BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1342

Length=855
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009768904.1|  PREDICTED: protein REVEILLE 1-like isoform X2      117   2e-26   Nicotiana sylvestris
ref|XP_009768903.1|  PREDICTED: uncharacterized protein LOC104219...    117   2e-26   Nicotiana sylvestris
ref|XP_004235390.1|  PREDICTED: protein REVEILLE 7                      110   4e-24   Solanum lycopersicum
gb|AAU90342.2|  Myb-like DNA-binding protein, putative                  108   5e-23   Solanum demissum
ref|XP_009618566.1|  PREDICTED: protein REVEILLE 1-like isoform X2    93.6    3e-18   Nicotiana tomentosiformis
ref|XP_009618565.1|  PREDICTED: protein REVEILLE 1-like isoform X1    93.6    3e-18   Nicotiana tomentosiformis
emb|CDO98602.1|  unnamed protein product                              70.1    3e-10   Coffea canephora [robusta coffee]
ref|XP_011072048.1|  PREDICTED: protein REVEILLE 7-like isoform X1    63.9    3e-08   
ref|XP_011072049.1|  PREDICTED: protein REVEILLE 7-like isoform X2    63.9    3e-08   
ref|XP_011086969.1|  PREDICTED: protein REVEILLE 2-like isoform X2    61.2    3e-07   Sesamum indicum [beniseed]
ref|XP_011086968.1|  PREDICTED: protein REVEILLE 2-like isoform X1    60.8    4e-07   Sesamum indicum [beniseed]
ref|XP_011000774.1|  PREDICTED: protein REVEILLE 7-like               59.7    1e-06   Populus euphratica
ref|XP_002317724.1|  EARLY-PHYTOCHROME-RESPONSIVE1 family protein     59.7    1e-06   Populus trichocarpa [western balsam poplar]
gb|AGM20683.1|  EPR                                                   58.2    4e-06   Populus tomentosa [Chinese white poplar]
ref|XP_010099675.1|  Myb-like protein G                               57.8    5e-06   
ref|XP_007037070.1|  Homeodomain-like superfamily protein, putati...  55.1    4e-05   
ref|XP_007037069.1|  Homeodomain-like superfamily protein, putati...  54.7    4e-05   Theobroma cacao [chocolate]
ref|XP_010099677.1|  Myb-like protein G                               52.8    2e-04   



>ref|XP_009768904.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana sylvestris]
 ref|XP_009768905.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana sylvestris]
Length=450

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 128/230 (56%), Gaps = 17/230 (7%)
 Frame = -2

Query  848  NSSVKLDLLSRDTASSVKELSRDNP-GSFRLFGQTVSVSIAV-------ADSSKQEPHNF  693
            NS ++ D + R+T+   ++L+ + P  S +LFGQ V V  A        A S    P   
Sbjct  223  NSGMECDFVPRETSFPGEKLAVEAPLASIKLFGQMVLVPDATKLALQSPAGSCNSLPSKT  282

Query  692  KDAAREENDNTTVEGLPNHVNSQFVYTMVPHSMIPPASWFPQFLPNNDSK-----PTTMP  528
             +   E N+   + G     NSQF+  +VP +MIP A W  Q +  N+ +     PTT+P
Sbjct  283  TENEIETNNGNVIHGF--QANSQFILPVVPGNMIPSACWLSQDMLENNPEGVAAFPTTIP  340

Query  527  PWWSWHQDLMHRYFSSCSHVAAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNC  348
             W SW+QDL++RY S CS  AA+TT      +   P RE SS+  S GSASEV+   R+ 
Sbjct  341  -WLSWYQDLVYRYISLCSQTAAETTTLCRRPEDEEPQREGSSSGLSVGSASEVDDGNRSS  399

Query  347  DAIESKGGTVKLENTQNRKGFVPYKKCLAERNEESSAADIEEPERKKLCV  198
            + +ESK  T K +   N KGFVPYK+CLAER+  SS  ++EE E +++ V
Sbjct  400  ETVESKY-TTKSDKWNNIKGFVPYKRCLAERDGMSSGVELEERESQRVRV  448



