRAKPWLDIAFPQLRPLWTKYINFSDKFIKSCHIRAS  533


 Score = 52.8 bits (125),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAKSFDPNECAWAYGMNIFD
Sbjct  399  PLIAKSFDPNECAWAYGMNIFD  420



>gb|KHG21333.1| putative galacturonosyltransferase 12 -like protein [Gossypium 
arboreum]
Length=534

 Score =   214 bits (545),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TY+HWLE+N KSDLSLWQLGTLPPGLIAF+GHVHVID FWHMLGLGYQD
Sbjct  422  LEAWRKTNISLTYYHWLEENFKSDLSLWQLGTLPPGLIAFYGHVHVIDPFWHMLGLGYQD  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT++ADA++AGV+HFNGRAKPWLDIAFPQLR LW KY++FSD FIK CHI AS
Sbjct  482  NTTLADAETAGVIHFNGRAKPWLDIAFPQLRPLWAKYIDFSDKFIKGCHIRAS  534


 Score = 51.2 bits (121),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+FDPNECAWAYGMNIFD
Sbjct  400  PLIAKNFDPNECAWAYGMNIFD  421



>ref|XP_010240964.1| PREDICTED: probable galacturonosyltransferase 12 [Nelumbo nucifera]
Length=534

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYH+WL++NLKSDLSLWQLGTLPPGLIAFHGHVH+ID FWHMLGLGYQ+
Sbjct  422  LEAWRKTNISATYHYWLQKNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPFWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTSIADA+ AGV+HFNGRAKPWL+IAFP LR LW KYVNFSD FIK+CHI AS
Sbjct  482  NTSIADAERAGVIHFNGRAKPWLEIAFPHLRPLWAKYVNFSDKFIKTCHIRAS  534



>gb|KJB13571.1| hypothetical protein B456_002G082100 [Gossypium raimondii]
Length=534

 Score =   214 bits (545),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TY+HWLE+N KSDLSLWQLGTLPPGLIAF+GHVHVID FWHMLGLGYQD
Sbjct  422  LEAWRKTNISLTYYHWLEENFKSDLSLWQLGTLPPGLIAFYGHVHVIDPFWHMLGLGYQD  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT++ADA++AGV+HFNGRAKPWLDIAFPQLR LW KY++FSD FIK CHI AS
Sbjct  482  NTTLADAETAGVIHFNGRAKPWLDIAFPQLRPLWAKYIDFSDKFIKGCHIRAS  534


 Score = 51.2 bits (121),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+FDPNECAWAYGMNIFD
Sbjct  400  PLIAKNFDPNECAWAYGMNIFD  421



>gb|EYU33598.1| hypothetical protein MIMGU_mgv1a004326mg [Erythranthe guttata]
Length=533

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWRRTNIS TY++W+E+NLKSDLSLWQLGTLPPGLIAFHGHV +ID FWHMLGLGYQD
Sbjct  421  LEAWRRTNISHTYYYWIEENLKSDLSLWQLGTLPPGLIAFHGHVQIIDPFWHMLGLGYQD  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+I DA+SAGV+HFNGRAKPWLDIAFPQLR LWTKY++FSD F+KSCHI A+
Sbjct  481  NTTIEDAQSAGVIHFNGRAKPWLDIAFPQLRPLWTKYLDFSDRFLKSCHIRAN  533



>ref|XP_003596616.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
 gb|AES66867.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=412

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWRRTNIS  YHHW+ QN+KSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  301  LEAWRRTNISNKYHHWVAQNIKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  360

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT++ D ++AGV+HFNGRAKPWLDIAFP+LRSLWTKYV+FSD FIKSC+I A
Sbjct  361  NTNVDDVENAGVIHFNGRAKPWLDIAFPELRSLWTKYVDFSDKFIKSCNIRA  412



>ref|XP_007213904.1| hypothetical protein PRUPE_ppa004043mg [Prunus persica]
 gb|EMJ15103.1| hypothetical protein PRUPE_ppa004043mg [Prunus persica]
Length=533

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LDAWRKTNISLTYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS AD KSAGV+HFNGRAKPWL+IAFP+LR  W KYV+FSD FIKSCHI AS
Sbjct  481  NTSSADVKSAGVIHFNGRAKPWLEIAFPKLRPFWAKYVDFSDKFIKSCHIRAS  533



>ref|XP_008244342.1| PREDICTED: probable galacturonosyltransferase 12 [Prunus mume]
Length=533

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYH+WLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LDAWRKTNISLTYHYWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS AD KSAGV+HFNGRAKPWL+IAFP+LR  W KYV+FSD FIKSCHI AS
Sbjct  481  NTSSADVKSAGVIHFNGRAKPWLEIAFPKLRPFWAKYVDFSDKFIKSCHIRAS  533



>ref|XP_007149694.1| hypothetical protein PHAVU_005G091200g [Phaseolus vulgaris]
 gb|ESW21688.1| hypothetical protein PHAVU_005G091200g [Phaseolus vulgaris]
Length=533

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS  YH+W+EQN+KSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISNIYHYWVEQNIKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS  DA+SAGVVH+NGRAKPWL+IAFPQL  LWTKYV+FSD FIKSCHI AS
Sbjct  481  NTSFVDAESAGVVHYNGRAKPWLEIAFPQLSKLWTKYVDFSDKFIKSCHIRAS  533



>ref|XP_004487615.1| PREDICTED: probable galacturonosyltransferase 12-like [Cicer 
arietinum]
Length=533

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYH+W+EQN+KSDLSLWQLGTLPPGLIAFHGHVH+I+ FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISNTYHYWVEQNIKSDLSLWQLGTLPPGLIAFHGHVHIINPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS AD ++AGV+HFNGRAKPWLDIAFPQLR LWTKYV+FSD FIKSC I AS
Sbjct  481  NTSSADVENAGVIHFNGRAKPWLDIAFPQLRPLWTKYVDFSDKFIKSCQIRAS  533



>gb|KCW67211.1| hypothetical protein EUGRSUZ_F00995 [Eucalyptus grandis]
Length=465

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR++NIS TY+HWLEQNLKSDLSLWQLGTLPPGLIAFHGHVH+ID FWHMLGLGYQ+
Sbjct  353  LEAWRKSNISLTYYHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPFWHMLGLGYQE  412

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            N S AD K AGV+HFNGRAKPWLDIAFP+LR LW KY++FSD  IKSCHI AS
Sbjct  413  NISFADPKDAGVIHFNGRAKPWLDIAFPKLRPLWAKYIDFSDKLIKSCHIRAS  465



>ref|XP_003540035.1| PREDICTED: probable galacturonosyltransferase 12-like [Glycine 
max]
 gb|KHN20439.1| Putative galacturonosyltransferase 12 [Glycine soja]
Length=533

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYHHW+EQN+KSDLSLWQLGTLPPGLIAFHGHVH ID FWHMLGLGYQ+
Sbjct  421  LDAWRKTNISSTYHHWVEQNIKSDLSLWQLGTLPPGLIAFHGHVHTIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NTS ADA++AGV+HFNGRAKPWLDIAFP L+ LWTKY++FSD FIKSCHI A
Sbjct  481  NTSFADAETAGVIHFNGRAKPWLDIAFPHLKPLWTKYIDFSDYFIKSCHIRA  532



>ref|XP_008365716.1| PREDICTED: probable galacturonosyltransferase 12 [Malus domestica]
Length=532

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TY HWLE+NLKSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  420  LDAWRKTNISLTYXHWLEENLKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  479

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS AD KSAGV+HFNGRAKPWLDIAFP+LR  W KYVNFSD FIK C ITA+
Sbjct  480  NTSSADVKSAGVIHFNGRAKPWLDIAFPKLRPFWAKYVNFSDKFIKGCRITAT  532



>ref|XP_008349951.1| PREDICTED: probable galacturonosyltransferase 12 [Malus domestica]
Length=532

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHV VID FWHMLGLGYQ+
Sbjct  420  LDAWRKTNISFTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVQVIDPFWHMLGLGYQE  479

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS AD KSAGV+H+NGRAKPWL+IAFP+LR  W KYV+FSD FIKSCHI A+
Sbjct  480  NTSXADVKSAGVIHYNGRAKPWLEIAFPKLRPFWAKYVDFSDKFIKSCHIMAT  532



>ref|XP_008386024.1| PREDICTED: probable galacturonosyltransferase 12 [Malus domestica]
Length=532

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHV VID FWHMLGLGYQ+
Sbjct  420  LDAWRKTNISFTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVQVIDPFWHMLGLGYQE  479

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS AD KSAGV+H+NGRAKPWL+IAFP+LR  W KYV+FSD FIKSCHI A+
Sbjct  480  NTSXADVKSAGVIHYNGRAKPWLEIAFPKLRPFWAKYVDFSDKFIKSCHIMAT  532



>ref|XP_003596615.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
 gb|AES66866.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=541

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWRRTNIS  YHHW+ QN+KSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  430  LEAWRRTNISNKYHHWVAQNIKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  489

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT++ D ++AGV+HFNGRAKPWLDIAFP+LRSLWTKYV+FSD FIKSC+I A
Sbjct  490  NTNVDDVENAGVIHFNGRAKPWLDIAFPELRSLWTKYVDFSDKFIKSCNIRA  541



>gb|AFK39430.1| unknown [Medicago truncatula]
Length=541

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWRRTNIS  YHHW+ QN+KSDLSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  430  LEAWRRTNISNKYHHWVAQNIKSDLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  489

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT++ D ++AGV+HFNGRAKPWLDIAFP+LRSLWTKYV+FSD FIKSC+I A
Sbjct  490  NTNVDDVENAGVIHFNGRAKPWLDIAFPELRSLWTKYVDFSDKFIKSCNIRA  541



>ref|XP_010060438.1| PREDICTED: probable galacturonosyltransferase 12 [Eucalyptus 
grandis]
 gb|KCW67210.1| hypothetical protein EUGRSUZ_F00995 [Eucalyptus grandis]
Length=533

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR++NIS TY+HWLEQNLKSDLSLWQLGTLPPGLIAFHGHVH+ID FWHMLGLGYQ+
Sbjct  421  LEAWRKSNISLTYYHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            N S AD K AGV+HFNGRAKPWLDIAFP+LR LW KY++FSD  IKSCHI AS
Sbjct  481  NISFADPKDAGVIHFNGRAKPWLDIAFPKLRPLWAKYIDFSDKLIKSCHIRAS  533



>ref|XP_009355580.1| PREDICTED: probable galacturonosyltransferase 12 [Pyrus x bretschneideri]
Length=532

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHV VID FWHMLGLGYQ+
Sbjct  420  LDAWRKTNISFTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVQVIDPFWHMLGLGYQE  479

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS AD KSAGV+H+NGRAKPWL+IAFP+LR  W KYV+FSD FIKSCHI A+
Sbjct  480  NTSSADVKSAGVIHYNGRAKPWLEIAFPKLRPFWAKYVDFSDKFIKSCHIMAT  532



>ref|XP_006582240.1| PREDICTED: probable galacturonosyltransferase 12-like [Glycine 
max]
 gb|KHN47844.1| Putative galacturonosyltransferase 12 [Glycine soja]
Length=533

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYH+W+EQN+KSDLSLWQLGTLPPGLIAFHGHVH ID FWHMLGLGYQ+
Sbjct  421  LDAWRKTNISSTYHYWVEQNIKSDLSLWQLGTLPPGLIAFHGHVHTIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NTS ADA++AGV+HFNGRAKPWL+IAFP LR LWTKY++FSD FIKSCHI A
Sbjct  481  NTSFADAETAGVIHFNGRAKPWLEIAFPHLRPLWTKYIDFSDYFIKSCHIRA  532



>gb|KJB81832.1| hypothetical protein B456_013G164000 [Gossypium raimondii]
Length=533

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNI+ TY+HWLEQNLKSDLSLWQLGTLPPGLIAFHG VHVID FWHMLGLGYQD
Sbjct  421  LEAWRKTNITLTYYHWLEQNLKSDLSLWQLGTLPPGLIAFHGQVHVIDPFWHMLGLGYQD  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+++DA++AGV+HFNGRAKPWLDIAFPQLR  W KY++FSD FIK CHI  S
Sbjct  481  NTTLSDAETAGVIHFNGRAKPWLDIAFPQLRPSWAKYIDFSDKFIKGCHIRVS  533



>gb|KHG10223.1| putative galacturonosyltransferase 12 -like protein [Gossypium 
arboreum]
Length=534

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNI+ TY+HWLEQNLKSDLSLWQLGTLPPGLIAFHG VHVID FWHMLGLGYQD
Sbjct  422  LEAWRKTNITLTYYHWLEQNLKSDLSLWQLGTLPPGLIAFHGQVHVIDPFWHMLGLGYQD  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+++DA++AGV+HFNGRAKPWLDIAFPQLR LW KY+ FSD FIK CHI
Sbjct  482  NTTLSDAETAGVIHFNGRAKPWLDIAFPQLRPLWAKYIGFSDKFIKGCHI  531



>ref|XP_010931276.1| PREDICTED: probable galacturonosyltransferase 12 [Elaeis guineensis]
Length=532

 Score =   207 bits (526),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYHHWL++NLKSDLSLWQLGTLPPGLIAFHGHVH+ID +WHMLGLGYQ+
Sbjct  421  LDAWRKTNISLTYHHWLQKNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPYWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT+IAD + A V+HFNGRAKPWLDIAFPQLR LWTKY+NFSD FI+ C+I A
Sbjct  481  NTTIADVEKAAVIHFNGRAKPWLDIAFPQLRPLWTKYLNFSDKFIRGCNIRA  532


 Score = 52.0 bits (123),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+KSFDPNECAWAYGMNIFD
Sbjct  399  PLISKSFDPNECAWAYGMNIFD  420



>ref|XP_002317564.1| hypothetical protein POPTR_0011s13600g [Populus trichocarpa]
 gb|EEE98176.1| hypothetical protein POPTR_0011s13600g [Populus trichocarpa]
Length=532

 Score =   207 bits (526),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYHHW+E+NLKS LSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISITYHHWVEENLKSGLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NTS+ADA++AGV+HFNGRAKPWLDIAFPQLR LW KY+N SD FI  CHI
Sbjct  481  NTSLADAETAGVIHFNGRAKPWLDIAFPQLRPLWAKYINSSDKFITGCHI  530


 Score = 49.7 bits (117),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+F+PNECAWAYGMNIFD
Sbjct  399  PLIAKNFNPNECAWAYGMNIFD  420



>ref|XP_011030886.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
 ref|XP_011030887.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
 ref|XP_011030888.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
 ref|XP_011030889.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
Length=533

 Score =   206 bits (525),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS  YHHW+E+NLKS LSLWQLGTLPPGLIAFHGHVHVID FWHMLGLGYQ+
Sbjct  421  LEAWRKTNISIAYHHWVEENLKSGLSLWQLGTLPPGLIAFHGHVHVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS+ADA++AGV+HFNGRAKPWLDIAFPQLR LW KY+N SD FI  CHI  S
Sbjct  481  NTSLADAETAGVIHFNGRAKPWLDIAFPQLRPLWAKYINSSDKFITGCHIRTS  533


 Score = 49.7 bits (117),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+F+PNECAWAYGMNIFD
Sbjct  399  PLIAKNFNPNECAWAYGMNIFD  420



>ref|XP_004505435.1| PREDICTED: probable galacturonosyltransferase 12-like isoform 
X2 [Cicer arietinum]
Length=476

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYH+W+EQN KSDLSLWQLGTLPPGLIAFHG+VH ID FWHM+GLGYQ+
Sbjct  364  LEAWRKTNISYTYHYWVEQNTKSDLSLWQLGTLPPGLIAFHGNVHTIDPFWHMMGLGYQE  423

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS  DAK+AGVVHFNGRAKPWLDIAF QLR LWTKYV+FSD FIK CHI  S
Sbjct  424  NTSFDDAKNAGVVHFNGRAKPWLDIAFRQLRPLWTKYVDFSDNFIKGCHIRRS  476


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+K FDPNECAWAYGMNIFD
Sbjct  342  PLISKKFDPNECAWAYGMNIFD  363



>ref|XP_004505434.1| PREDICTED: probable galacturonosyltransferase 12-like isoform 
X1 [Cicer arietinum]
Length=533

