BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1336

Length=1034
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004244862.1|  PREDICTED: CSC1-like protein ERD4                  445   2e-147   Solanum lycopersicum
ref|XP_009611468.1|  PREDICTED: CSC1-like protein ERD4 isoform X2       440   6e-146   Nicotiana tomentosiformis
ref|XP_009611467.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       441   9e-146   Nicotiana tomentosiformis
ref|XP_006364887.1|  PREDICTED: uncharacterized membrane protein ...    440   3e-145   Solanum tuberosum [potatoes]
ref|XP_009781612.1|  PREDICTED: CSC1-like protein ERD4                  437   4e-144   Nicotiana sylvestris
ref|XP_010245168.1|  PREDICTED: CSC1-like protein ERD4                  430   2e-141   Nelumbo nucifera [Indian lotus]
ref|XP_010086875.1|  Uncharacterized membrane protein                   428   2e-141   
ref|XP_007211358.1|  hypothetical protein PRUPE_ppa002050mg             428   7e-141   Prunus persica
ref|XP_009362276.1|  PREDICTED: CSC1-like protein ERD4                  427   2e-140   Pyrus x bretschneideri [bai li]
ref|XP_007024953.1|  Early-responsive to dehydration stress prote...    427   3e-140   
emb|CBI30957.3|  unnamed protein product                                424   1e-139   Vitis vinifera
ref|XP_011096640.1|  PREDICTED: CSC1-like protein ERD4                  425   2e-139   Sesamum indicum [beniseed]
ref|XP_008371799.1|  PREDICTED: uncharacterized membrane protein ...    425   2e-139   Malus domestica [apple tree]
ref|XP_002280109.1|  PREDICTED: CSC1-like protein ERD4                  424   5e-139   Vitis vinifera
ref|XP_008225537.1|  PREDICTED: uncharacterized membrane protein ...    423   7e-139   Prunus mume [ume]
ref|XP_012072181.1|  PREDICTED: CSC1-like protein ERD4                  422   3e-138   Jatropha curcas
emb|CDP05663.1|  unnamed protein product                                417   2e-136   Coffea canephora [robusta coffee]
ref|XP_002531053.1|  conserved hypothetical protein                     414   2e-136   
ref|XP_009377481.1|  PREDICTED: CSC1-like protein ERD4                  417   2e-136   Pyrus x bretschneideri [bai li]
ref|XP_008439583.1|  PREDICTED: uncharacterized membrane protein ...    415   1e-135   Cucumis melo [Oriental melon]
ref|XP_011012269.1|  PREDICTED: CSC1-like protein ERD4                  414   2e-135   Populus euphratica
ref|XP_003593877.1|  Early-responsive to dehydration                    414   3e-135   Medicago truncatula
gb|KDO75375.1|  hypothetical protein CISIN_1g004795mg                   407   5e-135   Citrus sinensis [apfelsine]
ref|XP_003542948.1|  PREDICTED: uncharacterized membrane protein ...    413   6e-135   Glycine max [soybeans]
ref|XP_002300337.1|  early-responsive to dehydration stress famil...    413   8e-135   Populus trichocarpa [western balsam poplar]
gb|KDO75374.1|  hypothetical protein CISIN_1g004795mg                   407   3e-134   Citrus sinensis [apfelsine]
ref|XP_004134564.1|  PREDICTED: CSC1-like protein ERD4                  411   4e-134   Cucumis sativus [cucumbers]
gb|KJB66976.1|  hypothetical protein B456_010G168400                    410   5e-134   Gossypium raimondii
ref|XP_006448976.1|  hypothetical protein CICLE_v100144071mg            406   3e-133   
ref|XP_010540605.1|  PREDICTED: CSC1-like protein ERD4                  408   6e-133   Tarenaya hassleriana [spider flower]
ref|XP_007147944.1|  hypothetical protein PHAVU_006G167700g             408   6e-133   Phaseolus vulgaris [French bean]
gb|KJB57185.1|  hypothetical protein B456_009G152500                    407   1e-132   Gossypium raimondii
gb|KDO75368.1|  hypothetical protein CISIN_1g004795mg                   407   1e-132   Citrus sinensis [apfelsine]
gb|KHN06954.1|  Putative membrane protein C24H6.13                      407   1e-132   Glycine soja [wild soybean]
ref|XP_003546071.1|  PREDICTED: uncharacterized membrane protein ...    407   2e-132   Glycine max [soybeans]
ref|XP_010052016.1|  PREDICTED: CSC1-like protein ERD4                  407   2e-132   Eucalyptus grandis [rose gum]
ref|XP_006468078.1|  PREDICTED: uncharacterized membrane protein ...    406   2e-132   Citrus sinensis [apfelsine]
ref|XP_010687100.1|  PREDICTED: CSC1-like protein ERD4                  404   1e-131   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011014082.1|  PREDICTED: CSC1-like protein ERD4                  403   4e-131   Populus euphratica
ref|XP_010275905.1|  PREDICTED: CSC1-like protein ERD4                  403   6e-131   
ref|XP_004485983.1|  PREDICTED: uncharacterized membrane protein ...    402   2e-130   Cicer arietinum [garbanzo]
gb|KHG13189.1|  putative membrane C2G11.09                              400   5e-130   Gossypium arboreum [tree cotton]
ref|XP_008784823.1|  PREDICTED: CSC1-like protein ERD4                  398   4e-129   Phoenix dactylifera
gb|EYU19153.1|  hypothetical protein MIMGU_mgv1a001965mg                397   1e-128   Erythranthe guttata [common monkey flower]
gb|KCW75872.1|  hypothetical protein EUGRSUZ_D00261                     395   3e-128   Eucalyptus grandis [rose gum]
ref|XP_008371649.1|  PREDICTED: uncharacterized membrane protein ...    395   9e-128   Malus domestica [apple tree]
gb|EPS64315.1|  hypothetical protein M569_10465                         392   7e-127   Genlisea aurea
ref|XP_010052015.1|  PREDICTED: CSC1-like protein ERD4                  390   5e-126   Eucalyptus grandis [rose gum]
ref|XP_009398321.1|  PREDICTED: CSC1-like protein ERD4                  388   3e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408546.1|  PREDICTED: CSC1-like protein ERD4                  388   4e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687078.1|  PREDICTED: CSC1-like protein ERD4 isoform X2       384   8e-125   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687077.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       385   3e-124   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010907974.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    385   3e-124   
gb|KHG16289.1|  putative membrane C2G11.09                              382   9e-124   Gossypium arboreum [tree cotton]
gb|AAL47004.1|AF448811_1  unknown                                       367   1e-123   Davidia involucrata
emb|CDY67965.1|  BnaCnng57110D                                          375   4e-123   Brassica napus [oilseed rape]
gb|KDO75367.1|  hypothetical protein CISIN_1g004795mg                   379   8e-122   Citrus sinensis [apfelsine]
ref|XP_004293515.1|  PREDICTED: CSC1-like protein ERD4                  379   1e-121   Fragaria vesca subsp. vesca
emb|CDY12050.1|  BnaC03g59660D                                          379   1e-121   Brassica napus [oilseed rape]
ref|NP_001288888.1|  CSC1-like protein ERD4                             376   3e-121   Brassica rapa
ref|XP_006415482.1|  hypothetical protein EUTSA_v10006933mg             373   5e-121   
emb|CDX90246.1|  BnaA08g17380D                                          377   8e-121   
ref|XP_009377479.1|  PREDICTED: CSC1-like protein ERD4                  376   1e-120   Pyrus x bretschneideri [bai li]
gb|KFK44850.1|  hypothetical protein AALP_AA1G310500                    375   3e-120   Arabis alpina [alpine rockcress]
ref|XP_009115162.1|  PREDICTED: CSC1-like protein ERD4                  375   3e-120   Brassica rapa
ref|XP_006836313.1|  PREDICTED: CSC1-like protein ERD4                  374   5e-120   Amborella trichopoda
sp|A9LIW2.2|CSC1L_BRAJU  RecName: Full=CSC1-like protein ERD4; Al...    374   7e-120   Brassica juncea [brown mustard]
ref|XP_006415483.1|  hypothetical protein EUTSA_v10006933mg             374   1e-119   Eutrema salsugineum [saltwater cress]
emb|CDY02286.1|  BnaA09g26160D                                          373   2e-119   
gb|ABV89627.1|  early-responsive to dehydration 4                       370   3e-118   Brassica rapa
ref|XP_010478422.1|  PREDICTED: CSC1-like protein ERD4                  369   1e-117   Camelina sativa [gold-of-pleasure]
ref|XP_010499567.1|  PREDICTED: CSC1-like protein ERD4                  369   1e-117   Camelina sativa [gold-of-pleasure]
ref|XP_002461460.1|  hypothetical protein SORBIDRAFT_02g003010          369   1e-117   Sorghum bicolor [broomcorn]
dbj|BAB63915.1|  ERD4 protein                                           365   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460826.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       367   3e-117   Camelina sativa [gold-of-pleasure]
ref|XP_002890865.1|  early-responsive to dehydration 4                  367   3e-117   
ref|NP_564354.1|  Early-responsive to dehydration stress protein ...    367   5e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306879.1|  hypothetical protein CARUB_v10008433mg             363   8e-116   Capsella rubella
ref|XP_006657447.1|  PREDICTED: uncharacterized membrane protein ...    363   2e-115   Oryza brachyantha
gb|KCW75871.1|  hypothetical protein EUGRSUZ_D00260                     360   1e-114   Eucalyptus grandis [rose gum]
gb|EAZ02783.1|  hypothetical protein OsI_24908                          360   3e-114   Oryza sativa Indica Group [Indian rice]
ref|NP_001058898.1|  Os07g0150100                                       359   5e-114   
dbj|BAJ94358.1|  predicted protein                                      348   2e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT14399.1|  Putative membrane protein                               354   3e-112   
ref|NP_001108122.1|  early responsive to dehydration protein            354   4e-112   
ref|XP_003557644.1|  PREDICTED: CSC1-like protein ERD4                  353   1e-111   Brachypodium distachyon [annual false brome]
gb|AGV54580.1|  early-responsive to dehydration 4                       348   8e-111   Phaseolus vulgaris [French bean]
ref|XP_004955452.1|  PREDICTED: uncharacterized membrane protein ...    350   2e-110   Setaria italica
gb|EAZ38704.1|  hypothetical protein OsJ_23104                          360   3e-110   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ93282.1|  predicted protein                                      348   1e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS45497.1|  Uncharacterized membrane protein C24H6.13               347   2e-109   Triticum urartu
gb|EMS64036.1|  Uncharacterized membrane protein C2G11.09               339   3e-108   Triticum urartu
gb|EMT14905.1|  Putative membrane protein                               337   3e-106   
emb|CAN64310.1|  hypothetical protein VITISV_037471                     333   2e-104   Vitis vinifera
gb|AGV54368.1|  early-responsive to dehydration                         322   5e-102   Phaseolus vulgaris [French bean]
gb|KHN47349.1|  Putative membrane protein C24H6.13                      322   4e-100   Glycine soja [wild soybean]
ref|XP_002990725.1|  hypothetical protein SELMODRAFT_41467              311   7e-96    
ref|XP_002986705.1|  hypothetical protein SELMODRAFT_41460              310   2e-95    
gb|AAX92695.1|  early-responsive to dehydration stress protein          285   1e-90    Picea abies
ref|XP_001766729.1|  predicted protein                                  290   4e-87    
ref|XP_001754029.1|  predicted protein                                  285   2e-85    
ref|XP_001761096.1|  predicted protein                                  283   1e-84    
ref|XP_001766634.1|  predicted protein                                  278   7e-83    
dbj|BAD94517.1|  ERD4 protein                                           260   3e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001776984.1|  predicted protein                                  274   3e-81    
ref|XP_001770612.1|  predicted protein                                  271   2e-80    
ref|XP_001762227.1|  predicted protein                                  261   1e-76    
gb|EYU19152.1|  hypothetical protein MIMGU_mgv1a001965mg                252   3e-74    Erythranthe guttata [common monkey flower]
gb|KDO75369.1|  hypothetical protein CISIN_1g004795mg                   244   3e-71    Citrus sinensis [apfelsine]
gb|KJB57182.1|  hypothetical protein B456_009G152500                    239   3e-69    Gossypium raimondii
gb|KJB57184.1|  hypothetical protein B456_009G152500                    238   7e-69    Gossypium raimondii
gb|AFK47057.1|  unknown                                                 220   3e-67    Medicago truncatula
ref|XP_007024954.1|  Early-responsive to dehydration stress prote...    230   9e-66    
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...    168   6e-43    Nelumbo nucifera [Indian lotus]
gb|AAC79116.1|  hypothetical protein                                    164   9e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535             164   2e-41    
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...    164   2e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001782141.1|  predicted protein                                  163   2e-41    
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725             163   4e-41    Selaginella moellendorffii
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177             163   4e-41    Selaginella moellendorffii
ref|XP_001754358.1|  predicted protein                                  162   5e-41    
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900             162   7e-41    
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900             162   8e-41    
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg             162   9e-41    
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...    162   1e-40    
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...    161   1e-40    Pyrus x bretschneideri [bai li]
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...    162   2e-40    
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900             161   2e-40    Nelumbo nucifera [Indian lotus]
ref|XP_010664612.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    160   2e-40    Vitis vinifera
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    161   3e-40    Tarenaya hassleriana [spider flower]
ref|XP_012066469.1|  PREDICTED: CSC1-like protein At1g32090             161   3e-40    Jatropha curcas
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    160   3e-40    Tarenaya hassleriana [spider flower]
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    160   4e-40    Tarenaya hassleriana [spider flower]
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg             159   5e-40    
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    160   5e-40    Vitis vinifera
gb|KHG26829.1|  putative membrane C2G11.09                              160   5e-40    Gossypium arboreum [tree cotton]
ref|XP_006854105.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    159   7e-40    Amborella trichopoda
ref|XP_011626938.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    159   7e-40    
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                    159   7e-40    Arabis alpina [alpine rockcress]
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                    159   7e-40    Arabis alpina [alpine rockcress]
ref|XP_002519965.1|  Extensin-3 precursor, putative                     159   2e-39    
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900             158   3e-39    Brassica rapa
emb|CDX90914.1|  BnaA03g25940D                                          158   3e-39    
emb|CDY17981.1|  BnaC03g30530D                                          157   3e-39    Brassica napus [oilseed rape]
gb|KJB51550.1|  hypothetical protein B456_008G222200                    157   4e-39    Gossypium raimondii
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900             157   7e-39    Pyrus x bretschneideri [bai li]
gb|KJB51549.1|  hypothetical protein B456_008G222200                    157   9e-39    Gossypium raimondii
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1            156   1e-38    
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090             156   1e-38    Nelumbo nucifera [Indian lotus]
emb|CDP11732.1|  unnamed protein product                                156   2e-38    Coffea canephora [robusta coffee]
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090             155   2e-38    Nelumbo nucifera [Indian lotus]
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...    155   2e-38    Pyrus x bretschneideri [bai li]
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1            155   3e-38    Malus domestica [apple tree]
ref|XP_008455926.1|  PREDICTED: uncharacterized membrane protein ...    154   3e-38    
ref|XP_008455928.1|  PREDICTED: uncharacterized membrane protein ...    153   4e-38    Cucumis melo [Oriental melon]
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711              154   4e-38    
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg             154   5e-38    Prunus persica
emb|CDP03600.1|  unnamed protein product                                154   5e-38    Coffea canephora [robusta coffee]
gb|KJB10672.1|  hypothetical protein B456_001G215500                    153   5e-38    Gossypium raimondii
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...    154   6e-38    Fragaria vesca subsp. vesca
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320             154   6e-38    Camelina sativa [gold-of-pleasure]
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320             154   7e-38    Camelina sativa [gold-of-pleasure]
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620             154   7e-38    Nicotiana sylvestris
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960             154   7e-38    Tarenaya hassleriana [spider flower]
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...    154   8e-38    Cucumis melo [Oriental melon]
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620             154   8e-38    Nicotiana tomentosiformis
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...    153   9e-38    Fragaria vesca subsp. vesca
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    153   1e-37    Phoenix dactylifera
gb|KHG10946.1|  putative membrane C2G11.09                              153   1e-37    Gossypium arboreum [tree cotton]
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...    153   1e-37    Fragaria vesca subsp. vesca
ref|XP_003616997.1|  Transmembrane protein                              153   1e-37    Medicago truncatula
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...    153   1e-37    Cicer arietinum [garbanzo]
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    153   1e-37    Camelina sativa [gold-of-pleasure]
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...    153   1e-37    Prunus mume [ume]
gb|KJB10673.1|  hypothetical protein B456_001G215500                    153   2e-37    Gossypium raimondii
gb|KJB10674.1|  hypothetical protein B456_001G215500                    152   2e-37    Gossypium raimondii
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    153   2e-37    
gb|KHG22816.1|  putative membrane C2G11.09                              151   2e-37    Gossypium arboreum [tree cotton]
ref|XP_004151944.1|  PREDICTED: calcium permeable stress-gated ca...    152   2e-37    Cucumis sativus [cucumbers]
emb|CDP04437.1|  unnamed protein product                                152   3e-37    Coffea canephora [robusta coffee]
ref|XP_002301612.2|  early-responsive to dehydration family protein     152   4e-37    
gb|AFI41197.1|  dehydration stress protein                              152   4e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090             152   4e-37    Fragaria vesca subsp. vesca
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...    152   4e-37    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620             151   5e-37    Tarenaya hassleriana [spider flower]
ref|XP_008363487.1|  PREDICTED: uncharacterized protein RSN1-like       150   6e-37    
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960             151   6e-37    Camelina sativa [gold-of-pleasure]
ref|XP_010089460.1|  Uncharacterized membrane protein                   151   7e-37    
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960             151   7e-37    Camelina sativa [gold-of-pleasure]
ref|XP_003612662.1|  Membrane protein, putative                         151   7e-37    Medicago truncatula
dbj|BAF98597.1|  CM0545.360.nc                                          150   9e-37    Lotus japonicus
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...    150   1e-36    Citrus sinensis [apfelsine]
ref|XP_006850790.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    150   1e-36    Amborella trichopoda
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960             150   1e-36    Brassica rapa
emb|CDX98089.1|  BnaA06g08400D                                          150   1e-36    
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620             150   1e-36    Vitis vinifera
ref|XP_011625695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    150   1e-36    
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...    150   1e-36    Fragaria vesca subsp. vesca
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09               150   1e-36    Triticum urartu
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620             150   1e-36    Eucalyptus grandis [rose gum]
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620             150   2e-36    Solanum lycopersicum
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg             150   2e-36    Capsella rubella
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...    150   2e-36    Prunus mume [ume]
gb|EMT11783.1|  Putative membrane protein                               150   2e-36    
emb|CDY30043.1|  BnaC05g09770D                                          150   2e-36    Brassica napus [oilseed rape]
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09               150   2e-36    Triticum urartu
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...    150   2e-36    
gb|EMT13890.1|  Putative membrane protein                               150   2e-36    
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like       149   3e-36    Cicer arietinum [garbanzo]
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    149   3e-36    
ref|XP_004146108.1|  PREDICTED: CSC1-like protein At1g32090             149   3e-36    Cucumis sativus [cucumbers]
gb|AFW81357.1|  HYP1 isoform 1                                          149   3e-36    
ref|NP_001147493.1|  LOC100281102                                       149   3e-36    Zea mays [maize]
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg             149   3e-36    Prunus persica
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900             149   3e-36    Vitis vinifera
ref|XP_006843810.1|  PREDICTED: calcium permeable stress-gated ca...    149   3e-36    Amborella trichopoda
dbj|BAJ96091.1|  predicted protein                                      149   3e-36    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320             149   3e-36    Camelina sativa [gold-of-pleasure]
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    149   3e-36    Nelumbo nucifera [Indian lotus]
emb|CBI32349.3|  unnamed protein product                                149   4e-36    Vitis vinifera
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620             149   4e-36    Populus euphratica
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...    149   4e-36    
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg             149   5e-36    Capsella rubella
ref|XP_002321139.1|  early-responsive to dehydration family protein     149   5e-36    Populus trichocarpa [western balsam poplar]
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...    149   5e-36    
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620             148   6e-36    Populus euphratica
gb|KDP20707.1|  hypothetical protein JCGZ_21178                         147   7e-36    Jatropha curcas
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1            148   7e-36    Cucumis melo [Oriental melon]
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...    148   8e-36    Glycine max [soybeans]
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683             147   8e-36    
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...    148   8e-36    
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346             148   8e-36    
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg             148   8e-36    
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...    148   9e-36    Brachypodium distachyon [annual false brome]
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...    148   9e-36    Cucumis melo [Oriental melon]
ref|NP_001056508.1|  Os05g0594700                                       148   9e-36    
emb|CDP11354.1|  unnamed protein product                                148   9e-36    Coffea canephora [robusta coffee]
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900             148   1e-35    Eucalyptus grandis [rose gum]
ref|XP_002529341.1|  conserved hypothetical protein                     147   1e-35    
ref|XP_011626939.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    147   1e-35    
ref|XP_008363043.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    146   2e-35    
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...    147   2e-35    Solanum tuberosum [potatoes]
ref|NP_192343.1|  early-responsive to dehydration stress-related ...    147   2e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770          147   2e-35    Sorghum bicolor [broomcorn]
gb|KJB42871.1|  hypothetical protein B456_007G171500                    147   2e-35    Gossypium raimondii
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g             147   2e-35    Phaseolus vulgaris [French bean]
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620             147   2e-35    Populus euphratica
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090             147   2e-35    Eucalyptus grandis [rose gum]
gb|EEE64912.1|  hypothetical protein OsJ_19772                          147   2e-35    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg             147   2e-35    Capsella rubella
gb|KJB42870.1|  hypothetical protein B456_007G171500                    147   2e-35    Gossypium raimondii
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...    146   3e-35    Fragaria vesca subsp. vesca
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090             147   3e-35    Pyrus x bretschneideri [bai li]
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg             147   3e-35    Prunus persica
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...    147   3e-35    
gb|AAL07154.1|  unknown protein                                         147   3e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006368323.1|  early-responsive to dehydration family protein     147   3e-35    
ref|XP_011046982.1|  PREDICTED: calcium permeable stress-gated ca...    145   3e-35    Populus euphratica
ref|XP_009123383.1|  PREDICTED: CSC1-like protein At1g62320             146   3e-35    Brassica rapa
emb|CDY19541.1|  BnaC09g13620D                                          146   3e-35    Brassica napus [oilseed rape]
ref|XP_004136187.1|  PREDICTED: CSC1-like protein At4g02900             146   3e-35    Cucumis sativus [cucumbers]
emb|CDP11733.1|  unnamed protein product                                147   3e-35    Coffea canephora [robusta coffee]
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658             146   3e-35    
ref|XP_012080615.1|  PREDICTED: CSC1-like protein At3g21620             146   4e-35    Jatropha curcas
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg             146   5e-35    Capsella rubella
ref|XP_006383870.1|  early-responsive to dehydration family protein     146   5e-35    
ref|XP_010235059.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    145   5e-35    
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...    145   6e-35    Cucumis melo [Oriental melon]
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090             146   6e-35    Nicotiana sylvestris
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...    145   6e-35    Oryza brachyantha
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697             145   6e-35    Arabidopsis lyrata subsp. lyrata
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...    145   6e-35    
emb|CDY32032.1|  BnaA03g60360D                                          145   7e-35    Brassica napus [oilseed rape]
ref|XP_010090368.1|  Uncharacterized membrane protein                   146   7e-35    
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...    145   7e-35    Populus euphratica
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                      145   7e-35    Camelina sativa [gold-of-pleasure]
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg             145   7e-35    Prunus persica
ref|XP_002464863.1|  hypothetical protein SORBIDRAFT_01g027810          145   7e-35    Sorghum bicolor [broomcorn]
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg                145   9e-35    Erythranthe guttata [common monkey flower]
ref|XP_010099166.1|  Uncharacterized membrane protein                   145   9e-35    
ref|XP_003574401.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    145   9e-35    
ref|XP_012092360.1|  PREDICTED: uncharacterized protein LOC105650086    146   1e-34    
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090             145   1e-34    
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1            145   1e-34    
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg             145   1e-34    
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226             144   1e-34    
ref|XP_011018446.1|  PREDICTED: CSC1-like protein At1g32090             145   2e-34    
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...    144   2e-34    
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1            144   2e-34    
gb|EAY79648.1|  hypothetical protein OsI_34792                          145   2e-34    
ref|NP_001065504.1|  Os10g0579100                                       144   2e-34    
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090             144   2e-34    
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...    144   2e-34    
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg             144   2e-34    
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like       144   2e-34    
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...    144   2e-34    
emb|CDY32438.1|  BnaC03g42220D                                          144   2e-34    
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    144   2e-34    
emb|CDY22920.1|  BnaA01g18580D                                          144   2e-34    
ref|XP_006469645.1|  PREDICTED: uncharacterized membrane protein ...    142   2e-34    
ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...    144   2e-34    
ref|NP_001055457.1|  Os05g0393800                                       144   3e-34    
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990          144   3e-34    
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320      144   3e-34    
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...    144   3e-34    
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...    143   4e-34    
emb|CDY49293.1|  BnaC01g22480D                                          143   4e-34    
emb|CAA18115.1|  putative protein                                       142   4e-34    
ref|XP_002518432.1|  conserved hypothetical protein                     143   4e-34    
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...    143   4e-34    
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900             143   4e-34    
gb|KJB42062.1|  hypothetical protein B456_007G134700                    142   5e-34    
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900             143   5e-34    
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    143   5e-34    
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    142   5e-34    
emb|CDX82907.1|  BnaC01g13570D                                          143   5e-34    
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900             143   5e-34    
gb|KJB42060.1|  hypothetical protein B456_007G134700                    142   5e-34    
ref|XP_009601393.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    142   5e-34    
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    142   5e-34    
gb|KDO58806.1|  hypothetical protein CISIN_1g040696mg                   143   5e-34    
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like          143   5e-34    
ref|NP_193943.2|  early-responsive to dehydration stress-related ...    143   6e-34    
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg             142   6e-34    
ref|XP_006662108.1|  PREDICTED: uncharacterized membrane protein ...    143   6e-34    
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900             142   7e-34    
gb|KJB42059.1|  hypothetical protein B456_007G134700                    142   7e-34    
dbj|BAD93792.1|  hypothetical protein                                   142   8e-34    
ref|XP_006432649.1|  hypothetical protein CICLE_v10000312mg             142   8e-34    
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    142   9e-34    
gb|KHN38468.1|  Putative membrane protein C2G11.09                      142   1e-33    
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...    142   1e-33    
gb|KHN19872.1|  Putative membrane protein C2G11.09                      142   1e-33    
ref|NP_172660.5|  putative ERD4 protein                                 142   1e-33    
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    142   1e-33    
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...    142   1e-33    
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg             142   1e-33    
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...    142   1e-33    
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...    142   1e-33    
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...    142   1e-33    
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...    142   1e-33    
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    142   1e-33    
ref|NP_001043256.1|  Os01g0534900                                       142   1e-33    
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg             142   1e-33    
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    141   2e-33    
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900             141   2e-33    
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...    141   2e-33    
emb|CDX79125.1|  BnaA01g11920D                                          140   2e-33    
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...    141   2e-33    
gb|EMS56194.1|  Uncharacterized membrane protein C2G11.09               140   2e-33    
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620             141   2e-33    
emb|CDY48898.1|  BnaA03g36370D                                          141   2e-33    
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    140   2e-33    
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620             141   2e-33    
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    141   2e-33    
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    141   2e-33    
ref|XP_011625696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    141   2e-33    
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    141   3e-33    
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg             140   3e-33    
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...    140   3e-33    
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    140   3e-33    
ref|XP_002304365.2|  hypothetical protein POPTR_0003s09900g             140   3e-33    
ref|XP_008658829.1|  PREDICTED: uncharacterized protein RSN1            140   4e-33    
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...    140   4e-33    
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...    140   4e-33    
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900             140   4e-33    
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...    140   4e-33    
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                    140   4e-33    
emb|CDY35541.1|  BnaA05g16450D                                          140   5e-33    
emb|CDY29933.1|  BnaC05g29030D                                          140   5e-33    
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090             140   5e-33    
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    140   6e-33    
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430             140   6e-33    
dbj|BAK05559.1|  predicted protein                                      140   6e-33    
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like       140   6e-33    
gb|KCW77011.1|  hypothetical protein EUGRSUZ_D01358                     139   7e-33    
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    140   7e-33    
ref|NP_188799.1|  early-responsive to dehydration stress-related ...    139   7e-33    
dbj|BAD94445.1|  hypothetical protein                                   139   7e-33    
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g             140   7e-33    
ref|XP_011028084.1|  PREDICTED: CSC1-like protein At1g32090             140   7e-33    
emb|CDY21297.1|  BnaC03g29810D                                          139   9e-33    
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    139   9e-33    
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g             139   1e-32    
gb|KHN40403.1|  Putative membrane protein C2G11.09                      139   1e-32    
dbj|BAK03311.1|  predicted protein                                      139   1e-32    
ref|XP_004983522.1|  PREDICTED: uncharacterized membrane protein ...    139   1e-32    
ref|XP_006447608.1|  hypothetical protein CICLE_v10014696mg             137   1e-32    
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like       139   1e-32    
gb|EPS60017.1|  hypothetical protein M569_14787                         139   1e-32    
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...    139   1e-32    
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312             139   1e-32    
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340             139   1e-32    
gb|EPS61105.1|  hypothetical protein M569_13694                         137   1e-32    
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...    139   2e-32    
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...    139   2e-32    
ref|XP_008360740.1|  PREDICTED: uncharacterized protein RSN1-like       134   2e-32    
emb|CDX90856.1|  BnaA03g25360D                                          138   2e-32    
gb|KDO39720.1|  hypothetical protein CISIN_1g048588mg                   137   2e-32    
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like       138   2e-32    
gb|KJB69238.1|  hypothetical protein B456_011G012200                    137   2e-32    
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg             138   2e-32    
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...    138   2e-32    
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...    138   2e-32    
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    138   3e-32    
ref|XP_004145433.1|  PREDICTED: calcium permeable stress-gated ca...    138   3e-32    
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010          138   3e-32    
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg             138   3e-32    
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...    138   3e-32    
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...    138   3e-32    
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...    138   3e-32    
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg                138   3e-32    
gb|EMT27455.1|  Putative membrane protein                               138   3e-32    
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...    137   4e-32    
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...    137   4e-32    
emb|CDY27443.1|  BnaC03g64830D                                          137   4e-32    
gb|KHG01808.1|  putative membrane C2G11.09                              137   4e-32    
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...    137   4e-32    
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg             137   4e-32    
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090             137   4e-32    
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...    137   5e-32    
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...    137   6e-32    
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...    137   6e-32    
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                    137   6e-32    
gb|KJB69236.1|  hypothetical protein B456_011G012200                    137   7e-32    
gb|KJB69243.1|  hypothetical protein B456_011G012200                    137   7e-32    
gb|KHN28986.1|  Putative membrane protein C2G11.09                      137   7e-32    
gb|KJB69239.1|  hypothetical protein B456_011G012200                    137   7e-32    
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...    137   7e-32    
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320             137   9e-32    
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    136   9e-32    
emb|CDY09064.1|  BnaC08g10180D                                          136   1e-31    
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430             136   1e-31    
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    135   1e-31    
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...    136   1e-31    
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...    136   1e-31    
emb|CDX76386.1|  BnaA08g10140D                                          135   1e-31    
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                    136   2e-31    
gb|KHG30770.1|  putative membrane C2G11.09                              135   2e-31    
emb|CDY12941.1|  BnaA09g13330D                                          135   2e-31    
ref|NP_174489.1|  early-responsive to dehydration stress protein ...    135   2e-31    
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...    135   2e-31    
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090             135   3e-31    
gb|KJB57786.1|  hypothetical protein B456_009G181100                    135   3e-31    
ref|XP_002886475.1|  F24O1.4                                            135   3e-31    
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g             135   3e-31    
ref|XP_010231849.1|  PREDICTED: calcium permeable stress-gated ca...    134   3e-31    
ref|XP_001770572.1|  predicted protein                                  134   3e-31    
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg                135   3e-31    
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g             135   3e-31    
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    135   4e-31    
ref|XP_003610472.1|  Membrane protein, putative                         134   4e-31    
gb|EAY97938.1|  hypothetical protein OsI_19855                          134   5e-31    
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392             134   5e-31    
emb|CDM81261.1|  unnamed protein product                                134   5e-31    
gb|EYU23284.1|  hypothetical protein MIMGU_mgv1a001448mg                134   5e-31    
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...    134   8e-31    
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090             134   8e-31    
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...    134   8e-31    
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090             134   9e-31    
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg             134   1e-30    
ref|XP_011082330.1|  PREDICTED: CSC1-like protein At1g32090             134   1e-30    
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09               134   1e-30    
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...    133   1e-30    
gb|KJB22581.1|  hypothetical protein B456_004G055300                    132   1e-30    
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...    133   1e-30    
ref|XP_012084749.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       132   2e-30    
gb|EMT22148.1|  Putative membrane protein                               133   2e-30    
gb|EMT23208.1|  Putative membrane protein                               133   2e-30    
ref|XP_012084747.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       132   2e-30    
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...    132   2e-30    
gb|KHG17938.1|  putative membrane C2G11.09                              132   2e-30    
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...    132   2e-30    
ref|XP_012092490.1|  PREDICTED: CSC1-like protein At4g02900             132   2e-30    
ref|XP_010110412.1|  Uncharacterized protein RSN1                       129   2e-30    
gb|EPS60193.1|  hypothetical protein M569_14609                         132   2e-30    
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...    133   2e-30    
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...    132   3e-30    
ref|XP_004968885.1|  PREDICTED: uncharacterized membrane protein ...    132   3e-30    
ref|XP_006348154.1|  PREDICTED: uncharacterized protein RSN1-like...    131   4e-30    
gb|KJB22580.1|  hypothetical protein B456_004G055300                    129   4e-30    
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...    131   4e-30    
ref|XP_010677412.1|  PREDICTED: CSC1-like protein At1g32090             132   4e-30    
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...    131   5e-30    
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...    131   5e-30    
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090             131   5e-30    
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg                131   5e-30    
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...    131   5e-30    
gb|EPS71707.1|  hypothetical protein M569_03051                         131   6e-30    
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...    131   6e-30    
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg                131   6e-30    
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...    131   6e-30    
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    132   7e-30    
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g             130   7e-30    
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...    131   7e-30    
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1    130   1e-29    
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...    130   1e-29    
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    130   2e-29    
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900             129   2e-29    
gb|EMT18085.1|  Putative membrane protein                               129   2e-29    