>ref|XP_009768903.1| PREDICTED: uncharacterized protein LOC104219851 isoform X1 [Nicotiana 
sylvestris]
Length=468

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 128/230 (56%), Gaps = 17/230 (7%)
 Frame = -2

Query  848  NSSVKLDLLSRDTASSVKELSRDNP-GSFRLFGQTVSVSIAV-------ADSSKQEPHNF  693
            NS ++ D + R+T+   ++L+ + P  S +LFGQ V V  A        A S    P   
Sbjct  241  NSGMECDFVPRETSFPGEKLAVEAPLASIKLFGQMVLVPDATKLALQSPAGSCNSLPSKT  300

Query  692  KDAAREENDNTTVEGLPNHVNSQFVYTMVPHSMIPPASWFPQFLPNNDSK-----PTTMP  528
             +   E N+   + G     NSQF+  +VP +MIP A W  Q +  N+ +     PTT+P
Sbjct  301  TENEIETNNGNVIHGF--QANSQFILPVVPGNMIPSACWLSQDMLENNPEGVAAFPTTIP  358

Query  527  PWWSWHQDLMHRYFSSCSHVAAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNC  348
             W SW+QDL++RY S CS  AA+TT      +   P RE SS+  S GSASEV+   R+ 
Sbjct  359  -WLSWYQDLVYRYISLCSQTAAETTTLCRRPEDEEPQREGSSSGLSVGSASEVDDGNRSS  417

Query  347  DAIESKGGTVKLENTQNRKGFVPYKKCLAERNEESSAADIEEPERKKLCV  198
            + +ESK  T K +   N KGFVPYK+CLAER+  SS  ++EE E +++ V
Sbjct  418  ETVESKY-TTKSDKWNNIKGFVPYKRCLAERDGMSSGVELEERESQRVRV  466



>ref|XP_004235390.1| PREDICTED: protein REVEILLE 7 [Solanum lycopersicum]
Length=458

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 127/225 (56%), Gaps = 14/225 (6%)
 Frame = -2

Query  854  TDNSSVKLDLLSRDTASSVKELSRDNP-GSFRLFGQTVSVSIAVADSSKQEPHNFKDAAR  678
            T++  ++ +++  + + + ++L+ + P  S +LFG+TV V  A  + +   P+N +    
Sbjct  240  TNSEFMECNIVHMENSCNGEKLAVEPPSASIKLFGKTVFVPDA-NNLAPPAPYNTEKEKE  298

Query  677  EENDNTTVEGLPNHVNSQFVYTMVPHSMIPPASWFPQFLPNNDSKPTTMPP-----WWSW  513
              N++       N  NS FV  MVP +MIPPASW  Q +  N+ + T   P     WWSW
Sbjct  299  ISNEDVLHGFQANQANSPFVLAMVPGNMIPPASWLSQNMLENNRESTAAFPAATISWWSW  358

Query  512  HQDLMHRYFSSCSHVAAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNCDAIES  333
            +QDL++R  SSC     +     +  K   P RE SST SS GSASEV+    +C+ +ES
Sbjct  359  YQDLLYRSISSCGQTTVEAASHCQGLKDEEPQREGSSTGSSIGSASEVDDGNTSCETVES  418

Query  332  KGGTVKLENTQNRKGFVPYKKCLAERNEESSAADIEEPERKKLCV  198
            K  T K+      KGFVPYK+CLAER+ +SS A +EE E +++ V
Sbjct  419  KC-TTKI------KGFVPYKRCLAERDGKSSGAVLEERESQRVRV  456



>gb|AAU90342.2| Myb-like DNA-binding protein, putative [Solanum demissum]
Length=532

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 122/222 (55%), Gaps = 20/222 (9%)
 Frame = -2

Query  836  KLDLLSRDTASSVKELSRDNP-GSFRLFGQTVSVSIAVADSSKQEPHNFKDAARE---EN  669
            + D++  + + + ++L+ + P  S +LFG+TV     V D++   P    +  +E    N
Sbjct  320  ECDIVHMENSCNGEKLAVEPPSASIKLFGKTV----FVPDANNLAPPALYNTEKEIEISN  375