 Score =   205 bits (522),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TYH+W+EQN KSDLSLWQLGTLPPGLIAFHG+VH ID FWHM+GLGYQ+
Sbjct  421  LEAWRKTNISYTYHYWVEQNTKSDLSLWQLGTLPPGLIAFHGNVHTIDPFWHMMGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS  DAK+AGVVHFNGRAKPWLDIAF QLR LWTKYV+FSD FIK CHI  S
Sbjct  481  NTSFDDAKNAGVVHFNGRAKPWLDIAFRQLRPLWTKYVDFSDNFIKGCHIRRS  533


 Score = 50.4 bits (119),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+K FDPNECAWAYGMNIFD
Sbjct  399  PLISKKFDPNECAWAYGMNIFD  420



>ref|XP_008800493.1| PREDICTED: probable galacturonosyltransferase 12 [Phoenix dactylifera]
Length=532

 Score =   205 bits (521),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS+TYHHWL++NLKSDLSLWQLGTLPPGLIAFHGHVHVID +WHMLGLGYQ+
Sbjct  421  LDAWRKTNISQTYHHWLQKNLKSDLSLWQLGTLPPGLIAFHGHVHVIDPYWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT+ ADA+ A V+HFNGRAKPWLDIAFP LR LWTKY+NFSD FI+ C+I A
Sbjct  481  NTTTADAEMAAVIHFNGRAKPWLDIAFPHLRPLWTKYLNFSDKFIRGCNIRA  532


 Score = 50.4 bits (119),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI++SFDPNECAWAYGMNIFD
Sbjct  399  PLISESFDPNECAWAYGMNIFD  420



>ref|XP_010908149.1| PREDICTED: probable galacturonosyltransferase 12 [Elaeis guineensis]
Length=532

 Score =   206 bits (523),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYHHWL++NLKSDLSLWQLGTLPPGLIAFHGHVH+ID +WHMLGLGYQ+
Sbjct  421  LDAWRKTNISHTYHHWLQKNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPYWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT+IADA+ A V+HFNGRAKPWLDIAFP LR LWTKY+NFSD FI+ C+I A
Sbjct  481  NTTIADAEKAAVIHFNGRAKPWLDIAFPHLRPLWTKYLNFSDKFIRGCNIRA  532


 Score = 49.3 bits (116),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+ SFDPNECAWAYGMNIFD
Sbjct  399  PLISDSFDPNECAWAYGMNIFD  420



>ref|XP_010448492.1| PREDICTED: probable galacturonosyltransferase 12 [Camelina sativa]
 ref|XP_010448502.1| PREDICTED: probable galacturonosyltransferase 12 [Camelina sativa]
Length=167

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  55   LAAWRKTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  114

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS ADA+SA VVH+NGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  115  TTSFADAESAAVVHYNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  167



>ref|XP_007132980.1| hypothetical protein PHAVU_011G141200g [Phaseolus vulgaris]
 gb|ESW04974.1| hypothetical protein PHAVU_011G141200g [Phaseolus vulgaris]
Length=533

 Score =   206 bits (523),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYH+W+EQN+KSDL LWQLGTLPP LIAFHGHVH ID FWHMLGLGYQ+
Sbjct  421  LDAWRKTNISSTYHYWVEQNIKSDLGLWQLGTLPPWLIAFHGHVHTIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            +TS ADAKSAGV+HFNGRAKPWLDIAFP LR LWTKY++FSD FIKSCHI A
Sbjct  481  STSFADAKSAGVIHFNGRAKPWLDIAFPHLRPLWTKYIDFSDYFIKSCHIKA  532


 Score = 49.3 bits (116),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+++FDPNECAWAYGMNIFD
Sbjct  399  PLISQNFDPNECAWAYGMNIFD  420



>ref|XP_008775922.1| PREDICTED: probable galacturonosyltransferase 12 isoform X1 [Phoenix 
dactylifera]
Length=532

 Score =   204 bits (520),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYHHWL +NLKSDLSLWQLGTLPPGLIAFHGHVH+ID +WHMLGLGYQ+
Sbjct  421  LDAWRKTNISLTYHHWLRKNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPYWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            N +IADA+ A V+HFNGRAKPWLDIAFPQ+R LWTKY+NFSD FI+ C+I A
Sbjct  481  NATIADAEKAAVIHFNGRAKPWLDIAFPQVRPLWTKYLNFSDKFIRGCNIRA  532


 Score = 50.1 bits (118),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI++SFDPNECAWAYGMNIFD
Sbjct  399  PLISESFDPNECAWAYGMNIFD  420



>ref|XP_008775923.1| PREDICTED: probable galacturonosyltransferase 12 isoform X2 [Phoenix 
dactylifera]
Length=531

 Score =   204 bits (519),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TYHHWL +NLKSDLSLWQLGTLPPGLIAFHGHVH+ID +WHMLGLGYQ+
Sbjct  420  LDAWRKTNISLTYHHWLRKNLKSDLSLWQLGTLPPGLIAFHGHVHIIDPYWHMLGLGYQE  479

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            N +IADA+ A V+HFNGRAKPWLDIAFPQ+R LWTKY+NFSD FI+ C+I A
Sbjct  480  NATIADAEKAAVIHFNGRAKPWLDIAFPQVRPLWTKYLNFSDKFIRGCNIRA  531


 Score = 50.1 bits (118),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI++SFDPNECAWAYGMNIFD
Sbjct  398  PLISESFDPNECAWAYGMNIFD  419



>ref|XP_003610561.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
Length=468

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  671  LILEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGY  492
            L LEAWR+TNIS TYH+W+EQN+KSDLSLW LGTLPPGLIAFHG+VH ID FWHMLGLGY
Sbjct  355  LDLEAWRKTNISYTYHYWVEQNIKSDLSLWHLGTLPPGLIAFHGNVHTIDPFWHMLGLGY  414

Query  491  QDNTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            Q+NT++ DAK+AGVVHFNG AKPWLDIAFPQL+ LWTKYV+FSD FI+SCHI A
Sbjct  415  QENTNLVDAKNAGVVHFNGWAKPWLDIAFPQLKPLWTKYVDFSDNFIESCHIRA  468



>gb|AES92758.2| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=464

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  671  LILEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGY  492
            L LEAWR+TNIS TYH+W+EQN+KSDLSLW LGTLPPGLIAFHG+VH ID FWHMLGLGY
Sbjct  351  LDLEAWRKTNISYTYHYWVEQNIKSDLSLWHLGTLPPGLIAFHGNVHTIDPFWHMLGLGY  410

Query  491  QDNTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            Q+NT++ DAK+AGVVHFNG AKPWLDIAFPQL+ LWTKYV+FSD FI+SCHI A
Sbjct  411  QENTNLVDAKNAGVVHFNGWAKPWLDIAFPQLKPLWTKYVDFSDNFIESCHIRA  464



>ref|XP_009402871.1| PREDICTED: probable galacturonosyltransferase 12 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TY+HWL++NL+SDLSLWQLGTLPPGLIAFHGHVHVID +WHMLGLGYQ+
Sbjct  420  LDAWRKTNISVTYYHWLQKNLESDLSLWQLGTLPPGLIAFHGHVHVIDPYWHMLGLGYQE  479

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT++ADA+ A V+HFNGRAKPWLDIAFP++R LWTKY++FSD FI++C+I A
Sbjct  480  NTTVADAEKAAVIHFNGRAKPWLDIAFPEIRPLWTKYLDFSDKFIRACNIRA  531



>ref|XP_009402872.1| PREDICTED: probable galacturonosyltransferase 12 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=525

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS TY+HWL++NL+SDLSLWQLGTLPPGLIAFHGHVHVID +WHMLGLGYQ+
Sbjct  414  LDAWRKTNISVTYYHWLQKNLESDLSLWQLGTLPPGLIAFHGHVHVIDPYWHMLGLGYQE  473

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT++ADA+ A V+HFNGRAKPWLDIAFP++R LWTKY++FSD FI++C+I A
Sbjct  474  NTTVADAEKAAVIHFNGRAKPWLDIAFPEIRPLWTKYLDFSDKFIRACNIRA  525



>ref|XP_006281668.1| hypothetical protein CARUB_v10027804mg [Capsella rubella]
 gb|EOA14566.1| hypothetical protein CARUB_v10027804mg [Capsella rubella]
Length=535

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWRRTNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  423  LAAWRRTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS ADA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  483  TTSFADAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  535



>ref|XP_010539273.1| PREDICTED: probable galacturonosyltransferase 12 [Tarenaya hassleriana]
Length=535

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TN++ TY+ WLE+N+KSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  423  LEAWRKTNVTSTYYRWLEENIKSDLSLWQLGTLPPGLIAFHGHVQPIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS +DA+SA V+HFNGRAKPWLDIAFP LR LW KYV+ SD FIKSCHI AS
Sbjct  483  NTSFSDAESAAVIHFNGRAKPWLDIAFPHLRPLWAKYVDSSDRFIKSCHIKAS  535



>ref|XP_002866055.1| GAUT12/IRX8/LGT6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42314.1| GAUT12/IRX8/LGT6 [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWRRTNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  423  LAAWRRTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS ADA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  483  TTSYADAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  535



>ref|NP_200280.1| probable galacturonosyltransferase 12 [Arabidopsis thaliana]
 sp|Q9FH36.1|GAUTC_ARATH RecName: Full=Probable galacturonosyltransferase 12; AltName: 
Full=Like glycosyl transferase 6; AltName: Full=Protein IRREGULAR 
XYLEM 8 [Arabidopsis thaliana]
 dbj|BAB09935.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAZ23921.1| At5g54690 [Arabidopsis thaliana]
 dbj|BAF01430.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96527.1| probable galacturonosyltransferase 12 [Arabidopsis thaliana]
 gb|AHL38578.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=535

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWRRTNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  423  LAAWRRTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS ADA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  483  TTSYADAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  535



>ref|XP_006401545.1| hypothetical protein EUTSA_v10013202mg [Eutrema salsugineum]
 gb|ESQ42998.1| hypothetical protein EUTSA_v10013202mg [Eutrema salsugineum]
Length=537

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  424  LAAWRKTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  483

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS ADA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  484  TTSFADAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  536



>ref|XP_010443047.1| PREDICTED: probable galacturonosyltransferase 12 [Camelina sativa]
Length=535

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  423  LAAWRKTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS ADA+SA VVH+NGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  483  TTSFADAESAAVVHYNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  535



>ref|XP_010482877.1| PREDICTED: probable galacturonosyltransferase 12 [Camelina sativa]
Length=535

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  423  LAAWRKTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS ADA+SA VVH+NGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  483  TTSFADAESAAVVHYNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  535



>emb|CDY42476.1| BnaA10g08520D [Brassica napus]
Length=515

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  403  LAAWRKTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  462

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS +DA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  463  TTSFSDAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  515



>gb|KFK27082.1| hypothetical protein AALP_AA8G331600 [Arabis alpina]
Length=535

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  423  LAAWRKTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS ADA+SA VVH+NGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  483  TTSFADAESAAVVHYNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  535



>ref|XP_009120000.1| PREDICTED: probable galacturonosyltransferase 12 [Brassica rapa]
Length=535

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  423  LAAWRKTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS +DA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  483  TTSFSDAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  535



>emb|CDY47455.1| BnaC09g31020D [Brassica napus]
Length=535

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNIS TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  423  LAAWRKTNISSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS +DA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  483  TTSFSDAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  535



>emb|CDY28757.1| BnaA02g09490D [Brassica napus]
Length=534

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI+ TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  422  LAAWRKTNITSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS +DA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCHI AS
Sbjct  482  KTSFSDAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAS  534



>ref|XP_010694261.1| PREDICTED: probable galacturonosyltransferase 12 [Beta vulgaris 
subsp. vulgaris]
Length=534

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR +NI+ +Y+ WL+ NLKSDLSLWQLGTLPPGLIAFHG+VHVID FWHMLGLGYQ+
Sbjct  422  LKAWRNSNITDSYYQWLQLNLKSDLSLWQLGTLPPGLIAFHGNVHVIDPFWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NTS+ DA +AGVVHFNGRAKPWLDIAFPQLR LW +Y+NFSD FIK CHI
Sbjct  482  NTSLIDAANAGVVHFNGRAKPWLDIAFPQLRPLWARYINFSDKFIKGCHI  531



>emb|CDY41005.1| BnaA02g27950D [Brassica napus]
Length=534

 Score =   197 bits (501),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR TNI+ TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  422  LAAWRETNITSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS +DA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCH+ AS
Sbjct  482  KTSFSDAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDPSDRFIKSCHVRAS  534


 Score = 47.0 bits (110),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IA++FDP ECAWAYGMN+FD
Sbjct  400  PIIARNFDPEECAWAYGMNVFD  421



>ref|XP_009397165.1| PREDICTED: probable galacturonosyltransferase 12 [Musa acuminata 
subsp. malaccensis]
Length=533

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNIS TY+HWL++NL+SDLSLWQLGTLPPGLIAFHGHVHVID +WHMLGLGYQ+
Sbjct  422  LEAWRKTNISVTYYHWLQKNLESDLSLWQLGTLPPGLIAFHGHVHVIDPYWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITA  330
            NT++ DA+ A V+HFNGRAKPWLDIAFP++R LW KY+N SD  I++C+I A
Sbjct  482  NTTVEDAEKAAVIHFNGRAKPWLDIAFPEIRPLWAKYLNLSDKLIRACNIRA  533



>ref|XP_009127073.1| PREDICTED: probable galacturonosyltransferase 12 [Brassica rapa]
Length=534

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI+ TY+HWL++NLKSDLSLWQLGTLPPGLIAFHGHV  ID FWHMLGLGYQ+
Sbjct  422  LAAWRKTNITSTYYHWLDENLKSDLSLWQLGTLPPGLIAFHGHVQTIDPFWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS +DA+SA VVHFNGRAKPWLDIAFP LR LW KY++ SD FIKSCHI A+
Sbjct  482  ITSFSDAESAAVVHFNGRAKPWLDIAFPHLRPLWAKYLDSSDRFIKSCHIRAA  534



>gb|ERM97875.1| hypothetical protein AMTR_s00115p00091320 [Amborella trichopoda]
Length=548

 Score =   195 bits (495),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS+TYH WL+QNLKS LSLWQLGTLPPGLIAFHGHVH+ID FWHMLGLGYQ 
Sbjct  436  LKAWRKTNISQTYHSWLQQNLKSGLSLWQLGTLPPGLIAFHGHVHIIDPFWHMLGLGYQA  495

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS+  A+ A V+HFNGRAKPWLDIAF QLR LW KYV+ SD FIKSC I  S
Sbjct  496  NTSVEAAEKAAVIHFNGRAKPWLDIAFAQLRPLWAKYVDGSDKFIKSCKIKVS  548


 Score = 46.6 bits (109),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++FDP +CAWAYGMNIFD
Sbjct  414  PLIAQNFDPEKCAWAYGMNIFD  435



>ref|XP_006830459.2| PREDICTED: probable galacturonosyltransferase 12 [Amborella trichopoda]
Length=533

 Score =   194 bits (494),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNIS+TYH WL+QNLKS LSLWQLGTLPPGLIAFHGHVH+ID FWHMLGLGYQ 
Sbjct  421  LKAWRKTNISQTYHSWLQQNLKSGLSLWQLGTLPPGLIAFHGHVHIIDPFWHMLGLGYQA  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTS+  A+ A V+HFNGRAKPWLDIAF QLR LW KYV+ SD FIKSC I  S
Sbjct  481  NTSVEAAEKAAVIHFNGRAKPWLDIAFAQLRPLWAKYVDGSDKFIKSCKIKVS  533


 Score = 46.6 bits (109),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++FDP +CAWAYGMNIFD
Sbjct  399  PLIAQNFDPEKCAWAYGMNIFD  420



>gb|EPS70108.1| hypothetical protein M569_04651 [Genlisea aurea]
Length=533

 Score =   186 bits (473),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWRRT+I++TY+ W+++N+KS+LSLWQLGTLPPGLIAF   V+VID FWHMLGLGYQ+
Sbjct  421  LEAWRRTSITQTYYQWIDKNVKSNLSLWQLGTLPPGLIAFRSQVYVIDPFWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+  +A+SAGV+HFNG +KPWLDIAFP LR LWTKY++FSD FIKSC I +S
Sbjct  481  NTTFEEAESAGVIHFNGYSKPWLDIAFPHLRPLWTKYLDFSDRFIKSCRIRSS  533