>ref|XP_004244862.1| PREDICTED: CSC1-like protein ERD4 [Solanum lycopersicum]
Length=723

 Score =   445 bits (1145),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/286 (78%), Positives = 249/286 (87%), Gaps = 2/286 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESH  RAASGKYFYFTVLNVFIGVT+G TLF + KSIE +PNSI  +LA S
Sbjct  438   LSKAEGIPSESHVTRAASGKYFYFTVLNVFIGVTLGGTLFTSFKSIEHDPNSIFRVLAKS  497

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AEIKEAWAPGDLGYAT
Sbjct  498   LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEIKEAWAPGDLGYAT  557

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             RFP DML++ I LCYSVIAPIIIPFG VYFGLGWLLLRNQALKVYVPSFESYG+MWPH++
Sbjct  558   RFPNDMLIMTIVLCYSVIAPIIIPFGVVYFGLGWLLLRNQALKVYVPSFESYGRMWPHIY  617

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++A LILYQ+TM+GYFGVKKF   P++ PLPI+S +FAF+C KKF RFF S ALE VS
Sbjct  618   TRMIATLILYQVTMLGYFGVKKFKPTPVLFPLPIISLIFAFICQKKFRRFFTSPALEVVS  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASN  175
                E KEVPNM+I++RSFIPPC G  K DE  FEDALS VS++ S+
Sbjct  678   --HELKEVPNMEIVYRSFIPPCLGAGKPDEHQFEDALSHVSKTGSS  721



>ref|XP_009611468.1| PREDICTED: CSC1-like protein ERD4 isoform X2 [Nicotiana tomentosiformis]
Length=691

 Score =   440 bits (1132),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 220/286 (77%), Positives = 247/286 (86%), Gaps = 2/286 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESH  RAASGKYFYF+VLNVFIGVT+G TLF + KSIE++PNSI  +LA S
Sbjct  406   LSKAEGIPSESHVTRAASGKYFYFSVLNVFIGVTLGGTLFSSFKSIENDPNSIFRVLAES  465

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CK +AEIKEAWAPGDLGYAT
Sbjct  466   LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKIEAEIKEAWAPGDLGYAT  525

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             RFP DML++ I LCYSVIAPII+PFG VYFGLGWLLLRNQALKVYVPSFESYG+MWPH+H
Sbjct  526   RFPSDMLIMTIVLCYSVIAPIILPFGVVYFGLGWLLLRNQALKVYVPSFESYGRMWPHIH  585

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++A LILYQ+TM GYFGVKKF   P++ PLPI S +FAF+C KKF RFF S ALE +S
Sbjct  586   TRMLATLILYQVTMCGYFGVKKFAPTPVLFPLPIFSLIFAFICQKKFRRFFVSPALEVIS  645

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASN  175
                E KEVPNMDI+FRSFIPPC    KSD+  FEDALS VS++ S+
Sbjct  646   --HELKEVPNMDIVFRSFIPPCLSAGKSDDHQFEDALSHVSKTGSS  689



>ref|XP_009611467.1| PREDICTED: CSC1-like protein ERD4 isoform X1 [Nicotiana tomentosiformis]
Length=723

 Score =   441 bits (1134),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 220/286 (77%), Positives = 247/286 (86%), Gaps = 2/286 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESH  RAASGKYFYF+VLNVFIGVT+G TLF + KSIE++PNSI  +LA S
Sbjct  438   LSKAEGIPSESHVTRAASGKYFYFSVLNVFIGVTLGGTLFSSFKSIENDPNSIFRVLAES  497

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CK +AEIKEAWAPGDLGYAT
Sbjct  498   LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKIEAEIKEAWAPGDLGYAT  557

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             RFP DML++ I LCYSVIAPII+PFG VYFGLGWLLLRNQALKVYVPSFESYG+MWPH+H
Sbjct  558   RFPSDMLIMTIVLCYSVIAPIILPFGVVYFGLGWLLLRNQALKVYVPSFESYGRMWPHIH  617

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++A LILYQ+TM GYFGVKKF   P++ PLPI S +FAF+C KKF RFF S ALE +S
Sbjct  618   TRMLATLILYQVTMCGYFGVKKFAPTPVLFPLPIFSLIFAFICQKKFRRFFVSPALEVIS  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASN  175
                E KEVPNMDI+FRSFIPPC    KSD+  FEDALS VS++ S+
Sbjct  678   --HELKEVPNMDIVFRSFIPPCLSAGKSDDHQFEDALSHVSKTGSS  721



>ref|XP_006364887.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Solanum 
tuberosum]
Length=723

 Score =   440 bits (1131),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 220/286 (77%), Positives = 247/286 (86%), Gaps = 2/286 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESHA RAASGKYFYFTVLNVFIG+T+G TLF + KSIE +PNSI  +LA S
Sbjct  438   LSKAEGIPSESHATRAASGKYFYFTVLNVFIGITLGGTLFTSFKSIEHDPNSIFGVLAKS  497

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AEIKEAWAP DLGYAT
Sbjct  498   LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEIKEAWAPDDLGYAT  557

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             RFP DML++ I LCYSVIAPIIIPFG  YFGLGWLLLRNQALKVYVPSFESYG+MWPH++
Sbjct  558   RFPNDMLIMTIVLCYSVIAPIIIPFGVAYFGLGWLLLRNQALKVYVPSFESYGRMWPHIY  617

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++A LILYQ+TM+GYFGVKKF   P++ PLPI+S +FAF+C KKF RFF S ALE VS
Sbjct  618   TRMIATLILYQVTMLGYFGVKKFKPTPVLFPLPIISLIFAFICQKKFRRFFISPALEVVS  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASN  175
                E KEVPNM+I++RSFIPPC    K DED FEDALS VS+  S+
Sbjct  678   --HELKEVPNMEIVYRSFIPPCLSAGKPDEDQFEDALSHVSKPGSS  721



>ref|XP_009781612.1| PREDICTED: CSC1-like protein ERD4 [Nicotiana sylvestris]
Length=723

 Score =   437 bits (1123),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 217/286 (76%), Positives = 244/286 (85%), Gaps = 2/286 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESH  RAASGKYFYF+VLNVFIGVT+  TL    KSIE +PNSI  +LA S
Sbjct  438   LSKAEGIPSESHVTRAASGKYFYFSVLNVFIGVTLAGTLLGAFKSIEKDPNSIFRVLAES  497

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AEIKEAWAPGDLGYAT
Sbjct  498   LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEIKEAWAPGDLGYAT  557

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             RFP DML++ I LCYSVIAPII+PFG VYFGLGWLLLRNQALKVYVPSFESYG+MWPH+H
Sbjct  558   RFPSDMLIMTIVLCYSVIAPIILPFGVVYFGLGWLLLRNQALKVYVPSFESYGRMWPHIH  617

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++A LILYQ+TM GYFG+K F   P++ PLPI S +FAF+C KKF RFF+S ALE VS
Sbjct  618   TRMLATLILYQVTMCGYFGIKTFAPTPVLFPLPIFSLIFAFICQKKFRRFFESPALEVVS  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASN  175
                E KE+PNMDI+FRSFIPPC    KSD+  FEDALS VS++ S+
Sbjct  678   --HELKEIPNMDIVFRSFIPPCLSAGKSDDHQFEDALSHVSKTGSS  721



>ref|XP_010245168.1| PREDICTED: CSC1-like protein ERD4 [Nelumbo nucifera]
Length=724

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/287 (74%), Positives = 254/287 (89%), Gaps = 4/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVT+G TLF T K IE +PN+I+SLL T 
Sbjct  438   LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTVGGTLFQTFKDIEKHPNNIVSLLGTG  497

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSR+VPL+++HLK++++CKT+AE+KEAWAPGDLGYAT
Sbjct  498   LPGNATFFLTFVALKFFVGYGLELSRLVPLVMYHLKRRFLCKTEAELKEAWAPGDLGYAT  557

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++II LCYSVIAPIIIPFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  558   RVPSDMLIIIIVLCYSVIAPIIIPFGVLYFGLGWLILRNQALKVYVPSYESYGRMWPHVH  617

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             +R++AALI+YQ+TM+GYF VKKF Y P++IPLP+LS +F FVCSKKFY+ FQST LE   
Sbjct  618   SRILAALIIYQITMLGYFAVKKFFYTPILIPLPVLSLMFGFVCSKKFYKSFQSTPLEV--  675

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDE-DHFEDALS-QVSRSAS  178
             A +E KE PNM+ IFR++IPPC  ++K D+ + FEDALS QVSR+ S
Sbjct  676   ACRELKETPNMESIFRAYIPPCLSSDKVDDGEQFEDALSTQVSRTGS  722



>ref|XP_010086875.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB24359.1| Uncharacterized membrane protein [Morus notabilis]
Length=658

 Score =   428 bits (1100),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 204/285 (72%), Positives = 242/285 (85%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESHAVRAASGKYFYF+VLNVFIGVT+  TLF T KSI+  P S + +LA S
Sbjct  374   LSKAEGIPSESHAVRAASGKYFYFSVLNVFIGVTVAGTLFSTFKSIQKEPKSAVDILANS  433

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             +P +A FFLTFVALKFFVGYGLELSRIVPLIIFH+K+KY+CKT+ E+K+AW PG LGY T
Sbjct  434   IPENAAFFLTFVALKFFVGYGLELSRIVPLIIFHIKRKYLCKTEEEVKDAWTPGALGYGT  493

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML++ I LCYSVIAP++IPFG  YFGLGWL+LRNQAL VYVPS+ESYG++WPH+H
Sbjct  494   RIPGDMLIITIVLCYSVIAPLVIPFGVAYFGLGWLILRNQALNVYVPSYESYGRLWPHIH  553

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R++AALILYQ+TM GY GVKKF Y+P++I LPILS +FAF+C+KKFYR F  TALE V+
Sbjct  554   VRIIAALILYQVTMFGYLGVKKFYYSPILISLPILSLIFAFICNKKFYRAFHDTALEVVA  613

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
               +E KE PN++ +FRSFIPP    EKSD+D FEDALSQVSR+ S
Sbjct  614   --QESKETPNLEQVFRSFIPPSLNYEKSDDDQFEDALSQVSRTGS  656



>ref|XP_007211358.1| hypothetical protein PRUPE_ppa002050mg [Prunus persica]
 gb|EMJ12557.1| hypothetical protein PRUPE_ppa002050mg [Prunus persica]
Length=724

 Score =   428 bits (1101),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 210/285 (74%), Positives = 248/285 (87%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPS+SHA+RAASGKYFYFT+ NVF+GVTIG TLF T K+IE++PNSII+LLATS
Sbjct  440   LSKAEGIPSQSHAIRAASGKYFYFTIFNVFLGVTIGGTLFSTFKTIENDPNSIITLLATS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +AT+FLTFVALKFFVGYGLELSRIVPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500   LPGNATYFLTFVALKFFVGYGLELSRIVPLIIFHIKRKYLCKTEAELKAAWLPSDLGYGT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML++ I LCYSVIAP+I+PFG +YFG+GWL+LRNQALKVYVP++ESYG+MWPHMH
Sbjct  560   RVPGDMLIITIVLCYSVIAPLIVPFGVLYFGIGWLVLRNQALKVYVPAYESYGRMWPHMH  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              RV+AALILYQ+TM GYFGVKKF +AP +I LPILS LF F+C KKFYR FQ TALE   
Sbjct  620   VRVLAALILYQVTMFGYFGVKKFVFAPFLIVLPILSLLFGFICRKKFYRAFQDTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A  E KE+PNM+ ++R+FIPP  G+EK D+D FEDA S VSR+ S
Sbjct  678   AAHELKELPNMEQVYRAFIPPSLGSEKMDDDQFEDAQSHVSRAGS  722



>ref|XP_009362276.1| PREDICTED: CSC1-like protein ERD4 [Pyrus x bretschneideri]
Length=724

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 249/285 (87%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPS+SHA+RAASGKYFYFT+ NVF+GVT+G TLF T K+IE +PNS++ +LA+S
Sbjct  440   LSKAEGIPSQSHAIRAASGKYFYFTIFNVFLGVTVGGTLFSTFKTIEKDPNSLVDILASS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP++AT+FLTFVALKFFVGYGLELSR+VPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500   LPANATYFLTFVALKFFVGYGLELSRLVPLIIFHIKRKYLCKTEAEVKAAWLPSDLGYGT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P D+L++ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVY+P++ESYG+MWPHM 
Sbjct  560   RVPSDLLIITIVLCYSVIAPLILPFGVLYFGLGWLILRNQALKVYIPAYESYGRMWPHMQ  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R++A+LILYQ+TM GYFGVK+F YAP +IPLPI+S LF+F+CSKKFYRFFQ TALE   
Sbjct  620   IRIIASLILYQVTMFGYFGVKRFYYAPFLIPLPIMSLLFSFICSKKFYRFFQHTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A  E KE+PNM+ ++R+FIPP   +EK D+D FEDA S VSR+AS
Sbjct  678   AAHELKEIPNMEQVYRAFIPPSLSSEKIDDDQFEDAQSSVSRTAS  722



>ref|XP_007024953.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 gb|EOY27575.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
Length=724

 Score =   427 bits (1098),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 213/287 (74%), Positives = 245/287 (85%), Gaps = 2/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SH VRAASGKYFYFTV NVFIGVT+G+TLF T KSIE +PNSI  LLA S
Sbjct  440   LSKTEGIPSGSHVVRAASGKYFYFTVFNVFIGVTVGATLFSTFKSIEKDPNSIFDLLAKS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGYAT
Sbjct  500   LPGSATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYAT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             RFPGDML+L I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVP++ESYGKMWPHMH
Sbjct  560   RFPGDMLILTIVLCYSVIAPVIIPFGVLYFALGWLILRNQALKVYVPAYESYGKMWPHMH  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TRV+ AL+LYQ TM+GYFGV KF Y P++IPLPILS +FA+VC +KFY+ F  TALE   
Sbjct  620   TRVIGALLLYQATMLGYFGVMKFYYTPILIPLPILSLIFAYVCRQKFYKAFSHTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
             A +E KE P M+ IF+S+IPP   +EK +++ FEDALSQ SR+ S V
Sbjct  678   ACQELKETPQMEQIFKSYIPPSLCSEKQEDEQFEDALSQASRTGSFV  724



>emb|CBI30957.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   424 bits (1089),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 210/286 (73%), Positives = 245/286 (86%), Gaps = 3/286 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SKAEGIPS+SHAVRAASGKYFYFT+LNVFIGVT+G TLFDT K+IED P  ++S+LA SL
Sbjct  397   SKAEGIPSQSHAVRAASGKYFYFTILNVFIGVTVGGTLFDTFKTIEDQPKELVSILAKSL  456

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             PS+ATFFLTFVALKFFVGYGLELSRIVPLIIFHLK+KY+CKT+ E+KEAWAPGDLGY +R
Sbjct  457   PSNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTETEVKEAWAPGDLGYVSR  516

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGD+L++ I LCYSVIAPII+PFG +YFGLGWL+LRNQALKVYVPS+ES G+MWPH+H 
Sbjct  517   VPGDLLIITIVLCYSVIAPIILPFGVLYFGLGWLILRNQALKVYVPSYESNGRMWPHIHV  576

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R++ AL+LYQ+TM+GYFGVK+F Y P VI L ILS +F FVC KKFYR FQS  LE   A
Sbjct  577   RLIGALLLYQVTMLGYFGVKEFRYTPFVIVLLILSLIFIFVCQKKFYRSFQSVPLEV--A  634

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
               E KE PNM+ IFR++IPP    EK DE+ FEDALSQVSR+ S+V
Sbjct  635   SHELKESPNMEHIFRAYIPPSLSCEK-DEEQFEDALSQVSRTTSSV  679



>ref|XP_011096640.1| PREDICTED: CSC1-like protein ERD4 [Sesamum indicum]
Length=718

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/280 (75%), Positives = 243/280 (87%), Gaps = 2/280 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGI SESHA RAASGKYFYF+VLNVFIGVTIG+TLF TLK IE +PNS++ LLA S
Sbjct  440   LSKAEGIASESHAQRAASGKYFYFSVLNVFIGVTIGNTLFTTLKRIEKDPNSLVPLLAES  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+KEAWAPGDLGYAT
Sbjct  500   LPGSATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEVKEAWAPGDLGYAT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+L I +CYSVIAP+IIPFG +Y+GLGWL+LRNQ LKVYVPS+ESYG++WPH++
Sbjct  560   RIPADMLILTIVICYSVIAPLIIPFGIIYYGLGWLVLRNQVLKVYVPSYESYGRIWPHIY  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R++A+LILYQ TM+GYF  K+F Y P++IPL +LSF+F  VC KKFYRFFQ TALE   
Sbjct  620   VRIMASLILYQATMLGYFSAKEFIYTPVLIPLIVLSFIFVLVCRKKFYRFFQCTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQV  193
             A +E KE PNM ++FRSFIPP   +EK+DED FEDALS V
Sbjct  678   ASRELKETPNMQVVFRSFIPPSLSSEKADEDQFEDALSHV  717



>ref|XP_008371799.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Malus 
domestica]
Length=724

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 249/285 (87%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPS+SHA+RAASGKYFYFT+ NVF+G+T+G TLF T K+IE +PNS++ +LA+S
Sbjct  440   LSKAEGIPSQSHAIRAASGKYFYFTIFNVFLGITVGGTLFSTFKTIEKDPNSLVDILASS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LPS+AT+FLTFVALKFFVGYGLELSR+VPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500   LPSNATYFLTFVALKFFVGYGLELSRLVPLIIFHIKRKYLCKTEAEVKAAWLPSDLGYGT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P D+LV+ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVY+P++ESYG+MWPHM 
Sbjct  560   RVPNDLLVITIVLCYSVIAPLILPFGVLYFGLGWLILRNQALKVYIPAYESYGRMWPHMQ  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R++A+LILYQ+TM GYFGVK+F YAP +IPLPI+S +F+F+CSKKFYRFFQ TALE   
Sbjct  620   IRIIASLILYQVTMFGYFGVKRFYYAPFLIPLPIMSLIFSFICSKKFYRFFQHTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A  E KE+PNM+ ++R+FIPP   +EK D+D +EDA S VSR+AS
Sbjct  678   AAHELKEIPNMEQVYRAFIPPSLSSEKIDDDQYEDAQSSVSRTAS  722