Query  668  DNTTVEGLPNHVNSQFVYTMVPHSMIPPASWFPQFLPNNDSKPTTMPP-----WWSWHQD  504
            ++       N  NS F+  MVP +MIPPASW  Q +  N+ + T   P     WWSW+QD
Sbjct  376  EDVLHAFQANQANSPFILAMVPGNMIPPASWLSQNMLENNPESTAAFPAATISWWSWYQD  435

Query  503  LMHRYFSSCSHVAAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNCDAIESKGG  324
            L++R  SSC   A  T    +  K   P RE SST SS GSASEV+   R+ + +ESK  
Sbjct  436  LIYRSISSCGQTAVGTAAHCQGPKDEEPQREGSSTGSSIGSASEVDDGNRSSETVESKC-  494

Query  323  TVKLENTQNRKGFVPYKKCLAERNEESSAADIEEPERKKLCV  198
                  T   KGFVPYK+CLAER+ +SS A +EE E +++ V
Sbjct  495  ------TTKSKGFVPYKRCLAERDGKSSGAVLEERESRRVRV  530



>ref|XP_009618566.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana tomentosiformis]
Length=423

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 113/200 (57%), Gaps = 16/200 (8%)
 Frame = -2

Query  848  NSSVKLDLLSRDTASSVKELSRDNP-GSFRLFGQTVSV----SIAVADSSKQEPHNFKDA  684
            NS ++ DL+ R+T+   ++L+ + P  S +LFGQTV V     +A+          FK  
Sbjct  223  NSGMECDLVPRETSCPGEKLAVEAPLASIKLFGQTVLVPDATKLALQSPGSCNSFPFKTT  282

Query  683  ARE--ENDNTTVEGLPNHVNSQFVYTMVPHSMIPPASWFPQFLPNNDSK-----PTTMPP  525
              E   N+   + G     NSQF+  +VP +MIPPA W  Q +  N+ +     PTT+P 
Sbjct  283  ESEIVTNNGDVIHGF--QANSQFILPVVPGNMIPPACWLLQDMLENNPEGVAAFPTTLP-  339

Query  524  WWSWHQDLMHRYFSSCSHVAAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNCD  345
            WWSW+QDL++RY SSCS   A+T  P +  K     RE SST SS+GSASEVN   R+ +
Sbjct  340  WWSWYQDLVYRYISSCSQTTAETAPPCQRPKDEEAHREGSSTGSSTGSASEVNDGNRSSE  399

Query  344  AIESKGGTVKLENTQNRKGF  285
             +ESK  T K +   +R+G+
Sbjct  400  TVESK-YTTKSDKWNSREGW  418



>ref|XP_009618565.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana tomentosiformis]
Length=441

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 113/200 (57%), Gaps = 16/200 (8%)
 Frame = -2

Query  848  NSSVKLDLLSRDTASSVKELSRDNP-GSFRLFGQTVSV----SIAVADSSKQEPHNFKDA  684
            NS ++ DL+ R+T+   ++L+ + P  S +LFGQTV V     +A+          FK  
Sbjct  241  NSGMECDLVPRETSCPGEKLAVEAPLASIKLFGQTVLVPDATKLALQSPGSCNSFPFKTT  300

Query  683  ARE--ENDNTTVEGLPNHVNSQFVYTMVPHSMIPPASWFPQFLPNNDSK-----PTTMPP  525
              E   N+   + G     NSQF+  +VP +MIPPA W  Q +  N+ +     PTT+P 
Sbjct  301  ESEIVTNNGDVIHGF--QANSQFILPVVPGNMIPPACWLLQDMLENNPEGVAAFPTTLP-  357

Query  524  WWSWHQDLMHRYFSSCSHVAAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNCD  345
            WWSW+QDL++RY SSCS   A+T  P +  K     RE SST SS+GSASEVN   R+ +
Sbjct  358  WWSWYQDLVYRYISSCSQTTAETAPPCQRPKDEEAHREGSSTGSSTGSASEVNDGNRSSE  417