 Score = 44.7 bits (104),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+ +FDP ECAWAYG+NIFD
Sbjct  399  PLISNNFDPEECAWAYGLNIFD  420



>emb|CAC01746.1| putative protein [Arabidopsis thaliana]
Length=572

 Score =   172 bits (436),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH+IDS WHMLGLGYQ 
Sbjct  461  LQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQS  520

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  521  KTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  570


 Score = 47.0 bits (110),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  439  PLIAKHLDPEECAWAYGMNIFD  460



>ref|XP_011013393.1| PREDICTED: probable galacturonosyltransferase 14 [Populus euphratica]
Length=536

 Score =   172 bits (435),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W+++NLKS+L++W+LGTLPP LIAF GHVH ID FWHMLGLGYQ+
Sbjct  423  LHAWRKTNIRETYHSWMKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPFWHMLGLGYQN  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+I   K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  483  NTNIESVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIRNCHILDS  535


 Score = 47.4 bits (111),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  401  PLIAKNLDPDECAWAYGMNIFD  422



>ref|NP_197051.2| probable galacturonosyltransferase 14 [Arabidopsis thaliana]
 sp|Q8GWT1.1|GAUTE_ARATH RecName: Full=Probable galacturonosyltransferase 14 [Arabidopsis 
thaliana]
 dbj|BAC43247.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64834.1| At5g15470 [Arabidopsis thaliana]
 gb|AED92165.1| probable galacturonosyltransferase 14 [Arabidopsis thaliana]
 gb|AHL38629.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=532

 Score =   171 bits (434),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH+IDS WHMLGLGYQ 
Sbjct  421  LQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  481  KTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  530


 Score = 47.0 bits (110),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  399  PLIAKHLDPEECAWAYGMNIFD  420



>ref|XP_002305374.1| hypothetical protein POPTR_0004s12340g [Populus trichocarpa]
 gb|EEE85885.1| hypothetical protein POPTR_0004s12340g [Populus trichocarpa]
Length=528

 Score =   171 bits (432),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR TNI  TYH W+++NLKS+L++W+LGTLPP LIAF GHVH ID FWHMLGLGYQ+
Sbjct  415  LHAWRNTNIRETYHSWMKENLKSNLTMWKLGTLPPSLIAFKGHVHPIDPFWHMLGLGYQN  474

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+I   K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  475  NTNIESVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIRNCHILDS  527


 Score = 47.4 bits (111),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  393  PLIAKNLDPDECAWAYGMNIFD  414



>ref|XP_010453684.1| PREDICTED: probable galacturonosyltransferase 14 [Camelina sativa]
Length=532

 Score =   171 bits (434),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH+IDS WHMLGLGYQ+
Sbjct  421  LQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  481  MTNIGNVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  530


 Score = 46.2 bits (108),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  399  PLIAKHLDPEECAWAYGMNVFD  420



>ref|XP_010492387.1| PREDICTED: probable galacturonosyltransferase 14 [Camelina sativa]
Length=532

 Score =   171 bits (434),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH+IDS WHMLGLGYQ+
Sbjct  421  LQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  481  MTNIGNVKQAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  530


 Score = 46.2 bits (108),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  399  PLIAKHLDPEECAWAYGMNVFD  420



>ref|XP_010259116.1| PREDICTED: probable galacturonosyltransferase 14 [Nelumbo nucifera]
Length=533

 Score =   170 bits (430),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  421  LRAWRKTNIRETYHFWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT I   K A V+H+NG++KPWL++ F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  481  NTDIESVKKAAVIHYNGQSKPWLEVGFEHLRPFWTKYVNYSNNFIRNCHILES  533


 Score = 47.4 bits (111),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  399  PLIAKNLDPDECAWAYGMNIFD  420



>ref|XP_006287475.1| hypothetical protein CARUB_v10000686mg [Capsella rubella]
 gb|EOA20373.1| hypothetical protein CARUB_v10000686mg [Capsella rubella]
Length=532

 Score =   171 bits (433),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH+IDS WHMLGLGYQ+
Sbjct  421  LQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  481  MTNIDNVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  530


 Score = 46.2 bits (108),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  399  PLIAKHLDPEECAWAYGMNVFD  420



>ref|XP_010258139.1| PREDICTED: probable galacturonosyltransferase 14 [Nelumbo nucifera]
Length=533

 Score =   169 bits (429),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF  HVH ID  WHMLGLGYQ+
Sbjct  421  LRAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKDHVHPIDPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT I   K A V+H+NG++KPWL+I F QLR  WTKYVN+S+ F+++CHI  S
Sbjct  481  NTDIESVKKAAVIHYNGQSKPWLEIGFEQLRPFWTKYVNYSNDFVRNCHILES  533


 Score = 47.4 bits (111),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  399  PLIAKNLDPDECAWAYGMNIFD  420



>gb|KFK25790.1| hypothetical protein AALP_AA8G160800 [Arabis alpina]
Length=524

 Score =   171 bits (433),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH IDS WHMLGLGYQ+
Sbjct  413  LQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHTIDSSWHMLGLGYQN  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  473  KTNIENVKQAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  522


 Score = 45.4 bits (106),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  391  PLIAKYLDPEECAWAYGMNVFD  412



>ref|XP_010420207.1| PREDICTED: probable galacturonosyltransferase 14 [Camelina sativa]
Length=532

 Score =   171 bits (433),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH+IDS WHMLGLGYQ 
Sbjct  421  LQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  481  MTNIGNVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  530


 Score = 45.4 bits (106),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+K  DP ECAWAYGMN+FD
Sbjct  399  PLISKHLDPEECAWAYGMNVFD  420



>ref|XP_011035850.1| PREDICTED: probable galacturonosyltransferase 14 [Populus euphratica]
Length=536

 Score =   169 bits (427),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  423  LRAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I   K A V+H+NG+AKPWL+I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  483  KTNIESVKKAAVIHYNGQAKPWLEIGFEHLRPFWTKYVNYSNDFIRNCHILDS  535


 Score = 47.4 bits (111),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  401  PLIAKNLDPDECAWAYGMNIFD  422



>ref|XP_002324094.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
 gb|EEF04227.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
Length=536

 Score =   169 bits (427),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  423  LRAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I   K A V+H+NG+AKPWL+I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  483  KTNIESVKKAAVIHYNGQAKPWLEIGFEHLRPFWTKYVNYSNDFIRNCHILDS  535


 Score = 47.4 bits (111),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  401  PLIAKNLDPDECAWAYGMNIFD  422



>ref|XP_006400067.1| hypothetical protein EUTSA_v10013218mg [Eutrema salsugineum]
 gb|ESQ41520.1| hypothetical protein EUTSA_v10013218mg [Eutrema salsugineum]
Length=532

 Score =   169 bits (429),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+ WR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH+IDS WHMLGLGYQ+
Sbjct  421  LQTWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  481  KTNIENVRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  530


 Score = 46.2 bits (108),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  399  PLIAKHLDPEECAWAYGMNVFD  420



>ref|XP_002873726.1| hypothetical protein ARALYDRAFT_326001 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49985.1| hypothetical protein ARALYDRAFT_326001 [Arabidopsis lyrata subsp. 
lyrata]
Length=573

 Score =   169 bits (427),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH+IDS WHMLGLGYQ 
Sbjct  462  LQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQS  521

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I   K A V+H+NG++KPWL+I F  LR  WTKYVN S+ FIK+CHI
Sbjct  522  KTNIEHVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNHSNDFIKNCHI  571


 Score = 46.6 bits (109),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  440  PLIAKHLDPEECAWAYGMNVFD  461



>ref|XP_012084793.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Jatropha 
curcas]
Length=547

 Score =   166 bits (421),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  435  LRAWRLTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  494

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I D K A V+H+NG++KPWL I F  LR  WTKYV++S+ FI++CHI  S
Sbjct  495  KTNIEDVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVDYSNDFIRNCHILES  547


 Score = 48.9 bits (115),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAKS DP+ECAWAYGMNIFD
Sbjct  413  PLIAKSLDPDECAWAYGMNIFD  434



>emb|CDX78631.1| BnaA03g05430D [Brassica napus]
Length=533

 Score =   169 bits (428),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+T+I  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH++D  WHMLGLGYQ 
Sbjct  422  LQAWRKTDIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHILDPSWHMLGLGYQK  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  482  NTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  531


 Score = 46.2 bits (108),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  400  PLIAKHLDPEECAWAYGMNVFD  421



>ref|XP_012084794.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Jatropha 
curcas]
Length=536

 Score =   166 bits (420),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  424  LRAWRLTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  483

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I D K A V+H+NG++KPWL I F  LR  WTKYV++S+ FI++CHI  S
Sbjct  484  KTNIEDVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVDYSNDFIRNCHILES  536


 Score = 48.9 bits (115),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAKS DP+ECAWAYGMNIFD
Sbjct  402  PLIAKSLDPDECAWAYGMNIFD  423



>ref|XP_012084795.1| PREDICTED: probable galacturonosyltransferase 14 isoform X3 [Jatropha 
curcas]
 gb|KDP27214.1| hypothetical protein JCGZ_19913 [Jatropha curcas]
Length=535

 Score =   166 bits (420),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  423  LRAWRLTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I D K A V+H+NG++KPWL I F  LR  WTKYV++S+ FI++CHI  S
Sbjct  483  KTNIEDVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVDYSNDFIRNCHILES  535


 Score = 48.9 bits (115),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAKS DP+ECAWAYGMNIFD
Sbjct  401  PLIAKSLDPDECAWAYGMNIFD  422



>emb|CDX90990.1| BnaC02g06070D [Brassica napus]
Length=535

 Score =   168 bits (425),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NL+ +L++W+LGTLPP LIAF GHVHVIDS WHMLGLGYQ+
Sbjct  424  LQAWRKTNIRETYHSWLRENLRLNLAMWKLGTLPPALIAFKGHVHVIDSSWHMLGLGYQN  483

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  484  KTNIENVRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  533


 Score = 46.6 bits (109),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  402  PLIAKHLDPEECAWAYGMNVFD  423



>ref|XP_002884297.1| GAUT13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60556.1| GAUT13 [Arabidopsis lyrata subsp. lyrata]
Length=533

 Score =   167 bits (424),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  422  LRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQS  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT++ +AK A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  482  NTNLDNAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  531


 Score = 47.0 bits (110),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  400  PLIAKHLDPEECAWAYGMNIFD  421



>ref|XP_010417209.1| PREDICTED: probable galacturonosyltransferase 13 [Camelina sativa]
Length=771

 Score =   166 bits (419),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  660  LRTWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQS  719

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTKYVN+S+ F+K+CHI
Sbjct  720  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFVKNCHI  769


 Score = 48.9 bits (115),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  638  PLIAKHLDPEECAWAYGMNIFD  659



>ref|XP_009131467.1| PREDICTED: probable galacturonosyltransferase 14 [Brassica rapa]
Length=533

 Score =   167 bits (424),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+T+I  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH++D  WHMLGLGYQ 
Sbjct  422  LQAWRKTSIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHILDPSWHMLGLGYQK  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+I + + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  482  NTNIENVRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  531


 Score = 46.2 bits (108),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  400  PLIAKHLDPEECAWAYGMNVFD  421



>ref|XP_009365848.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Pyrus 
x bretschneideri]
Length=525

 Score =   168 bits (425),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  413  LSAWRKTNIRETYHSWLKENLKSNLTMWRLGTLPPALIAFRGHVHAIDPRWHMLGLGYQN  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+I     A V+H+NG++KPWL I F  LR  WTKYVN+S+ F++SCHI  S
Sbjct  473  NTNIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRSCHILDS  525


 Score = 45.4 bits (106),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  391  PLVSKNLDPEECAWAYGMNIFD  412



>emb|CDX85550.1| BnaA02g02630D [Brassica napus]
Length=537

 Score =   167 bits (422),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NL+ +L++W+LGTLPP LIAF GHVHVIDS WHMLGLGYQ+
Sbjct  424  LKAWRKTNIRETYHSWLRENLRLNLAMWKLGTLPPALIAFKGHVHVIDSSWHMLGLGYQN  483

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FI++CHI
Sbjct  484  KTNIENVRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIRNCHI  533


 Score = 46.6 bits (109),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  402  PLIAKHLDPEECAWAYGMNVFD  423



>ref|XP_009365847.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Pyrus 
x bretschneideri]
Length=533

 Score =   168 bits (425),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  421  LSAWRKTNIRETYHSWLKENLKSNLTMWRLGTLPPALIAFRGHVHAIDPRWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+I     A V+H+NG++KPWL I F  LR  WTKYVN+S+ F++SCHI  S
Sbjct  481  NTNIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRSCHILDS  533


 Score = 45.4 bits (106),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  399  PLVSKNLDPEECAWAYGMNIFD  420



>ref|XP_007139505.1| hypothetical protein PHAVU_008G035400g [Phaseolus vulgaris]
 gb|ESW11499.1| hypothetical protein PHAVU_008G035400g [Phaseolus vulgaris]
Length=535

 Score =   166 bits (421),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWRRTNI  TYH WL++NLKS+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ+
Sbjct  423  LRAWRRTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGLVHPIDPSWHMLGLGYQN  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+I   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  483  NTNIESVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFLRNCHILES  535


 Score = 46.6 bits (109),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++ DP+ECAWAYGMNIFD
Sbjct  401  PLIARNLDPDECAWAYGMNIFD  422



>ref|NP_186753.2| putative galacturonosyltransferase 13 [Arabidopsis thaliana]
 sp|Q0WV13.1|GAUTD_ARATH RecName: Full=Probable galacturonosyltransferase 13 [Arabidopsis 
thaliana]
 dbj|BAE99035.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABO09884.1| At3g01040 [Arabidopsis thaliana]
 gb|AEE73598.1| putative galacturonosyltransferase 13 [Arabidopsis thaliana]
Length=533

 Score =   166 bits (420),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  422  LRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQS  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  482  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  531


 Score = 47.0 bits (110),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  400  PLIAKHLDPEECAWAYGMNIFD  421



>ref|XP_006297411.1| hypothetical protein CARUB_v10013435mg [Capsella rubella]
 gb|EOA30309.1| hypothetical protein CARUB_v10013435mg [Capsella rubella]
Length=532

 Score =   166 bits (420),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  421  LRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  481  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  530


 Score = 47.0 bits (110),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  399  PLIAKHLDPEECAWAYGMNIFD  420



>ref|NP_001118545.1| putative galacturonosyltransferase 13 [Arabidopsis thaliana]
 gb|AEE73599.1| putative galacturonosyltransferase 13 [Arabidopsis thaliana]
 gb|AHL38789.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=532

 Score =   166 bits (420),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  421  LRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  481  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  530


 Score = 47.0 bits (110),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  399  PLIAKHLDPEECAWAYGMNIFD  420



>gb|AAF26170.1|AC008261_27 unknown protein [Arabidopsis thaliana]
Length=510

 Score =   166 bits (419),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  399  LRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQS  458

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  459  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  508


 Score = 47.0 bits (110),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  377  PLIAKHLDPEECAWAYGMNIFD  398



>ref|XP_011085730.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
14 [Sesamum indicum]
Length=530

 Score =   167 bits (424),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L+LW+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  419  LRAWRKTNIRDTYHSWLKENLKSNLTLWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  478

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T + + K+A V+HFNG++KPWL+I F  LR  WTKYVN+S+ FI++CH+
Sbjct  479  KTKVENVKNAAVIHFNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIRNCHV  528


 Score = 44.7 bits (104),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+K+ +P+ECAWAYGMNIFD
Sbjct  397  PLISKNLNPDECAWAYGMNIFD  418



>ref|XP_009134640.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Brassica 
rapa]
Length=530

 Score =   167 bits (423),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL+ NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  419  LRTWRKTNIRETYHSWLKANLKSNLTMWKLGTLPPALIAFKGHVQAIDSSWHMLGLGYQS  478

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT++ + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIKSCHI
Sbjct  479  NTNLENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKSCHI  528


 Score = 44.7 bits (104),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI++  DP ECAWAYGMNIFD
Sbjct  397  PLISQHLDPEECAWAYGMNIFD  418



>ref|XP_009134641.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Brassica 
rapa]
Length=529

 Score =   167 bits (424),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL+ NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  418  LRTWRKTNIRETYHSWLKANLKSNLTMWKLGTLPPALIAFKGHVQAIDSSWHMLGLGYQS  477

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT++ + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIKSCHI
Sbjct  478  NTNLENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKSCHI  527