>ref|XP_002280109.1| PREDICTED: CSC1-like protein ERD4 [Vitis vinifera]
Length=724

 Score =   424 bits (1089),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 210/286 (73%), Positives = 245/286 (86%), Gaps = 3/286 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SKAEGIPS+SHAVRAASGKYFYFT+LNVFIGVT+G TLFDT K+IED P  ++S+LA SL
Sbjct  442   SKAEGIPSQSHAVRAASGKYFYFTILNVFIGVTVGGTLFDTFKTIEDQPKELVSILAKSL  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             PS+ATFFLTFVALKFFVGYGLELSRIVPLIIFHLK+KY+CKT+ E+KEAWAPGDLGY +R
Sbjct  502   PSNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTETEVKEAWAPGDLGYVSR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGD+L++ I LCYSVIAPII+PFG +YFGLGWL+LRNQALKVYVPS+ES G+MWPH+H 
Sbjct  562   VPGDLLIITIVLCYSVIAPIILPFGVLYFGLGWLILRNQALKVYVPSYESNGRMWPHIHV  621

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R++ AL+LYQ+TM+GYFGVK+F Y P VI L ILS +F FVC KKFYR FQS  LE   A
Sbjct  622   RLIGALLLYQVTMLGYFGVKEFRYTPFVIVLLILSLIFIFVCQKKFYRSFQSVPLEV--A  679

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
               E KE PNM+ IFR++IPP    EK DE+ FEDALSQVSR+ S+V
Sbjct  680   SHELKESPNMEHIFRAYIPPSLSCEK-DEEQFEDALSQVSRTTSSV  724



>ref|XP_008225537.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=724

 Score =   423 bits (1088),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 207/285 (73%), Positives = 247/285 (87%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPS+SHA+RAASGKYFYFT+ NVF+GVTIG TL+ T K+IE +PNSI++LLATS
Sbjct  440   LSKAEGIPSQSHAIRAASGKYFYFTIFNVFLGVTIGGTLYSTFKTIEKDPNSIVTLLATS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LPS+AT+FLTFVALKFFVGYGLELSRIVPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500   LPSNATYFLTFVALKFFVGYGLELSRIVPLIIFHIKRKYLCKTEAELKAAWLPSDLGYGT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML++ I LCYSVIAP+I+PFG +YFG+GWL+LRNQALKVYVP++ESYG+MWPHMH
Sbjct  560   RVPGDMLIITIVLCYSVIAPLIVPFGVLYFGIGWLVLRNQALKVYVPAYESYGRMWPHMH  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              RV+A+LILYQ+TM GYFGVKKF +AP +I LPILS LF F+C KKFYR FQ  ALE   
Sbjct  620   VRVLASLILYQVTMFGYFGVKKFVFAPFLIVLPILSLLFGFICRKKFYRAFQDIALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A  E KE+PNM+ ++R+FIPP  G+EK D+D FEDA S VSR+ S
Sbjct  678   AAHELKELPNMEQVYRAFIPPSLGSEKIDDDQFEDAQSHVSRAGS  722



>ref|XP_012072181.1| PREDICTED: CSC1-like protein ERD4 [Jatropha curcas]
 gb|KDP38019.1| hypothetical protein JCGZ_04662 [Jatropha curcas]
Length=724

 Score =   422 bits (1084),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 210/285 (74%), Positives = 244/285 (86%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESHA+RAASGKYFYFTV NVFIGVT+G TLF T K I+ +P S++++LA S
Sbjct  439   LSKAEGIPSESHAIRAASGKYFYFTVFNVFIGVTLGGTLFSTFKQIQKDPGSLVTVLADS  498

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E+KEAWAPGDLGYAT
Sbjct  499   LPGNATFFLTYVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDELKEAWAPGDLGYAT  558

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I  CYSVIAP+IIPFG VYFGLGWL+LRNQALKV+VPSFESYG+MWPH+H
Sbjct  559   RIPSDMLIITIVYCYSVIAPLIIPFGVVYFGLGWLVLRNQALKVFVPSFESYGRMWPHIH  618

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              RV+A+L+L+Q+T  GY GVKKF YAP +IPLPI+S +F FVC KKFYR F +TALE   
Sbjct  619   MRVLASLLLFQVTTFGYMGVKKFYYAPFLIPLPIISLIFFFVCKKKFYRSFCNTALEV--  676

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A  E KEVPNM+ +FRSFIPP   +EK DED FEDALSQVSR  S
Sbjct  677   ACCELKEVPNMEQVFRSFIPPSLSSEKVDEDQFEDALSQVSRMGS  721



>emb|CDP05663.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 219/287 (76%), Positives = 249/287 (87%), Gaps = 2/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPSESH  RAASGKYFYFTVLNVFIGVT+GS+LF T K IE +PNSI+ LLATS
Sbjct  440   LSKTEGIPSESHVTRAASGKYFYFTVLNVFIGVTVGSSLFGTFKQIEKDPNSIVPLLATS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELS+IVPLII+HLKKKY+CKT+AE+KEAWAPGDLGYAT
Sbjct  500   LPKSATFFLTFVALKFFVGYGLELSQIVPLIIYHLKKKYLCKTEAEVKEAWAPGDLGYAT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             RFP DML++ +  CYSVIAPIIIPFG VYFGLGWL+LRNQ LKVYVPSFESYG+MWPH+ 
Sbjct  560   RFPNDMLIVTLVFCYSVIAPIIIPFGVVYFGLGWLVLRNQVLKVYVPSFESYGRMWPHIF  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R+++AL+LYQ+TM+G+ GVKKFPY  L+IPLPI+S +F  VC KKFYR FQSTALE   
Sbjct  620   IRIMSALLLYQVTMLGFLGVKKFPYTVLLIPLPIISIIFCVVCDKKFYRSFQSTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
             A KE KEVPNM+ +FRSFIPP    EKSD+D FEDALSQVSR+ S +
Sbjct  678   ACKELKEVPNMESVFRSFIPPSLSAEKSDDDQFEDALSQVSRTGSTL  724



>ref|XP_002531053.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31314.1| conserved hypothetical protein [Ricinus communis]
Length=641

 Score =   414 bits (1065),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 240/285 (84%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SHAVRA SGKYFYFTVLNVF+GVT+  TLF   K I+ +PNS ++LLA  
Sbjct  357   LSKLEGIPSVSHAVRATSGKYFYFTVLNVFLGVTLSGTLFSAFKKIQKDPNSTVTLLADG  416

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CKT+ E+KEAW PGD GYAT
Sbjct  417   LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKTEDELKEAWKPGDFGYAT  476

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML++ I LCYS+IAP+IIPFG VYFGLGWL+LRNQALKV+VPSFESYG+MWPH+H
Sbjct  477   RVPGDMLIITIVLCYSIIAPLIIPFGVVYFGLGWLVLRNQALKVFVPSFESYGRMWPHIH  536

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++A+L+L+Q+TM GYFGVKKF +AP ++PLPI++ +F FVC KKFYR F + ALE   
Sbjct  537   TRILASLLLFQVTMFGYFGVKKFVFAPFLLPLPIITLIFVFVCRKKFYRSFCNPALEVAC  596

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
              G   KE+PNM+ IFRSFIPP   +EK D+D FEDALSQ+SR  S
Sbjct  597   RG--LKEIPNMEQIFRSFIPPSLNSEKIDDDQFEDALSQISRMGS  639



>ref|XP_009377481.1| PREDICTED: CSC1-like protein ERD4 [Pyrus x bretschneideri]
Length=724

 Score =   417 bits (1071),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 245/285 (86%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SHAVRA+SGKYFYFT+ NVFIGVT+G TLF T KSIE +PNS++ LLATS
Sbjct  440   LSKTEGIPSLSHAVRASSGKYFYFTIFNVFIGVTVGGTLFSTFKSIEKDPNSLVDLLATS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP++AT+FLTFVALKFFVGYGLEL R+VPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500   LPANATYFLTFVALKFFVGYGLELFRLVPLIIFHIKRKYLCKTEAELKAAWFPSDLGYGT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML++ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+ 
Sbjct  560   RVPGDMLIITIVLCYSVIAPLILPFGVLYFGLGWLVLRNQALKVYVPSYESYGRMWPHIQ  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R++A+LILYQ+TM GYFGVKKF YAP ++PLPI+S L+ F+CSKKFY FFQ TAL+   
Sbjct  620   VRLIASLILYQVTMFGYFGVKKFYYAPFLLPLPIVSLLYCFICSKKFYHFFQHTALKV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A  E KE+PNM+ ++R+FIPP   +EK D+D FEDA S VSR+AS
Sbjct  678   AAHELKEIPNMEQVYRAFIPPSLSSEKLDDDQFEDAQSNVSRTAS  722



>ref|XP_008439583.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Cucumis 
melo]
Length=725

 Score =   415 bits (1066),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 243/284 (86%), Gaps = 2/284 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK+EGIPSE HA RAASGKYFYFTVLNVFIGVT+   LF T KSI+ +PNS++ LLA+SL
Sbjct  442   SKSEGIPSEGHAERAASGKYFYFTVLNVFIGVTLSGALFRTFKSIQKDPNSLVPLLASSL  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P SATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKK++CK +A++K AW PGDLGY TR
Sbjct  502   PGSATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKFLCKCEADVKNAWTPGDLGYGTR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGD+L+  I LCYS+I P+I+PFG +YFGLGWL+LRNQALKVYVPS+E+YG++WPH+  
Sbjct  562   IPGDLLIFTIVLCYSIITPLIVPFGVIYFGLGWLILRNQALKVYVPSYETYGRIWPHIFN  621

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R+VA+L+LYQLTM G+FGVKKF YAP++IPLPI+S +FAF+C KKFYR F +TALE   A
Sbjct  622   RIVASLLLYQLTMFGFFGVKKFYYAPILIPLPIISLIFAFLCHKKFYRSFANTALEV--A  679

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
               E KEVPNM+ +FRSF+PP   +EK ++DHFEDA SQVSR+ S
Sbjct  680   RNELKEVPNMEQVFRSFVPPSLSSEKVEDDHFEDARSQVSRAGS  723



>ref|XP_011012269.1| PREDICTED: CSC1-like protein ERD4 [Populus euphratica]
Length=724

 Score =   414 bits (1065),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 220/285 (77%), Positives = 248/285 (87%), Gaps = 3/285 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SKAEGIPS  HAVRA SGKYFYF +LNVFIGVT+G TLF T KSIE  PNSI+SLLA+SL
Sbjct  440   SKAEGIPSVGHAVRATSGKYFYFIILNVFIGVTLGGTLFSTFKSIEKEPNSIVSLLASSL  499

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+KEAW PGDLGYATR
Sbjct  500   PGNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAELKEAWFPGDLGYATR  559

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGDMLV+ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVY PSFE+YG+MWPH+H 
Sbjct  560   IPGDMLVITIVLCYSVIAPLIIPFGVVYFGLGWLVLRNQALKVYAPSFETYGRMWPHIHA  619

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             RV+AALILYQ+TM GYFGVKKF ++   +IPLPILS LFA+VC KKFYR F  TALE   
Sbjct  620   RVIAALILYQVTMFGYFGVKKFSFSTFSLIPLPILSLLFAYVCHKKFYRSFSDTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A +E KE+PNM+ I+RSFIPP   +EK+D+DHFEDALSQVSR+ S
Sbjct  678   ASRELKEIPNMERIYRSFIPPSLSSEKADDDHFEDALSQVSRAGS  722



>ref|XP_003593877.1| Early-responsive to dehydration [Medicago truncatula]
 gb|AES64128.1| early-responsive to dehydration stress protein (ERD4) [Medicago 
truncatula]
Length=722

 Score =   414 bits (1064),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/287 (71%), Positives = 243/287 (85%), Gaps = 2/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIP+ESHA RAASGKYFYFTVLNVFIGVT+  TLFDT K I++ P  I+ +LA S
Sbjct  438   LSKLEGIPTESHAARAASGKYFYFTVLNVFIGVTLSGTLFDTFKRIQNKPKDIVPVLAES  497

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP  ATFFLTFVALKFFVGYGLELSR+VPLII++LKKK++CKT+AE+KEAWAPGDLGYAT
Sbjct  498   LPGRATFFLTFVALKFFVGYGLELSRLVPLIIYNLKKKFLCKTEAELKEAWAPGDLGYAT  557

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYS IAP+IIPFGA+YFGLGWL+LRNQALKVYVP +ESYG+MWPH++
Sbjct  558   RIPADMLIVTIVLCYSCIAPLIIPFGALYFGLGWLVLRNQALKVYVPRYESYGRMWPHIN  617

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R++A+++LYQ+TM GYFGV++F YAPL+IPLPIL+ LF F+CSKKFY  FQ  ALE   
Sbjct  618   NRILASMVLYQVTMFGYFGVQQFVYAPLLIPLPILTVLFGFICSKKFYPSFQHQALEV--  675

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
             A  E KEVPNM++I+RSFIP    +EK D+D FEDA S+VSR  S V
Sbjct  676   AASEVKEVPNMELIYRSFIPLSLSSEKIDDDQFEDARSEVSRQTSFV  722



>gb|KDO75375.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=546

 Score =   407 bits (1047),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 202/286 (71%), Positives = 238/286 (83%), Gaps = 2/286 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  262   SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  321

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  322   PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  381

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  382   VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  441

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+ F  TALE   A
Sbjct  442   RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEV--A  499

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
              +E KE P+M+ IFRS+IP    +EK D+D FEDALSQ SRS S V
Sbjct  500   SRELKETPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQASRSGSFV  545



>ref|XP_003542948.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine 
max]
Length=724

 Score =   413 bits (1062),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 206/285 (72%), Positives = 241/285 (85%), Gaps = 4/285 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiisllat  856
             SK EGIP+ESHAVRAASGKYFYFTVLNVFIGVTIG TLF   K I ++P  + I SLLA 
Sbjct  440   SKFEGIPTESHAVRAASGKYFYFTVLNVFIGVTIGGTLFKAFKRIREHPTLDEISSLLAE  499

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             SLP +ATFFLT+VALKFF+GYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  500   SLPGNATFFLTYVALKFFIGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  559

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             TR PGDML++ I  CYSVIAP+IIPFGA+YFGLGWL+LRNQALKVYVP+FESYG+MWPH+
Sbjct  560   TRVPGDMLIVTIVFCYSVIAPVIIPFGALYFGLGWLVLRNQALKVYVPTFESYGRMWPHI  619

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
             H R++A+LILYQ+TM GYFG +KF Y PLV+PLPILS +F FVC+KKFY  FQ  ALE  
Sbjct  620   HNRILASLILYQITMFGYFGTQKFYYTPLVLPLPILSLIFGFVCAKKFYPAFQHPALEV-  678

Query  315   SAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSA  181
              A    KEVPNM++IFR++IPP   +EK D+D  EDALSQ SR+A
Sbjct  679   -AANTLKEVPNMELIFRAYIPPSLRSEKIDDDRVEDALSQCSRTA  722



>ref|XP_002300337.1| early-responsive to dehydration stress family protein [Populus 
trichocarpa]
 gb|EEE85142.1| early-responsive to dehydration stress family protein [Populus 
trichocarpa]
Length=724

 Score =   413 bits (1061),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 221/285 (78%), Positives = 249/285 (87%), Gaps = 3/285 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SKAEGIPS  HAVRA SGKYFYFT+LNVFIGVT+G TLF T KSIE+ PNSI+SLLA+SL
Sbjct  440   SKAEGIPSVGHAVRATSGKYFYFTILNVFIGVTLGGTLFTTFKSIEEKPNSIVSLLASSL  499

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+KEAW PGDLGYATR
Sbjct  500   PGNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAELKEAWFPGDLGYATR  559

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGDMLVL I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVY PSFE+YG+MWPH+HT
Sbjct  560   IPGDMLVLTIVLCYSVIAPLIIPFGVVYFGLGWLVLRNQALKVYAPSFETYGRMWPHIHT  619

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             RV+AALIL+Q+TM GYF VKKF ++   +IPLPILS LFA+VC KKFYR F  TALE   
Sbjct  620   RVIAALILFQVTMFGYFVVKKFSFSTFLLIPLPILSLLFAYVCHKKFYRSFSDTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A +E KE+PNM+ I+RSFIPP   +EK+D+DHFEDALSQVSR  S
Sbjct  678   ACRELKEIPNMERIYRSFIPPSLSSEKADDDHFEDALSQVSRVGS  722



>gb|KDO75374.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=590

 Score =   407 bits (1046),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/286 (71%), Positives = 238/286 (83%), Gaps = 2/286 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  306   SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  365

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  366   PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  425

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  426   VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  485

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+ F  TALE   A
Sbjct  486   RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEV--A  543

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
              +E KE P+M+ IFRS+IP    +EK D+D FEDALSQ SRS S V
Sbjct  544   SRELKETPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQASRSGSFV  589



>ref|XP_004134564.1| PREDICTED: CSC1-like protein ERD4 [Cucumis sativus]
 gb|KGN49436.1| hypothetical protein Csa_6G525220 [Cucumis sativus]
Length=725

 Score =   411 bits (1056),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 242/284 (85%), Gaps = 2/284 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIPSE HA RAASGKYFYFTVLNVFIGVT+   LF T KSI+ +PNS++ LLA+SL
Sbjct  442   SKTEGIPSEGHAQRAASGKYFYFTVLNVFIGVTLSGALFRTFKSIQKDPNSLVPLLASSL  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P SATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKK++CK +A++K+AW PGDLGY TR
Sbjct  502   PGSATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKFLCKCEADVKDAWTPGDLGYGTR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGD+L+  I LCYS+I P+I+PFG +YFGLGWL+LRNQ LKVYVPS+E+YG++WPH+  
Sbjct  562   IPGDLLIFTIVLCYSIITPLIVPFGVIYFGLGWLILRNQVLKVYVPSYETYGRIWPHIFN  621

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R++A+L+LYQLTM G+FGVKKF YAP++IPLPI+S +FAF+C KKFYR F +TALE   A
Sbjct  622   RIIASLLLYQLTMFGFFGVKKFYYAPILIPLPIISLIFAFLCHKKFYRSFANTALEV--A  679

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
               + KEVP+M+ +FRSF+PP   +EK D+DHFEDA SQVSR+ S
Sbjct  680   RNDLKEVPSMEQVFRSFVPPSLSSEKVDDDHFEDARSQVSRTGS  723



>gb|KJB66976.1| hypothetical protein B456_010G168400 [Gossypium raimondii]
Length=725

 Score =   410 bits (1055),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 243/285 (85%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SH +RAASGKYFYF+VLNVFIGVTIG TLFDTLKS+E+ PNS++ LLA S
Sbjct  441   LSKIEGIPSGSHVIRAASGKYFYFSVLNVFIGVTIGGTLFDTLKSVEEEPNSLVPLLAKS  500

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFF+TFVALKFFVGYGLELSRIVPLII+HL++KY+CK++AEI+EAW PGD+ YAT
Sbjct  501   LPGNATFFITFVALKFFVGYGLELSRIVPLIIYHLRRKYLCKSEAEIREAWFPGDISYAT  560

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVPS+ESYG+MWPHMH
Sbjct  561   RVPSDMLIITIVLCYSVIAPVIIPFGVLYFALGWLVLRNQALKVYVPSYESYGRMWPHMH  620

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++ AL+LYQ+TM+GYFGV +F Y P++IP PILS LF +VC +KFY  F  TALE   
Sbjct  621   TRIMGALLLYQVTMLGYFGVIQFYYTPILIPAPILSLLFYYVCRRKFYNAFCHTALEV--  678

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A +E KE PNM++IFRS+IPP    EK +++ FE ALS+VSR+ +
Sbjct  679   ASQELKETPNMELIFRSYIPPSLIPEKQEDEQFEGALSRVSRTGT  723



>ref|XP_006448976.1| hypothetical protein CICLE_v100144071mg, partial [Citrus clementina]
 gb|ESR62216.1| hypothetical protein CICLE_v100144071mg, partial [Citrus clementina]
Length=635

 Score =   406 bits (1043),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 236/284 (83%), Gaps = 2/284 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  351   SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  410

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE KEAW PGDLGY TR
Sbjct  411   PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAEQKEAWFPGDLGYGTR  470

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  471   VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLVLRNQALKVYVPAYESYGRMWPHMFL  530

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+ F  TALE   A
Sbjct  531   RLVAALLLYQITMLGYFGSKKFVYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEV--A  588

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
              +E KE P+M+ IFRS+IP    +EK D+D FEDALSQ SRS S
Sbjct  589   SRELKEAPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQASRSGS  632



>ref|XP_010540605.1| PREDICTED: CSC1-like protein ERD4 [Tarenaya hassleriana]
Length=718

 Score =   408 bits (1048),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 241/286 (84%), Gaps = 2/286 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESHA RAASGKYFYF+VLNVFIGVTI  TLFDTLK +E NPNSIIS+LATS
Sbjct  433   LSKAEGIPSESHAQRAASGKYFYFSVLNVFIGVTISGTLFDTLKKVEKNPNSIISILATS  492

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLT+VALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+K+AW PGDL YAT
Sbjct  493   LPRSATFFLTYVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEVKDAWFPGDLSYAT  552

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDMLVL I  CYSVIAP+IIPFG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  553   RVPGDMLVLTITFCYSVIAPLIIPFGVTYFGLGWLILRNQALKVYVPSYESYGQMWPHIH  612

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL+L+Q+TM GY G K F YA LVIPL +++ +FA+VCSKKFY  F+ TALE   
Sbjct  613   TRILAALLLFQVTMFGYLGAKIFVYAVLVIPLIVITLIFAYVCSKKFYLAFKHTALEV--  670

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASN  175
             A +E KE PN++ +FRS++P C    K D+  FE ALS+   + S+
Sbjct  671   ACRELKETPNLEQVFRSYVPTCLSCHKPDDHQFEGALSRCQLTGSS  716



>ref|XP_007147944.1| hypothetical protein PHAVU_006G167700g [Phaseolus vulgaris]
 gb|ESW19938.1| hypothetical protein PHAVU_006G167700g [Phaseolus vulgaris]
Length=728

 Score =   408 bits (1049),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 229/285 (80%), Gaps = 4/285 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIP+ESHAVRAASGKYFYF VLNVFIGVTIG TLF     I+ NP+        + 
Sbjct  444   SKFEGIPTESHAVRAASGKYFYFIVLNVFIGVTIGGTLFKAFNKIQKNPSLSEISSLLAE  503

Query  849   ps--saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
                 +ATFFLT+VALKFFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  504   SLPGNATFFLTYVALKFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             TR PGDML++ I  CYSVIAP+IIPFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+
Sbjct  564   TRVPGDMLIVTIVFCYSVIAPVIIPFGVLYFGLGWLVLRNQALKVYVPSYESYGRMWPHI  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
             H RV+A+LILYQ+TM GYFG +KF Y PLV+PLP LS +F FVC+KKFY  F+  ALE  
Sbjct  624   HNRVLASLILYQITMFGYFGAQKFYYTPLVLPLPFLSLIFGFVCAKKFYPAFEHPALEV-  682

Query  315   SAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSA  181
              A    KE PNM++IFRSFIPP   +EK D+D FEDALS VSR+ 
Sbjct  683   -AANPLKEPPNMELIFRSFIPPSLSSEKIDDDRFEDALSSVSRTT  726



>gb|KJB57185.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=725

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 198/287 (69%), Positives = 240/287 (84%), Gaps = 2/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SH +RAASGKYFYF V NVFIGVTIG TLF ++K+IE+ PNS+  +LA S
Sbjct  441   LSKTEGIPSGSHVIRAASGKYFYFIVFNVFIGVTIGGTLFASIKTIEEKPNSVFDMLAKS  500

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CK +AE++EAW PGD+ YAT
Sbjct  501   LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKNEAELREAWFPGDINYAT  560

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVP++ESYG+MWPHM 
Sbjct  561   RVPSDMLIVTIVLCYSVIAPVIIPFGVLYFALGWLVLRNQALKVYVPAYESYGRMWPHMQ  620

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R+++AL LYQ+TM+GYFGV +F Y P+++PLPILS +F FVC KKFY  F  T LE   
Sbjct  621   IRIISALFLYQVTMLGYFGVMRFYYTPILVPLPILSLVFVFVCRKKFYGAFCHTVLEV--  678

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
             A +E KE P+M+ IF+SFIPP   +EK +++HFEDALSQVSRS S+V
Sbjct  679   ASQELKETPHMEQIFKSFIPPSLISEKQEDEHFEDALSQVSRSESSV  725



>gb|KDO75368.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=726

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 237/284 (83%), Gaps = 2/284 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  442   SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  502   PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  562   VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  621

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+ F  TALE   A
Sbjct  622   RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEV--A  679

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
              +E KE P+M+ IFRS+IP    +EK D+D FEDALSQ SRS S
Sbjct  680   SRELKETPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQASRSGS  723



>gb|KHN06954.1| Putative membrane protein C24H6.13 [Glycine soja]
Length=723

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 204/285 (72%), Positives = 238/285 (84%), Gaps = 4/285 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiisllat  856
             SK EGIP+ESHAVRAASGKYFYFTVLNVFIGVTIG TLF   K I ++P  + I SLLA 
Sbjct  439   SKFEGIPTESHAVRAASGKYFYFTVLNVFIGVTIGGTLFKAFKRIREHPTLDEISSLLAE  498

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             SLP +ATFFLT+VALKFF+GYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  499   SLPGNATFFLTYVALKFFIGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  558

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             TR PGDML++ I  CYSVIAP+IIPFGA+YFGLGWL+LRNQALKVYVP+FESYG+MWPH+
Sbjct  559   TRVPGDMLIVTIVFCYSVIAPVIIPFGALYFGLGWLVLRNQALKVYVPTFESYGRMWPHI  618