Query  344  AIESKGGTVKLENTQNRKGF  285
             +ESK  T K +   +R+G+
Sbjct  418  TVESK-YTTKSDKWNSREGW  436



>emb|CDO98602.1| unnamed protein product [Coffea canephora]
Length=535

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 118/235 (50%), Gaps = 20/235 (9%)
 Frame = -2

Query  851  DNSSVKLDLLSRDTASSVKELSRDN-PGSFRLFGQTVSV------SIAVADSSKQEP-HN  696
            D S+++LDLL+   A   ++ + +  P + +LFG+TV +      S +  ++S+  P H+
Sbjct  302  DESAMELDLLTFGRACPAEDPAFEQAPATIKLFGRTVEIKENQKLSSSAPENSELSPSHS  361

Query  695  FKDAAREENDNTTVEGLPNHVNSQFVYTMVPHSMIPPASWFPQFLPNND-----SKPTTM  531
             K+     N    +    N ++SQ   ++VP  + P A   PQ+  + D     S P  +
Sbjct  362  MKEKLDIRNGRHMIGSAENTIDSQVNLSLVPSCITPVACLVPQYAVSEDFGQLGSIPHMI  421

Query  530  PPW-WSWHQDLMHRYFSSCSHVAAQTTYPEED-FKHPRPLRERsstdsssgsasevnSVL  357
            P W WS    L +   S+ + +      P +   K+    RE S T S+SG  +      
Sbjct  422  PMWTWSHGPLLPNLSLSNQTAIENFGNNPYKGAVKNEESQREISLTGSNSGLVTAAKRGQ  481

Query  356  RNCDAIESKG-GTVKLENTQNRKGFVPYKKCLAERNEESS--AADIEEPERKKLC  201
            +  +AI+SK  G V  E  ++ KGFVPYK+CLAER+  SS  AA+  E +R ++C
Sbjct  482  KIFNAIQSKNLGNV--ERQRSTKGFVPYKRCLAERDATSSLVAAEEREGQRARIC  534



>ref|XP_011072048.1| PREDICTED: protein REVEILLE 7-like isoform X1 [Sesamum indicum]
Length=468

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 119/232 (51%), Gaps = 23/232 (10%)
 Frame = -2

Query  851  DNSSVKLDLLSRDTASSVKELSRDNP-GSFRLFGQTVSVS------IAVADSSKQEPHNF  693
            + +++K +L  ++T SS+   +   P  S +LFG+TV V       + V ++S+      
Sbjct  244  NKTTMKFELFPQETESSLDSPNAGEPYTSIKLFGKTVVVRDTPKQPLDVVENSESLLPGA  303

Query  692  KDAAREENDNTTVEGL-PNHVNSQFVYTMVPHSMIPPASWFPQFLPNNDSKPTTMP--PW  522
             D   E N++   +GL PN+++S+ V+  V +S   PA   PQ L N       +   PW
Sbjct  304  VDDKSENNNDKFAQGLSPNNLDSRVVFGFVSNSS-SPACLPPQPLANIYCPMENLITLPW  362

Query  521  WSWHQDLMHRYFSSCSHVAAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNCDA  342
             +W+      Y SS ++   +     E  K     RE S   S+SGS  EVN+  RN D 
Sbjct  363  STWYHSTAFPYSSSYNNTVIENF---EGLKDEELQREGSLVGSNSGSTGEVNNDNRNSDV  419

Query  341  IESKGGTVKLENTQNR---KGFVPYKKCLAERNEESSAADIEEPE--RKKLC  201
            ++SK    +L +   +   KGFVPYK+CLAER+++ S + ++E E  R ++C
Sbjct  420  VDSK----QLSSPGKKECGKGFVPYKRCLAERDDKLSISFLQEREGQRARVC  467



>ref|XP_011072049.1| PREDICTED: protein REVEILLE 7-like isoform X2 [Sesamum indicum]
Length=458

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 119/232 (51%), Gaps = 23/232 (10%)
 Frame = -2