 Score = 44.7 bits (104),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI++  DP ECAWAYGMNIFD
Sbjct  396  PLISQHLDPEECAWAYGMNIFD  417



>emb|CDX74279.1| BnaA03g27680D [Brassica napus]
Length=530

 Score =   167 bits (423),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL+ NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  419  LRTWRKTNIRETYHSWLKANLKSNLTMWKLGTLPPALIAFKGHVQAIDSSWHMLGLGYQS  478

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT++ + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIKSCHI
Sbjct  479  NTNLENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKSCHI  528


 Score = 44.7 bits (104),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI++  DP ECAWAYGMNIFD
Sbjct  397  PLISQHLDPEECAWAYGMNIFD  418



>gb|KJB75646.1| hypothetical protein B456_012G049900 [Gossypium raimondii]
Length=534

 Score =   164 bits (416),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH+WL++NLKS+L++W+LGTLPP LIAF GH+H ID  WHMLGLGYQ 
Sbjct  422  LRTWRKTNIRETYHYWLKENLKSNLTMWKLGTLPPALIAFKGHIHPIDPSWHMLGLGYQS  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I  AK A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI
Sbjct  482  KTNIEKAKRAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHI  531


 Score = 47.0 bits (110),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP+ECAWAYGMNIFD
Sbjct  400  PLIAKHLDPDECAWAYGMNIFD  421



>gb|KJB75644.1| hypothetical protein B456_012G049900 [Gossypium raimondii]
Length=533

 Score =   164 bits (416),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH+WL++NLKS+L++W+LGTLPP LIAF GH+H ID  WHMLGLGYQ 
Sbjct  421  LRTWRKTNIRETYHYWLKENLKSNLTMWKLGTLPPALIAFKGHIHPIDPSWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I  AK A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI
Sbjct  481  KTNIEKAKRAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHI  530


 Score = 47.0 bits (110),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP+ECAWAYGMNIFD
Sbjct  399  PLIAKHLDPDECAWAYGMNIFD  420



>ref|XP_011467906.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=525

 Score =   165 bits (418),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WH+LGLGYQ+
Sbjct  413  LSTWRKTNIRETYHSWLKENLKSNLTIWKLGTLPPALIAFRGHVHPIDPSWHLLGLGYQN  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTSI   + A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  473  NTSIESIEKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHIMES  525


 Score = 46.6 bits (109),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+AK+ DP ECAWAYGMNIFD
Sbjct  391  PLVAKNLDPEECAWAYGMNIFD  412



>ref|XP_004304247.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=533

 Score =   165 bits (418),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WH+LGLGYQ+
Sbjct  421  LSTWRKTNIRETYHSWLKENLKSNLTIWKLGTLPPALIAFRGHVHPIDPSWHLLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NTSI   + A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  481  NTSIESIEKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHIMES  533


 Score = 46.2 bits (108),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+AK+ DP ECAWAYGMNIFD
Sbjct  399  PLVAKNLDPEECAWAYGMNIFD  420



>ref|XP_008379401.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Malus 
domestica]
Length=525

 Score =   166 bits (420),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  413  LSTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFRGHVHAIDPRWHMLGLGYQN  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+I     A V+H+NG++KPWL I F  LR  WTKYVN+S+ FI+SCHI
Sbjct  473  NTNIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFIRSCHI  522


 Score = 45.4 bits (106),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  391  PLVSKNLDPEECAWAYGMNIFD  412



>ref|XP_002284273.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Vitis 
vinifera]
Length=534

 Score =   166 bits (419),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  422  LSAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHIHPIDPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  482  KTNIDSVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHILES  534


 Score = 45.8 bits (107),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  400  PLIAKNLNPDECAWAYGMNIFD  421



>ref|XP_008379400.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Malus 
domestica]
Length=533

 Score =   166 bits (420),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  421  LSTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFRGHVHAIDPRWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+I     A V+H+NG++KPWL I F  LR  WTKYVN+S+ FI+SCHI
Sbjct  481  NTNIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFIRSCHI  530


 Score = 45.4 bits (106),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  399  PLVSKNLDPEECAWAYGMNIFD  420



>ref|XP_002526079.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF36273.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=540

 Score =   166 bits (420),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  428  LHAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  487

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  488  KTNIERVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFIRNCHILES  540


 Score = 45.4 bits (106),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI K+ DP+ECAWAYGMNIFD
Sbjct  406  PLILKNLDPDECAWAYGMNIFD  427



>emb|CAN68963.1| hypothetical protein VITISV_019278 [Vitis vinifera]
Length=548

 Score =   166 bits (419),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  436  LSAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHIHPIDPSWHMLGLGYQN  495

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  496  KTNIDSVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHILES  548


 Score = 45.8 bits (107),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  414  PLIAKNLNPDECAWAYGMNIFD  435



>emb|CBI22287.3| unnamed protein product [Vitis vinifera]
Length=511

 Score =   166 bits (419),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  399  LSAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHIHPIDPSWHMLGLGYQN  458

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  459  KTNIDSVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHILES  511


 Score = 45.8 bits (107),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  377  PLIAKNLNPDECAWAYGMNIFD  398



>ref|XP_010661124.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Vitis 
vinifera]
Length=533

 Score =   166 bits (419),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  421  LSAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHIHPIDPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  481  KTNIDSVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHILES  533


 Score = 45.8 bits (107),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  399  PLIAKNLNPDECAWAYGMNIFD  420



>ref|XP_010089605.1| putative galacturonosyltransferase 14 [Morus notabilis]
 gb|EXB38076.1| putative galacturonosyltransferase 14 [Morus notabilis]
Length=534

 Score =   167 bits (423),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH+WL +NLKS+L++W+LGTLPP LIAF GHVH ID  WH+LGLGYQ+
Sbjct  422  LNAWRKTNIRETYHYWLRENLKSNLTMWKLGTLPPALIAFRGHVHPIDPSWHLLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TSI   + A V+H+NG++KPWL I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  482  KTSIESVREAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFIRNCHILES  534


 Score = 43.9 bits (102),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+AK+ D  ECAWAYGMNIFD
Sbjct  400  PLVAKNLDSEECAWAYGMNIFD  421



>ref|XP_009147389.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Brassica 
rapa]
 emb|CDY43264.1| BnaC05g48570D [Brassica napus]
Length=532

 Score =   164 bits (415),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+T+I  TYH WL+ NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  421  LRTWRKTDIRETYHSWLKANLKSNLTMWKLGTLPPALIAFKGHVQAIDSSWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+I + K A V+H+NG++KPWL+I F  LR  WTKY+N+S+ FI+SCHI
Sbjct  481  NTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYLNYSNDFIRSCHI  530


 Score = 47.0 bits (110),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  399  PLIAKHLDPEECAWAYGMNIFD  420



>ref|XP_006408454.1| hypothetical protein EUTSA_v10020487mg [Eutrema salsugineum]
 gb|ESQ49907.1| hypothetical protein EUTSA_v10020487mg [Eutrema salsugineum]
Length=533

 Score =   164 bits (415),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  422  LRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQAIDSSWHMLGLGYQS  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ + K A V+H+NG++KPWL+I F  LR  WTKYVN+++ FIK+CHI
Sbjct  482  KTNLENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYTNDFIKNCHI  531


 Score = 47.0 bits (110),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  400  PLIAKHLDPEECAWAYGMNIFD  421



>ref|XP_009121571.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Brassica 
rapa]
Length=524

 Score =   169 bits (427),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVHVIDS WHMLGLGYQ 
Sbjct  413  LKAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHVIDSSWHMLGLGYQS  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  473  QTNVESIRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  522


 Score = 42.4 bits (98),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P IAK  +P ECAWAYGMN+FD
Sbjct  391  PHIAKHLNPEECAWAYGMNVFD  412



>ref|XP_009147387.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Brassica 
rapa]
 ref|XP_009147388.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Brassica 
rapa]
 emb|CDY37548.1| BnaA05g34130D [Brassica napus]
Length=533

 Score =   164 bits (415),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+T+I  TYH WL+ NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  422  LRTWRKTDIRETYHSWLKANLKSNLTMWKLGTLPPALIAFKGHVQAIDSSWHMLGLGYQS  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+I + K A V+H+NG++KPWL+I F  LR  WTKY+N+S+ FI+SCHI
Sbjct  482  NTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYLNYSNDFIRSCHI  531


 Score = 47.0 bits (110),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  400  PLIAKHLDPEECAWAYGMNIFD  421



>ref|XP_009121572.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Brassica 
rapa]
Length=516

 Score =   169 bits (427),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVHVIDS WHMLGLGYQ 
Sbjct  405  LKAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHVIDSSWHMLGLGYQS  464

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  465  QTNVESIRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  514


 Score = 42.4 bits (98),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P IAK  +P ECAWAYGMN+FD
Sbjct  383  PHIAKHLNPEECAWAYGMNVFD  404



>gb|KHG03530.1| putative galacturonosyltransferase 14 -like protein [Gossypium 
arboreum]
Length=533

 Score =   164 bits (415),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ 
Sbjct  421  LRAWRKTNIRETYHFWLKENLKSNLTMWKLGTLPPALIAFKGRVHPIDPSWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  481  KTNIENVKRAAVIHYNGQSKPWLEIGFDHLRPFWTKYVNYSNDFVRNCHILES  533


 Score = 47.0 bits (110),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP+ECAWAYGMNIFD
Sbjct  399  PLIAKHLDPDECAWAYGMNIFD  420



>ref|XP_011098715.1| PREDICTED: probable galacturonosyltransferase 14 [Sesamum indicum]
Length=537

 Score =   164 bits (414),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L+LW+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  427  LRAWRKTNIRDTYHAWLKENLKSNLTLWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  486

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I   + A V+H+NG++KPWL+I F  LR  WTKYVN+S  FI++CHI
Sbjct  487  KTNIESLEKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSSDFIRNCHI  536


 Score = 47.4 bits (111),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  405  PLIAKNLDPDECAWAYGMNIFD  426



>ref|XP_006431227.1| hypothetical protein CICLE_v10011444mg [Citrus clementina]
 gb|ESR44467.1| hypothetical protein CICLE_v10011444mg [Citrus clementina]
Length=537

 Score =   164 bits (415),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WH+LGLGYQ+
Sbjct  425  LRAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPLWHLLGLGYQN  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             TSI   K A V+H+NG++KPWL I F  LR  W KYVN+S+ F+++CHI
Sbjct  485  KTSIESVKKAAVIHYNGQSKPWLQIGFEHLRPFWAKYVNYSNDFVRNCHI  534


 Score = 47.0 bits (110),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  403  PLIAKHLDPEECAWAYGMNIFD  424



>ref|XP_010525101.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Tarenaya 
hassleriana]
Length=533

 Score =   164 bits (416),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH I+  WHMLGLGYQ+
Sbjct  422  LRAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFRGHVHPIEPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            +T + D K A V+H+NG++KPWL+I F  LR  WTKYV++S+ F+++CHI
Sbjct  482  STDVEDVKRAAVIHYNGQSKPWLEIGFEHLRPFWTKYVDYSNDFVRNCHI  531


 Score = 46.2 bits (108),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  400  PLIAKYLDPKECAWAYGMNIFD  421



>ref|XP_010525102.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Tarenaya 
hassleriana]
Length=532

 Score =   164 bits (416),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH I+  WHMLGLGYQ+
Sbjct  421  LRAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFRGHVHPIEPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            +T + D K A V+H+NG++KPWL+I F  LR  WTKYV++S+ F+++CHI
Sbjct  481  STDVEDVKRAAVIHYNGQSKPWLEIGFEHLRPFWTKYVDYSNDFVRNCHI  530


 Score = 46.2 bits (108),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  399  PLIAKYLDPKECAWAYGMNIFD  420



>gb|KJB40878.1| hypothetical protein B456_007G081500 [Gossypium raimondii]
Length=525

 Score =   164 bits (414),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ 
Sbjct  413  LRAWRKTNIRETYHFWLKENLKSNLTMWKLGTLPPALIAFKGRVHPIDPSWHMLGLGYQR  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  473  KTNIENVKRAAVIHYNGQSKPWLEIGFDHLRPFWTKYVNYSNDFVRNCHILES  525


 Score = 47.0 bits (110),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP+ECAWAYGMNIFD
Sbjct  391  PLIAKHLDPDECAWAYGMNIFD  412



>emb|CDP02301.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   165 bits (418),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NL S+L+LW+LGTLPP LIAF GHVH ID FWHMLGLGYQ+
Sbjct  432  LRAWRQTNIRETYHAWLKENLMSNLTLWKLGTLPPALIAFKGHVHPIDPFWHMLGLGYQN  491

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + + A V+H+NG+AKPWL+I F  LR  WTK+VN+S+ F+++CHI
Sbjct  492  KTNIENLRKAAVIHYNGQAKPWLEIGFEHLRPFWTKHVNYSNDFVRNCHI  541


 Score = 45.4 bits (106),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P ECAWAYGMNIFD
Sbjct  410  PLIAKNLNPEECAWAYGMNIFD  431



>emb|CDX91967.1| BnaC03g32690D [Brassica napus]
Length=529

 Score =   166 bits (420),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH+WL+ NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  418  LRTWRKTNIRETYHYWLKANLKSNLTMWKLGTLPPALIAFKGHVQAIDSSWHMLGLGYQS  477

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIKSCHI
Sbjct  478  KTNLENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKSCHI  527


 Score = 44.7 bits (104),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI++  DP ECAWAYGMNIFD
Sbjct  396  PLISQHLDPEECAWAYGMNIFD  417



>gb|KJB40879.1| hypothetical protein B456_007G081500 [Gossypium raimondii]
Length=533

 Score =   164 bits (414),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ 
Sbjct  421  LRAWRKTNIRETYHFWLKENLKSNLTMWKLGTLPPALIAFKGRVHPIDPSWHMLGLGYQR  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  481  KTNIENVKRAAVIHYNGQSKPWLEIGFDHLRPFWTKYVNYSNDFVRNCHILES  533


 Score = 47.0 bits (110),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP+ECAWAYGMNIFD
Sbjct  399  PLIAKHLDPDECAWAYGMNIFD  420



>emb|CDX70612.1| BnaC03g06960D [Brassica napus]
Length=533

 Score =   164 bits (416),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+T+I  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH++D  WHMLGLGYQ 
Sbjct  422  LQAWRKTDIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHILDPSWHMLGLGYQK  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            +T+I + + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FI +CHI
Sbjct  482  DTNIENVRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFINNCHI  531


 Score = 46.2 bits (108),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMN+FD
Sbjct  400  PLIAKHLDPEECAWAYGMNVFD  421



>ref|XP_010467967.1| PREDICTED: probable galacturonosyltransferase 13 [Camelina sativa]
Length=525

 Score =   164 bits (414),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  414  LRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQS  473

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTK+VN+S+ FIK+CHI
Sbjct  474  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKHVNYSNDFIKNCHI  523


 Score = 47.0 bits (110),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  392  PLIAKHLDPEECAWAYGMNIFD  413



>emb|CDY26424.1| BnaC09g42440D [Brassica napus]
Length=523

 Score =   168 bits (426),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVH+IDS WHMLGLGYQ 
Sbjct  412  LKAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQS  471

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  472  QTNVESIRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  521


 Score = 42.4 bits (98),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P IAK  +P ECAWAYGMN+FD
Sbjct  390  PHIAKHLNPEECAWAYGMNVFD  411



>ref|XP_010485434.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Camelina 
sativa]
Length=533

 Score =   163 bits (413),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  422  LRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQS  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTK+VN+S+ FIK+CHI
Sbjct  482  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKHVNYSNDFIKNCHI  531


 Score = 47.0 bits (110),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  400  PLIAKHLDPEECAWAYGMNIFD  421



>ref|XP_010485435.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Camelina 
sativa]
Length=532

 Score =   163 bits (413),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHV  IDS WHMLGLGYQ 
Sbjct  421  LRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTK+VN+S+ FIK+CHI
Sbjct  481  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKHVNYSNDFIKNCHI  530


 Score = 47.0 bits (110),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  399  PLIAKHLDPEECAWAYGMNIFD  420



>ref|XP_009126049.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Brassica 
rapa]
Length=527

 Score =   165 bits (418),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NL+ +L++W+LGTLPP LIAF GHVHVIDS WHMLGLGYQ+
Sbjct  416  LKAWRKTNIRETYHSWLRENLRLNLAMWKLGTLPPALIAFKGHVHVIDSSWHMLGLGYQN  475