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
             H R++A+LILYQ+TM GYFG +KF Y PLV+PLPILS +F FVC+KKFY  FQ  ALE  
Sbjct  619   HNRILASLILYQITMFGYFGTQKFYYTPLVLPLPILSLIFGFVCAKKFYPAFQHPALEV-  677

Query  315   SAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSA  181
              A    KEVPNM++IF ++IPP   +EK D D  EDALSQ SR+ 
Sbjct  678   -AANTLKEVPNMELIFGAYIPPSLRSEKIDGDRVEDALSQASRTT  721



>ref|XP_003546071.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine 
max]
Length=723

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 204/285 (72%), Positives = 238/285 (84%), Gaps = 4/285 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiisllat  856
             SK EGIP+ESHAVRAASGKYFYFTVLNVFIGVTIG TLF   K I ++P  + I SLLA 
Sbjct  439   SKFEGIPTESHAVRAASGKYFYFTVLNVFIGVTIGGTLFKAFKRIREHPTLDEISSLLAE  498

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             SLP +ATFFLT+VALKFF+GYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  499   SLPGNATFFLTYVALKFFIGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  558

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             TR PGDML++ I  CYSVIAP+IIPFGA+YFGLGWL+LRNQALKVYVP+FESYG+MWPH+
Sbjct  559   TRVPGDMLIVTIVFCYSVIAPVIIPFGALYFGLGWLVLRNQALKVYVPTFESYGRMWPHI  618

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
             H R++A+LILYQ+TM GYFG +KF Y PLV+PLPILS +F FVC+KKFY  FQ  ALE  
Sbjct  619   HNRILASLILYQITMFGYFGTQKFYYTPLVLPLPILSLVFGFVCAKKFYPAFQHPALEV-  677

Query  315   SAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSA  181
              A    KEVPNM++IF ++IPP   +EK D D  EDALSQ SR+ 
Sbjct  678   -AANTLKEVPNMELIFGAYIPPSLRSEKIDGDRVEDALSQASRTT  721



>ref|XP_010052016.1| PREDICTED: CSC1-like protein ERD4 [Eucalyptus grandis]
Length=725

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/281 (71%), Positives = 239/281 (85%), Gaps = 2/281 (1%)
 Frame = -3

Query  1020  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatslpss  841
             EGIPS+SH  RAASGKYFYFTVLNVFIGVT+G TLF T K IE +PNS++++LA SLP +
Sbjct  445   EGIPSQSHIERAASGKYFYFTVLNVFIGVTVGGTLFATFKEIEKDPNSLLTVLAASLPGN  504

Query  840   aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPG  661
             ATFFLT+VAL+FFVGYGLELSRIVPLIIFHLK+KY+CKT+AE+KEAW PGDL YATR PG
Sbjct  505   ATFFLTYVALQFFVGYGLELSRIVPLIIFHLKRKYLCKTEAEVKEAWFPGDLKYATRVPG  564

Query  660   DMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVV  481
             DML++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVYVPS+ESYG+MWPHMH R++
Sbjct  565   DMLIVTITLCYSVIAPLIIPFGVVYFGLGWLILRNQALKVYVPSYESYGRMWPHMHLRIL  624

Query  480   AALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSAGKE  301
             AAL+LYQLTM+ YFG KKF +AP ++PL I S +FA+VC+KKFYRFF   ALE   A  E
Sbjct  625   AALVLYQLTMLAYFGAKKFVFAPFLVPLIISSLIFAYVCNKKFYRFFCCPALEV--ASHE  682

Query  300   KKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
              KE  +M+ IFR+++PP   +EK ++D FEDALS VSR+ S
Sbjct  683   LKETLHMERIFRTYVPPSLCSEKVEDDRFEDALSHVSRAGS  723



>ref|XP_006468078.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
Length=726

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 237/284 (83%), Gaps = 2/284 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  442   SKIEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  502   PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  562   VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  621

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+ F  TALE   A
Sbjct  622   RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEV--A  679

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
              +E KE P+M+ IFRS+IP    +EK D+D FEDALSQ SRS S
Sbjct  680   SRELKETPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQASRSGS  723



>ref|XP_010687100.1| PREDICTED: CSC1-like protein ERD4 [Beta vulgaris subsp. vulgaris]
Length=709

 Score =   404 bits (1038),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/276 (71%), Positives = 235/276 (85%), Gaps = 2/276 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPSESHAVRAASGKYFYFTVLN F+GVT+G TLF   K +E +PN I+++L   
Sbjct  436   LSKEEGIPSESHAVRAASGKYFYFTVLNAFLGVTLGGTLFGNFKEMEKDPNKIVNILGKD  495

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSR+VPLI+FH+KKKY+CKT+A++KEAWAPGD GYAT
Sbjct  496   LPDNATFFLTFVALKFFVGYGLELSRLVPLIMFHVKKKYLCKTEAQVKEAWAPGDFGYAT  555

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P D+L+L I +CYS+IAP+I+PFGA+YFGLGWL++RNQALKVYVPSFESYG+MWPH+H
Sbjct  556   RVPSDLLILTITICYSIIAPLILPFGAIYFGLGWLVMRNQALKVYVPSFESYGRMWPHLH  615

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR VAAL+LYQ+TMIGYFGVK+F Y  L+IPLPI+S +FA+VCSKKFYRFFQ  ALE   
Sbjct  616   TRFVAALVLYQVTMIGYFGVKQFIYGVLLIPLPIISLIFAWVCSKKFYRFFQHPALEV--  673

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDA  205
             A  + KE PN + ++ SF+PPC  T+K D D + DA
Sbjct  674   ACHQLKETPNFERVYISFLPPCLSTDKLDVDQYGDA  709



>ref|XP_011014082.1| PREDICTED: CSC1-like protein ERD4 [Populus euphratica]
Length=724

 Score =   403 bits (1036),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 218/285 (76%), Positives = 246/285 (86%), Gaps = 3/285 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SKAEGIPS  HAVRA SGKYFYF +LNVFIGVT+G TLF T KSIE  PNSI+SLLA+SL
Sbjct  440   SKAEGIPSVGHAVRATSGKYFYFIILNVFIGVTLGGTLFSTFKSIEKEPNSIVSLLASSL  499

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+KEAW PGDLGYATR
Sbjct  500   PGNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAELKEAWFPGDLGYATR  559

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGDMLV+ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVY PSFE+YG+MWPH+HT
Sbjct  560   IPGDMLVITIVLCYSVIAPLIIPFGVVYFGLGWLVLRNQALKVYAPSFETYGRMWPHIHT  619

Query  489   RVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             R +AAL+LYQ+TM GYFGVKKF + + L+IPLPILS LFA VC KKFYR F  TALE   
Sbjct  620   RFIAALVLYQVTMFGYFGVKKFSFRSLLLIPLPILSLLFANVCRKKFYRSFSDTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A +E KE+PNM+ I+ SFIPP   +EK+D+DHFED LSQVSR+ S
Sbjct  678   ACRELKEIPNMERIYGSFIPPNLSSEKADDDHFEDCLSQVSRAGS  722



>ref|XP_010275905.1| PREDICTED: CSC1-like protein ERD4 [Nelumbo nucifera]
 ref|XP_010275906.1| PREDICTED: CSC1-like protein ERD4 [Nelumbo nucifera]
Length=722

 Score =   403 bits (1035),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 198/280 (71%), Positives = 240/280 (86%), Gaps = 3/280 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESHAVRAASGKYF FTVLNVFIGVT+G TLF   +++E +PNSI ++L   
Sbjct  436   LSKAEGIPSESHAVRAASGKYFCFTVLNVFIGVTVGGTLFSASETLEKDPNSIANMLGVG  495

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSR+VPLII++LK+K++CKT+AE KEAWAPGDLGYAT
Sbjct  496   LPRNATFFLTFVALKFFVGYGLELSRLVPLIIYYLKRKFLCKTEAEFKEAWAPGDLGYAT  555

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I +CYSVI PIIIPFG  YF LGWL++RNQALKVYVPS+ESYG+MWPHMH
Sbjct  556   RVPNDMLIITIVICYSVITPIIIPFGMAYFSLGWLIVRNQALKVYVPSYESYGRMWPHMH  615

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             +R++AALI+YQ+TM+GYFGVK FP+ PL+IPLP+LS +FAFVCSKKFY+ F+ T LE   
Sbjct  616   SRILAALIVYQITMLGYFGVKIFPFTPLLIPLPVLSLVFAFVCSKKFYKSFRYTPLEV--  673

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSD-EDHFEDALSQ  196
             A  E KE+PNM+ IFR +IPPC  ++K + ++HFEDA S 
Sbjct  674   ACLELKEMPNMETIFREYIPPCLRSDKFEIDEHFEDARSS  713



>ref|XP_004485983.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Cicer 
arietinum]
Length=722

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 214/287 (75%), Positives = 249/287 (87%), Gaps = 2/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIP+ESH VRAASGKYFYFTVLNVFIGVT+G TLF T K+I++ P  I+SLLA S
Sbjct  438   LSKLEGIPTESHVVRAASGKYFYFTVLNVFIGVTLGGTLFSTFKTIQNEPKQIVSLLAES  497

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFFVGYGLELSR+VPLI++HLKKKY+CKT+AE+KEAWAPGDLGYAT
Sbjct  498   LPGNATFFLTYVALKFFVGYGLELSRLVPLIMYHLKKKYLCKTEAELKEAWAPGDLGYAT  557

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFGAVYFGLGWL+LRNQALKVYVPS+ESYG+MWPH++
Sbjct  558   RIPSDMLIVTIVLCYSVIAPLIIPFGAVYFGLGWLVLRNQALKVYVPSYESYGRMWPHIN  617

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R++A+LILYQ+TM GYFGV+KF YAPL+IPLPILS LF FV +KKFY  FQ  ALE  +
Sbjct  618   NRILASLILYQITMFGYFGVQKFYYAPLLIPLPILSLLFGFVSAKKFYPAFQHPALEIAA  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
              G   KEVPNM++IFRSFIPP   +EK ++D FEDA SQVSRS S V
Sbjct  678   PG--LKEVPNMELIFRSFIPPSLSSEKVEDDQFEDARSQVSRSTSFV  722



>gb|KHG13189.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=725

 Score =   400 bits (1029),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 194/287 (68%), Positives = 237/287 (83%), Gaps = 2/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIP  SH +RAASGKYFYF V NVFIGVTIG TL  ++K+IE+ PNS+  +LA S
Sbjct  441   LSKTEGIPGGSHVIRAASGKYFYFIVFNVFIGVTIGGTLIASIKTIEEKPNSVFDMLAKS  500

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CK +AE++EAW PGD+ Y T
Sbjct  501   LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKNEAELREAWFPGDINYVT  560

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVP++ESYG+MWPHM 
Sbjct  561   RVPSDMLIVTIVLCYSVIAPVIIPFGVLYFALGWLVLRNQALKVYVPAYESYGRMWPHMQ  620

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR+++AL LYQ+TM+GYFGV +F Y P+++PLPILS +F  VC KKFY  F  T LE   
Sbjct  621   TRIISALFLYQVTMLGYFGVMRFYYTPILVPLPILSLVFVIVCRKKFYGAFCHTVLEV--  678

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
             A +E KE P+M+ IF+SFIPP   ++K +++HFEDALSQVSRS S+V
Sbjct  679   ASQELKETPHMEQIFKSFIPPSLISDKQEDEHFEDALSQVSRSESSV  725



>ref|XP_008784823.1| PREDICTED: CSC1-like protein ERD4 [Phoenix dactylifera]
Length=723

 Score =   398 bits (1022),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 199/286 (70%), Positives = 239/286 (84%), Gaps = 3/286 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESHAVRAASGKYFYF + NVF+GVTIG  LF +LK+I D+P  I+S+L TS
Sbjct  439   LSKAEGIPSESHAVRAASGKYFYFIIFNVFLGVTIGGALFSSLKTIIDHPKQIVSMLGTS  498

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP+SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+K++CKT+AE+KEAWAPGD GYAT
Sbjct  499   LPASATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKFLCKTEAEVKEAWAPGDFGYAT  558

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ + LCYSVIAP+IIPFG VYF LGWL+ RNQALKVYVP +ES G+MWPHMH
Sbjct  559   RVPNDMLIVTVVLCYSVIAPLIIPFGVVYFALGWLIARNQALKVYVPKYESNGRMWPHMH  618

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             +R++AALI+YQ+TM G+FG+KKF YAP ++PL ILSF+FAFVC K+FY  F  T LE   
Sbjct  619   SRILAALIIYQVTMFGFFGLKKFIYAPFMLPLIILSFIFAFVCKKRFYLAFYYTPLEV--  676

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSAS  178
             A ++ KE+PN++ I+  +IPPC   EK  D D FEDA S  SR+AS
Sbjct  677   ASRDLKEIPNLESIYAGYIPPCLRPEKLEDVDQFEDAQSHTSRTAS  722



>gb|EYU19153.1| hypothetical protein MIMGU_mgv1a001965mg [Erythranthe guttata]
Length=733

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/290 (70%), Positives = 245/290 (84%), Gaps = 5/290 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPSESHA RAASGKYFYF+VLNVFIGVTIGSTLF T K IE++PNSI+ LLA S
Sbjct  446   LSKQEGIPSESHAQRAASGKYFYFSVLNVFIGVTIGSTLFTTFKEIEEHPNSIVDLLAKS  505

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYG+ELSRI+PL+++HL+KKY+CK++ E++EAWAPGDLGYAT
Sbjct  506   LPGSATFFLTFVALKFFVGYGIELSRIIPLLVYHLQKKYVCKSENELREAWAPGDLGYAT  565

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQ LKVYVP +ESYG+ WPHM+
Sbjct  566   RIPGDMLIVTIVLCYSVIAPLIIPFGIVYFGLGWLVLRNQVLKVYVPKYESYGRTWPHMY  625

Query  492   TRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
              R++A+L+LYQ+TM+GYF  KKF   APLVI LPI S +F  VC++KFYR F  T L+  
Sbjct  626   IRIMASLMLYQVTMLGYFSAKKFVKGAPLVILLPIFSIIFILVCNEKFYRSFAFTPLDV-  684

Query  315   SAGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFED-ALSQVSRSASNV  172
              A +E KE PNM++IF+S++PPC  ++K  DED FED ALSQV+++ S V
Sbjct  685   -ACRELKETPNMEVIFKSYVPPCLHSDKGDDEDQFEDHALSQVTKTGSAV  733



>gb|KCW75872.1| hypothetical protein EUGRSUZ_D00261 [Eucalyptus grandis]
 gb|KCW75873.1| hypothetical protein EUGRSUZ_D00261 [Eucalyptus grandis]
Length=718

 Score =   395 bits (1016),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/276 (71%), Positives = 235/276 (85%), Gaps = 2/276 (1%)
 Frame = -3

Query  1020  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatslpss  841
             EGIPS+SH  RAASGKYFYFTVLNVFIGVT+G TLF T K IE +PNS++++LA SLP +
Sbjct  445   EGIPSQSHIERAASGKYFYFTVLNVFIGVTVGGTLFATFKEIEKDPNSLLTVLAASLPGN  504

Query  840   aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPG  661
             ATFFLT+VAL+FFVGYGLELSRIVPLIIFHLK+KY+CKT+AE+KEAW PGDL YATR PG
Sbjct  505   ATFFLTYVALQFFVGYGLELSRIVPLIIFHLKRKYLCKTEAEVKEAWFPGDLKYATRVPG  564

Query  660   DMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVV  481
             DML++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H R++
Sbjct  565   DMLIVTITLCYSVIAPLIIPFGVVYFGLGWLILRNQALKVYVPSYESYGRMWPHIHLRIL  624

Query  480   AALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSAGKE  301
             A+L+LYQLTM+ YFG KKF YAPL++PL I S +FA+VC+KKFYR F   ALE   A  E
Sbjct  625   ASLVLYQLTMLAYFGTKKFYYAPLLLPLVISSLIFAYVCNKKFYRSFCCPALEV--ASHE  682

Query  300   KKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQV  193
              KE  +M+ IFR+++PP   +EK ++D  EDALS+V
Sbjct  683   LKETLDMERIFRAYVPPSLCSEKVEDDRIEDALSRV  718



>ref|XP_008371649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Malus 
domestica]
Length=725

 Score =   395 bits (1014),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 204/287 (71%), Positives = 246/287 (86%), Gaps = 2/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SHAVRA+SGKYFYFTV NVFIGVT+G TLF T K+IE +PNSI+ LLATS
Sbjct  440   LSKTEGIPSLSHAVRASSGKYFYFTVFNVFIGVTVGGTLFSTFKTIEKDPNSIVDLLATS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP++AT+FLTFVALKFFVGYGLEL R+VPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500   LPANATYFLTFVALKFFVGYGLELFRLVPLIIFHIKRKYVCKTEAEVKAAWFPSDLGYGT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML++ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+ 
Sbjct  560   RVPGDMLIITIVLCYSVIAPLILPFGVLYFGLGWLVLRNQALKVYVPSYESYGRMWPHIQ  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R++A+LILYQ+TM GYFGVKKF YAP ++PLPILS L+ F+CSKKFY FFQ TALE   
Sbjct  620   VRLIASLILYQVTMFGYFGVKKFVYAPFLLPLPILSLLYIFICSKKFYHFFQHTALEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
             A  E KE+PNM+ ++R+FIPP   +EK + D FEDA S VSR+A+++
Sbjct  678   AAHELKEIPNMEQVYRAFIPPSLSSEKLNHDQFEDAQSNVSRTAASL  724



>gb|EPS64315.1| hypothetical protein M569_10465, partial [Genlisea aurea]
Length=717

 Score =   392 bits (1007),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 204/281 (73%), Positives = 231/281 (82%), Gaps = 2/281 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGI SESHA RAASGKYFYFT+LNVFIGVTIGSTLF  LK+IE +PNS I+LLATS
Sbjct  439   LSKAEGITSESHAQRAASGKYFYFTILNVFIGVTIGSTLFTALKTIEKSPNSAITLLATS  498

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AEIKEAWAPGDLGYAT
Sbjct  499   LPESATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEIKEAWAPGDLGYAT  558

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ + LCYSVIAP+IIPFG  YFGLGWL    Q LKVYVPS+ESYG+ WPH+ 
Sbjct  559   RIPNDMLIVTVVLCYSVIAPLIIPFGVAYFGLGWLSFIPQVLKVYVPSYESYGRAWPHLF  618

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
              R+VA+LILYQ+TM GYF +KKF  A  +IPLPILS +F  VC+KKFYRFFQ+TAL+   
Sbjct  619   IRIVASLILYQVTMFGYFALKKFYSAVFLIPLPILSIIFISVCNKKFYRFFQTTALDV--  676

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVS  190
             A    KE P++  +FRSF+PP    EK +ED  E ALS  S
Sbjct  677   ASHPLKETPDLKTVFRSFVPPSLKCEKREEDELEYALSSSS  717



>ref|XP_010052015.1| PREDICTED: CSC1-like protein ERD4 [Eucalyptus grandis]
 gb|KCW75874.1| hypothetical protein EUGRSUZ_D00261 [Eucalyptus grandis]
Length=718

 Score =   390 bits (1001),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 192/276 (70%), Positives = 233/276 (84%), Gaps = 2/276 (1%)
 Frame = -3

Query  1020  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatslpss  841
             EGIPS+SH  RAASGKYFYFT LNVFIGVT+G TLF T K IE +PNS++++LA SLP +
Sbjct  445   EGIPSQSHIERAASGKYFYFTSLNVFIGVTVGGTLFATFKKIEKDPNSLLTILAASLPDN  504

Query  840   aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPG  661
             ATFFLTFVAL+ F+GYGLELSRIVPLIIFHLK+KY+CKT+AE+KEAW PGD GYATR PG
Sbjct  505   ATFFLTFVALRSFIGYGLELSRIVPLIIFHLKRKYLCKTEAEVKEAWYPGDQGYATRVPG  564

Query  660   DMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVV  481
             D+L++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H R++
Sbjct  565   DLLIVTITLCYSVIAPLIIPFGVVYFGLGWLILRNQALKVYVPSYESYGRMWPHIHLRIL  624

Query  480   AALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSAGKE  301
             A+L+LYQLTM+ YFG KKF YAPL++PL I S +FA+VC+KKFYR F   ALE   A  E
Sbjct  625   ASLVLYQLTMLAYFGTKKFYYAPLLLPLVISSLIFAYVCNKKFYRSFCCPALEV--ASHE  682

Query  300   KKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQV  193
              KE  +M+ IFR+++PP   +EK ++D  EDALS+V
Sbjct  683   LKETLDMERIFRAYVPPSLCSEKVEDDRIEDALSRV  718



>ref|XP_009398321.1| PREDICTED: CSC1-like protein ERD4 [Musa acuminata subsp. malaccensis]
Length=724

 Score =   388 bits (997),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 195/280 (70%), Positives = 234/280 (84%), Gaps = 4/280 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPSESHAVRAASGKYFYF V NVF+GVTIG  LFD+LK+I ++P  +I+LL +S
Sbjct  440   LSKEEGIPSESHAVRAASGKYFYFVVFNVFLGVTIGGALFDSLKTIINHPTQVITLLGSS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLKK+++CKT+AE+KEAWAPGD GYAT
Sbjct  500   LPKSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKKRFLCKTEAEVKEAWAPGDFGYAT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAPIIIPFG VYFGLGWL+ RNQALKVYVP++ES G+MWPH+H
Sbjct  560   RVPSDMLIITIVLCYSVIAPIIIPFGVVYFGLGWLVARNQALKVYVPNYESNGRMWPHLH  619

Query  492   TRVVAALILYQLTMIGYFGV-KKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
              R++A+LILYQ+TM GY G+ +KF YAP +IP+ ++SF+FA+VC K FY  F  T LE  
Sbjct  620   ARIIASLILYQITMFGYIGILRKFYYAPFLIPVIVISFVFAYVCKKHFYLAFFHTPLEVA  679

Query  315   SAGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALS  199
               G   KE+PNM+ I+ ++IPPC GTEK  D+D FEDA S
Sbjct  680   CRG--TKEIPNMESIYTAYIPPCLGTEKLEDDDQFEDARS  717



>ref|XP_009408546.1| PREDICTED: CSC1-like protein ERD4 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   388 bits (996),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 198/287 (69%), Positives = 233/287 (81%), Gaps = 4/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPSESHAVRAASGKYFYF V NVF+GVTIG TL+ +LK I   P+ II+LL +S
Sbjct  440   LSKEEGIPSESHAVRAASGKYFYFIVFNVFLGVTIGGTLYGSLKEIIKKPSQIITLLGSS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLT+VALKFFVGYGLELSR+VPLIIFHLKKKY+CKT+AE+KEAWAP D GYAT
Sbjct  500   LPKSATFFLTYVALKFFVGYGLELSRLVPLIIFHLKKKYLCKTEAEVKEAWAPSDFGYAT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             RFP DML++ I LCYSVIAPIIIPFG VYFGLGWL+ RNQALKVYVP +ES G+MWPHMH
Sbjct  560   RFPNDMLIVTIVLCYSVIAPIIIPFGVVYFGLGWLVARNQALKVYVPRYESNGRMWPHMH  619

Query  492   TRVVAALILYQLTMIGYFGV-KKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
              R+VAALI+YQ+TM+GY G+ +KF YAP +IP+  +SF+FA+VC ++FY  F  T LE  
Sbjct  620   ARIVAALIVYQITMLGYIGILRKFYYAPFLIPVIAISFIFAYVCKQRFYLAFFHTPLEVA  679

Query  315   SAGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSAS  178
               G   KE+PNM+ I+ ++IPPC  TEK  D D FEDA S   R+ S
Sbjct  680   CEG--TKEIPNMESIYAAYIPPCLSTEKLHDADQFEDAHSHSLRTTS  724



>ref|XP_010687078.1| PREDICTED: CSC1-like protein ERD4 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=640

 Score =   384 bits (987),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 189/275 (69%), Positives = 226/275 (82%), Gaps = 2/275 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPSESHAVR+ASGKYFYF V N FIGVT+G TLF  LK +E++PN I  LL   
Sbjct  367   LSKLEGIPSESHAVRSASGKYFYFIVFNAFIGVTLGGTLFGNLKDMEEHPNEIAELLGKG  426

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVAL+ FVGYGLELSR+VPLI+F+LKKKY+CKT+AE+KEAWAPGD  YAT
Sbjct  427   LPDNATFFLTFVALRCFVGYGLELSRLVPLIMFYLKKKYLCKTEAEVKEAWAPGDFRYAT  486

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P D+L+L I LCYSVIAP+I+PFG +YFGLGWL++RNQALKVYVPSFESYG+MWPH+H
Sbjct  487   RIPADLLILTITLCYSVIAPLILPFGIIYFGLGWLVMRNQALKVYVPSFESYGRMWPHLH  546

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR +AAL+LYQ+TM+GYFGVK+F Y   +IPLPI+S +FA+VC+KKFYRFFQ  ALE   
Sbjct  547   TRFLAALVLYQVTMLGYFGVKEFIYTVTLIPLPIISLIFAWVCNKKFYRFFQHPALEV--  604

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFED  208
             A +E KE PN+  ++ SF+PP    E  D D  ED
Sbjct  605   ACQELKETPNLKCVYMSFLPPSLSYEMLDVDQCED  639



>ref|XP_010687077.1| PREDICTED: CSC1-like protein ERD4 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=709

 Score =   385 bits (989),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 189/275 (69%), Positives = 226/275 (82%), Gaps = 2/275 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPSESHAVR+ASGKYFYF V N FIGVT+G TLF  LK +E++PN I  LL   
Sbjct  436   LSKLEGIPSESHAVRSASGKYFYFIVFNAFIGVTLGGTLFGNLKDMEEHPNEIAELLGKG  495

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVAL+ FVGYGLELSR+VPLI+F+LKKKY+CKT+AE+KEAWAPGD  YAT
Sbjct  496   LPDNATFFLTFVALRCFVGYGLELSRLVPLIMFYLKKKYLCKTEAEVKEAWAPGDFRYAT  555