Query  851  DNSSVKLDLLSRDTASSVKELSRDNP-GSFRLFGQTVSVS------IAVADSSKQEPHNF  693
            + +++K +L  ++T SS+   +   P  S +LFG+TV V       + V ++S+      
Sbjct  234  NKTTMKFELFPQETESSLDSPNAGEPYTSIKLFGKTVVVRDTPKQPLDVVENSESLLPGA  293

Query  692  KDAAREENDNTTVEGL-PNHVNSQFVYTMVPHSMIPPASWFPQFLPNNDSKPTTMP--PW  522
             D   E N++   +GL PN+++S+ V+  V +S   PA   PQ L N       +   PW
Sbjct  294  VDDKSENNNDKFAQGLSPNNLDSRVVFGFVSNSS-SPACLPPQPLANIYCPMENLITLPW  352

Query  521  WSWHQDLMHRYFSSCSHVAAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNCDA  342
             +W+      Y SS ++   +     E  K     RE S   S+SGS  EVN+  RN D 
Sbjct  353  STWYHSTAFPYSSSYNNTVIENF---EGLKDEELQREGSLVGSNSGSTGEVNNDNRNSDV  409

Query  341  IESKGGTVKLENTQNR---KGFVPYKKCLAERNEESSAADIEEPE--RKKLC  201
            ++SK    +L +   +   KGFVPYK+CLAER+++ S + ++E E  R ++C
Sbjct  410  VDSK----QLSSPGKKECGKGFVPYKRCLAERDDKLSISFLQEREGQRARVC  457



>ref|XP_011086969.1| PREDICTED: protein REVEILLE 2-like isoform X2 [Sesamum indicum]
Length=456

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 111/237 (47%), Gaps = 28/237 (12%)
 Frame = -2

Query  848  NSSVKLDLLSRDTASSVKELSRDNPGS-FRLFGQTVSV------SIAVADSSKQEPHNFK  690
            NS +KL L  ++   ++     + P +  +LFG+TV V      S+ V ++S+  P +  
Sbjct  226  NSPMKLKLFPQEAECAIDSPQAEEPYTRIKLFGKTVMVRDASKQSLEVVENSQSLPPDII  285

Query  689  DAAREENDNTTVEGLPNHVNSQFVYTMV---PHSMIPPASWFPQFLPNNDSKPTTM----  531
            D   + N +  V+       SQ++   V     S+IP  S  PQ  P N+     M    
Sbjct  286  DKKLDNNADELVKDRALISTSQYLEDTVECDSKSVIP--SSLPQH-PLNNIHCHMMNVFG  342

Query  530  PPWWSWHQDLMHRYFSSCSHVAAQTTYPEEDFK--HPRPLRERsstdsssgsasevnSVL  357
             PWW WHQ +++   SSC  VA+Q        K      L+   S +      SE N+  
Sbjct  343  LPWWMWHQGVVYPSASSCQEVASQNAECSLIGKGLESEQLQLNGSLNGPKAPISEANTEN  402

Query  356  RNCDAIESKGGTVKLENTQNR---KGFVPYKKCLAERNEESSAADIEEPE--RKKLC  201
            RN +A E K     L +T  +   KGFV YK+CLAER+  SS + ++E E  R ++C
Sbjct  403  RNNEASEGK----HLFDTGKKEPAKGFVAYKRCLAERDGRSSMSLLQEREGQRARVC  455



>ref|XP_011086968.1| PREDICTED: protein REVEILLE 2-like isoform X1 [Sesamum indicum]
 ref|XP_011086971.1| PREDICTED: protein REVEILLE 2-like isoform X1 [Sesamum indicum]
Length=474

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 111/237 (47%), Gaps = 28/237 (12%)
 Frame = -2

Query  848  NSSVKLDLLSRDTASSVKELSRDNPGS-FRLFGQTVSV------SIAVADSSKQEPHNFK  690
            NS +KL L  ++   ++     + P +  +LFG+TV V      S+ V ++S+  P +  
Sbjct  244  NSPMKLKLFPQEAECAIDSPQAEEPYTRIKLFGKTVMVRDASKQSLEVVENSQSLPPDII  303