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FI++CHI
Sbjct  476  KTNVETVRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIRNCHI  525


 Score = 44.7 bits (104),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  +P ECAWAYGMN+FD
Sbjct  394  PLIAKHLNPEECAWAYGMNVFD  415



>ref|XP_009126048.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Brassica 
rapa]
Length=535

 Score =   165 bits (418),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NL+ +L++W+LGTLPP LIAF GHVHVIDS WHMLGLGYQ+
Sbjct  424  LKAWRKTNIRETYHSWLRENLRLNLAMWKLGTLPPALIAFKGHVHVIDSSWHMLGLGYQN  483

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FI++CHI
Sbjct  484  KTNVETVRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIRNCHI  533


 Score = 44.7 bits (104),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  +P ECAWAYGMN+FD
Sbjct  402  PLIAKHLNPEECAWAYGMNVFD  423



>ref|XP_008661159.1| PREDICTED: probable galacturonosyltransferase 13 [Zea mays]
Length=538

 Score =   160 bits (406),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+T I   YHHW+++NLKS+ +LW+LGTLPPGLIAF GHVH ID  WH+LGLGYQ+
Sbjct  421  LKAWRKTTIKDQYHHWVKENLKSNFTLWRLGTLPPGLIAFKGHVHPIDPSWHLLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T ++  + A V+H+NG++KPWL+I F  L+  WTKYVN+S+ FI++CHI
Sbjct  481  KTDVSSVEQAAVIHYNGQSKPWLEIGFKHLQPFWTKYVNYSNEFIRNCHI  530


 Score = 49.3 bits (116),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+FDP+ECAWAYGMNIFD
Sbjct  399  PLIAKNFDPSECAWAYGMNIFD  420



>gb|KJB40877.1| hypothetical protein B456_007G081500 [Gossypium raimondii]
Length=393

 Score =   163 bits (412),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ 
Sbjct  281  LRAWRKTNIRETYHFWLKENLKSNLTMWKLGTLPPALIAFKGRVHPIDPSWHMLGLGYQR  340

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  341  KTNIENVKRAAVIHYNGQSKPWLEIGFDHLRPFWTKYVNYSNDFVRNCHILES  393


 Score = 47.0 bits (110),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP+ECAWAYGMNIFD
Sbjct  259  PLIAKHLDPDECAWAYGMNIFD  280



>ref|XP_002443426.1| hypothetical protein SORBIDRAFT_08g019260 [Sorghum bicolor]
 gb|EES17264.1| hypothetical protein SORBIDRAFT_08g019260 [Sorghum bicolor]
Length=535

 Score =   160 bits (406),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T I   YHHW+++NLKS+ +LW+LGTLPPGLIAF GHVH ID  WH+LGLGYQ+
Sbjct  421  LNAWRKTTIKDKYHHWVKENLKSNFTLWRLGTLPPGLIAFKGHVHPIDPSWHLLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I+  + A V+H+NG++KPWL+I F  L+  WTKYVN+S+ FI++CHI
Sbjct  481  KTDISSVEQAAVIHYNGQSKPWLEIGFKHLQPFWTKYVNYSNEFIRNCHI  530


 Score = 49.3 bits (116),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+FDP+ECAWAYGMNIFD
Sbjct  399  PLIAKNFDPSECAWAYGMNIFD  420



>ref|XP_008459373.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Cucumis 
melo]
Length=534

 Score =   164 bits (414),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR +NI+ TYH WL +NLKS L+LW+LGTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  422  LRAWRESNITETYHWWLRENLKSTLTLWRLGTLPPALIAFRGHIHPIDPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I + K A V+H+NG++KPWL I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  482  KTNIENVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFIRNCHILES  534


 Score = 46.2 bits (108),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+A   DPNECAWAYGMNIFD
Sbjct  400  PLVAMHLDPNECAWAYGMNIFD  421



>emb|CDX69522.1| BnaA10g18710D [Brassica napus]
Length=524

 Score =   167 bits (424),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+TNI  TYH WL +NLKS+L++W+LGTLPP LIAF GHVHVIDS WHMLGLGYQ 
Sbjct  413  LKAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHVIDSSWHMLGLGYQS  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+    + A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  473  QTNTESIRKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  522


 Score = 42.4 bits (98),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P IAK  +P ECAWAYGMN+FD
Sbjct  391  PQIAKHLNPEECAWAYGMNVFD  412



>gb|KFK37568.1| hypothetical protein AALP_AA3G000200 [Arabis alpina]
Length=538

 Score =   163 bits (412),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHV  ID  WHMLGLGYQ 
Sbjct  427  LRTWRKTNIRETYHSWLKENLRSNLTMWKLGTLPPALIAFKGHVQPIDPSWHMLGLGYQS  486

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  487  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  536


 Score = 46.6 bits (109),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  405  PLIAKHLDPEECAWAYGMNIFD  426



>ref|XP_006482685.1| PREDICTED: probable galacturonosyltransferase 14-like [Citrus 
sinensis]
 gb|KDO72666.1| hypothetical protein CISIN_1g009348mg [Citrus sinensis]
Length=537

 Score =   163 bits (412),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WH+LGLGYQ+
Sbjct  425  LRAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHLLGLGYQN  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             TSI   K A V+H+NG++KPWL I F  LR  W KYVN+S+ F+++CHI
Sbjct  485  KTSIESVKKAAVIHYNGQSKPWLQIGFEHLRPFWAKYVNYSNDFVRNCHI  534


 Score = 47.0 bits (110),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  403  PLIAKHLDPEECAWAYGMNIFD  424



>gb|KFK37569.1| hypothetical protein AALP_AA3G000200 [Arabis alpina]
Length=524

 Score =   163 bits (412),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHV  ID  WHMLGLGYQ 
Sbjct  413  LRTWRKTNIRETYHSWLKENLRSNLTMWKLGTLPPALIAFKGHVQPIDPSWHMLGLGYQS  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ +AK A V+H+NG++KPWL+I F  LR  WTKYVN+S+ FIK+CHI
Sbjct  473  KTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHI  522


 Score = 46.6 bits (109),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  391  PLIAKHLDPEECAWAYGMNIFD  412



>ref|XP_008459374.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Cucumis 
melo]
Length=533

 Score =   164 bits (414),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR +NI+ TYH WL +NLKS L+LW+LGTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  421  LRAWRESNITETYHWWLRENLKSTLTLWRLGTLPPALIAFRGHIHPIDPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I + K A V+H+NG++KPWL I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  481  KTNIENVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFIRNCHILES  533


 Score = 46.2 bits (108),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+A   DPNECAWAYGMNIFD
Sbjct  399  PLVAMHLDPNECAWAYGMNIFD  420



>gb|KDO72667.1| hypothetical protein CISIN_1g009348mg [Citrus sinensis]
Length=410

 Score =   162 bits (411),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WH+LGLGYQ+
Sbjct  298  LRAWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHLLGLGYQN  357

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             TSI   K A V+H+NG++KPWL I F  LR  W KYVN+S+ F+++CHI
Sbjct  358  KTSIESVKKAAVIHYNGQSKPWLQIGFEHLRPFWAKYVNYSNDFVRNCHI  407


 Score = 46.6 bits (109),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP ECAWAYGMNIFD
Sbjct  276  PLIAKHLDPEECAWAYGMNIFD  297



>ref|XP_009609798.1| PREDICTED: probable galacturonosyltransferase 13 [Nicotiana tomentosiformis]
Length=254

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T+I  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  143  LRAWRKTSIRDTYHTWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  202

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWLDI F  LR  WTKYVN S+ FI+SCHI
Sbjct  203  KTNIENVKKAAVIHYNGQSKPWLDIGFEHLRPFWTKYVNCSNDFIRSCHI  252



>ref|XP_007032681.1| Galacturonosyltransferase 13 isoform 1 [Theobroma cacao]
 gb|EOY03607.1| Galacturonosyltransferase 13 isoform 1 [Theobroma cacao]
Length=533

 Score =   164 bits (414),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI   YH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ 
Sbjct  421  LRAWRKTNIREKYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I + K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  481  KTNIDNVKRAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHILES  533


 Score = 45.4 bits (106),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI K  DP+ECAWAYGMNIFD
Sbjct  399  PLIMKHLDPDECAWAYGMNIFD  420



>ref|NP_001145771.1| uncharacterized protein LOC100279278 [Zea mays]
 gb|ACL52558.1| unknown [Zea mays]
 gb|ACN25858.1| unknown [Zea mays]
 tpg|DAA55152.1| TPA: hypothetical protein ZEAMMB73_453640 [Zea mays]
Length=535

 Score =   160 bits (404),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T I   YHHW+++NLKS+ +LW+LGTLPPGLIAF GHVH ID  WH+LGLGYQ+
Sbjct  421  LNAWRKTTIKDKYHHWVKENLKSNFTLWRLGTLPPGLIAFKGHVHPIDPSWHLLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I+  + A V+H+NG++KPWL+I F  L+  WTKYVN+S+ F+++CHI
Sbjct  481  KTDISSVEQAAVIHYNGQSKPWLEIGFKHLQPFWTKYVNYSNEFLRNCHI  530


 Score = 49.3 bits (116),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+FDP+ECAWAYGMNIFD
Sbjct  399  PLIAKNFDPSECAWAYGMNIFD  420



>ref|XP_010317115.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Solanum 
lycopersicum]
Length=533

 Score =   163 bits (412),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T+I  +YH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  422  LRAWRKTSIRDSYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT++ + K A V+H+NG++KPWL+I F  LR  WTKYVN ++ FIK+CHI
Sbjct  482  NTNVENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNSTNDFIKNCHI  531


 Score = 45.8 bits (107),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  400  PLIAKNLNPDECAWAYGMNIFD  421



>ref|XP_004233377.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Solanum 
lycopersicum]
Length=534

 Score =   163 bits (412),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T+I  +YH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  423  LRAWRKTSIRDSYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT++ + K A V+H+NG++KPWL+I F  LR  WTKYVN ++ FIK+CHI
Sbjct  483  NTNVENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNSTNDFIKNCHI  532


 Score = 45.8 bits (107),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  401  PLIAKNLNPDECAWAYGMNIFD  422



>ref|XP_009789618.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Nicotiana 
sylvestris]
Length=536

 Score =   164 bits (415),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  425  LHAWRKTNIRDTYHSWLKENLKSKLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             ++I D K A V+H+NG++KPWL++ F  LR  WTKYV++S+ FIK+CHI
Sbjct  485  KSNIEDVKKAAVIHYNGQSKPWLELGFEHLRPFWTKYVDYSNDFIKNCHI  534


 Score = 44.7 bits (104),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  +P ECAWAYGMN+FD
Sbjct  403  PLIAKHLNPEECAWAYGMNVFD  424



>ref|XP_009789619.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Nicotiana 
sylvestris]
Length=535

 Score =   164 bits (415),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  424  LHAWRKTNIRDTYHSWLKENLKSKLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  483

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             ++I D K A V+H+NG++KPWL++ F  LR  WTKYV++S+ FIK+CHI
Sbjct  484  KSNIEDVKKAAVIHYNGQSKPWLELGFEHLRPFWTKYVDYSNDFIKNCHI  533


 Score = 44.7 bits (104),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  +P ECAWAYGMN+FD
Sbjct  402  PLIAKHLNPEECAWAYGMNVFD  423



>gb|AES74845.2| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=533

 Score =   162 bits (410),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR  NI  TYH WL++NL+S++++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  421  LRAWRAANIRETYHSWLKENLRSNMTMWKLGTLPPALIAFRGHVHPIDPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS+   K A V+H+NG++KPWL+I F  L+  WTKYVN+S+ F+++CHI  S
Sbjct  481  KTSVEKVKMAAVIHYNGQSKPWLEIGFEHLKPFWTKYVNYSNDFVRNCHIMES  533


 Score = 46.6 bits (109),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP+ECAWAYGMN+FD
Sbjct  399  PLIAKHLDPDECAWAYGMNVFD  420



>ref|XP_009587641.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Nicotiana 
tomentosiformis]
Length=537

 Score =   166 bits (419),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T+I  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  426  LRAWRKTSIRDTYHTWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  485

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWLDI F  LR  WTKYVN S+ FI+SCHI
Sbjct  486  KTNIENVKKAAVIHYNGQSKPWLDIGFEHLRPFWTKYVNCSNDFIRSCHI  535


 Score = 43.1 bits (100),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -1

Query  729  LIAKSFDPNECAWAYGMNIFD  667
            LIAK+ +P+ECAWAYGMNIFD
Sbjct  405  LIAKNLNPDECAWAYGMNIFD  425



>ref|XP_003618627.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
Length=561

 Score =   162 bits (410),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR  NI  TYH WL++NL+S++++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  449  LRAWRAANIRETYHSWLKENLRSNMTMWKLGTLPPALIAFRGHVHPIDPSWHMLGLGYQN  508

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             TS+   K A V+H+NG++KPWL+I F  L+  WTKYVN+S+ F+++CHI  S
Sbjct  509  KTSVEKVKMAAVIHYNGQSKPWLEIGFEHLKPFWTKYVNYSNDFVRNCHIMES  561


 Score = 46.6 bits (109),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP+ECAWAYGMN+FD
Sbjct  427  PLIAKHLDPDECAWAYGMNVFD  448



>ref|XP_008341637.1| PREDICTED: probable galacturonosyltransferase 14 isoform X3 [Malus 
domestica]
Length=526

 Score =   163 bits (412),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W+++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  414  LNAWRKTNIRETYHSWVKENLKSNLTIWKLGTLPPALIAFRGHVHAIDPKWHMLGLGYQN  473

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I     A V+H+NG++KPWL I F  LR  WTKY+N+S+ F+++CHI  S
Sbjct  474  KTDIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYINYSNDFVRNCHILES  526


 Score = 45.4 bits (106),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  392  PLVSKNLDPEECAWAYGMNIFD  413



>ref|XP_009587642.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Nicotiana 
tomentosiformis]
Length=536

 Score =   166 bits (419),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T+I  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  425  LRAWRKTSIRDTYHTWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWLDI F  LR  WTKYVN S+ FI+SCHI
Sbjct  485  KTNIENVKKAAVIHYNGQSKPWLDIGFEHLRPFWTKYVNCSNDFIRSCHI  534


 Score = 43.1 bits (100),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -1

Query  729  LIAKSFDPNECAWAYGMNIFD  667
            LIAK+ +P+ECAWAYGMNIFD
Sbjct  404  LIAKNLNPDECAWAYGMNIFD  424



>ref|XP_008341638.1| PREDICTED: probable galacturonosyltransferase 14 isoform X4 [Malus 
domestica]
Length=525

 Score =   163 bits (412),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W+++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  413  LNAWRKTNIRETYHSWVKENLKSNLTIWKLGTLPPALIAFRGHVHAIDPKWHMLGLGYQN  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I     A V+H+NG++KPWL I F  LR  WTKY+N+S+ F+++CHI  S
Sbjct  473  KTDIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYINYSNDFVRNCHILES  525


 Score = 45.4 bits (106),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  391  PLVSKNLDPEECAWAYGMNIFD  412



>ref|XP_004141462.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Cucumis 
sativus]
Length=535

 Score =   162 bits (409),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR +NI+ TYH WL +NLKS L+LW+LGTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  423  LRVWRESNITETYHWWLRENLKSTLTLWRLGTLPPALIAFRGHIHPIDPSWHMLGLGYQN  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I + K A V+H+NG++KPWL I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  483  KTNIENVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFIRNCHILES  535


 Score = 46.6 bits (109),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+A   DPNECAWAYGMNIFD
Sbjct  401  PLVATHLDPNECAWAYGMNIFD  422



>ref|XP_011656007.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Cucumis 
sativus]
 gb|KGN52500.1| hypothetical protein Csa_5G638390 [Cucumis sativus]
Length=534

 Score =   162 bits (409),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR +NI+ TYH WL +NLKS L+LW+LGTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  422  LRVWRESNITETYHWWLRENLKSTLTLWRLGTLPPALIAFRGHIHPIDPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I + K A V+H+NG++KPWL I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  482  KTNIENVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFIRNCHILES  534


 Score = 46.6 bits (109),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+A   DPNECAWAYGMNIFD
Sbjct  400  PLVATHLDPNECAWAYGMNIFD  421



>ref|XP_003552555.1| PREDICTED: probable galacturonosyltransferase 14-like [Glycine 
max]
Length=539