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P D+L+L I LCYSVIAP+I+PFG +YFGLGWL++RNQALKVYVPSFESYG+MWPH+H
Sbjct  556   RIPADLLILTITLCYSVIAPLILPFGIIYFGLGWLVMRNQALKVYVPSFESYGRMWPHLH  615

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR +AAL+LYQ+TM+GYFGVK+F Y   +IPLPI+S +FA+VC+KKFYRFFQ  ALE   
Sbjct  616   TRFLAALVLYQVTMLGYFGVKEFIYTVTLIPLPIISLIFAWVCNKKFYRFFQHPALEV--  673

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFED  208
             A +E KE PN+  ++ SF+PP    E  D D  ED
Sbjct  674   ACQELKETPNLKCVYMSFLPPSLSYEMLDVDQCED  708



>ref|XP_010907974.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein ERD4 [Elaeis 
guineensis]
Length=724

 Score =   385 bits (990),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/287 (68%), Positives = 236/287 (82%), Gaps = 4/287 (1%)
 Frame = -3

Query  1032  LSKAEG-IPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllat  856
             LSKAEG IPSESHAVRAASGKYFYF + NVF+GVTI  TLF +LK I  +P  I+ LL T
Sbjct  439   LSKAEGGIPSESHAVRAASGKYFYFIIFNVFLGVTITGTLFTSLKKIIGHPGEIVRLLGT  498

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             +LP +ATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+K++CKT+AE+KEAWAPGD GY 
Sbjct  499   NLPGNATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKFLCKTEAEVKEAWAPGDFGYN  558

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             TR P DML++ I LCYSVIAP+IIPFG VYF LGWL+ RNQALKVYVP++ES G+MWPHM
Sbjct  559   TRVPNDMLIITIVLCYSVIAPLIIPFGVVYFALGWLVARNQALKVYVPNYESNGRMWPHM  618

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
             H+R++AALI+YQ+TM G+F +K+F YAP ++PL I SF+FAFVC ++FY  F  T LE  
Sbjct  619   HSRILAALIIYQVTMFGFFALKEFYYAPFMLPLIISSFIFAFVCKQRFYLAFYHTPLEV-  677

Query  315   SAGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSAS  178
              A ++ KE+PN++ +F ++IPPC G EK  D D FEDA SQ SR+AS
Sbjct  678   -ASRDLKEIPNLESVFAAYIPPCLGPEKLEDVDQFEDAQSQTSRTAS  723



>gb|KHG16289.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   382 bits (981),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 242/285 (85%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             + + EGIPS SH +RAASGKYFYF+VLNVFIGVTIG TLFDTLKS+E+ PNS++ LLA S
Sbjct  365   VDQIEGIPSGSHVIRAASGKYFYFSVLNVFIGVTIGGTLFDTLKSVEEEPNSLVPLLAKS  424

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFF+TFVALKFFVGYGLELSR+ PLII+HL++KY+CK++AEI+EAW PGD+ YAT
Sbjct  425   LPGNATFFITFVALKFFVGYGLELSRLFPLIIYHLRRKYLCKSEAEIREAWFPGDISYAT  484

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVPS+ESYG+MWPHMH
Sbjct  485   RVPSDMLIITIVLCYSVIAPVIIPFGVLYFALGWLVLRNQALKVYVPSYESYGRMWPHMH  544

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++ AL+LYQ+TM+GYFGV +F Y P++IPLPILS LF +VC +KFY  F  TALE   
Sbjct  545   TRIMGALLLYQVTMLGYFGVIQFYYTPILIPLPILSLLFYYVCRRKFYNAFCHTALEV--  602

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A +E KE PNM++IFRS+IPP    EK +++ FE ALS+VSR+ S
Sbjct  603   ASQELKETPNMELIFRSYIPPSLIPEKQEDEQFEGALSRVSRTGS  647



>gb|AAL47004.1|AF448811_1 unknown [Davidia involucrata]
Length=226

 Score =   367 bits (942),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 197/221 (89%), Gaps = 2/221 (1%)
 Frame = -3

Query  834  FFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPGDM  655
            FFLT+VALKFFVGYGLELSRIVPLII+HLK+KY+CKT AE+KEAW+PGDLGYATRFPGDM
Sbjct  8    FFLTYVALKFFVGYGLELSRIVPLIIYHLKRKYLCKTQAELKEAWSPGDLGYATRFPGDM  67

Query  654  LVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVAA  475
            L++ I LCYSVIAPII+PFG +YFGLGWL+LRNQ LKVYVPS+ESYG+MWPHMHTR++AA
Sbjct  68   LIITIVLCYSVIAPIIVPFGVLYFGLGWLVLRNQVLKVYVPSYESYGRMWPHMHTRILAA  127

Query  474  LILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSAGKEKK  295
            L+LYQ+TM GYFGVKKF Y P++IPLPILS +FAFVC KKFY FFQ+TALE   A +E K
Sbjct  128  LLLYQVTMFGYFGVKKFYYVPILIPLPILSLIFAFVCKKKFYHFFQATALEV--ACREMK  185

Query  294  EVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
            E PNM+++FRSFIPP    EKSD+D FEDA SQVSR+AS V
Sbjct  186  ETPNMELVFRSFIPPSLSAEKSDDDQFEDAKSQVSRAASFV  226



>emb|CDY67965.1| BnaCnng57110D, partial [Brassica napus]
Length=487

 Score =   375 bits (963),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 187/285 (66%), Positives = 233/285 (82%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS SHAVRAASGKYFYF+VLNVFIGVT+  +LFD LK++E  PNSI+++LATS
Sbjct  201   LSKSEGIPSRSHAVRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALEQKPNSIVTVLATS  260

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+ KT+AE+KEAW PGDL YAT
Sbjct  261   LPKNATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLYKTEAEVKEAWYPGDLSYAT  320

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  321   RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  380

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+Q+ M GY GVK F +A L++PL ++S +F +VC +KFY  FQ TALE   
Sbjct  381   TRILAALFLFQVVMFGYLGVKLFVWATLLVPLIVISLIFGYVCRRKFYLGFQHTALEV--  438

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A +E K+ P+ + IFRSFIP    T K ++  F+ A+S+    A+
Sbjct  439   ACRELKQSPDHEEIFRSFIPHSLSTHKPEDHQFKGAMSRYQDYAA  483



>gb|KDO75367.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=730

 Score =   379 bits (974),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 190/273 (70%), Positives = 226/273 (83%), Gaps = 3/273 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  442   SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  502   PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  562   VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  621

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+ F  TALE   A
Sbjct  622   RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEV--A  679

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHF  214
              +E KE P+M+ IFRS+IP    +EK   +DH 
Sbjct  680   SRELKETPSMEHIFRSYIPLSLNSEKLPGQDHL  712



>ref|XP_004293515.1| PREDICTED: CSC1-like protein ERD4 [Fragaria vesca subsp. vesca]
Length=726

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 239/286 (84%), Gaps = 4/286 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SKAEGIPS+SHA+RAA+GKYFYF V NVF+GVT+G  LF T K IED+PN ++ LLATSL
Sbjct  441   SKAEGIPSQSHAIRAAAGKYFYFIVFNVFLGVTVGGALFSTFKEIEDDPNKLVPLLATSL  500

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P SAT+F+TFVALKFFVGYGLELSRIVPLIIFHLK+KY+CKT+ E+K AW P DLGY TR
Sbjct  501   PGSATYFITFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTEGELKAAWQPSDLGYGTR  560

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGDML++ + LCYSVIAP+I+PFG +YFG+GWL+LRNQALKVY P++ES GK WPHM  
Sbjct  561   VPGDMLIITVALCYSVIAPLILPFGVLYFGIGWLVLRNQALKVYCPAYESNGKFWPHMQL  620

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R++AALILYQ+TM+G+ GVKKF YAPL+IPLPILS +F ++CSKKFYRFFQ TALE   A
Sbjct  621   RILAALILYQVTMVGFLGVKKFVYAPLLIPLPILSLIFGYICSKKFYRFFQDTALEV--A  678

Query  309   GKEKKEVPNMDIIFRSFIPP--CFGTEKSDEDHFEDALSQVSRSAS  178
               E KE+PNM+ I+++++P   C G    D+D FEDA S VSR+AS
Sbjct  679   SHELKEIPNMEQIYKAYLPQSLCSGKVLLDDDQFEDAKSNVSRTAS  724



>emb|CDY12050.1| BnaC03g59660D [Brassica napus]
Length=723

 Score =   379 bits (972),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/279 (66%), Positives = 234/279 (84%), Gaps = 2/279 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS+SHA+RAASGKYFYF+VLNVFIGVT+  +LFD LK++E  PNSII++LA+S
Sbjct  437   LSKSEGIPSQSHAIRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALEKKPNSIITVLASS  496

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  497   LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  556

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557   RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+QL M GY GVK F +A L++PL  +S +F +VC +KFY+ F+ TALE   
Sbjct  617   TRILAALFLFQLVMFGYLGVKLFVWATLLVPLIFISLIFGYVCRQKFYKGFEHTALEV--  674

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
             A +E K+ P+++ +F+++IP    T K D+  F+ A+S+
Sbjct  675   ACRELKQRPDLEEVFKAYIPHSLSTHKGDDHQFKGAMSR  713



>ref|NP_001288888.1| CSC1-like protein ERD4 [Brassica rapa]
 gb|ABV89652.1| early-responsive to dehydration 4 [Brassica rapa]
Length=678

 Score =   376 bits (966),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/279 (65%), Positives = 232/279 (83%), Gaps = 2/279 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS+SHA+RAASGKYFYF+VLNVFIGVT+  +LFD LK++E  PNSI+++LATS
Sbjct  392   LSKSEGIPSQSHAIRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALETKPNSIVTVLATS  451

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  452   LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  511

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  512   RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  571

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+QL M GY G K F +A L++PL  +S +F +VC +KFY+ F+ TALE   
Sbjct  572   TRILAALFLFQLVMFGYLGAKLFVWATLLVPLIFISLIFGYVCRQKFYKGFEHTALEVAC  631

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
              G +++  P+++ +FR++IP    T K D+  F+ A+S+
Sbjct  632   RGLKQR--PDLEEVFRAYIPHSLSTHKGDDHQFKGAMSR  668



>ref|XP_006415482.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
 gb|ESQ33835.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
Length=584

 Score =   373 bits (957),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 235/285 (82%), Gaps = 2/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPS SHA+RAASGKYFYF+VLNVF+GVT+  +LFD LK++E  PNSI+++LATS
Sbjct  298   LSKAEGIPSVSHAIRAASGKYFYFSVLNVFLGVTLAGSLFDNLKALEKKPNSIVTVLATS  357

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y T
Sbjct  358   LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYGT  417

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML+L I  CYSVIAP+I+ F  +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  418   RVPGDMLILTITFCYSVIAPVILVFAVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  477

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+Q+ M G+ GVK+F +A LV+PL  +S +F +VC +KFY+ FQ TA+E   
Sbjct  478   TRILAALFLFQVLMFGFLGVKEFIWAILVVPLIAISLVFGYVCRQKFYKGFQHTAVEV--  535

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
             A +E K+ P+++ IFRS+IP    + K ++  F+ A+S+    A+
Sbjct  536   ACRELKQSPDLEEIFRSYIPHSLSSHKPEDHQFKGAMSRYQDYAA  580



>emb|CDX90246.1| BnaA08g17380D [Brassica napus]
Length=723

 Score =   377 bits (967),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 182/279 (65%), Positives = 232/279 (83%), Gaps = 2/279 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS+SHA+RAASGKYFYF+VLNVFIGVT+  +LFD LK++E  PNSI+++LATS
Sbjct  437   LSKSEGIPSQSHAIRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALETKPNSIVTVLATS  496

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  497   LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  556

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557   RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+QL M GY G K F +A L++PL  +S +F +VC +KFY+ F+ TALE   
Sbjct  617   TRILAALFLFQLVMFGYLGAKLFVWATLLVPLIFISLIFGYVCRQKFYKGFEHTALEVAC  676

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
              G +++  P+++ +FR++IP    T K D+  F+ A+S+
Sbjct  677   RGLKQR--PDLEEVFRAYIPHSLSTHKGDDHQFKGAMSR  713



>ref|XP_009377479.1| PREDICTED: CSC1-like protein ERD4 [Pyrus x bretschneideri]
Length=729

 Score =   376 bits (966),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 189/275 (69%), Positives = 235/275 (85%), Gaps = 2/275 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SKAEGIPS+SHAVRA SGKYFYF + NVF+GVT+G TLF TLK+IE +PNS++ LLATSL
Sbjct  441   SKAEGIPSQSHAVRATSGKYFYFIIFNVFLGVTVGGTLFSTLKTIEKDPNSLVDLLATSL  500

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P+++T+FLTFVALKFFVGYGLELSR+VPLIIFH+K+KY CK++ E+K AW P  LGY TR
Sbjct  501   PANSTYFLTFVALKFFVGYGLELSRLVPLIIFHIKRKYFCKSEDEVKAAWLPRGLGYGTR  560

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DML++ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVY+PS+ESYG+MWPH+  
Sbjct  561   VPSDMLMITIVLCYSVIAPLILPFGVLYFGLGWLVLRNQALKVYIPSYESYGRMWPHIQV  620

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R++A+LILYQ+TM GYFGVKKF YAP ++PLP++S LF+F+CSKKFY FFQ TALE   A
Sbjct  621   RLIASLILYQVTMFGYFGVKKFYYAPFLLPLPVVSLLFSFICSKKFYHFFQHTALEV--A  678

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDA  205
               E K +PNM+ ++R+FIPP   ++K D+D FEDA
Sbjct  679   AHELKVIPNMEQVYRAFIPPSLSSKKLDDDLFEDA  713



>gb|KFK44850.1| hypothetical protein AALP_AA1G310500 [Arabis alpina]
Length=723

 Score =   375 bits (963),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/279 (65%), Positives = 233/279 (84%), Gaps = 2/279 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+G +LFDTLK I+ +P S +S+LATS
Sbjct  437   LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLGGSLFDTLKVIQKDPKSTVSILATS  496

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLT+VALKFF+GYGLELSR++PLIIFH+KKKY+CKT+ E+KEAW PGDL Y+T
Sbjct  497   LPKSATFFLTYVALKFFIGYGLELSRLIPLIIFHIKKKYLCKTEDEVKEAWYPGDLSYST  556

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML+L I  CYSVIAP+I+ F  +YF LGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557   RVPGDMLILTITFCYSVIAPLILIFAVIYFALGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+Q+ M GY G+K+F +A L++P+ ++S LF +VC +KFY+ F+ TALE VS
Sbjct  617   TRILAALFLFQVVMFGYLGIKEFIWAVLLVPIIVISLLFGYVCRQKFYKGFEHTALEVVS  676

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
                E K+ PN++ IF+++IP    T K D+  F+ A+S+
Sbjct  677   --HELKQSPNLEEIFKAYIPHSLSTHKGDDHQFKGAMSR  713



>ref|XP_009115162.1| PREDICTED: CSC1-like protein ERD4 [Brassica rapa]
Length=722

 Score =   375 bits (963),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/279 (67%), Positives = 231/279 (83%), Gaps = 2/279 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SHAVRAASGKYFYF+VLNVFIGVT+  +LFD LK+++  PNSI+++LATS
Sbjct  436   LSKYEGIPSRSHAVRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALQQKPNSIVTVLATS  495

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+ KT+AE+KEAW PGDL YAT
Sbjct  496   LPKNATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLYKTEAEVKEAWYPGDLRYAT  555

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  556   RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  615

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+Q+ M GY GVK F +A L++PL ++S +F +VC +KFY  FQ TALE   
Sbjct  616   TRILAALFLFQVVMFGYLGVKLFVWATLLVPLIVISLIFGYVCRRKFYSGFQHTALEV--  673

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
             A +E KE P+++ IFRSFIP    T K ++  F+ A+S+
Sbjct  674   ACRELKERPDLEEIFRSFIPHSLSTHKPEDHQFKGAMSR  712



>ref|XP_006836313.1| PREDICTED: CSC1-like protein ERD4 [Amborella trichopoda]
 gb|ERM99166.1| hypothetical protein AMTR_s00092p00051600 [Amborella trichopoda]
Length=711

 Score =   374 bits (961),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 178/269 (66%), Positives = 221/269 (82%), Gaps = 2/269 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESHAVRAASGKYFYFT+  VFIG T+G +LFD LK++  +P+ I+++L  S
Sbjct  440   LSKAEGIPSESHAVRAASGKYFYFTIFTVFIGFTLGGSLFDNLKNVGKHPDQIVTMLGDS  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             +P  A +F+TFVALKFFVGYGLELSR+VPLII+HLK+KY+CKT+ E+KEAWAPG +GYAT
Sbjct  500   VPKVAMYFITFVALKFFVGYGLELSRLVPLIIYHLKRKYLCKTEEELKEAWAPGSMGYAT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ + LCYSVI+P+IIPFG +YFG GWL+LRNQALKV+VPS+ESYG+MWPHMH
Sbjct  560   RVPNDMLIVTLSLCYSVISPLIIPFGVLYFGFGWLVLRNQALKVFVPSYESYGRMWPHMH  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR+VAAL ++QLTMIGYFG K F Y PL+IPLP LS +FAFVC K+FY+ F    LE   
Sbjct  620   TRIVAALFVFQLTMIGYFGTKAFVYTPLLIPLPFLSVIFAFVCQKRFYQSFAVNPLEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSD  226
             A +  KE PN+D I  +++PPC  + K D
Sbjct  678   ACQSLKEAPNLDSIAEAYVPPCLSSVKHD  706



>sp|A9LIW2.2|CSC1L_BRAJU RecName: Full=CSC1-like protein ERD4; AltName: Full=Protein EARLY-RESPONSIVE 
TO DEHYDRATION STRESS 4 [Brassica juncea]
 gb|ABX56139.2| ERD4 protein [Brassica juncea]
Length=723

 Score =   374 bits (960),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 232/279 (83%), Gaps = 2/279 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS+SHA+RA SGKYFYF+VLNVFIGVT+  +LF+ LK++E+ PNS I+LLATS
Sbjct  437   LSKSEGIPSQSHAIRATSGKYFYFSVLNVFIGVTLAGSLFENLKALEEKPNSFITLLATS  496

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  497   LPKSATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  556

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557   RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+QL M GY GVK F +A L++PL  +S +F +VC +KFY  F+ TALE   
Sbjct  617   TRILAALFLFQLVMFGYLGVKIFVWAILLVPLIFISLIFGYVCRQKFYGGFEHTALEV--  674

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
             A +E K+ P+++ +FR++IP    T K D+  F+ A+S+
Sbjct  675   ACRELKQRPDLEEVFRAYIPHSLSTHKGDDHQFKGAMSR  713



>ref|XP_006415483.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
 gb|ESQ33836.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
Length=723

 Score =   374 bits (959),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/279 (66%), Positives = 233/279 (84%), Gaps = 2/279 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPS SHA+RAASGKYFYF+VLNVF+GVT+  +LFD LK++E  PNSI+++LATS
Sbjct  437   LSKAEGIPSVSHAIRAASGKYFYFSVLNVFLGVTLAGSLFDNLKALEKKPNSIVTVLATS  496

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y T
Sbjct  497   LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYGT  556

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R PGDML+L I  CYSVIAP+I+ F  +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557   RVPGDMLILTITFCYSVIAPVILVFAVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+Q+ M G+ GVK+F +A LV+PL  +S +F +VC +KFY+ FQ TA+E   
Sbjct  617   TRILAALFLFQVLMFGFLGVKEFIWAILVVPLIAISLVFGYVCRQKFYKGFQHTAVEV--  674

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
             A +E K+ P+++ IFRS+IP    + K ++  F+ A+S+
Sbjct  675   ACRELKQSPDLEEIFRSYIPHSLSSHKPEDHQFKGAMSR  713



>emb|CDY02286.1| BnaA09g26160D [Brassica napus]
Length=722

 Score =   373 bits (957),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/279 (66%), Positives = 231/279 (83%), Gaps = 2/279 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS SHAVRAASGKYFYF+VLNVFIGVT+  +LFD LK+++  PNSI+++LATS
Sbjct  436   LSKSEGIPSRSHAVRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALQQKPNSIVTVLATS  495

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+ KT+AE+KEAW PGDL YAT
Sbjct  496   LPKNATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLYKTEAEVKEAWYPGDLRYAT  555

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+L I  CYSV AP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  556   RVPSDMLILTITFCYSVFAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  615

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+Q+ M GY GVK F +A L++PL ++S +F +VC +KFY  FQ TALE   
Sbjct  616   TRILAALFLFQVVMFGYLGVKLFVWATLLVPLIVISLIFGYVCRRKFYSGFQHTALEV--  673

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
             A ++ KE P+++ IFRSFIP    T K ++  F+ A+S+
Sbjct  674   ACRDLKERPDLEEIFRSFIPHSLSTHKPEDHQFKGAMSR  712



>gb|ABV89627.1| early-responsive to dehydration 4 [Brassica rapa]
Length=723

 Score =   370 bits (949),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/279 (64%), Positives = 226/279 (81%), Gaps = 2/279 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS+SHA+RAASGKYFYF+VLNVFIGVT+  +LFD LK++  N   I   LATS
Sbjct  437   LSKSEGIPSQSHAIRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALRRNQTPIAYRLATS  496

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  497   LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  556

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557   RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL L+QL M GY G K F +A L++PL  +S +F +VC +KFY+ F+ TALE   
Sbjct  617   TRILAALFLFQLVMFGYLGAKLFVWATLLVPLIFISLIFGYVCRQKFYKGFEHTALEVAC  676

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
              G +++  P+++ +FR++IP    T K D+  F+ A+S+
Sbjct  677   RGLKQR--PDLEEVFRAYIPYSLSTHKGDDHQFKGAMSR  713



>ref|XP_010478422.1| PREDICTED: CSC1-like protein ERD4 [Camelina sativa]
Length=725

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/281 (67%), Positives = 228/281 (81%), Gaps = 4/281 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  859
             LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + +I+LLA
Sbjct  437   LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMVINLLA  496

Query  858   tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
             TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKK+MCKT+AE+KEAW PGDL Y
Sbjct  497   TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKFMCKTEAEVKEAWYPGDLSY  556

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
             ATR PGD+L+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  557   ATRVPGDLLILTITFCYSVIAPLILVFGVTYFGLGWLVLRNQALKVYVPSYESYGRMWPH  616

Query  498   MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY  F+ TALE 
Sbjct  617   IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFYGGFEHTALEV  676

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
               A +E K+ P+++ IFR++IP    T K DE  F+ A+S+
Sbjct  677   --ACRELKQSPDLEEIFRAYIPHSLSTHKPDEHEFKGAMSR  715



>ref|XP_010499567.1| PREDICTED: CSC1-like protein ERD4 [Camelina sativa]
Length=725

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/281 (66%), Positives = 229/281 (81%), Gaps = 4/281 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  859
             LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + +I+LLA
Sbjct  437   LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMVINLLA  496

Query  858   tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
             TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKK++CKT+AE+KEAW PGDL Y
Sbjct  497   TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKFLCKTEAEVKEAWYPGDLSY  556

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
             ATR PGD+L+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  557   ATRVPGDLLILTITFCYSVIAPLILVFGVTYFGLGWLVLRNQALKVYVPSYESYGRMWPH  616

Query  498   MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             +H R++AAL L+Q+ M GY G K F Y  LVIPL I+S +F +VC +KFY  F+ TALE 
Sbjct  617   IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIIISLIFGYVCRQKFYGGFEHTALEV  676

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
               A +E K+ P+++ IFR++IP    T K DE  F+ A+S+
Sbjct  677   --ACRELKQSPDLEEIFRAYIPHSLSTHKPDEHEFKGAMSR  715



>ref|XP_002461460.1| hypothetical protein SORBIDRAFT_02g003010 [Sorghum bicolor]
 gb|EER97981.1| hypothetical protein SORBIDRAFT_02g003010 [Sorghum bicolor]
Length=732

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/288 (64%), Positives = 227/288 (79%), Gaps = 2/288 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS+SHAVRAASGKYFYF V NVF+G T+GSTLF +L +I D+P  I+++LA S
Sbjct  446   LSKQEGIPSQSHAVRAASGKYFYFIVFNVFLGYTLGSTLFKSLTTIIDHPAGIVTMLANS  505

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ ++K AWAPGDLGY T
Sbjct  506   LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEEDVKAAWAPGDLGYNT  565

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+  + LCYSVIAP+IIPFG  YF LGWL+ +NQ L+VYVPS+ESYG+MWPHMH
Sbjct  566   RVPNDMLIATVVLCYSVIAPLIIPFGVAYFALGWLIAKNQILRVYVPSYESYGRMWPHMH  625

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++ AL++YQ TMIG+  +KKF Y P+++PL  +S +FA+VC  +FY  F  T LE V 
Sbjct  626   TRIITALMVYQTTMIGFIPLKKFYYVPVLVPLLPISIIFAYVCHMRFYPAFAKTPLEVV-  684

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSASNV  172
             A  + KE PNM+ I+ S+IPPC   EK  D D FEDA S  +  A +V
Sbjct  685   AQHDLKETPNMETIYTSYIPPCLKPEKLEDLDAFEDAQSHKTSRAPSV  732



>dbj|BAB63915.1| ERD4 protein [Arabidopsis thaliana]
Length=640

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 187/281 (67%), Positives = 227/281 (81%), Gaps = 4/281 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  859
             LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + II+LLA
Sbjct  352   LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMIINLLA  411

Query  858   tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
             TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y
Sbjct  412   TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSY  471

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
             ATR PGDML+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  472   ATRVPGDMLILTITFCYSVIAPLILIFGITYFGLGWLVLRNQALKVYVPSYESYGRMWPH  531

Query  498   MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY  F+ TALE 
Sbjct  532   IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFYGGFEHTALEV  591

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
               A +E K+ P ++ IFR++IP    + K +E  F+ A+S+
Sbjct  592   --ACRELKQSPVLEEIFRAYIPHSLSSHKPEEHEFKGAMSR  630



>ref|XP_010460826.1| PREDICTED: CSC1-like protein ERD4 isoform X1 [Camelina sativa]
 ref|XP_010460827.1| PREDICTED: CSC1-like protein ERD4 isoform X2 [Camelina sativa]
Length=725