Query  689  DAAREENDNTTVEGLPNHVNSQFVYTMV---PHSMIPPASWFPQFLPNNDSKPTTM----  531
            D   + N +  V+       SQ++   V     S+IP  S  PQ  P N+     M    
Sbjct  304  DKKLDNNADELVKDRALISTSQYLEDTVECDSKSVIP--SSLPQH-PLNNIHCHMMNVFG  360

Query  530  PPWWSWHQDLMHRYFSSCSHVAAQTTYPEEDFK--HPRPLRERsstdsssgsasevnSVL  357
             PWW WHQ +++   SSC  VA+Q        K      L+   S +      SE N+  
Sbjct  361  LPWWMWHQGVVYPSASSCQEVASQNAECSLIGKGLESEQLQLNGSLNGPKAPISEANTEN  420

Query  356  RNCDAIESKGGTVKLENTQNR---KGFVPYKKCLAERNEESSAADIEEPE--RKKLC  201
            RN +A E K     L +T  +   KGFV YK+CLAER+  SS + ++E E  R ++C
Sbjct  421  RNNEASEGK----HLFDTGKKEPAKGFVAYKRCLAERDGRSSMSLLQEREGQRARVC  473



>ref|XP_011000774.1| PREDICTED: protein REVEILLE 7-like [Populus euphratica]
Length=488

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (56%), Gaps = 6/113 (5%)
 Frame = -2

Query  527  PWWSWHQDLMHRYFSSCSHVAAQTTYP--EEDFKHPRPLRERsstdsssgsasevnSVLR  354
            PWW++ Q +   Y +S  H +AQ   P  EE F+    L ERS T S+  S  ++ +  R
Sbjct  371  PWWAYSQVVPLMYLTSYEHTSAQKPIPCVEERFEEKENLNERSCTSSNVFSVVDLENGER  430

Query  353  NCDAIESKGGTVKLEN----TQNRKGFVPYKKCLAERNEESSAADIEEPERKK  207
            N   ++S+ G   +E      ++ +GFVPYK+CL ER+ +S+    EE ER++
Sbjct  431  NLGVVDSQYGQPSVEGRSSFQKSTRGFVPYKRCLGERDVKSTVIVSEERERQR  483



>ref|XP_002317724.1| EARLY-PHYTOCHROME-RESPONSIVE1 family protein [Populus trichocarpa]
 gb|EEE95944.1| EARLY-PHYTOCHROME-RESPONSIVE1 family protein [Populus trichocarpa]
Length=487

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 112/243 (46%), Gaps = 46/243 (19%)
 Frame = -2

Query  836  KLDLLSRDTASSVKELSRD-NPGSFRLFGQTVSVSIAVADSSKQEP--------------  702
            K +L S++T  +  + ++  +  S +LFG TV +     DS K+ P              
Sbjct  253  KFELGSKNTVCAEHDAAKKASSASIKLFGMTVKI----VDSQKESPPGAEIVLPVISNEN  308

Query  701  HNFKDAAREENDNTTVEGLPNHVNSQFVYTMVP--HSMIP-PASWF---------PQFLP  558
            H+  DA +E+  +T         +++    M     ++ P PAS F           +  
Sbjct  309  HDNVDADKEKPAHTLQR---KQSDTELSLGMANSNQNLWPSPASVFHCTEMQGDNANYFA  365

Query  557  NNDSKPTTMPPWWSWHQDLMHRYFSSCSHVAAQTTYP--EEDFKHPRPLRERsstdsssg  384
             N S      PWW+  Q +   Y +S  H +AQ   P  EE F+    L ERS T S+  
Sbjct  366  TNSS-----IPWWTLCQGVPFLYLTSNDHTSAQKPIPCVEERFEEKEILNERSCTSSNVF  420