 Score =   162 bits (409),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWRRTNI   YH WL++NLKS+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ+
Sbjct  427  LHAWRRTNIREIYHSWLKENLKSNLTMWKLGTLPPALIAFKGLVHPIDPSWHMLGLGYQN  486

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+I   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI
Sbjct  487  NTNIESVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFLRNCHI  536


 Score = 46.6 bits (109),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++ DP+ECAWAYGMNIFD
Sbjct  405  PLIARNLDPDECAWAYGMNIFD  426



>gb|KHN13575.1| Putative galacturonosyltransferase 14 [Glycine soja]
Length=538

 Score =   162 bits (409),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWRRTNI   YH WL++NLKS+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ+
Sbjct  426  LHAWRRTNIREIYHSWLKENLKSNLTMWKLGTLPPALIAFKGLVHPIDPSWHMLGLGYQN  485

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+I   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI
Sbjct  486  NTNIESVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFLRNCHI  535


 Score = 46.6 bits (109),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++ DP+ECAWAYGMNIFD
Sbjct  404  PLIARNLDPDECAWAYGMNIFD  425



>ref|XP_008341635.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Malus 
domestica]
Length=534

 Score =   162 bits (411),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W+++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  422  LNAWRKTNIRETYHSWVKENLKSNLTIWKLGTLPPALIAFRGHVHAIDPKWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I     A V+H+NG++KPWL I F  LR  WTKY+N+S+ F+++CHI  S
Sbjct  482  KTDIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYINYSNDFVRNCHILES  534


 Score = 45.4 bits (106),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  400  PLVSKNLDPEECAWAYGMNIFD  421



>ref|XP_008341636.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Malus 
domestica]
Length=533

 Score =   162 bits (411),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W+++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  421  LNAWRKTNIRETYHSWVKENLKSNLTIWKLGTLPPALIAFRGHVHAIDPKWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I     A V+H+NG++KPWL I F  LR  WTKY+N+S+ F+++CHI  S
Sbjct  481  KTDIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYINYSNDFVRNCHILES  533


 Score = 45.4 bits (106),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  399  PLVSKNLDPEECAWAYGMNIFD  420



>ref|XP_004491881.1| PREDICTED: probable galacturonosyltransferase 14-like [Cicer 
arietinum]
Length=535

 Score =   164 bits (415),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  423  LGAWRQTNIRETYHSWLKENLRSNLTMWKLGTLPPALIAFRGHVHPIDPSWHMLGLGYQN  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+    K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  483  NTNFESVKKAAVIHYNGQSKPWLPIGFEHLRPFWTKYVNYSNDFVRNCHILES  535


 Score = 43.9 bits (102),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+   DP+ECAWAYGMNIFD
Sbjct  401  PLISNHLDPDECAWAYGMNIFD  422



>dbj|BAJ86151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   164 bits (415),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAWR+TNI  TYH WL++NLK+ L+LW+ GTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  452  LEAWRKTNIRDTYHFWLKENLKAGLTLWKFGTLPPALIAFRGHVHGIDPSWHMLGLGYQE  511

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            +T I   K A VVH+NG+ KPWLDIAF  L+  WTK+VN+S+ FI++CHI
Sbjct  512  STDIESVKKAAVVHYNGQCKPWLDIAFKNLQPFWTKHVNYSNDFIRNCHI  561


 Score = 43.9 bits (102),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+I +S DP+ECAWAYGMN+FD
Sbjct  430  PVIDRSLDPDECAWAYGMNVFD  451



>ref|XP_009360555.1| PREDICTED: probable galacturonosyltransferase 14 isoform X3 [Pyrus 
x bretschneideri]
Length=525

 Score =   162 bits (410),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W+++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ 
Sbjct  413  LNAWRKTNIRETYHSWVKENLKSNLTIWKLGTLPPALIAFRGHVHAIDPKWHMLGLGYQS  472

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I     A V+H+NG++KPWL I F  LR  WTKY+N+S+ F+++CHI  S
Sbjct  473  KTDIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYINYSNDFVRNCHILES  525


 Score = 45.4 bits (106),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  391  PLVSKNLDPEECAWAYGMNIFD  412



>ref|XP_009360552.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Pyrus 
x bretschneideri]
Length=534

 Score =   162 bits (410),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W+++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ 
Sbjct  422  LNAWRKTNIRETYHSWVKENLKSNLTIWKLGTLPPALIAFRGHVHAIDPKWHMLGLGYQS  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I     A V+H+NG++KPWL I F  LR  WTKY+N+S+ F+++CHI  S
Sbjct  482  KTDIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYINYSNDFVRNCHILES  534


 Score = 45.4 bits (106),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  400  PLVSKNLDPEECAWAYGMNIFD  421



>ref|XP_009360554.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Pyrus 
x bretschneideri]
Length=533

 Score =   162 bits (410),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W+++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ 
Sbjct  421  LNAWRKTNIRETYHSWVKENLKSNLTIWKLGTLPPALIAFRGHVHAIDPKWHMLGLGYQS  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I     A V+H+NG++KPWL I F  LR  WTKY+N+S+ F+++CHI  S
Sbjct  481  KTDIESVSRAAVIHYNGQSKPWLQIGFEHLRPFWTKYINYSNDFVRNCHILES  533


 Score = 45.4 bits (106),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL++K+ DP ECAWAYGMNIFD
Sbjct  399  PLVSKNLDPEECAWAYGMNIFD  420



>ref|XP_003531845.1| PREDICTED: probable galacturonosyltransferase 14-like [Glycine 
max]
 gb|KHM98796.1| Putative galacturonosyltransferase 14 [Glycine soja]
Length=538

 Score =   161 bits (407),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWRRTNI   YH WL++NLKS+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ+
Sbjct  426  LHAWRRTNIREIYHSWLKENLKSNLTMWKLGTLPPALIAFKGLVHPIDPSWHMLGLGYQN  485

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
            NT+I   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++C+I  S
Sbjct  486  NTNIESVKKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFLRNCNILES  538


 Score = 46.6 bits (109),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++ DP+ECAWAYGMNIFD
Sbjct  404  PLIARNLDPDECAWAYGMNIFD  425



>ref|XP_008658926.1| PREDICTED: uncharacterized protein LOC100384251 isoform X2 [Zea 
mays]
Length=487

 Score =   160 bits (406),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L+LW+ GTLPP LIAF GHVH ID  WH+LGLGYQD
Sbjct  370  LAAWRKTNIRDTYHFWLKENLKSGLTLWKFGTLPPSLIAFRGHVHGIDPSWHLLGLGYQD  429

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I   + A V+H+NG+ KPWLDIAF  L+  WTK+VN+S+ F+K+CHI
Sbjct  430  KTDIESVRRAAVIHYNGQCKPWLDIAFKNLQPFWTKHVNYSNDFVKNCHI  479


 Score = 47.0 bits (110),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IA+S DP+ECAWAYGMNIFD
Sbjct  348  PVIARSLDPDECAWAYGMNIFD  369



>gb|KHG04367.1| putative galacturonosyltransferase 13 -like protein [Gossypium 
arboreum]
Length=534

 Score =   160 bits (405),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH+WL++NLK +L++W+LGTLPP LIAF GH+H ID  WHMLGLGYQ 
Sbjct  422  LRTWRKTNIRETYHYWLKENLKWNLTMWKLGTLPPALIAFKGHIHPIDPSWHMLGLGYQT  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I  AK A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI
Sbjct  482  KTNIEKAKRAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHI  531


 Score = 47.0 bits (110),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  DP+ECAWAYGMNIFD
Sbjct  400  PLIAKHLDPDECAWAYGMNIFD  421



>ref|XP_010550020.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Tarenaya 
hassleriana]
Length=533

 Score =   160 bits (406),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NL+S+L++W+LGTLPP LIAF G V  I+  WHMLGLGYQ+
Sbjct  422  LRAWRKTNIRETYHSWLKENLESNLTMWKLGTLPPALIAFRGQVQAIEPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I D   A V+H+NG++KPWL+I F  LR  WTKYVN+S+ F++SCHI
Sbjct  482  KTNIEDVHKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNEFVRSCHI  531


 Score = 46.6 bits (109),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+AK  DP ECAWAYGMNIFD
Sbjct  400  PLVAKHLDPEECAWAYGMNIFD  421



>ref|XP_006363419.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X1 [Solanum tuberosum]
Length=534

 Score =   162 bits (409),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T+I  +YH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  423  LRAWRKTSIRDSYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT++ + K A V+H+NG++KPWL+I F  LR  WTKYVN ++ FI++CHI
Sbjct  483  NTNVENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNNTNDFIRNCHI  532


 Score = 45.8 bits (107),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  401  PLIAKNLNPDECAWAYGMNIFD  422



>ref|XP_010550021.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Tarenaya 
hassleriana]
Length=532

 Score =   160 bits (406),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NL+S+L++W+LGTLPP LIAF G V  I+  WHMLGLGYQ+
Sbjct  421  LRAWRKTNIRETYHSWLKENLESNLTMWKLGTLPPALIAFRGQVQAIEPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I D   A V+H+NG++KPWL+I F  LR  WTKYVN+S+ F++SCHI
Sbjct  481  KTNIEDVHKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNEFVRSCHI  530


 Score = 46.6 bits (109),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+AK  DP ECAWAYGMNIFD
Sbjct  399  PLVAKHLDPEECAWAYGMNIFD  420



>ref|XP_008658925.1| PREDICTED: uncharacterized protein LOC100384251 isoform X1 [Zea 
mays]
 gb|AFW89249.1| hypothetical protein ZEAMMB73_107521 [Zea mays]
Length=560

 Score =   160 bits (406),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L+LW+ GTLPP LIAF GHVH ID  WH+LGLGYQD
Sbjct  443  LAAWRKTNIRDTYHFWLKENLKSGLTLWKFGTLPPSLIAFRGHVHGIDPSWHLLGLGYQD  502

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I   + A V+H+NG+ KPWLDIAF  L+  WTK+VN+S+ F+K+CHI
Sbjct  503  KTDIESVRRAAVIHYNGQCKPWLDIAFKNLQPFWTKHVNYSNDFVKNCHI  552


 Score = 46.6 bits (109),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IA+S DP+ECAWAYGMNIFD
Sbjct  421  PVIARSLDPDECAWAYGMNIFD  442



>ref|XP_006363420.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X2 [Solanum tuberosum]
Length=533

 Score =   161 bits (408),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T+I  +YH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  422  LRAWRKTSIRDSYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT++ + K A V+H+NG++KPWL+I F  LR  WTKYVN ++ FI++CHI
Sbjct  482  NTNVENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNNTNDFIRNCHI  531


 Score = 45.8 bits (107),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  400  PLIAKNLNPDECAWAYGMNIFD  421



>ref|XP_010551819.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Tarenaya 
hassleriana]
Length=533

 Score =   164 bits (414),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W ++NLKS L++W+LGTLPP LIAF GHVH I+  WHMLGLGYQ+
Sbjct  422  LRAWRKTNIRETYHSWFKENLKSGLTMWKLGTLPPALIAFRGHVHPIEPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ D K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ F+++CHI
Sbjct  482  KTNVEDIKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFVRNCHI  531


 Score = 43.1 bits (100),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P++ K  DP ECAWAYGMNIFD
Sbjct  400  PIVVKYLDPEECAWAYGMNIFD  421



>ref|XP_003558510.1| PREDICTED: probable galacturonosyltransferase 14 [Brachypodium 
distachyon]
Length=563

 Score =   163 bits (412),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            LEAW++TNI  TYH WL++NLKS L+LW+ GTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  447  LEAWKKTNIRDTYHFWLKENLKSGLTLWKFGTLPPALIAFRGHVHGIDPSWHMLGLGYQE  506

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I   K A VVH+NG+ KPWLDIAF  L+  WTK+VN+S+ FI++CHI
Sbjct  507  RTDIESVKRAAVVHYNGQCKPWLDIAFKNLQPFWTKHVNYSNDFIRNCHI  556


 Score = 43.9 bits (102),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+I +S DP+ECAWAYGMNIFD
Sbjct  425  PVIDQSLDPDECAWAYGMNIFD  446



>ref|XP_010551820.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Tarenaya 
hassleriana]
Length=532

 Score =   164 bits (414),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH W ++NLKS L++W+LGTLPP LIAF GHVH I+  WHMLGLGYQ+
Sbjct  421  LRAWRKTNIRETYHSWFKENLKSGLTMWKLGTLPPALIAFRGHVHPIEPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ D K A V+H+NG++KPWL+I F  LR  WTKYVN+S+ F+++CHI
Sbjct  481  KTNVEDIKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFVRNCHI  530


 Score = 43.1 bits (100),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P++ K  DP ECAWAYGMNIFD
Sbjct  399  PIVVKYLDPEECAWAYGMNIFD  420



>gb|ABF94604.1| Glycosyl transferase family 8 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01509.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58569.1| hypothetical protein OsJ_09887 [Oryza sativa Japonica Group]
Length=577

 Score =   160 bits (405),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L+LW+ GTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  460  LAAWRKTNIRETYHFWLKENLKSGLTLWKFGTLPPALIAFRGHLHGIDPSWHMLGLGYQE  519

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT I   + + V+H+NG+ KPWLDIAF  L+  WTK+VN+S+ FI++CHI
Sbjct  520  NTDIEGVRRSAVIHYNGQCKPWLDIAFKNLQPFWTKHVNYSNDFIRNCHI  569


 Score = 46.6 bits (109),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IA+S DP+ECAWAYGMNIFD
Sbjct  438  PVIARSLDPDECAWAYGMNIFD  459



>ref|XP_009629907.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Nicotiana 
tomentosiformis]
Length=536

 Score =   162 bits (410),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  425  LHAWRKTNIRDTYHSWLKENLKSKLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             ++I + K A V+H+NG++KPWL++ F  LR  WTKYV++S+ FIK+CHI
Sbjct  485  KSNIENVKKAAVIHYNGQSKPWLELGFEHLRPFWTKYVDYSNDFIKNCHI  534


 Score = 44.7 bits (104),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  +P ECAWAYGMN+FD
Sbjct  403  PLIAKHLNPEECAWAYGMNVFD  424



>ref|XP_009629908.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Nicotiana 
tomentosiformis]
Length=535

 Score =   162 bits (410),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  424  LHAWRKTNIRDTYHSWLKENLKSKLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  483

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             ++I + K A V+H+NG++KPWL++ F  LR  WTKYV++S+ FIK+CHI
Sbjct  484  KSNIENVKKAAVIHYNGQSKPWLELGFEHLRPFWTKYVDYSNDFIKNCHI  533


 Score = 44.7 bits (104),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  +P ECAWAYGMN+FD
Sbjct  402  PLIAKHLNPEECAWAYGMNVFD  423



>gb|EEC74744.1| hypothetical protein OsI_10497 [Oryza sativa Indica Group]
Length=548

 Score =   160 bits (405),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L+LW+ GTLPP LIAF GH+H ID  WHMLGLGYQ+
Sbjct  431  LAAWRKTNIRETYHFWLKENLKSGLTLWKFGTLPPALIAFRGHLHGIDPSWHMLGLGYQE  490

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT I   + + V+H+NG+ KPWLDIAF  L+  WTK+VN+S+ FI++CHI
Sbjct  491  NTDIEGVRRSAVIHYNGQCKPWLDIAFKNLQPFWTKHVNYSNDFIRNCHI  540


 Score = 46.6 bits (109),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IA+S DP+ECAWAYGMNIFD
Sbjct  409  PVIARSLDPDECAWAYGMNIFD  430



>ref|XP_006338386.1| PREDICTED: probable galacturonosyltransferase 14-like [Solanum 
tuberosum]
Length=534

 Score =   163 bits (413),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI+ TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID+ WHMLGLGYQ 
Sbjct  423  LRAWRKTNITNTYHAWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDASWHMLGLGYQS  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWL+I F  LR  WTK+VN S+ FI +CHI
Sbjct  483  KTNIDNVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKFVNSSNDFISTCHI  532


 Score = 43.1 bits (100),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P  CAWAYGMNIFD
Sbjct  401  PLIAKNLNPENCAWAYGMNIFD  422



>ref|XP_004149844.2| PREDICTED: probable galacturonosyltransferase 14 [Cucumis sativus]
 gb|KGN58112.1| hypothetical protein Csa_3G516510 [Cucumis sativus]
Length=534