 Score =   367 bits (943),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/281 (66%), Positives = 228/281 (81%), Gaps = 4/281 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  859
             LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + +I+LLA
Sbjct  437   LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMVINLLA  496

Query  858   tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
             TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKK++CKT+AE+KEAW PGDL Y
Sbjct  497   TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKFLCKTEAEVKEAWYPGDLSY  556

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
             ATR PGD+L+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  557   ATRVPGDLLILTITFCYSVIAPLILVFGVTYFGLGWLVLRNQALKVYVPSYESYGRMWPH  616

Query  498   MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY  F+ TALE 
Sbjct  617   IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFYGGFEHTALEV  676

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
               A +E K+ P+++ IFR++IP    T K DE  F+ A+S+
Sbjct  677   --ACRELKQSPDLEEIFRAYIPHSLSTHKPDEHEFKGAMSR  715



>ref|XP_002890865.1| early-responsive to dehydration 4 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67124.1| early-responsive to dehydration 4 [Arabidopsis lyrata subsp. 
lyrata]
Length=722

 Score =   367 bits (942),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 187/281 (67%), Positives = 230/281 (82%), Gaps = 4/281 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  859
             LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + II+LLA
Sbjct  434   LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMIINLLA  493

Query  858   tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
             TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y
Sbjct  494   TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLTY  553

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
             ATR PGD+LVL I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  554   ATRVPGDLLVLTITFCYSVIAPLILIFGIIYFGLGWLVLRNQALKVYVPSYESYGRMWPH  613

Query  498   MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY  F+ TALE 
Sbjct  614   IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFYGGFKHTALEV  673

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
               A +E K+ P+++ IFR++IP    + K++E  F+ A+S+
Sbjct  674   --ACRELKQSPDLEEIFRAYIPHSLSSHKAEEHEFKGAMSR  712



>ref|NP_564354.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 sp|Q9C8G5.1|CSCLD_ARATH RecName: Full=CSC1-like protein ERD4; AltName: Full=Protein EARLY-RESPONSIVE 
TO DEHYDRATION STRESS 4 [Arabidopsis thaliana]
 gb|AAG51102.1|AC025295_10 unknown protein [Arabidopsis thaliana]
 gb|AAK59597.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34230.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31209.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AIU34626.1| hyperosmolality-gated Ca2+ permeable channel 3.1 [Arabidopsis 
thaliana]
Length=724

 Score =   367 bits (942),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 187/281 (67%), Positives = 228/281 (81%), Gaps = 4/281 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  859
             LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + II+LLA
Sbjct  436   LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMIINLLA  495

Query  858   tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
             TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y
Sbjct  496   TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSY  555

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
             ATR PGDML+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  556   ATRVPGDMLILTITFCYSVIAPLILIFGITYFGLGWLVLRNQALKVYVPSYESYGRMWPH  615

Query  498   MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY  F+ TALE 
Sbjct  616   IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFYGGFEHTALEV  675

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
               A +E K+ P+++ IFR++IP    + K +E  F+ A+S+
Sbjct  676   --ACRELKQSPDLEEIFRAYIPHSLSSHKPEEHEFKGAMSR  714



>ref|XP_006306879.1| hypothetical protein CARUB_v10008433mg [Capsella rubella]
 gb|EOA39777.1| hypothetical protein CARUB_v10008433mg [Capsella rubella]
Length=725

 Score =   363 bits (933),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 183/281 (65%), Positives = 226/281 (80%), Gaps = 4/281 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  859
             LSK+EGIPS+SH +RAASGKYFYF+V NVF+GVT+  TLF+T+K I  NP  + +I+LLA
Sbjct  437   LSKSEGIPSQSHVIRAASGKYFYFSVFNVFLGVTLAGTLFNTVKDIAKNPKLDMVINLLA  496

Query  858   tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
             TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y
Sbjct  497   TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSY  556

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
              TR PGDML+L I  CYSVIAP+I+ FG  YF LGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  557   QTRVPGDMLILTITFCYSVIAPLILVFGITYFSLGWLVLRNQALKVYVPSYESYGRMWPH  616

Query  498   MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY  F+ TALE 
Sbjct  617   IHQRILAALFLFQVLMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFYGAFEHTALEV  676

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
               A +E K+ P++D IFR++IP    T K++E  F+ A+S+
Sbjct  677   --ACRELKQSPDLDEIFRAYIPHSLSTHKAEEHEFKGAMSR  715



>ref|XP_006657447.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Oryza 
brachyantha]
Length=729

 Score =   363 bits (931),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 227/288 (79%), Gaps = 3/288 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EG+PS+SH VRAA+GKYFYF V NVF+GVTIGSTLF  L +I +NP  I+ +LA S
Sbjct  444   LSKSEGLPSQSHIVRAAAGKYFYFIVFNVFLGVTIGSTLFSALTTIINNPPGIVKMLANS  503

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ +++ AWAPGDLGY T
Sbjct  504   LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDDVRAAWAPGDLGYNT  563

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFG  YF LGW++ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  564   RVPNDMLIVTIVLCYSVIAPLIIPFGVAYFALGWIIAKNQVLRVYVPSYESNGRMWPHMH  623

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL++YQ TM+G   +KKF Y+P+++PL  +SF+FA++C+ +FY  F  T LE V 
Sbjct  624   TRIIAALLIYQTTMVGVILLKKFFYSPVLVPLIPMSFIFAYICNMRFYPAFAKTPLEVVQ  683

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSASNV  172
                + KE PNMD I+ ++IP C   EK  D D FEDA S  +  A ++
Sbjct  684   --HDVKETPNMDAIYTAYIPACLKPEKLEDVDIFEDAQSNTTSRAPSI  729



>gb|KCW75871.1| hypothetical protein EUGRSUZ_D00260 [Eucalyptus grandis]
Length=710

 Score =   360 bits (924),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 183/280 (65%), Positives = 221/280 (79%), Gaps = 16/280 (6%)
 Frame = -3

Query  1020  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatslpss  841
             EGIPS+SH  RAASGKYFYFTVLNVFIGVT+G TLF T K IE +PNS++++LA SLP +
Sbjct  444   EGIPSQSHIERAASGKYFYFTVLNVFIGVTVGGTLFATFKEIEKDPNSLLTILAASLPDN  503

Query  840   aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPG  661
             ATFFLT++A+KFFVGYGLELSRIVPLIIFHLK+KY+CKT+AE+KEAW PGDL YATR PG
Sbjct  504   ATFFLTYIAMKFFVGYGLELSRIVPLIIFHLKRKYICKTEAEVKEAWYPGDLEYATRVPG  563

Query  660   DMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVV  481
             DML++ I LCYSVIAP+II FG VYFGLGW++LRNQ              MWP MH R++
Sbjct  564   DMLIVTITLCYSVIAPLIILFGVVYFGLGWIILRNQ--------------MWPRMHLRIL  609

Query  480   AALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSAGKE  301
             AAL+LYQLTM  YFG KKF YA  ++PL I S +FA+VC+KKFYRFF+  ALE   A  E
Sbjct  610   AALVLYQLTMFAYFGTKKFYYATFLVPLIISSLIFAYVCNKKFYRFFRCPALEV--ASHE  667

Query  300   KKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSA  181
              KE  +M+ IFR+++PP   +EK ++D FEDALS VSR+ 
Sbjct  668   LKETLHMERIFRTYVPPSLCSEKVEDDRFEDALSHVSRAG  707



>gb|EAZ02783.1| hypothetical protein OsI_24908 [Oryza sativa Indica Group]
Length=731

 Score =   360 bits (923),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 225/288 (78%), Gaps = 3/288 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS+ H VRAA+GKYFYF V NVF+GVTI STLF  L +I +NP  I+++LA+S
Sbjct  446   LSKLEGIPSQGHTVRAAAGKYFYFIVFNVFLGVTISSTLFSALTTIINNPPGIVNMLASS  505

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY T
Sbjct  506   LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNT  565

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFG  YF LGW++ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  566   RVPNDMLIVTIVLCYSVIAPLIIPFGVAYFALGWIIAKNQVLRVYVPSYESNGRMWPHMH  625

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL++YQ+TM+G   +KKF Y+P+++PL  +SF+FA++C  +FY  F  T LE V 
Sbjct  626   TRIIAALLIYQITMVGVILLKKFLYSPVLVPLIPISFIFAYICHMRFYPAFAKTPLEVVQ  685

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSASNV  172
                  K+ PNMD ++ S+IP C   EK  D D FEDA S  +  A ++
Sbjct  686   --HNVKDTPNMDAVYTSYIPACLKPEKLEDVDIFEDAQSHTTSRAPSI  731



>ref|NP_001058898.1| Os07g0150100 [Oryza sativa Japonica Group]
 dbj|BAC82906.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF20812.1| Os07g0150100 [Oryza sativa Japonica Group]
 gb|AIU34637.1| hyperosmolality-gated Ca2+ permeable channel 3.1 [Oryza sativa]
Length=731

 Score =   359 bits (922),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 180/287 (63%), Positives = 226/287 (79%), Gaps = 4/287 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS+ H VRAA+GKYFYF V NVF+GVTI STLF  L +I +NP  I+++LA+S
Sbjct  446   LSKLEGIPSQGHTVRAAAGKYFYFIVFNVFLGVTISSTLFSALTTIINNPPGIVNMLASS  505

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY T
Sbjct  506   LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNT  565

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFG  YF LGW++++NQ L+VYVPS+ES G+MWPHMH
Sbjct  566   RVPNDMLIVTIVLCYSVIAPLIIPFGVAYFALGWIIVKNQVLRVYVPSYESNGRMWPHMH  625

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL++YQ+TM+G   +KKF Y+P+++PL  +SF+FA++C  +FY  F  T LE V 
Sbjct  626   TRIIAALLIYQITMVGVILLKKFLYSPVLVPLIPISFIFAYICHMRFYPAFAKTPLEVVQ  685

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDA-LSQVSRSAS  178
                  K+ PNMD ++ S+IP C   EK  D D FEDA L   SR+ S
Sbjct  686   --HNVKDTPNMDAVYTSYIPACLKPEKLEDVDIFEDAQLHTTSRAPS  730



>dbj|BAJ94358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/286 (60%), Positives = 215/286 (75%), Gaps = 4/286 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIPS+SH VRAASGKYFYF V NVFIG  IGS+LF  L+ + +NP  I + L   L
Sbjct  217   SKLEGIPSQSHLVRAASGKYFYFIVFNVFIGYAIGSSLFSALQDVINNPPGIFTTLGARL  276

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY TR
Sbjct  277   PGNATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNTR  336

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DML++ + LCYSVIAP+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMHT
Sbjct  337   VPNDMLIVTVVLCYSVIAPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMHT  396

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R++AAL++YQ TMIG    K+F Y+ ++ PL  +S +FA+ C  +FY  F  T LE   A
Sbjct  397   RIIAALMVYQATMIGIITAKRFYYSTILFPLLAISLIFAYTCHTRFYPAFAKTPLEV--A  454

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQ-VSRSAS  178
              ++ KE PNM  I+ ++IPPC   EK  D + FEDA S+  SR  S
Sbjct  455   SQQLKETPNMSTIYTAYIPPCLKPEKLEDVEVFEDAQSRTTSRDPS  500



>gb|EMT14399.1| Putative membrane protein [Aegilops tauschii]
Length=725

 Score =   354 bits (909),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/285 (60%), Positives = 220/285 (77%), Gaps = 3/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS+SH VRA+SGKYFYF V NVFIG  IGS+LF  L+ + +NP  I++ L + 
Sbjct  440   LSKSEGIPSQSHVVRASSGKYFYFIVFNVFIGYAIGSSLFSALQKVIENPTGIVTTLGSR  499

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY T
Sbjct  500   LPGNATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNT  559

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P D+L++ + +CYSVIAP+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  560   RVPNDLLIVTLVMCYSVIAPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMH  619

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL++YQ TM+G  G+KKF Y+ ++ PL  +S +FA+ C  +FY  F  T LE   
Sbjct  620   TRIIAALMIYQATMLGIIGLKKFYYSAILTPLLAISLIFAYTCHTRFYPAFAKTPLEV--  677

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSA  181
             A ++ KE PNM  I+ ++IPPC   EK  D + FEDA S+ +  A
Sbjct  678   ASQQLKETPNMSTIYTAYIPPCLKPEKLEDVEVFEDAQSRTTSRA  722



>ref|NP_001108122.1| early responsive to dehydration protein [Zea mays]
 gb|ABY60425.1| early responsive to dehydration protein [Zea mays]
Length=732

 Score =   354 bits (909),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 177/288 (61%), Positives = 222/288 (77%), Gaps = 2/288 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS+ HAVRAASGKYFYF V NVF+  T+GSTLF +L +I ++P  I+++LA S
Sbjct  446   LSKQEGIPSQGHAVRAASGKYFYFIVFNVFLCYTLGSTLFKSLTTIINHPAEIVNMLAKS  505

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKF VGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAP DLGY T
Sbjct  506   LPGSATFFLTFVALKFLVGYGLELSRLVPLIIFHLKRKYLCKTEEEVRAAWAPVDLGYNT  565

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML+  + LCYSVIAP+IIPFG  YF LGWL+ RNQ L+VYVPS+ESYG+MWPHMH
Sbjct  566   RVPNDMLIATVVLCYSVIAPLIIPFGVAYFALGWLIARNQILRVYVPSYESYGRMWPHMH  625

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL++YQ TMIG+  +KKF YA +++PL   S +FA+VC  +FY  F  T LE V 
Sbjct  626   TRIIAALMVYQTTMIGFISLKKFAYASVLVPLLPASIIFAYVCHMRFYPAFAKTPLEVV-  684

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSASNV  172
                + KE PNM+ I+ ++IPPC   +K  D D FEDA S+ +    ++
Sbjct  685   VRHDLKETPNMEAIYTAYIPPCLKPDKLEDLDAFEDAQSRATSRVPSI  732



>ref|XP_003557644.1| PREDICTED: CSC1-like protein ERD4 [Brachypodium distachyon]
Length=729

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 218/284 (77%), Gaps = 3/284 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK+EGIPS+SH VRAASGKYFYF + NVFIG TI S+LF  LK+I +NP  IIS+LA SL
Sbjct  445   SKSEGIPSQSHVVRAASGKYFYFIIFNVFIGFTISSSLFSALKTIINNPPGIISMLANSL  504

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P SATFFLTFVALKFFVGYGLELSR+VPLIIFHLKKKY+CKT+ E++ AWAPGDLGY TR
Sbjct  505   PGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKKKYLCKTEDEVRAAWAPGDLGYNTR  564

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DMLV+ I LCYSVIAP+IIPFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMHT
Sbjct  565   VPNDMLVVTIVLCYSVIAPLIIPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMHT  624

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             RV+AAL++YQ TMIG   +K F Y+ ++ PL  +S +FA+ C  +FY  F  T LE    
Sbjct  625   RVIAALMIYQATMIGVIILKLFYYSTILFPLLAISLIFAYTCHTRFYPAFAKTPLEVACQ  684

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSA  181
             G   KE PNM  I+ ++IPPC   EK  D D FEDA S+ +  A
Sbjct  685   G--LKETPNMGAIYTAYIPPCLKPEKLEDVDIFEDAQSRTTSRA  726



>gb|AGV54580.1| early-responsive to dehydration 4 [Phaseolus vulgaris]
Length=643

 Score =   348 bits (893),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 169/254 (67%), Positives = 200/254 (79%), Gaps = 4/254 (2%)
 Frame = -3

Query  936  VTIGSTLFDTLKSIEDNPNsiisllatslps--saTFFLTFVALKFFVGYGLELSRIVPL  763
            VTIG TLF     I+ NP+        +     +ATFFLT+VALKFFVGYGLELSRIVPL
Sbjct  390  VTIGGTLFKAFNKIQKNPSLSEISSLLAESLPGNATFFLTYVALKFFVGYGLELSRIVPL  449

Query  762  IIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYF  583
            II+HLK+KY+CKT+AE+KEAW PGDLGY TR PGDML++ I  CYSVIAP+IIPFG +YF
Sbjct  450  IIYHLKRKYLCKTEAELKEAWRPGDLGYGTRVPGDMLIVTIVFCYSVIAPVIIPFGVLYF  509

Query  582  GLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVI  403
            GLGWL+LRNQALKVYVPS+ESYG+MWPH+H RV+A+LILYQ+TM GYFG +KF Y PLV+
Sbjct  510  GLGWLVLRNQALKVYVPSYESYGRMWPHIHNRVLASLILYQITMFGYFGAQKFYYTPLVL  569

Query  402  PLPILSFLFAFVCSKKFYRFFQSTALEAVSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDE  223
            PLP LS +F FVC+KKFY  F+  ALE   A    KE PNM++IFRSFIPP   +EK D+
Sbjct  570  PLPFLSLIFGFVCAKKFYPAFEHPALEV--AANPLKEPPNMELIFRSFIPPSLSSEKIDD  627

Query  222  DHFEDALSQVSRSA  181
            D FEDALS VSR+ 
Sbjct  628  DRFEDALSSVSRTT  641



>ref|XP_004955452.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Setaria 
italica]
Length=738

 Score =   350 bits (899),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/290 (58%), Positives = 218/290 (75%), Gaps = 5/290 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPS+SH VRA++GKYFYF V NVF+  T+G +L  +LK+I +N N  + +   +
Sbjct  451   LSKAEGIPSQSHVVRASAGKYFYFIVFNVFLIYTLGKSLITSLKTILNNANITVIINMLA  510

Query  852   lpss--aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
                   ATFFLTFVALKFFVGYGLELSR+VPL+IFHLK+KY+CKT+ ++K AW PGDLGY
Sbjct  511   TSLPGGATFFLTFVALKFFVGYGLELSRVVPLVIFHLKRKYLCKTEDDVKAAWYPGDLGY  570

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
             +TR P DML+  + LCYSV+AP+IIPFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPH
Sbjct  571   STRVPNDMLIATVTLCYSVMAPLIIPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPH  630

Query  498   MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             MHTR++AAL+LYQ TMIG  G+KKF Y+P+++PL  +S +FA++C  +FY  F +T LE 
Sbjct  631   MHTRIIAALLLYQATMIGVIGLKKFYYSPILVPLLPISIIFAYICHMRFYPAFANTPLEV  690

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSASNV  172
               A  E KE PNMD I+ ++IP C   +K  D D FEDA S  +  A ++
Sbjct  691   --AQHELKETPNMDAIYTAYIPQCLKPDKLEDLDVFEDAQSHTTSRAPSI  738



>gb|EAZ38704.1| hypothetical protein OsJ_23104 [Oryza sativa Japonica Group]
Length=1280

 Score =   360 bits (924),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/288 (63%), Positives = 226/288 (78%), Gaps = 3/288 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS+ H VRAA+GKYFYF V NVF+GVTI STLF  L +I +NP  I+++LA+S
Sbjct  446   LSKLEGIPSQGHTVRAAAGKYFYFIVFNVFLGVTISSTLFSALTTIINNPPGIVNMLASS  505

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY T
Sbjct  506   LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNT  565

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFG  YF LGW++++NQ L+VYVPS+ES G+MWPHMH
Sbjct  566   RVPNDMLIVTIVLCYSVIAPLIIPFGVAYFALGWIIVKNQVLRVYVPSYESNGRMWPHMH  625

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL++YQ+TM+G   +KKF Y+P+++PL  +SF+FA++C  +FY  F  T LE V 
Sbjct  626   TRIIAALLIYQITMVGVILLKKFLYSPVLVPLIPISFIFAYICHMRFYPAFAKTPLEVVQ  685

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSASNV  172
                  K+ PNMD ++ S+IP C   EK  D D FEDA S   RS + V
Sbjct  686   --HNVKDTPNMDAVYTSYIPACLKPEKLEDVDIFEDAQSTRGRSRAGV  731



>dbj|BAJ93282.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=725

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/281 (60%), Positives = 213/281 (76%), Gaps = 3/281 (1%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIPS+SH VRAASGKYFYF V NVFIG  IGS+LF  L+ + +NP  I + L   L
Sbjct  441   SKLEGIPSQSHLVRAASGKYFYFIVFNVFIGYAIGSSLFSALQDVINNPPGIFTTLGARL  500

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY TR
Sbjct  501   PGNATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNTR  560

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              P DML++ + LCYSVIAP+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMHT
Sbjct  561   VPNDMLIVTVVLCYSVIAPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMHT  620

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R++AAL++YQ TMIG    K+F Y+ ++ PL  +S +FA+ C  +FY  F  T LE   A
Sbjct  621   RIIAALMVYQATMIGIITAKRFYYSTILFPLLAISLIFAYTCHTRFYPAFAKTPLEV--A  678

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVS  190
              ++ KE PNM  I+ ++IPPC   EK  D + FEDA S+ +
Sbjct  679   SQQLKETPNMSTIYTAYIPPCLKPEKLEDVEVFEDAQSRTT  719



>gb|EMS45497.1| Uncharacterized membrane protein C24H6.13 [Triticum urartu]
Length=729

 Score =   347 bits (890),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/285 (62%), Positives = 218/285 (76%), Gaps = 3/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS+SH VRAASGKYFYF + NVF+G TI S+LF  LK+I DNP  II +L  S
Sbjct  444   LSKSEGIPSQSHVVRAASGKYFYFIIFNVFLGFTISSSLFSALKTIVDNPPGIIVMLGNS  503

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFL+FVALKFFVGYGLELSR+VPLIIFHLKKKY+CKT+ E++ AW+PGDLGY T
Sbjct  504   LPGSATFFLSFVALKFFVGYGLELSRLVPLIIFHLKKKYLCKTEDELRAAWSPGDLGYNT  563

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+IIPFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPH+H
Sbjct  564   RVPSDMLIVTIVLCYSVIAPLIIPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHIH  623

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TRV+AAL++YQ TMIG   +K F Y+ ++ PL  +S +FA+ C  +FY  F  T LE   
Sbjct  624   TRVIAALMIYQATMIGVIILKLFFYSAILSPLIPISLIFAYTCHTRFYPAFAKTPLEV--  681

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSA  181
             A +E KE PNM  I+ ++IP C   EK  D D FEDA S+ +  A
Sbjct  682   ASQELKETPNMGAIYSAYIPLCLKPEKLEDVDVFEDAQSRTTSRA  726



>gb|EMS64036.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=548

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 210/285 (74%), Gaps = 3/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS+SH VRAASGKYFYF V NVFIG  IGS+LF  L+ +  NP  I   LAT 
Sbjct  263   LSKSEGIPSQSHVVRAASGKYFYFIVFNVFIGYAIGSSLFSALEKVIKNPTGIFMTLATR  322

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFF TFVAL+ FVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AW PG+L Y T
Sbjct  323   LPGTATFFFTFVALRCFVGYGLELSRLVPLIIFHLKRKYICKTEDEVRAAWVPGNLRYNT  382

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVI P+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  383   RVPNDMLIVTIVLCYSVITPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMH  442

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL++YQ TMIG   +KKF Y+ ++ PL ++S +FA  C  +FY  F  T LE   
Sbjct  443   TRIIAALMIYQATMIGIISLKKFYYSTILTPLLVISLIFARTCHARFYPAFAKTPLEV--  500

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSA  181
             A ++ KE PNM  I+ ++IPPC   EK  D   FED  S+ +  A
Sbjct  501   ASQQLKETPNMSAIYTAYIPPCLKPEKLEDVQVFEDTQSRTTSRA  545



>gb|EMT14905.1| Putative membrane protein [Aegilops tauschii]
Length=676

 Score =   337 bits (865),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 210/285 (74%), Gaps = 3/285 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK+EGIPS+SH VRAASGKYFYF V NVFIG  IGS+LF  L+ +  NP  I   LAT 
Sbjct  391   LSKSEGIPSQSHVVRAASGKYFYFIVFNVFIGYAIGSSLFSALEKVIKNPPGIFMTLATR  450

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFF TFVAL+ FVGYGLELSR+VPLIIFHLK+KY CKT+ E++ AW PG+L Y T
Sbjct  451   LPGNATFFFTFVALRCFVGYGLELSRLVPLIIFHLKRKYQCKTEEEVRAAWVPGNLRYNT  510

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVI P+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  511   RVPNDMLIVTIVLCYSVITPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMH  570

Query  492   TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVS  313
             TR++AAL++YQ TMIG   +KKF Y+ ++ PL ++S +FA  C  +FY  F  T LE   
Sbjct  571   TRIIAALMIYQATMIGIISLKKFYYSTILAPLLVISLIFAHTCHARFYPAFAKTPLEV--  628

Query  312   AGKEKKEVPNMDIIFRSFIPPCFGTEK-SDEDHFEDALSQVSRSA  181
             A ++ KE PNM  I+ ++IPPC   +K  D   FEDA S+ +  A
Sbjct  629   ASQQLKETPNMSAIYTAYIPPCLKPDKLQDVQVFEDAQSRTTSRA  673



>emb|CAN64310.1| hypothetical protein VITISV_037471 [Vitis vinifera]
Length=676

 Score =   333 bits (853),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 196/222 (88%), Gaps = 1/222 (0%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SKAEGIPS+SHAVRAASGKYFYFT+LNVFIGVT+G+TLFDT K+IED P  I+S+LA SL
Sbjct  442   SKAEGIPSQSHAVRAASGKYFYFTILNVFIGVTVGATLFDTFKTIEDQPKEIVSILAKSL  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             PS+ATFFLTFVALKFFVGYGLELSRIVPLIIFHLK+KY+CKT+ E+KEAWAPGDLGY +R
Sbjct  502   PSNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTETEVKEAWAPGDLGYVSR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGD+L++ I LCYSVIAPII+PFG +YFGLGWL+LRNQALKVYVPS+ES G+MWPH+H 
Sbjct  562   VPGDLLIITIVLCYSVIAPIILPFGVLYFGLGWLILRNQALKVYVPSYESNGRMWPHIHV  621

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVC  364
             R++ AL+LYQ+TM+GYFGVK+ P   +    P  +FL  ++C
Sbjct  622   RLIGALLLYQVTMLGYFGVKRIPLYSICDRAP-YTFLDLYLC  662