Query  383  sasevnSVLRNCDAIESKGGTVKLENT----QNRKGFVPYKKCLAERNEESSAADIEEPE  216
            S  ++ +  RN D ++S+ G   +E T    ++ +GFVPYK+CL ER+ +S+    EE E
Sbjct  421  SVGDLENGERNLD-VDSQCGQPSVEGTSSLQKSTRGFVPYKRCLGERDVKSTVIISEERE  479

Query  215  RKK  207
            R++
Sbjct  480  RQR  482



>gb|AGM20683.1| EPR [Populus tomentosa]
Length=687

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (56%), Gaps = 6/113 (5%)
 Frame = -2

Query  527  PWWSWHQDLMHRYFSSCSHVAAQTTYP--EEDFKHPRPLRERsstdsssgsasevnSVLR  354
            PW ++ Q +   Y +S  H +AQ   P  EE F+    L ERS T S+  S  ++ +  R
Sbjct  360  PWGAYCQGVPFLYLTSYDHTSAQNPMPCVEERFEEKEILNERSCTSSNVFSVGDLENGER  419

Query  353  NCDAIESKGGTVKLEN----TQNRKGFVPYKKCLAERNEESSAADIEEPERKK  207
            N D ++S+ G   +E      ++ +GFVPYK+CL ER+ +S+    EE ER++
Sbjct  420  NLDVVDSQCGQHFVEGRSSFQKSTRGFVPYKRCLGERDVKSTVIVSEERERQR  472



>ref|XP_010099675.1| Myb-like protein G [Morus notabilis]
 gb|EXB80252.1| Myb-like protein G [Morus notabilis]
Length=447

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 118/230 (51%), Gaps = 32/230 (14%)
 Frame = -2

Query  842  SVKLDLLSRD---TASSVKELSRDNPGSFRLFGQTVSVSIAVADSSKQEPHNFKDAAREE  672
            S+K +L ++D   T    +E      GSF+LFG+TV +S       K+ P   K++   +
Sbjct  228  SMKFELGAKDASYTKEEEEEAEVAASGSFKLFGRTVLLS----GFQKESPSGAKNSQTSK  283

Query  671  NDNTTVEGLPNHVNSQFVYTMVPHSMIPPASWFPQFLPNNDS--KPTTMPP--WWSWHQD  504
            ND    EGL   ++S  + T +  S+    S + Q     +S    T   P  WW+ +Q 
Sbjct  284  ND----EGLVLTLSSDQLDTNL--SLGGAVSIWNQLEQPKESCNTETANSPMLWWTLYQF  337

Query  503  LMHRYFSSCSHVAAQT------TYPEEDFKHPRPLRERsstdsssgsasevnSVL-RNCD  345
              H Y ++C+    QT       + EED   P+   ERSST S+ GSAS V +   +N +
Sbjct  338  PFH-YLAACNQTLDQTPRNSCSEHREEDKDIPK---ERSSTGSNDGSASGVETAGDKNLE  393

Query  344  AIES---KGGT-VKLENTQNRKGFVPYKKCLAERNEESSAADIEEPERKK  207
            A++S   K  T V +E + +RKGFVPYK+CLAER+  S+     + ER+K
Sbjct  394  AVDSFPQKPCTKVSVEPSNSRKGFVPYKRCLAERDNASAVVAPNDRERRK  443



>ref|XP_007037070.1| Homeodomain-like superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY21571.1| Homeodomain-like superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=466

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 106/213 (50%), Gaps = 32/213 (15%)
 Frame = -2

Query  770  SFRLFGQTVSVSIAVADSSK--QEPHNFKD----AAREEND---NTTVEGLPN-HVNSQF  621
            S +LFG+TV V     DS K   +  NFK      A+ + D   +  V+ LP+ H++++ 
Sbjct  256  SIKLFGKTVQV----KDSRKPSMDAENFKSPTSKTAQGDIDAEGDMLVQALPSTHLDTRL  311

Query  620  V-------YTMVPH--SMIPPASWFPQFLPNNDSKPTTMPPWWSWHQDLMHRYFSSCSHV  468
                    +++VP   ++ P     P  L + +S      PWW+++Q L   Y +S +  
Sbjct  312  SLGTVNEDWSVVPSQANLSPYMEIHPDKLDHVESTSDAPLPWWTFYQGLPFYYITSFNQT  371