 Score =   162 bits (409),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWRRTNI   YH WL +NL+S+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ+
Sbjct  422  LRAWRRTNIREIYHSWLRKNLRSNLTMWKLGTLPPALIAFRGQVHPIDPSWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T++ + K+A V+H+NG+ KPWL+I F  LR  W KYVN+S+ FI++CHI  S
Sbjct  482  RTNVENVKNAAVIHYNGQLKPWLEIGFEHLRPFWIKYVNYSNDFIRNCHIVES  534


 Score = 44.7 bits (104),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IAK  +P+ECAWAYGMNIFD
Sbjct  400  PIIAKHLNPDECAWAYGMNIFD  421



>ref|XP_009790355.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009790356.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Nicotiana 
sylvestris]
Length=537

 Score =   163 bits (413),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T++  TYH WL++NLKS+L++W+LGTLPP LIAF GHV+ ID  WHMLGLGYQ+
Sbjct  426  LRAWRKTSVRDTYHTWLKENLKSNLTMWKLGTLPPALIAFKGHVYPIDPSWHMLGLGYQN  485

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWLDI F  LR  WTKYVN S+ FI+SCHI
Sbjct  486  KTNIENVKKAAVIHYNGQSKPWLDIGFEHLRPFWTKYVNCSNDFIRSCHI  535


 Score = 43.1 bits (100),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -1

Query  729  LIAKSFDPNECAWAYGMNIFD  667
            LIAK+ +P+ECAWAYGMNIFD
Sbjct  405  LIAKNLNPDECAWAYGMNIFD  425



>ref|XP_009790357.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Nicotiana 
sylvestris]
Length=536

 Score =   163 bits (413),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T++  TYH WL++NLKS+L++W+LGTLPP LIAF GHV+ ID  WHMLGLGYQ+
Sbjct  425  LRAWRKTSVRDTYHTWLKENLKSNLTMWKLGTLPPALIAFKGHVYPIDPSWHMLGLGYQN  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWLDI F  LR  WTKYVN S+ FI+SCHI
Sbjct  485  KTNIENVKKAAVIHYNGQSKPWLDIGFEHLRPFWTKYVNCSNDFIRSCHI  534


 Score = 43.1 bits (100),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -1

Query  729  LIAKSFDPNECAWAYGMNIFD  667
            LIAK+ +P+ECAWAYGMNIFD
Sbjct  404  LIAKNLNPDECAWAYGMNIFD  424



>ref|XP_004234296.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Solanum 
lycopersicum]
Length=536

 Score =   159 bits (402),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  425  LHTWRKTNIRDTYHSWLKENLKSKLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             ++I   K+A V+H+NG++KPWL++ F  LR  WTKYV++S+ FIK+CHI
Sbjct  485  KSNIDKVKNAAVIHYNGQSKPWLELGFEHLRPYWTKYVDYSNDFIKNCHI  534


 Score = 47.0 bits (110),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAKS +P+ECAWAYGMNIFD
Sbjct  403  PLIAKSLNPDECAWAYGMNIFD  424



>ref|XP_010317525.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Solanum 
lycopersicum]
Length=537

 Score =   159 bits (402),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  426  LHTWRKTNIRDTYHSWLKENLKSKLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  485

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             ++I   K+A V+H+NG++KPWL++ F  LR  WTKYV++S+ FIK+CHI
Sbjct  486  KSNIDKVKNAAVIHYNGQSKPWLELGFEHLRPYWTKYVDYSNDFIKNCHI  535


 Score = 47.0 bits (110),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAKS +P+ECAWAYGMNIFD
Sbjct  404  PLIAKSLNPDECAWAYGMNIFD  425



>ref|XP_004232177.1| PREDICTED: probable galacturonosyltransferase 14 [Solanum lycopersicum]
Length=534

 Score =   163 bits (412),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI+ TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID+ WHMLGLGYQ 
Sbjct  423  LRAWRKTNITNTYHAWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIDASWHMLGLGYQS  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T+I + K A V+H+NG++KPWL+I F  LR  WTK+VN S+ FI +CHI
Sbjct  483  KTNIDNVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKFVNSSNDFISNCHI  532


 Score = 43.1 bits (100),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P  CAWAYGMNIFD
Sbjct  401  PLIAKNLNPENCAWAYGMNIFD  422



>ref|XP_006651162.1| PREDICTED: probable galacturonosyltransferase 14-like [Oryza 
brachyantha]
Length=519

 Score =   159 bits (403),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS L+LW+ GTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  402  LAEWRKTNIRDTYHFWLKENLKSGLTLWKFGTLPPALIAFRGHVHGIDPSWHMLGLGYQE  461

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT I   + + V+H+NG+ KPWLDIAF  L+  WTK+VN+S+ FI++CHI
Sbjct  462  NTDIESVRRSAVIHYNGQCKPWLDIAFKNLQPFWTKHVNYSNDFIRNCHI  511


 Score = 46.6 bits (109),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IA+S DP+ECAWAYGMNIFD
Sbjct  380  PVIARSLDPDECAWAYGMNIFD  401



>ref|XP_008792744.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Phoenix 
dactylifera]
Length=534

 Score =   159 bits (401),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH+WL++NLK++L+LW+ GTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  421  LSAWRKTNIRETYHYWLKENLKANLTLWKFGTLPPALIAFRGHVHPIDPSWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   K A V+H+NG+ KPWL+I F  L+  WTK+VN+++ FI++CHI
Sbjct  481  KTNLDSVKKAAVIHYNGQCKPWLEIGFKHLQPFWTKHVNYTNDFIRNCHI  530


 Score = 47.4 bits (111),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  399  PLIAKNLDPDECAWAYGMNIFD  420



>ref|XP_006837044.1| PREDICTED: probable galacturonosyltransferase 13 [Amborella trichopoda]
 gb|ERM99897.1| hypothetical protein AMTR_s00110p00049110 [Amborella trichopoda]
Length=533

 Score =   160 bits (404),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TY +WL++NL S+L+LW+LGTLPP LIAF GHVH IDS WHMLGLGYQ 
Sbjct  421  LNAWRKTNIRDTYDNWLKENLSSNLTLWRLGTLPPALIAFSGHVHPIDSSWHMLGLGYQP  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ + K A V+H+NG+ KPWL+I F +LR  WTK+VN+S+ FI++CHI
Sbjct  481  ETNLENIKRAAVIHYNGQGKPWLEIGFKELRPFWTKHVNYSNDFIRNCHI  530


 Score = 46.2 bits (108),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+AK  DP ECAWAYGMNIFD
Sbjct  399  PLVAKHLDPEECAWAYGMNIFD  420



>ref|XP_008230851.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
14 [Prunus mume]
Length=527

 Score =   159 bits (403),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  415  LSTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFRGHVHPIDPSWHMLGLGYQN  474

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T++       V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  475  KTNLESVARVAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNDFVRNCHILDS  527


 Score = 46.6 bits (109),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+AK+ DP ECAWAYGMNIFD
Sbjct  393  PLVAKNLDPEECAWAYGMNIFD  414



>gb|EYU44171.1| hypothetical protein MIMGU_mgv1a004225mg [Erythranthe guttata]
Length=538

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI   YH WL++NLKS+L+LW+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  427  LSAWRKTNIRDAYHIWLKENLKSNLTLWKLGTLPPALIAFRGHVHPIDPSWHMLGLGYQN  486

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT+I + K A V+H+NG++KPWL+I F  LR  WTKYVN+S  FI++CHI
Sbjct  487  NTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSSDFIRNCHI  536



>ref|XP_008792745.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Phoenix 
dactylifera]
Length=482

 Score =   158 bits (400),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH+WL++NLK++L+LW+ GTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  369  LSAWRKTNIRETYHYWLKENLKANLTLWKFGTLPPALIAFRGHVHPIDPSWHMLGLGYQE  428

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   K A V+H+NG+ KPWL+I F  L+  WTK+VN+++ FI++CHI
Sbjct  429  KTNLDSVKKAAVIHYNGQCKPWLEIGFKHLQPFWTKHVNYTNDFIRNCHI  478


 Score = 47.4 bits (111),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  347  PLIAKNLDPDECAWAYGMNIFD  368



>ref|XP_004962991.1| PREDICTED: probable galacturonosyltransferase 13-like [Setaria 
italica]
Length=535

 Score =   158 bits (400),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T I   YHHW+++NLKS+ +LW+LGTLPPGLIAF GHVH ID  WH+LGLGYQ+
Sbjct  421  LNAWRKTTIKDKYHHWVKENLKSNFTLWRLGTLPPGLIAFKGHVHPIDPSWHLLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I+  + A V+H+NG++KPWL+I F  L+  WT++VN+S+ FIK+CHI
Sbjct  481  KTDISSVEQAAVIHYNGQSKPWLEIGFKHLQPFWTRHVNYSNEFIKNCHI  530


 Score = 47.4 bits (111),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA +FDP+ECAWAYGMNIFD
Sbjct  399  PLIASNFDPSECAWAYGMNIFD  420



>gb|EMS53278.1| putative galacturonosyltransferase 13 [Triticum urartu]
Length=535

 Score =   159 bits (403),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T I   YHHW+++NLKS+ +LW+LGTLPPGLIAF GHVH ID  WH+LGLGYQ+
Sbjct  421  LAAWRKTTIKDKYHHWVKENLKSNFTLWRLGTLPPGLIAFKGHVHPIDPSWHLLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I+  + A V+H+NG++KPWLDI F  L+  WTK+VN+S+ F+++CHI
Sbjct  481  KTDISSVRKAAVIHYNGQSKPWLDIGFKHLQPFWTKHVNYSNEFVRNCHI  530


 Score = 45.8 bits (107),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA +FDP ECAWAYGMNIFD
Sbjct  399  PLIATNFDPLECAWAYGMNIFD  420



>gb|EYU34622.1| hypothetical protein MIMGU_mgv1a004198mg [Erythranthe guttata]
Length=539

 Score =   161 bits (407),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS+++LW+LGTLPP LIAF G+VH ID  WHMLGLGYQ+
Sbjct  428  LRAWRKTNIRDTYHSWLKENLKSNMTLWKLGTLPPALIAFKGYVHPIDPSWHMLGLGYQN  487

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T +   K A V+H+NG +KPWL+I F  LR  WTKYVN+S+ FI++CH+
Sbjct  488  KTDVESVKKAAVIHYNGPSKPWLEIGFEHLRPFWTKYVNYSNDFIRNCHV  537


 Score = 44.3 bits (103),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLI+ + DP+ECAWAYGMNIFD
Sbjct  406  PLISNNLDPDECAWAYGMNIFD  427



>ref|XP_008450151.1| PREDICTED: probable galacturonosyltransferase 14 [Cucumis melo]
Length=534

 Score =   161 bits (408),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWRRTNI   YH WL +NL+S+L++W+LGTLPP LIAF G VH ID  WHMLGLGYQ+
Sbjct  422  LRAWRRTNIREIYHSWLRKNLRSNLTMWKLGTLPPALIAFRGQVHPIDPSWHMLGLGYQE  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T++   K+A V+H+NG+ KPWL+I F  LR  W KYVN+S+ FI++CHI  S
Sbjct  482  QTNVEKVKNAAVIHYNGQLKPWLEIGFEHLRPFWIKYVNYSNDFIRNCHIVES  534


 Score = 43.9 bits (102),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IAK  +P+ECAWAYGMN+FD
Sbjct  400  PIIAKHLNPDECAWAYGMNVFD  421



>ref|XP_010936345.1| PREDICTED: probable galacturonosyltransferase 13 [Elaeis guineensis]
Length=534

 Score =   157 bits (398),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+T+I  TYH+WL++NLK++L+LW+ GTLPP LIAF GHVH IDS WHMLGLGYQ+
Sbjct  421  LSTWRKTDIRETYHYWLKENLKANLTLWKFGTLPPALIAFRGHVHPIDSSWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   K A V+H+NG+ KPWL+I F  L+  WTK+VN+S  FI++CHI
Sbjct  481  KTNLDSVKKAAVIHYNGQCKPWLEIGFKHLQPFWTKHVNYSSDFIRNCHI  530


 Score = 47.4 bits (111),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DP+ECAWAYGMNIFD
Sbjct  399  PLIAKNLDPDECAWAYGMNIFD  420



>gb|KHF97963.1| putative galacturonosyltransferase 14 -like protein [Gossypium 
arboreum]
Length=532

 Score =   159 bits (401),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYHHW ++NL S+L+LW+ GTLPP LIAF G+VH ID  WHMLGLGYQ 
Sbjct  420  LRAWRKTNIIETYHHWFKENLDSNLTLWKFGTLPPALIAFKGYVHPIDPSWHMLGLGYQS  479

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I + K A V+H+NG+ KPWL I    LR  WTKYVN+S+ F+++CHI  S
Sbjct  480  KTDIENVKKAAVIHYNGQLKPWLPIGLKHLRPFWTKYVNYSNDFVRNCHIMDS  532


 Score = 46.2 bits (108),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IAK  DP+ECAWAYGMNIFD
Sbjct  398  PIIAKHLDPDECAWAYGMNIFD  419



>ref|XP_006363745.1| PREDICTED: probable galacturonosyltransferase 14-like isoform 
X1 [Solanum tuberosum]
Length=537

 Score =   159 bits (402),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  426  LHTWRKTNIRDTYHSWLKENLKSKLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  485

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             ++I   K A V+H+NG++KPWL++ F  LR  WTKYV++S+ FIK+CHI
Sbjct  486  KSNIDKVKKAAVIHYNGQSKPWLELGFEHLRPYWTKYVDYSNDFIKNCHI  535


 Score = 45.8 bits (107),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  404  PLIAKNLNPDECAWAYGMNIFD  425



>ref|NP_001170288.1| uncharacterized protein LOC100384251 [Zea mays]
 gb|ACN36488.1| unknown [Zea mays]
Length=288

 Score =   159 bits (401),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L+LW+ GTLPP LIAF GHVH ID  WH+LGLGYQD
Sbjct  171  LAAWRKTNIRDTYHFWLKENLKSGLTLWKFGTLPPSLIAFRGHVHGIDPSWHLLGLGYQD  230

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I   + A V+H+NG+ KPWLDIAF  L+  WTK+VN+S+ F+K+CHI
Sbjct  231  KTDIESVRRAAVIHYNGQCKPWLDIAFKNLQPFWTKHVNYSNDFVKNCHI  280


 Score = 46.2 bits (108),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IA+S DP+ECAWAYGMNIFD
Sbjct  149  PVIARSLDPDECAWAYGMNIFD  170



>gb|EMT08056.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=537

 Score =   159 bits (403),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T I   YHHW+++NLKS+ +LW+LGTLPPGLIAF GHVH ID  WH+LGLGYQ+
Sbjct  423  LAAWRKTTIKDKYHHWVKENLKSNFTLWRLGTLPPGLIAFKGHVHPIDPSWHLLGLGYQE  482

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I+  + A V+H+NG++KPWLDI F  L+  WTK+VN+S+ F+++CHI
Sbjct  483  KTDISSVRKAAVIHYNGQSKPWLDIGFKHLQPFWTKHVNYSNEFVRNCHI  532


 Score = 45.4 bits (106),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA +FDP ECAWAYGMNIFD
Sbjct  401  PLIATNFDPLECAWAYGMNIFD  422



>ref|XP_006363746.1| PREDICTED: probable galacturonosyltransferase 14-like isoform 
X2 [Solanum tuberosum]
Length=536

 Score =   159 bits (402),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  425  LHTWRKTNIRDTYHSWLKENLKSKLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  484

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             ++I   K A V+H+NG++KPWL++ F  LR  WTKYV++S+ FIK+CHI
Sbjct  485  KSNIDKVKKAAVIHYNGQSKPWLELGFEHLRPYWTKYVDYSNDFIKNCHI  534


 Score = 45.8 bits (107),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  403  PLIAKNLNPDECAWAYGMNIFD  424



>ref|XP_007151294.1| hypothetical protein PHAVU_004G034200g [Phaseolus vulgaris]
 gb|ESW23288.1| hypothetical protein PHAVU_004G034200g [Phaseolus vulgaris]
Length=526

 Score =   160 bits (404),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  414  LRAWRSTNIRETYHTWLKENLRSNLTMWKLGTLPPALIAFRGHVHPIDHTWHMLGLGYQN  473

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I     A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  474  KTDIESLNKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNYFVRNCHILDS  526