>gb|AGV54368.1| early-responsive to dehydration [Phaseolus vulgaris]
Length=515

 Score =   322 bits (825),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 174/208 (84%), Gaps = 2/208 (1%)
 Frame = -3

Query  804  FVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPGDMLVLIICLCYS  625
            FVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR PGDML++ I  CYS
Sbjct  308  FVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYGTRVPGDMLIVTIVFCYS  367

Query  624  VIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVAALILYQLTMIG  445
            VIAP+IIPFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H RV+A+LILYQ+TM G
Sbjct  368  VIAPVIIPFGVLYFGLGWLVLRNQALKVYVPSYESYGRMWPHIHNRVLASLILYQITMFG  427

Query  444  YFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSAGKEKKEVPNMDIIFR  265
            YFG +KF Y PLV+PLP LS +F FVC+KKFY  F+  ALE   A    KE PNM++IFR
Sbjct  428  YFGAQKFYYTPLVLPLPFLSLIFGFVCAKKFYPAFEHPALEV--AANPLKEPPNMELIFR  485

Query  264  SFIPPCFGTEKSDEDHFEDALSQVSRSA  181
            SFIPP   +EK D+D FEDALS VSR+ 
Sbjct  486  SFIPPSLSSEKIDDDRFEDALSSVSRTT  513



>gb|KHN47349.1| Putative membrane protein C24H6.13 [Glycine soja]
Length=683

 Score =   322 bits (824),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 176/285 (62%), Positives = 203/285 (71%), Gaps = 45/285 (16%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiisllat  856
             SK EGIP+ESHAVRAASGKYFYFTVLNVFIGVTIG TLF   K I ++P  + I SLLA 
Sbjct  440   SKFEGIPTESHAVRAASGKYFYFTVLNVFIGVTIGGTLFKAFKRIREHPTLDEISSLLAE  499

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             SLP +ATFFLT+VALKFF+GYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  500   SLPGNATFFLTYVALKFFIGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  559

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             TR PGDML++ I  CYSVIAP+IIPFGA+YFGLGWL+LRNQ                   
Sbjct  560   TRVPGDMLIVTIVFCYSVIAPVIIPFGALYFGLGWLVLRNQ-------------------  600

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
                                   KF Y PLV+PLPILS +F FVC+KKFY  FQ  ALE  
Sbjct  601   ----------------------KFYYTPLVLPLPILSLIFGFVCAKKFYPAFQHPALEV-  637

Query  315   SAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSA  181
              A    KEVPNM++IFR++IPP   +EK D+D  EDALSQ SR+A
Sbjct  638   -AANTLKEVPNMELIFRAYIPPSLRSEKIDDDRVEDALSQCSRTA  681



>ref|XP_002990725.1| hypothetical protein SELMODRAFT_41467, partial [Selaginella moellendorffii]
 gb|EFJ08174.1| hypothetical protein SELMODRAFT_41467, partial [Selaginella moellendorffii]
Length=706

 Score =   311 bits (797),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 206/271 (76%), Gaps = 7/271 (3%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             S+ EGI S+SH  RAA+GKYFYF V NVF+G+TI S+LFDT+K I+  PNS +SLL  ++
Sbjct  442   SRMEGIVSQSHVERAAAGKYFYFNVFNVFLGITITSSLFDTVKKIQKEPNSTVSLLGAAI  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +A+FF+TF+AL+FFVGYGL+LSR+VPLIIF +KKKY+CKT  +I+ AWAP D  YATR
Sbjct  502   PPAASFFITFIALRFFVGYGLQLSRLVPLIIFRIKKKYLCKTKEDIRAAWAPKDFSYATR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGDML+L I LCY+VIAP+++PF  VYF   W++ R++ALKV VP++ESYG+MWPH+HT
Sbjct  562   VPGDMLILTIALCYAVIAPMVLPFALVYFAFAWIIARHEALKVVVPAYESYGRMWPHIHT  621

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R++AAL++ QL M+GYF +KKF ++P+++PLPI + LFA + +K +Y  F++  LE    
Sbjct  622   RIIAALLVSQLAMLGYFSIKKFVFSPILVPLPIATLLFALITNKIYYPTFKNPPLEVT--  679

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDH  217
             G  K+ +P +  I  ++ P        DE+H
Sbjct  680   GLTKEHIPTVSSIVTAYTPSYL-----DEEH  705



>ref|XP_002986705.1| hypothetical protein SELMODRAFT_41460, partial [Selaginella moellendorffii]
 gb|EFJ12268.1| hypothetical protein SELMODRAFT_41460, partial [Selaginella moellendorffii]
Length=706

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 206/271 (76%), Gaps = 7/271 (3%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             S+ EGI S+SH  RAA+GKYFYF V NVF+G+TI S+LFDT+K I+  PNS +SLL  ++
Sbjct  442   SRMEGIVSQSHVERAAAGKYFYFNVFNVFLGITITSSLFDTVKKIQKEPNSTVSLLGAAI  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +A+FF+TF+AL+FFVGYGL+LSR+VPLI+F +KKKY+CKT  +I+ AWAP D  YATR
Sbjct  502   PPAASFFITFIALRFFVGYGLQLSRLVPLIMFRIKKKYLCKTKEDIRAAWAPKDFSYATR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  490
              PGDML+L I LCY+VIAP+++PF  VYF   W++ R++ALKV VP++ESYG+MWPH+HT
Sbjct  562   VPGDMLILTIALCYAVIAPMVLPFALVYFAFAWIIARHEALKVVVPAYESYGRMWPHIHT  621

Query  489   RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSA  310
             R++AAL++ QL M+GYF +KKF ++P+++PLPI + LFA + +K +Y  F++  LE    
Sbjct  622   RIIAALLVSQLAMLGYFSIKKFVFSPILVPLPIATLLFALITNKIYYPTFKNPPLEVT--  679

Query  309   GKEKKEVPNMDIIFRSFIPPCFGTEKSDEDH  217
             G  K+ +P +  I  ++ P        DE+H
Sbjct  680   GLTKEHIPTVSSIVTAYTPSYL-----DEEH  705



>gb|AAX92695.1| early-responsive to dehydration stress protein [Picea abies]
Length=284

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSKAEGIPSESHAVRA+SGKYFYF   NVF+GVT G TLF++LK +E  PNSII+LL  S
Sbjct  89    LSKAEGIPSESHAVRASSGKYFYFIAFNVFLGVTSGGTLFESLKEVEKKPNSIITLLGNS  148

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFF++FVALKFFVGYGLEL+R+VPL+I+H+KK+++CKT+AE++EAWAPG  GYAT
Sbjct  149   LPPNATFFISFVALKFFVGYGLELTRLVPLVIYHIKKRFLCKTEAEVQEAWAPGGFGYAT  208

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  493
             R P DML++ I LCYSVIAP+I+PF  VYF +GW +LRNQAL VYVPS+ES G+MWPHMH
Sbjct  209   RVPNDMLIITIALCYSVIAPMILPFALVYFLVGWFVLRNQALNVYVPSYESNGRMWPHMH  268

Query  492   TRVVAALILYQLTMIG  445
             TR++AAL + Q+TMIG
Sbjct  269   TRILAALFISQVTMIG  284



>ref|XP_001766729.1| predicted protein [Physcomitrella patens]
 gb|EDQ68360.1| predicted protein [Physcomitrella patens]
Length=752

 Score =   290 bits (741),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 145/285 (51%), Positives = 197/285 (69%), Gaps = 12/285 (4%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             S+ EGIPS+SH VRAASGKYFYF + NVF+GVT+  T+F +L   +   NS    +++ +
Sbjct  441   SRMEGIPSQSHVVRAASGKYFYFVIFNVFLGVTLFGTVFSSLAGFQTLLNSKNFSVSSVV  500

Query  849   ps-------saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPG  691
                       A +F+TFVAL+FFVGYGLELSR+VPL ++HLK+K++CKT+ E++EAW PG
Sbjct  501   TLFGSKLPPVAAYFITFVALQFFVGYGLELSRVVPLSVYHLKRKFLCKTEKELEEAWEPG  560

Query  690   DLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGK  511
                Y T  P D+L+L+I + Y+VIAP+I+ F  VYF +G+++LRNQALKVYVP FES G+
Sbjct  561   PFEYQTLVPNDILILMISMAYAVIAPMILLFAIVYFAIGYVVLRNQALKVYVPEFESGGR  620

Query  510   MWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQST  331
             MWPH+HTR+V AL + Q+TM+GY G+KKFPYA LVI LP+ +  FA +C   +Y  F   
Sbjct  621   MWPHIHTRIVVALFIGQITMMGYMGIKKFPYAVLVIILPLFTIFFASMCKMNYYPSFNVM  680

Query  330   ALEAVSAGKEKKEVPNMDIIFRSFIPPCFGTEKSD---EDHFEDA  205
             +L    A ++ KE P M  I  ++ P C   E  D    +HFEDA
Sbjct  681   SLAI--ASEDVKESPPMREIIAAYTPECLVLEDQDVYESEHFEDA  723



>ref|XP_001754029.1| predicted protein [Physcomitrella patens]
 gb|EDQ81351.1| predicted protein [Physcomitrella patens]
Length=751

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 202/303 (67%), Gaps = 20/303 (7%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LS+ EGIPS+SH VR ASGKYFYF V NVF+GVT+  T+F +L   +   NS    +++ 
Sbjct  440   LSRMEGIPSQSHVVRGASGKYFYFIVFNVFLGVTLFGTVFSSLAGFQTLFNSKNFSVSSV  499

Query  852   lps-------saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAP  694
             +          A +F+TFVAL+FFVGYGLELSR+VPL ++HLKK + CKT  E++EAW P
Sbjct  500   VSLFGSKLPPVAAYFITFVALQFFVGYGLELSRVVPLAVYHLKKTFFCKTQKELEEAWEP  559

Query  693   GDLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYG  514
             G   Y    P D+L+L+I + Y+VIAP+I+ F  +YF +G+++LRNQALKVYVP+FES G
Sbjct  560   GPFEYHNLVPNDILILMISMAYAVIAPMILLFALLYFAIGYVVLRNQALKVYVPAFESGG  619

Query  513   KMWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQS  334
             +MWPH+H+R+VAAL + Q+TM+GY G+KKFPYA LVI LP+ +  FA +C   +Y  F  
Sbjct  620   RMWPHIHSRIVAALFIGQVTMMGYMGIKKFPYAVLVIILPLFTIFFASMCKMNYYPSFNV  679

Query  333   TALEAVSAGKEKKEVPNMDIIFRSFIPPCFGTEK---SDEDHFEDALSQ--------VSR  187
              +L    A ++ KE P M  I  ++ P C  TE+    +  H+EDAL          VSR
Sbjct  680   ISLAI--ASEDVKESPPMRKIIEAYTPECLLTEERALEESAHYEDALESSVSSRPMGVSR  737

Query  186   SAS  178
             S S
Sbjct  738   SNS  740



>ref|XP_001761096.1| predicted protein [Physcomitrella patens]
 gb|EDQ74163.1| predicted protein [Physcomitrella patens]
Length=740

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/289 (49%), Positives = 197/289 (68%), Gaps = 13/289 (4%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIE---DNPNsiislla  859
             SKAEGIPS+SH  RAASGKYFYF + NVF+GVTI   +F + K  +   D     +S + 
Sbjct  440   SKAEGIPSKSHISRAASGKYFYFMIFNVFLGVTIFGAVFSSFKGFKVLIDQQQLSVSKVV  499

Query  858   tslps----saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPG  691
                 +     +T+F+T+VALKFFVGYGLE+SRI+PLII+H+K+K++CKT+ E+++AWAPG
Sbjct  500   ELFGTKLPPVSTYFITYVALKFFVGYGLEISRIIPLIIYHIKRKFLCKTERELEDAWAPG  559

Query  690   DLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGK  511
                Y T  P D+LV+ + L YSVIAP+I+ F  +YF +GWL++RN AL VYVP +ES G+
Sbjct  560   SFSYHTSVPSDLLVVTLTLSYSVIAPMILVFAFLYFAIGWLVMRNSALNVYVPEWESNGR  619

Query  510   MWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQST  331
             MWPH+H R++ AL++ Q+T +G+F VKKFPY   +I LP+ +F F   C + FY+ F   
Sbjct  620   MWPHIHNRILVALLVSQITALGFFAVKKFPYTVFLIFLPLATFAFYLYCKRNFYKSFAVV  679

Query  330   ALEAVSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRS  184
             +L    A +  KE P+MD I +++ P C      + D FEDA  Q +RS
Sbjct  680   SLYV--ASQPVKETPSMDTIVQAYTPTCL----LEGDQFEDADFQDARS  722



>ref|XP_001766634.1| predicted protein [Physcomitrella patens]
 gb|EDQ68487.1| predicted protein [Physcomitrella patens]
Length=749

 Score =   278 bits (711),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 210/310 (68%), Gaps = 18/310 (6%)
 Frame = -3

Query  1020  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL---KSIEDNPNsiisllatsl  850
             EGIPS+SH VRAASGKYFYF V NVF+GVT+  T+F ++   K + ++ N  +S + T  
Sbjct  444   EGIPSQSHLVRAASGKYFYFIVFNVFLGVTLFGTVFSSIAGFKELRNSKNFSVSSVVTLF  503

Query  849   ps----saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLG  682
              S     A +F+T+VAL+ F+GYGLELSR+VPL I+HLK++++ KT  E+  AWAP    
Sbjct  504   GSRLPPVAAYFITYVALQNFIGYGLELSRVVPLAIYHLKRRFLIKTQKELDAAWAPPAFT  563

Query  681   YATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWP  502
             Y T  P D+L+L+I + Y+VIAP+I+ F  +YF +G+++LRNQALKVYVP+FES G+MWP
Sbjct  564   YHTLVPTDILILMISMAYAVIAPLILVFALLYFAIGYVVLRNQALKVYVPAFESGGRMWP  623

Query  501   HMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALE  322
             H+HTR+V AL + Q+TMIGYFG+KKFPYA LVI LP+++ +FA +C   +Y  F+ T+L 
Sbjct  624   HIHTRIVVALFVGQITMIGYFGIKKFPYAVLVILLPLITIIFATMCRINYYPSFRVTSLA  683

Query  321   AVSAGKEKKEVPNMDIIFRSFIPPCFGTEKS---DEDHFEDALSQV-SRSASNV*LHQFV  154
                A ++ KE P +  I   + P C    ++   D D FEDA S + SRS S    +  V
Sbjct  684   I--AVEDVKESPPLRKIIEVYTPSCLLNVETICEDSDKFEDAQSSIGSRSMSRS--NSVV  739

Query  153   SVC---FHGV  133
               C   FH +
Sbjct  740   QTCTEEFHAL  749



>dbj|BAD94517.1| ERD4 protein [Arabidopsis thaliana]
Length=203

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 152/195 (78%), Gaps = 2/195 (1%)
 Frame = -3

Query  780  SRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPGDMLVLIICLCYSVIAPIIIP  601
            SRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YATR PGDML+L I  CYSVIAP+I+ 
Sbjct  1    SRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYATRVPGDMLILTITFCYSVIAPLILI  60

Query  600  FGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVAALILYQLTMIGYFGVKKFP  421
            FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H R++AAL L+Q+ M GY G K F 
Sbjct  61   FGITYFGLGWLVLRNQALKVYVPSYESYGRMWPHIHQRILAALFLFQVVMFGYLGAKTFF  120

Query  420  YAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSAGKEKKEVPNMDIIFRSFIPPCFG  241
            Y  LVIPL I S +F +VC +KFY  F+ TALE   A +E K+ P+++ IFR++IP    
Sbjct  121  YTALVIPLIITSLIFGYVCRQKFYGGFEHTALEV--ACRELKQSPDLEEIFRAYIPHSLS  178

Query  240  TEKSDEDHFEDALSQ  196
            + K +E  F+ A+S+
Sbjct  179  SHKPEEHEFKGAMSR  193



>ref|XP_001776984.1| predicted protein [Physcomitrella patens]
 gb|EDQ58233.1| predicted protein [Physcomitrella patens]
Length=744

 Score =   274 bits (700),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/290 (48%), Positives = 193/290 (67%), Gaps = 13/290 (4%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIP++SH  RAA+GKY+YF V NVF+G+TI   +F +    ++  N     ++  +
Sbjct  440   SKTEGIPTKSHIERAAAGKYYYFMVFNVFLGITIFGAVFSSSAGFKELINQSSISVSKVV  499

Query  849   ps-------saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPG  691
                       AT+++TFVALKFFVGYGLE+SRIVPLIIFH+K+KY+CKT+ E++EAWAPG
Sbjct  500   ELLGSKLPPVATYYITFVALKFFVGYGLEISRIVPLIIFHIKRKYLCKTERELEEAWAPG  559

Query  690   DLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGK  511
                Y T  P D+L+LI+ LCYSVIAP+I+ F  +YF +GWL+ RN ALKV VP +ES G+
Sbjct  560   PFSYHTSVPADLLILIVTLCYSVIAPMILVFSFLYFFIGWLVTRNSALKVQVPEWESNGR  619

Query  510   MWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQST  331
             MWPH+H R + +L++ Q+T +GYF V++FPY   +I LPIL+F F   C + FY  F   
Sbjct  620   MWPHIHNRFLGSLLVSQITALGYFAVQQFPYTVFLIFLPILTFGFYVYCKRNFYPSFAVV  679

Query  330   ALEAVSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSA  181
             +L    A +  KE  + + I  ++ P C      + D +EDA  Q +RSA
Sbjct  680   SLYV--ASQPVKETVSTNTIVEAYTPTCL----LNSDEYEDAEFQDARSA  723



>ref|XP_001770612.1| predicted protein [Physcomitrella patens]
 gb|EDQ64595.1| predicted protein [Physcomitrella patens]
Length=734

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 183/267 (69%), Gaps = 9/267 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIE---DNPNsiisll  862
             LS+ EG P++S  VR+AS KYFYF + NVF+GVTI   +F  L S +   D  N  +S +
Sbjct  441   LSRLEGFPAQSQIVRSASAKYFYFVIFNVFLGVTIFGAVFSNLSSFQVLLDQSNLSVSRV  500

Query  861   atslps----saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAP  694
                L S     A++F+T+VAL+FFVGYGLELSRI+P IIFHLK+K+ CKTD E++EAWAP
Sbjct  501   VQLLGSKLPPVASYFITYVALRFFVGYGLELSRIIPFIIFHLKRKFKCKTDREVREAWAP  560

Query  693   GDLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYG  514
             G   Y      DML+L I LCY+VIAP+I+ F A YFGLGWL++RNQAL V+VP FES+G
Sbjct  561   GAFKYHKSVASDMLILTITLCYAVIAPLILIFAAAYFGLGWLVMRNQALNVHVPDFESHG  620

Query  513   KMWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQS  334
               WPH+H RV+AAL + Q+T IGYFG+K+FP++P +I LPIL+ +F   C K +Y   + 
Sbjct  621   SFWPHIHNRVLAALFVAQITAIGYFGIKEFPFSPFLIVLPILTVVFYMFCKKNYYPSIKV  680

Query  333   TALEAVSAGKEKKEVPNMDIIFRSFIP  253
              +L    A    K  P+ + I  ++ P
Sbjct  681   VSLYV--AADVPKAQPSAESIAHTYTP  705



>ref|XP_001762227.1| predicted protein [Physcomitrella patens]
 gb|EDQ73019.1| predicted protein [Physcomitrella patens]
Length=733

 Score =   261 bits (667),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 183/270 (68%), Gaps = 9/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-------EDNPNsi  874
             LS AEG PS+S  VR+AS KYFYF + NVF+GVTI   +F  L S+       + + N +
Sbjct  440   LSHAEGFPSQSQVVRSASSKYFYFIIFNVFLGVTIFGAVFSNLSSVKILVQQSQLSANKV  499

Query  873   isllatslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAP  694
             ++LL + LP  A++++T+VAL+FF+GYGLELSR++PL IFH K+K+ CKT+ E+KEAWAP
Sbjct  500   VTLLGSKLPPVASYYITYVALRFFIGYGLELSRLIPLCIFHFKRKFKCKTERELKEAWAP  559

Query  693   GDLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYG  514
             G   Y    P D+L+L I LCYSVIAP++IPF   Y+ LGW + RNQAL V+VP FES+G
Sbjct  560   GAFTYHKSIPNDLLILTISLCYSVIAPMVIPFAFTYYVLGWFVQRNQALNVHVPDFESHG  619

Query  513   KMWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQS  334
              MWPH+H R++AAL + Q+T +GYFGVK+F + P++I LP+ + +F   C K +Y     
Sbjct  620   SMWPHIHNRILAALFVAQITALGYFGVKEFLFTPILIILPVATVIFYMFCKKNYYPSIVV  679

Query  333   TALEAVSAGKEKKEVPNMDIIFRSFIPPCF  244
              +L   +A +  K  P+   I   + P C 
Sbjct  680   VSL--WTAAETPKSRPSEGAIAYEYTPSCL  707



>gb|EYU19152.1| hypothetical protein MIMGU_mgv1a001965mg [Erythranthe guttata]
Length=626

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPSESHA RAASGKYFYF+VLNVFIGVTIGSTLF T K IE++PNSI+ LLA S
Sbjct  446   LSKQEGIPSESHAQRAASGKYFYFSVLNVFIGVTIGSTLFTTFKEIEEHPNSIVDLLAKS  505

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP SATFFLTFVALKFFVGYG+ELSRI+PL+++HL+KKY+CK++ E++EAWAPGDLGYAT
Sbjct  506   LPGSATFFLTFVALKFFVGYGIELSRIIPLLVYHLQKKYVCKSENELREAWAPGDLGYAT  565

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQAL  547
             R PGDML++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQ +
Sbjct  566   RIPGDMLIVTIVLCYSVIAPLIIPFGIVYFGLGWLVLRNQVI  607



>gb|KDO75369.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=615

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  1029  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  850
             SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  442   SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  501

Query  849   pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  670
             P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  502   PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  561

Query  669   FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYV  535
              P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQ + +++
Sbjct  562   VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQVMSIFL  606



>gb|KJB57182.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=610

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SH +RAASGKYFYF V NVFIGVTIG TLF ++K+IE+ PNS+  +LA S
Sbjct  441   LSKTEGIPSGSHVIRAASGKYFYFIVFNVFIGVTIGGTLFASIKTIEEKPNSVFDMLAKS  500

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CK +AE++EAW PGD+ YAT
Sbjct  501   LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKNEAELREAWFPGDINYAT  560

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQ  553
             R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQ
Sbjct  561   RVPSDMLIVTIVLCYSVIAPVIIPFGVLYFALGWLVLRNQ  600



>gb|KJB57184.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=622

 Score =   238 bits (607),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SH +RAASGKYFYF V NVFIGVTIG TLF ++K+IE+ PNS+  +LA S
Sbjct  441   LSKTEGIPSGSHVIRAASGKYFYFIVFNVFIGVTIGGTLFASIKTIEEKPNSVFDMLAKS  500

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
             LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CK +AE++EAW PGD+ YAT
Sbjct  501   LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKNEAELREAWFPGDINYAT  560

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQ  553
             R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQ
Sbjct  561   RVPSDMLIVTIVLCYSVIAPVIIPFGVLYFALGWLVLRNQ  600



>gb|AFK47057.1| unknown [Medicago truncatula]
Length=160

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 129/162 (80%), Gaps = 2/162 (1%)
 Frame = -3

Query  657  MLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVA  478
            M ++ I LCYS IAP+IIPFGA+YFGLGWL+LRNQALKVYVP +ESYG+MWPH++ R++A
Sbjct  1    MQIVTIVLCYSCIAPLIIPFGALYFGLGWLVLRNQALKVYVPRYESYGRMWPHINNRILA  60

Query  477  ALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAVSAGKEK  298
            +++LYQ+TM GYFGV++F YAPL+IPLPIL+ LF F+CSKKFY  FQ  ALE   A  E 
Sbjct  61   SMVLYQVTMFGYFGVQQFVYAPLLIPLPILTVLFGFICSKKFYPSFQHQALEV--AASEV  118

Query  297  KEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV  172
            KEVPNM++I+RSFIP     EK D+D FE A  +VSR  S V
Sbjct  119  KEVPNMELIYRSFIPLSLSFEKIDDDQFEGARFEVSRQTSFV  160



>ref|XP_007024954.1| Early-responsive to dehydration stress protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY27576.1| Early-responsive to dehydration stress protein isoform 2, partial 
[Theobroma cacao]
Length=618

 Score =   230 bits (586),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 125/160 (78%), Gaps = 18/160 (11%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             LSK EGIPS SH VRAASGKYFYFTV NVFIGVT+G+TLF T KSIE +PN         
Sbjct  440   LSKTEGIPSGSHVVRAASGKYFYFTVFNVFIGVTVGATLFSTFKSIEKDPN---------  490

Query  852   lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  673
                      +   L  FVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGYAT
Sbjct  491   ---------SIFDLLAFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYAT  541

Query  672   RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQ  553
             RFPGDML+L I LCYSVIAP+IIPFG +YF LGWL+LRNQ
Sbjct  542   RFPGDMLILTIVLCYSVIAPVIIPFGVLYFALGWLILRNQ  581



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score =   168 bits (426),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 97/288 (34%), Positives = 161/288 (56%), Gaps = 7/288 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F ++NVF+G  I  T F+ L S I  + N +   +  
Sbjct  448   MSKFEGFTSLSSLERRSASRYYLFQLVNVFLGSIITGTAFEQLNSFIHQSANEVPKTIGV  507

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  508   AIPMKATFFITYIMVDGWAGIAGEILRVKPLIIYHLKNFFLVKTEKDREEAMDPGSLGFN  567

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ PI++PF  V+FGL +L+ R+Q + VY   +ES    WP +
Sbjct  568   TGEPQIQLYFLLGLVYAVVTPILLPFIVVFFGLAYLVFRHQIINVYNQEYESAAAFWPDV  627

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  628   HGRIITALIISQLLLMGLLSTKRAAQSTPLLIALPVLTIWFHRFCKSRYEPAFIRYPLQE  687

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVS  190
                    E+   PN+++   +  +++ P F  E  D D F + L + S
Sbjct  688   AMMKDTLERAREPNLNLKGYLQNAYVHPVFKGEDEDSDAFTEELQKES  735