Query  467  AAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNCDAIESKG------GTVKLEN  306
               +   EE  K    L ERSST S++GS S+  +  ++  +++S+       G   L+ 
Sbjct  372  QTDSCV-EERVKQKEILNERSSTGSNTGSVSQAENREKSSYSVDSQCQRPCPEGKTTLQK  430

Query  305  TQNRKGFVPYKKCLAERNEESSAADIEEPERKK  207
                +GFVPYK+CLAER+  SS    EE ER++
Sbjct  431  CS--RGFVPYKRCLAERDMSSSVVMSEERERQR  461



>ref|XP_007037069.1| Homeodomain-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY21570.1| Homeodomain-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=484

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 106/213 (50%), Gaps = 32/213 (15%)
 Frame = -2

Query  770  SFRLFGQTVSVSIAVADSSK--QEPHNFKD----AAREEND---NTTVEGLPN-HVNSQF  621
            S +LFG+TV V     DS K   +  NFK      A+ + D   +  V+ LP+ H++++ 
Sbjct  274  SIKLFGKTVQV----KDSRKPSMDAENFKSPTSKTAQGDIDAEGDMLVQALPSTHLDTRL  329

Query  620  V-------YTMVPH--SMIPPASWFPQFLPNNDSKPTTMPPWWSWHQDLMHRYFSSCSHV  468
                    +++VP   ++ P     P  L + +S      PWW+++Q L   Y +S +  
Sbjct  330  SLGTVNEDWSVVPSQANLSPYMEIHPDKLDHVESTSDAPLPWWTFYQGLPFYYITSFNQT  389

Query  467  AAQTTYPEEDFKHPRPLRERsstdsssgsasevnSVLRNCDAIESKG------GTVKLEN  306
               +   EE  K    L ERSST S++GS S+  +  ++  +++S+       G   L+ 
Sbjct  390  QTDSCV-EERVKQKEILNERSSTGSNTGSVSQAENREKSSYSVDSQCQRPCPEGKTTLQK  448

Query  305  TQNRKGFVPYKKCLAERNEESSAADIEEPERKK  207
                +GFVPYK+CLAER+  SS    EE ER++
Sbjct  449  CS--RGFVPYKRCLAERDMSSSVVMSEERERQR  479



>ref|XP_010099677.1| Myb-like protein G [Morus notabilis]
 gb|EXB80254.1| Myb-like protein G [Morus notabilis]
Length=475

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 105/205 (51%), Gaps = 25/205 (12%)
 Frame = -2

Query  773  GSFRLFGQTVSVSIAVADSSKQEPHNFKDAAREENDNTTVEGLPNHVNS-QFVYTMVPHS  597
             SF+LFG+TV +S       K+ P   K++   + D    EGL   ++S Q    +    
Sbjct  282  ASFKLFGRTVLLS----GFQKESPPGAKNSQTSKTD----EGLVLTLSSDQLDTNLSLGG  333

Query  596  MIPPASWFPQFLPNNDSKPTTMPP-WWSWHQDLMHRYFSSCSHVAAQT------TYPEED  438
             +   +   Q   + +++    P  WW+ +Q   H Y ++C+    QT       + EED
Sbjct  334  AVSNCNQLEQPKESCNTETANSPMLWWTLYQFPFH-YLAACNQTLDQTPRNSCSEHREED  392

Query  437  FKHPRPLRERsstdsssgsasevnSVL-RNCDAIES---KGGT-VKLENTQNRKGFVPYK  273
               P+   ERSST S+ GSAS V +   +N +A++S   K  T V +E + +RKGFVPYK
Sbjct  393  KDIPK---ERSSTGSNDGSASGVETAGDKNLEAVDSFPQKPCTKVSVEPSNSRKGFVPYK  449

Query  272  KCLAERNEESSAADIEEPERKKLCV  198
            +CLAER+  S+A      ER+K+ V
Sbjct  450  RCLAERDNASAAVVPNVRERRKIRV  474



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1881220847521