 Score = 44.7 bits (104),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+A+  DP+ECAWAYGMN+FD
Sbjct  392  PLVAQHLDPDECAWAYGMNVFD  413



>ref|XP_007151295.1| hypothetical protein PHAVU_004G034200g [Phaseolus vulgaris]
 gb|ESW23289.1| hypothetical protein PHAVU_004G034200g [Phaseolus vulgaris]
Length=534

 Score =   160 bits (404),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  422  LRAWRSTNIRETYHTWLKENLRSNLTMWKLGTLPPALIAFRGHVHPIDHTWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I     A V+H+NG++KPWL I F  LR  WTKYVN+S+ F+++CHI  S
Sbjct  482  KTDIESLNKAAVIHYNGQSKPWLQIGFEHLRPFWTKYVNYSNYFVRNCHILDS  534


 Score = 44.7 bits (104),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+A+  DP+ECAWAYGMN+FD
Sbjct  400  PLVAQHLDPDECAWAYGMNVFD  421



>dbj|BAJ97300.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   158 bits (400),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T I   YHHW+++NLKS+ +LW+LGTLPPGLIAF GHVH ID  WH+LGLGYQ+
Sbjct  421  LAAWRKTTIKDKYHHWVKENLKSNFTLWRLGTLPPGLIAFKGHVHPIDPSWHLLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I+  + + V+H+NG++KPWLDI F  L+  WTK+VN+S+ F+++CHI
Sbjct  481  KTDISSVRKSAVIHYNGQSKPWLDIGFKHLQPFWTKHVNYSNEFVRNCHI  530


 Score = 45.8 bits (107),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA +FDP ECAWAYGMNIFD
Sbjct  399  PLIATNFDPLECAWAYGMNIFD  420



>ref|XP_006363750.1| PREDICTED: probable galacturonosyltransferase 14-like isoform 
X6 [Solanum tuberosum]
Length=484

 Score =   158 bits (400),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  373  LHTWRKTNIRDTYHSWLKENLKSKLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  432

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             ++I   K A V+H+NG++KPWL++ F  LR  WTKYV++S+ FIK+CHI
Sbjct  433  KSNIDKVKKAAVIHYNGQSKPWLELGFEHLRPYWTKYVDYSNDFIKNCHI  482


 Score = 45.4 bits (106),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ +P+ECAWAYGMNIFD
Sbjct  351  PLIAKNLNPDECAWAYGMNIFD  372



>ref|XP_007217256.1| hypothetical protein PRUPE_ppa004045mg [Prunus persica]
 gb|EMJ18455.1| hypothetical protein PRUPE_ppa004045mg [Prunus persica]
Length=533

 Score =   157 bits (398),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+T+I  TYH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  421  LSTWRKTSIRETYHSWLKENLKSNLTMWKLGTLPPALIAFGGHVHPIDPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T++     A V+H+NG++KPWL I F  LR  WTKY+N+S+ F+++CHI  S
Sbjct  481  KTNLESVARAAVIHYNGQSKPWLQIGFEHLRPFWTKYINYSNDFVRNCHILDS  533


 Score = 46.2 bits (108),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+AK+ DP ECAWAYGMNIFD
Sbjct  399  PLVAKNLDPEECAWAYGMNIFD  420



>ref|XP_006603903.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X5 [Glycine max]
Length=526

 Score =   159 bits (401),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  414  LRTWRTTNIRETYHTWLKENLRSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  473

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I   + A V+HFNG++KPWL I F  LR  W KYVN+++ F+++CHI  S
Sbjct  474  KTDIESVRKAAVIHFNGQSKPWLQIGFDHLRPFWNKYVNYTNDFVRNCHILDS  526


 Score = 44.7 bits (104),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA+  DP+ECAWAYGMN+FD
Sbjct  392  PLIAEHLDPDECAWAYGMNLFD  413



>ref|XP_003554778.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X1 [Glycine max]
 gb|KHN48809.1| Putative galacturonosyltransferase 13 [Glycine soja]
Length=534

 Score =   159 bits (401),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  422  LRTWRTTNIRETYHTWLKENLRSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I   + A V+HFNG++KPWL I F  LR  W KYVN+++ F+++CHI  S
Sbjct  482  KTDIESVRKAAVIHFNGQSKPWLQIGFDHLRPFWNKYVNYTNDFVRNCHILDS  534


 Score = 44.7 bits (104),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA+  DP+ECAWAYGMN+FD
Sbjct  400  PLIAEHLDPDECAWAYGMNLFD  421



>ref|XP_008646847.1| PREDICTED: uncharacterized protein LOC100501135 isoform X1 [Zea 
mays]
 tpg|DAA44039.1| TPA: hypothetical protein ZEAMMB73_034434 [Zea mays]
Length=560

 Score =   156 bits (395),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR+TNI  TYH WL++NLKS L+LW+ GTLPP LIAF GHVH ID  WH+LGLGYQD
Sbjct  443  LAVWRKTNIRDTYHFWLKENLKSGLTLWKFGTLPPALIAFRGHVHGIDPSWHLLGLGYQD  502

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I   + A V+H+NG+ KPWLDIAF  L+  WT +VN+S+ F+++CHI
Sbjct  503  KTDIESVRRAAVIHYNGQCKPWLDIAFKNLQPFWTNHVNYSNDFVRNCHI  552


 Score = 46.6 bits (109),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+IA+S DP+ECAWAYGMNIFD
Sbjct  421  PVIARSLDPDECAWAYGMNIFD  442



>ref|XP_006603900.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X2 [Glycine max]
Length=540

 Score =   159 bits (401),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  428  LRTWRTTNIRETYHTWLKENLRSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  487

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I   + A V+HFNG++KPWL I F  LR  W KYVN+++ F+++CHI  S
Sbjct  488  KTDIESVRKAAVIHFNGQSKPWLQIGFDHLRPFWNKYVNYTNDFVRNCHILDS  540


 Score = 44.7 bits (104),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA+  DP+ECAWAYGMN+FD
Sbjct  406  PLIAEHLDPDECAWAYGMNLFD  427



>ref|XP_001755223.1| predicted protein [Physcomitrella patens]
 gb|EDQ80167.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   162 bits (411),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L+AWR+ +I+R YH+W +QNL+ +L+LW+LGTLPP LIAF G+VH I   WHMLGLGY  
Sbjct  418  LQAWRKADITRVYHYWQKQNLQLNLTLWRLGTLPPALIAFDGNVHPIPGNWHMLGLGYNT  477

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
            NT++   ++A V+H+NG+AKPWLDIAFPQLR  W+KYVNFSD FI+ C+I
Sbjct  478  NTNVEAVENAAVIHYNGQAKPWLDIAFPQLRPFWSKYVNFSDKFIRQCNI  527


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+I+ +F P++CAWAYGMN+FD
Sbjct  396  PIISSTFAPDKCAWAYGMNVFD  417



>ref|XP_009603903.1| PREDICTED: probable galacturonosyltransferase 14 [Nicotiana tomentosiformis]
Length=538

 Score =   159 bits (402),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+ NI+ TYH WL++NLKS+L++W+LGTLPP LIAF GHVH I+  WHMLGLGYQ 
Sbjct  427  LRAWRKKNITDTYHAWLKENLKSNLTMWKLGTLPPALIAFKGHVHPIELSWHMLGLGYQK  486

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++ + K A V+H+NG+AKPWL+I F  LR  WTK+VN S+ FI++CHI
Sbjct  487  KTNVNNVKKAAVIHYNGQAKPWLEIGFEHLRPFWTKFVNSSNDFIRNCHI  536


 Score = 43.9 bits (102),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK  +P++CAWAYGMNIFD
Sbjct  405  PLIAKHLNPDDCAWAYGMNIFD  426



>ref|XP_006603901.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X3 [Glycine max]
Length=539

 Score =   158 bits (400),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  427  LRTWRTTNIRETYHTWLKENLRSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  486

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I   + A V+HFNG++KPWL I F  LR  W KYVN+++ F+++CHI  S
Sbjct  487  KTDIESVRKAAVIHFNGQSKPWLQIGFDHLRPFWNKYVNYTNDFVRNCHILDS  539


 Score = 44.7 bits (104),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA+  DP+ECAWAYGMN+FD
Sbjct  405  PLIAEHLDPDECAWAYGMNLFD  426



>ref|XP_006603902.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X4 [Glycine max]
Length=533

 Score =   158 bits (400),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L  WR TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  421  LRTWRTTNIRETYHTWLKENLRSNLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I   + A V+HFNG++KPWL I F  LR  W KYVN+++ F+++CHI  S
Sbjct  481  KTDIESVRKAAVIHFNGQSKPWLQIGFDHLRPFWNKYVNYTNDFVRNCHILDS  533


 Score = 44.7 bits (104),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA+  DP+ECAWAYGMN+FD
Sbjct  399  PLIAEHLDPDECAWAYGMNLFD  420



>ref|XP_010032534.1| PREDICTED: probable galacturonosyltransferase 14 [Eucalyptus 
grandis]
 gb|KCW51923.1| hypothetical protein EUGRSUZ_J01378 [Eucalyptus grandis]
Length=533

 Score =   157 bits (397),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T I   YH WL++NLKS+L++W+LGTLPP LIAF GHVH ID  WH+LGLGYQ 
Sbjct  421  LRAWRQTGIREAYHAWLKENLKSNLTMWKLGTLPPALIAFRGHVHPIDPSWHLLGLGYQI  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T +   K A V+H+NG++KPWL I F  LR  WTKYVN+S+ FI++CHI  S
Sbjct  481  KTDVESVKKAAVIHYNGQSKPWLYIGFEHLRPFWTKYVNYSNDFIRNCHILES  533


 Score = 45.4 bits (106),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++ DP ECAWAYGMNIFD
Sbjct  399  PLIAENLDPEECAWAYGMNIFD  420



>ref|XP_004985228.1| PREDICTED: probable galacturonosyltransferase 14-like [Setaria 
italica]
Length=562

 Score =   157 bits (396),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH WL++NLKS L+LW+ GTLPP LIAF GHVH ID  WH+LGLGYQ+
Sbjct  445  LAAWRKTNIRDTYHFWLKENLKSGLTLWKFGTLPPALIAFRGHVHGIDPSWHLLGLGYQE  504

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T I   + A V+H+NG+ KPWLDIAF  L+  W K+VN+S+ F+++CHI
Sbjct  505  KTDIESVRRAAVIHYNGQCKPWLDIAFKNLQPFWAKHVNYSNDFVRNCHI  554


 Score = 45.4 bits (106),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            P+I++S DP+ECAWAYGMNIFD
Sbjct  423  PVISRSLDPDECAWAYGMNIFD  444



>ref|XP_008805098.1| PREDICTED: probable galacturonosyltransferase 14 [Phoenix dactylifera]
Length=534

 Score =   157 bits (397),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH+WL++NL ++L+LW+ GTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  421  LSAWRKTNIRETYHYWLKENLVANLTLWKFGTLPPALIAFRGHVHPIDPSWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   K A V+H+NG+ KPWL+I F  L+  WTK+VN+S+ FI++CHI
Sbjct  481  KTNLDSVKKAAVIHYNGQCKPWLEIGFKHLQPFWTKHVNYSNDFIRNCHI  530


 Score = 45.4 bits (106),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA + DP+ECAWAYGMNIFD
Sbjct  399  PLIANNLDPDECAWAYGMNIFD  420



>ref|XP_003543923.1| PREDICTED: probable galacturonosyltransferase 14-like isoform 
X1 [Glycine max]
 gb|KHN07148.1| Putative galacturonosyltransferase 13 [Glycine soja]
Length=534

 Score =   157 bits (397),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH I   WHMLGLGYQ+
Sbjct  422  LRAWRTTNIRETYHTWLKENLRSNLTMWKLGTLPPALIAFKGHVHPIGPSWHMLGLGYQN  481

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I   + A V+HFNG++KPWL I F  LR  W KYVN+++ F+++CHI  S
Sbjct  482  KTDIESVRKAAVIHFNGQSKPWLQIGFDHLRPFWNKYVNYTNDFVRNCHILDS  534


 Score = 44.7 bits (104),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+A+  DP+ECAWAYGMN+FD
Sbjct  400  PLVAQHLDPDECAWAYGMNVFD  421



>ref|XP_006593688.1| PREDICTED: probable galacturonosyltransferase 14-like isoform 
X2 [Glycine max]
Length=533

 Score =   157 bits (397),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR TNI  TYH WL++NL+S+L++W+LGTLPP LIAF GHVH I   WHMLGLGYQ+
Sbjct  421  LRAWRTTNIRETYHTWLKENLRSNLTMWKLGTLPPALIAFKGHVHPIGPSWHMLGLGYQN  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T I   + A V+HFNG++KPWL I F  LR  W KYVN+++ F+++CHI  S
Sbjct  481  KTDIESVRKAAVIHFNGQSKPWLQIGFDHLRPFWNKYVNYTNDFVRNCHILDS  533


 Score = 44.7 bits (104),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+A+  DP+ECAWAYGMN+FD
Sbjct  399  PLVAQHLDPDECAWAYGMNVFD  420



>ref|XP_008785954.1| PREDICTED: probable galacturonosyltransferase 13 [Phoenix dactylifera]
Length=534

 Score =   156 bits (394),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+TNI  TYH+W+++NLKS+L+LW+LGTLPP LIAF G++H ID  WHMLGLGYQ+
Sbjct  421  LNAWRKTNIRDTYHYWVKENLKSNLTLWKLGTLPPALIAFRGNIHPIDPSWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T +     A V+H+NG+ KPWL+I +  L+S WTK+VN+S+ FI++CHI
Sbjct  481  KTDLDSVSKAAVIHYNGQCKPWLEIGYKHLQSFWTKHVNYSNDFIRNCHI  530


 Score = 45.1 bits (105),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PL+A + DP+ECAWAYGMNIFD
Sbjct  399  PLVANNLDPHECAWAYGMNIFD  420



>ref|XP_010670180.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=528

 Score =   157 bits (396),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+ +I  TYH WL++NL ++L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  416  LRAWRKASIRDTYHSWLKENLNANLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  475

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I   K A V+H+NG++KPWL I F  LR  WTKYVN+++ F+++CHI  S
Sbjct  476  KTNIESLKKAAVIHYNGQSKPWLPIGFDHLRPFWTKYVNYTNDFVRNCHILES  528


 Score = 44.3 bits (103),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++ +P+ECAWAYGMNIFD
Sbjct  394  PLIAQNLNPDECAWAYGMNIFD  415



>ref|XP_010904951.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   152 bits (383),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+T+I  TYH+WL++NL ++L+LW+ GTLPP LIAF GH+H I+  WHMLGLGYQ+
Sbjct  421  LNAWRKTSIRETYHYWLKENLVANLTLWKFGTLPPALIAFRGHLHPIERSWHMLGLGYQE  480

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHI  336
             T++   K A V+H+NG+ KPWL+I F  L+  WTK+VN+S+ F+++CHI
Sbjct  481  KTNLDSVKKAAVIHYNGQCKPWLEIGFKHLQPFWTKHVNYSNDFVRNCHI  530


 Score = 49.3 bits (116),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIAK+ DPNECAWAYGMNIFD
Sbjct  399  PLIAKNLDPNECAWAYGMNIFD  420



>ref|XP_010670179.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=536

 Score =   157 bits (396),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -2

Query  665  LEAWRRTNISRTYHHWLEQNLKSDLSLWQLGTLPPGLIAFHGHVHVIDSFWHMLGLGYQD  486
            L AWR+ +I  TYH WL++NL ++L++W+LGTLPP LIAF GHVH ID  WHMLGLGYQ+
Sbjct  424  LRAWRKASIRDTYHSWLKENLNANLTMWKLGTLPPALIAFKGHVHPIDPSWHMLGLGYQN  483

Query  485  NTSIADAKSAGVVHFNGRAKPWLDIAFPQLRSLWTKYVNFSDTFIKSCHITAS  327
             T+I   K A V+H+NG++KPWL I F  LR  WTKYVN+++ F+++CHI  S
Sbjct  484  KTNIESLKKAAVIHYNGQSKPWLPIGFDHLRPFWTKYVNYTNDFVRNCHILES  536


 Score = 44.3 bits (103),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  732  PLIAKSFDPNECAWAYGMNIFD  667
            PLIA++ +P+ECAWAYGMNIFD
Sbjct  402  PLIAQNLNPDECAWAYGMNIFD  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1358489737150