>gb|AAC79116.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score =   164 bits (415),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 98/282 (35%), Positives = 157/282 (56%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  340   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  399

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  400   SIPMKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  459

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  460   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQVINVYDQKYESGARYWPDV  519

Query  495   HTRVVAALILYQLTMIGYFGVKKFP-YAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KKF     L++P PIL+F F   C+ +F   F    L+ 
Sbjct  520   HRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFYRYCAGRFESAFSKFPLQE  579

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F     D     D
Sbjct  580   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGNDFDRPRVVD  621



>ref|XP_002874888.1| hypothetical protein ARALYDRAFT_352535 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51147.1| hypothetical protein ARALYDRAFT_352535 [Arabidopsis lyrata subsp. 
lyrata]
Length=776

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/282 (35%), Positives = 157/282 (56%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  453   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  512

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  513   SIPMKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  572

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  573   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQVINVYDQKYESGARYWPDV  632

Query  495   HTRVVAALILYQLTMIGYFGVKKFP-YAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KKF     L++P PIL+F F   C+ +F   F    L+ 
Sbjct  633   HRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFYRYCAGRFESAFSKFPLQE  692

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F     D     D
Sbjct  693   AMVKDTLEKATEPNLNLKEYLKEAYVHPVFKGNDFDRPRAVD  734



>ref|NP_192199.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q9SY14.1|CSCL2_ARATH RecName: Full=CSC1-like protein At4g02900 [Arabidopsis thaliana]
 gb|AAD15333.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77775.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82248.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34619.1| hyperosmolality-gated Ca2+ permeable channel 1.7 [Arabidopsis 
thaliana]
Length=785

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/282 (35%), Positives = 157/282 (56%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQVINVYDQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFP-YAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KKF     L++P PIL+F F   C+ +F   F    L+ 
Sbjct  625   HRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFYRYCAGRFESAFSKFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F     D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGNDFDRPRVVD  726



>ref|XP_001782141.1| predicted protein [Physcomitrella patens]
 gb|EDQ53035.1| predicted protein, partial [Physcomitrella patens]
Length=735

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 148/276 (54%), Gaps = 8/276 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             ++K EG  + S   R A+ KY+ F V+N+F G     T F  LK+   + + +  L   +
Sbjct  460   ITKLEGHLAVSKIERRAAAKYYIFVVVNIFFGSIFTGTAFQQLKTFVTSSSFLDFLNTLA  519

Query  852   lp--ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
                   A+FF+T++ +  + G   E+ R+ PL+ +H++    C+TD +  EA  PG L  
Sbjct  520   SSIPQKASFFITYIMVDGWSGPAGEILRLKPLVKYHIRNMLFCRTDKDRLEAADPGTLSL  579

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
                 P   L  ++ L YSVI PIIIPF  V+ G G+L+ RNQ + VY P +ES G  W H
Sbjct  580   DESLPQLQLYFLMGLVYSVITPIIIPFIVVFMGFGFLVYRNQVINVYDPEYESAGAFWTH  639

Query  498   MHTRVVAALILYQLTMIGYFGVKK-FPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALE  322
             +H R++AALI+  LT+IG F V + F   P ++ LPIL+ +F   C K+F   F    LE
Sbjct  640   VHGRIIAALIIEHLTLIGLFLVNESFSSTPFMVALPILTLVFHNYCKKRFEAAFTHYPLE  699

Query  321   AVSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKS  229
                     EK+E PN+D+   +  ++  P F  E  
Sbjct  700   NAMEKDMIEKQEEPNLDLTIFLRNAYNHPDFDDEDD  735



>ref|XP_002975592.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
 gb|EFJ23221.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
Length=759

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 161/287 (56%), Gaps = 9/287 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  856
             +SK EG  + S    + S KY+YF V+NVF    I    F+ LK+  + +P+ I  +LA 
Sbjct  446   MSKIEGHLALSQLEVSTSAKYYYFMVVNVFFASVIAGAAFEQLKTFFQQSPSQIPVILAG  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  +     ++ RI PLI++HLK  ++ KTD + + A +PG  G+ 
Sbjct  506   SIPQKATFFITYIMVDGWASIAADIMRIKPLIVYHLKNMFLVKTDKDRENAMSPGSAGFD  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T FP   L  ++   YS+I P I+PF  VY    +++ R+Q + VY P +ES    WPH+
Sbjct  566   TVFPQLELYFLLGTVYSIITPFILPFIIVYLAFAYVVYRHQVINVYDPEYESAAAFWPHI  625

Query  495   HTRVVAALILYQLTMIGYF-GVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ +L++ Q+T+ G F G +     PL+I LPI++ +F + C  +F   F+   LE 
Sbjct  626   HNRIIVSLLVEQITLFGVFAGKRAAASTPLLIGLPIMTIVFHYYCKNRFEPAFRKYPLEE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF--GTEKSDEDHFEDALS  199
               +    ++   PN +I   +  S++ P F    E+ DE+ F+   S
Sbjct  686   AMSKDIVDRATHPNWNIKTYLQNSYMHPVFKDSEEEMDEEGFDAERS  732



>ref|XP_002973564.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
 gb|EFJ25224.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
Length=759

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 161/287 (56%), Gaps = 9/287 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  856
             +SK EG  + S    + S KY+YF V+NVF    I    F+ LK+  + +P+ I  +LA 
Sbjct  446   MSKIEGHLALSQLEVSTSAKYYYFMVVNVFFASVIAGAAFEQLKTFFQQSPSQIPVILAG  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  +     ++ RI PLI++HLK  ++ KTD + + A +PG  G+ 
Sbjct  506   SIPQKATFFITYIMVDGWASIAADIMRIKPLIVYHLKNMFLVKTDKDRENAMSPGSAGFD  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T FP   L  ++   YS+I P I+PF  VY    +++ R+Q + VY P +ES    WPH+
Sbjct  566   TVFPQLELYFLLGTVYSIITPFILPFIIVYLAFAYVVYRHQVINVYDPEYESAAAFWPHI  625

Query  495   HTRVVAALILYQLTMIGYF-GVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ +L++ Q+T+ G F G +     PL+I LPI++ +F + C  +F   F+   LE 
Sbjct  626   HNRIIVSLLVEQITLFGVFAGKRAAASTPLLIGLPIMTIVFHYYCKNRFEPAFRKYPLEE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF--GTEKSDEDHFEDALS  199
               +    ++   PN +I   +  S++ P F    E+ DE+ F+   S
Sbjct  686   AMSKDIVDRATHPNWNIKTYLQNSYMHPVFKDSEEEMDEEGFDAERS  732



>ref|XP_001754358.1| predicted protein [Physcomitrella patens]
 gb|EDQ80808.1| predicted protein, partial [Physcomitrella patens]
Length=734

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 160/275 (58%), Gaps = 8/275 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsi--islla  859
             LSK EG  S S   R A+ KY+YF V+N+F G  +  + F  LK+   + + +  ++ +A
Sbjct  460   LSKFEGHLSISKLERRAAAKYYYFVVVNIFFGSILTGSAFQQLKTFVTSSSVLGFLNTIA  519

Query  858   tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
              S+P  A+FF+T++ +  + G   E+ R+ PL+ +H+K    CKTD++  EA +PG L  
Sbjct  520   LSIPQKASFFITYIMVDGWSGPAGEILRLTPLVKYHVKNTLFCKTDSDRLEAASPGTLTL  579

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
                 P   L  ++ L YSVI P+IIPF  V+ G G+++ R+Q + VY  ++ES G  WPH
Sbjct  580   DETLPQLQLYFLMGLVYSVITPVIIPFIVVFMGFGFVVYRHQIINVYDSAYESAGSFWPH  639

Query  498   MHTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKFYRFFQS----  334
             +H R++AALI+  +T+I  F VK      P +I LP+L+ +F   C K+F   F++    
Sbjct  640   VHGRIIAALIIEHVTLISLFLVKDSCSSTPFMIALPVLTLVFNNYCKKRFEPAFKNYPVE  699

Query  333   TALEAVSAGKEKKEVPNMDIIFRS-FIPPCFGTEK  232
             TA+E  +  + ++   N+ + FR+ +  P F  EK
Sbjct  700   TAVEKDTIDRREEPDLNLAVFFRNAYNHPAFSDEK  734



>ref|XP_010430503.1| PREDICTED: CSC1-like protein At4g02900 [Camelina sativa]
Length=770

 Score =   162 bits (410),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 157/282 (56%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRVVPLVVFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFP-YAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KK      L++P PIL+F F   C+ +F   F    L+ 
Sbjct  625   HRRLIICLIISQLLMMGLLSTKKLAKVTALLLPQPILTFWFNRYCAGRFESAFSKFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGKDFDRPRVVD  726



>ref|XP_010422520.1| PREDICTED: CSC1-like protein At4g02900 [Camelina sativa]
Length=770

 Score =   162 bits (410),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 157/282 (56%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRVVPLVVFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFP-YAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KK      L++P PIL+F F   C+ +F   F    L+ 
Sbjct  625   HRRLIICLIISQLLMMGLLSTKKLAKVTALLLPQPILTFWFNRYCAGRFESAFSKFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGKDFDRPRVVD  726



>ref|XP_006396516.1| hypothetical protein EUTSA_v10029277mg, partial [Eutrema salsugineum]
 gb|ESQ37969.1| hypothetical protein EUTSA_v10029277mg, partial [Eutrema salsugineum]
Length=766

 Score =   162 bits (410),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 157/282 (56%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRLVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KK   A  L++P PIL+  F   C+ +F   F    L+ 
Sbjct  625   HRRLIICLIISQLLMMGLLSTKKLAKATALLLPQPILTIWFNRYCAGRFESAFSRFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLRDAYVHPVFKGKDIDRPRVVD  726



>ref|XP_007040776.1| Early-responsive to dehydration stress protein isoform 1 [Theobroma 
cacao]
 gb|EOY25277.1| Early-responsive to dehydration stress protein isoform 1 [Theobroma 
cacao]
Length=791

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 150/265 (57%), Gaps = 2/265 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R AS KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446   MSKIEGHIALSTLERRASAKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + ++A  PG + Y 
Sbjct  506   SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFLVKTERDREKAMDPGSVDYP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  566   ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISQLLLMGLLSTKKAANSTPLLVILPILTLAFHKYCKNRFEPAFRKYPLEE  685

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCF  244
               A          D+  ++F+   +
Sbjct  686   AMAKDIMDRTTEPDLNLKAFLADAY  710



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 156/279 (56%), Gaps = 7/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             ++K EG PS+S   R A+ +Y+ F+++NVF+G  I  T F+ L S I  +   I   +  
Sbjct  448   MAKFEGYPSKSSLERRAASRYYLFSLVNVFLGSIIAGTAFEQLDSFIHQSATEIPKTIGV  507

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KTD + +EA  PG +G+ 
Sbjct  508   AIPMKATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTDKDREEAMNPGSIGFN  567

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L L++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568   TGEPRIQLYLLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  627

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL + G    KK   + P +I LP+L+  F   C  +F   F+   L+ 
Sbjct  628   HGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLWFHRYCKGRFEPAFKRYPLQE  687

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDH  217
                    E+   PN+++   +  ++I P F     +EDH
Sbjct  688   AMMKDTLEQAREPNLNLKGYLQSAYIHPVFKECDDEEDH  726



>ref|XP_007040777.1| Early-responsive to dehydration stress protein isoform 2 [Theobroma 
cacao]
 gb|EOY25278.1| Early-responsive to dehydration stress protein isoform 2 [Theobroma 
cacao]
Length=804

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 150/265 (57%), Gaps = 2/265 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R AS KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446   MSKIEGHIALSTLERRASAKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + ++A  PG + Y 
Sbjct  506   SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFLVKTERDREKAMDPGSVDYP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  566   ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISQLLLMGLLSTKKAANSTPLLVILPILTLAFHKYCKNRFEPAFRKYPLEE  685

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCF  244
               A          D+  ++F+   +
Sbjct  686   AMAKDIMDRTTEPDLNLKAFLADAY  710



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 156/274 (57%), Gaps = 7/274 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S+  R ++GKY  F ++NVF+G  I  T F+ L   + ++ N I   +  
Sbjct  444   MSKIEGFTSLSYLERRSAGKYHLFILVNVFLGSIITGTAFEQLHQFVNESANEIPKTVGA  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T+  +  + G   E+ R+VPLIIFHLK  ++ KT+ + ++A  PG + +A
Sbjct  504   TVPMKATFFITYTMVDGWAGIAAEILRLVPLIIFHLKNTFLVKTEKDREQAMDPGSIAFA  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L YSV+API++PF  V+FGL +L+ R+Q + VY   +ES    WP +
Sbjct  564   SSEPRIQLYFLLGLVYSVVAPILLPFIVVFFGLAYLVFRHQIINVYDQKYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  +I+ QL ++G    K    + PL++ LPIL+  F  +C  +F   F    L+ 
Sbjct  624   HWRLIIGMIISQLLLMGLLSTKDAELSTPLLVVLPILTIWFHRICKNRFESAFVKFPLQD  683

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEK  232
               V    E+   PN+++   +  ++I P F   +
Sbjct  684   AMVKDTLERATEPNLNLKNYLQDAYIHPVFKDNQ  717



>ref|XP_010664612.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Vitis vinifera]
Length=624

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/272 (34%), Positives = 154/272 (57%), Gaps = 7/272 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             LSK EG  + S   R +S KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  298   LSKIEGYIALSTLERRSSAKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  357

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + + 
Sbjct  358   SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFLVKTERDREHAMNPGSVDFP  417

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   + + R+Q + VY   +ES    WPH+
Sbjct  418   ETIPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYFIYRHQVINVYNQQYESGAAFWPHV  477

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    KK   + PL+I LPIL+  F   C  +F   F+   LE 
Sbjct  478   HSRIIASLLISQLLLMGLLSTKKAANSTPLLIALPILTLTFHKYCKNRFEPAFRKYPLEE  537

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGT  238
               A    E+   PN++I   +  +++ P F +
Sbjct  538   AMAKDTMERTTEPNLNIKAYLADAYLHPIFQS  569



>ref|XP_010522697.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Tarenaya hassleriana]
Length=785

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 157/282 (56%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T+V +  + G   E+ R+VPLIIFHLK  ++ KT+ + ++A  PG L ++
Sbjct  505   SIPMKATFFITYVMVDGWAGVAAEILRLVPLIIFHLKNTFLVKTEQDRQQAMDPGHLDFS  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  K WP +
Sbjct  565   ISEPRIQFYFLLGLVYAAVTPILLPFIIVFFTFSYIVFRHQVINVYDQKYESGAKYWPSV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  L++ QL M+G    KK   A  +++PLPIL+  F   C+ +F   F    L+ 
Sbjct  625   HRRLIICLLISQLLMMGLLSTKKLAMATAMLLPLPILTIWFNRYCAGRFESAFSKFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  ++ D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLRGAYVHPMFKGQEMDRPQVVD  726



>ref|XP_012066469.1| PREDICTED: CSC1-like protein At1g32090 [Jatropha curcas]
 gb|KDP46674.1| hypothetical protein JCGZ_12198 [Jatropha curcas]
Length=797

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 166/306 (54%), Gaps = 15/306 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R A+ KY+YF ++NVF+G  I  T F+ L S +  +P  I   +  
Sbjct  446   MSKIEGYIAVSTLERRAAAKYYYFMLVNVFLGSIIAGTAFEQLHSFLHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + + 
Sbjct  506   SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDRENAMDPGSVDFP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F L +L+ R+Q + VY   +ES G  WPH+
Sbjct  566   ETLPSLQLYFLLGIVYAVVTPILLPFILVFFALAYLVYRHQIINVYNQQYESAGAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISQLLLMGLLSTKKAANSTPLLVILPILTLTFHKYCKSRFEPAFRKYPLEE  685

Query  318   VSAGK--EKKEVPNMDI-----------IFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
               A    ++   P++++           IF SF        + D+     A +++S  +S
Sbjct  686   AMAKDISDRTTEPDLNLKAYLADAYLHPIFHSFEEEELVEVRVDKHEAHVASARMSERSS  745

Query  177   NV*LHQ  160
                 HQ
Sbjct  746   PSPPHQ  751



>ref|XP_010522696.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Tarenaya hassleriana]
Length=800

 Score =   160 bits (406),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 157/282 (56%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T+V +  + G   E+ R+VPLIIFHLK  ++ KT+ + ++A  PG L ++
Sbjct  505   SIPMKATFFITYVMVDGWAGVAAEILRLVPLIIFHLKNTFLVKTEQDRQQAMDPGHLDFS  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  K WP +
Sbjct  565   ISEPRIQFYFLLGLVYAAVTPILLPFIIVFFTFSYIVFRHQVINVYDQKYESGAKYWPSV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  L++ QL M+G    KK   A  +++PLPIL+  F   C+ +F   F    L+ 
Sbjct  625   HRRLIICLLISQLLMMGLLSTKKLAMATAMLLPLPILTIWFNRYCAGRFESAFSKFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  ++ D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLRGAYVHPMFKGQEMDRPQVVD  726



>ref|XP_010522695.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Tarenaya hassleriana]
Length=803

 Score =   160 bits (406),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 157/282 (56%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T+V +  + G   E+ R+VPLIIFHLK  ++ KT+ + ++A  PG L ++
Sbjct  505   SIPMKATFFITYVMVDGWAGVAAEILRLVPLIIFHLKNTFLVKTEQDRQQAMDPGHLDFS  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  K WP +
Sbjct  565   ISEPRIQFYFLLGLVYAAVTPILLPFIIVFFTFSYIVFRHQVINVYDQKYESGAKYWPSV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  L++ QL M+G    KK   A  +++PLPIL+  F   C+ +F   F    L+ 
Sbjct  625   HRRLIICLLISQLLMMGLLSTKKLAMATAMLLPLPILTIWFNRYCAGRFESAFSKFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  ++ D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLRGAYVHPMFKGQEMDRPQVVD  726



>ref|XP_006287199.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
 gb|EOA20097.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
Length=685

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 141/239 (59%), Gaps = 2/239 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYNQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFP-YAPLVIPLPILSFLFAFVCSKKFYRFFQSTALE  322
             H R++  LI+ QL M+G    KKF     L++P PIL+F F   C+ +F   F    L+
Sbjct  625   HRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFNRYCAGRFESAFSKFPLQ  683



>ref|XP_002273732.1| PREDICTED: CSC1-like protein At1g32090 isoform X1 [Vitis vinifera]
 emb|CBI23272.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   160 bits (404),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 92/272 (34%), Positives = 154/272 (57%), Gaps = 7/272 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             LSK EG  + S   R +S KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446   LSKIEGYIALSTLERRSSAKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + + 
Sbjct  506   SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFLVKTERDREHAMNPGSVDFP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   + + R+Q + VY   +ES    WPH+
Sbjct  566   ETIPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYFIYRHQVINVYNQQYESGAAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    KK   + PL+I LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISQLLLMGLLSTKKAANSTPLLIALPILTLTFHKYCKNRFEPAFRKYPLEE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGT  238
               A    E+   PN++I   +  +++ P F +
Sbjct  686   AMAKDTMERTTEPNLNIKAYLADAYLHPIFQS  717



>gb|KHG26829.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=807

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 148/265 (56%), Gaps = 2/265 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R AS KY+YF ++NVF+G  +  T F  L S +   P  I   +  
Sbjct  446   MSKIEGHIAISTLERRASAKYYYFMLVNVFLGSIVTGTAFQQLHSFLHQPPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + Y 
Sbjct  506   SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDREMAMDPGSVDYP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  566   ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    K+   + PLV+ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISQLLLMGLLSTKEAANSTPLVVILPILTLSFHKYCKSRFEPAFRKHPLEE  685

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCF  244
               A     +    DI  ++F+   +
Sbjct  686   AMAKDLMDQTTESDINLKAFLADAY  710



>ref|XP_006854105.1| PREDICTED: CSC1-like protein At1g32090 isoform X1 [Amborella 
trichopoda]
 gb|ERN15572.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
Length=760

 Score =   159 bits (403),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 96/286 (34%), Positives = 157/286 (55%), Gaps = 15/286 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R  + KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  447   MSKVEGHLSLSKLERKTAEKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG +  +
Sbjct  507   SIPMKATFFVTYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDRENAMDPGSIELS  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+V+ PI++PF  V+FG  +L+ R+Q + VY   +ES    WPH+
Sbjct  567   NSLPTLQLYFLLGLVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEYESVAAFWPHV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++A+L++ Q  ++G    KK   + PL+I LP+L+  F   C  +F   F+   LE 
Sbjct  627   HGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLTIWFHKYCKSRFEPAFRKYPLEE  686

Query  318   VSAGK--EKKEVPNMDI-----------IFRSFIPPCFGTEKSDED  220
               A    E+ E PN+++           IF+SF     G  + D++
Sbjct  687   AMARDTMERAEEPNLNLMAYLADAYLHPIFQSFDDVEMGEVRVDKN  732



>ref|XP_011626938.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Amborella 
trichopoda]
Length=760

 Score =   159 bits (403),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 96/286 (34%), Positives = 157/286 (55%), Gaps = 15/286 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R  + KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  447   MSKVEGHLSLSKLERKTAEKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG +  +
Sbjct  507   SIPMKATFFVTYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDRENAMDPGSIELS  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+V+ PI++PF  V+FG  +L+ R+Q + VY   +ES    WPH+
Sbjct  567   NSLPTLQLYFLLGLVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEYESVAAFWPHV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++A+L++ Q  ++G    KK   + PL+I LP+L+  F   C  +F   F+   LE 
Sbjct  627   HGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLTIWFHKYCKSRFEPAFRKYPLEE  686

Query  318   VSAGK--EKKEVPNMDI-----------IFRSFIPPCFGTEKSDED  220
               A    E+ E PN+++           IF+SF     G  + D++
Sbjct  687   AMARDTMERAEEPNLNLMAYLADAYLHPIFQSFDDVEMGEVRVDKN  732



>gb|KFK30892.1| hypothetical protein AALP_AA6G039600 [Arabis alpina]
Length=693

 Score =   159 bits (401),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 156/282 (55%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  370   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  429

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  430   SIPMKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNAFLVKTEQDRQQAMDPGHLDFA  489

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  490   TTEPRIQFYFLLGLVYAAVTPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  549

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KK   A  L++P PIL+  F   C+ +F   F    L+ 
Sbjct  550   HRRLIICLIISQLLMMGLLSTKKLAKATVLLLPQPILTIWFNRYCAGRFESAFSKFPLQE  609

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  610   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGKDFDRPRVVD  651



>gb|KFK30891.1| hypothetical protein AALP_AA6G039600 [Arabis alpina]
Length=684

 Score =   159 bits (401),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 156/282 (55%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  361   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  420

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  421   SIPMKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNAFLVKTEQDRQQAMDPGHLDFA  480

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  481   TTEPRIQFYFLLGLVYAAVTPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  540

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KK   A  L++P PIL+  F   C+ +F   F    L+ 
Sbjct  541   HRRLIICLIISQLLMMGLLSTKKLAKATVLLLPQPILTIWFNRYCAGRFESAFSKFPLQE  600

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  601   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGKDFDRPRVVD  642



>ref|XP_002519965.1| Extensin-3 precursor, putative [Ricinus communis]
 gb|EEF42569.1| Extensin-3 precursor, putative [Ricinus communis]
Length=830

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 148/259 (57%), Gaps = 2/259 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R A+ KY+YF ++NVF+G  I  T F  L S +  +P  I   +  
Sbjct  446   MSKIEGYIAVSTLERRAAAKYYYFMLVNVFLGSIITGTAFQQLHSFLHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + ++A  PG + + 
Sbjct  506   SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDREKAMDPGSVDFP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F L +L+ R+Q + VY   +ES G  WPH+
Sbjct  566   ETLPSLQLYFLLGIVYAVVTPILLPFILVFFALAYLVYRHQVINVYNQQYESAGAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    K+   + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISQLLLMGLLSTKEAANSTPLLVILPILTLAFHKYCKNRFEPAFRKYPLEE  685

Query  318   VSAGKEKKEVPNMDIIFRS  262
               A     +    D+  +S
Sbjct  686   AMAKDITDQTAEPDLNLKS  704



>ref|XP_009134388.1| PREDICTED: CSC1-like protein At4g02900 [Brassica rapa]
Length=769

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 155/282 (55%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRLVPLVVFHLKNAFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+   LI+ QL M+G    KK      L++P PIL+  F   C+ +F   F    L+ 
Sbjct  625   HRRLTICLIISQLLMMGLLSTKKLAKVTVLLLPQPILTIWFYRYCAGRFESAFSRFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGKDLDRPRVVD  726



>emb|CDX90914.1| BnaA03g25940D [Brassica napus]
Length=769

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 155/282 (55%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRLVPLVVFHLKNAFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+   LI+ QL M+G    KK      L++P PIL+  F   C+ +F   F    L+ 
Sbjct  625   HRRLTICLIISQLLMMGLLSTKKLAKVTVLLLPQPILTIWFYRYCAGRFESAFSRFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGKDLDRPRVVD  726



>emb|CDY17981.1| BnaC03g30530D [Brassica napus]
Length=769

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 155/282 (55%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRLVPLVVFHLKNAFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+   LI+ QL M+G    KK      L++P PIL+  F   C+ +F   F    L+ 
Sbjct  625   HRRLTICLIISQLLMMGLLSTKKLAKVTVLLLPQPILTIWFYRYCAGRFESAFSRFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGKDLDRPRVVD  726



>gb|KJB51550.1| hypothetical protein B456_008G222200 [Gossypium raimondii]
Length=709

 Score =   157 bits (396),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 147/265 (55%), Gaps = 2/265 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R AS KY+YF ++NVF+G  +  T F  L S +   P  I   +  
Sbjct  348   MSKIEGHIAISTLERRASAKYYYFMLVNVFLGSIVTGTAFQQLHSFLHQPPTQIPRTIGV  407

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + Y 
Sbjct  408   SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDREMAMDPGSVDYP  467

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  468   ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  527

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    K+   + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  528   HSRIIASLLISQLLLMGLLSTKEAANSTPLLVILPILTLSFHKYCKSRFEPAFRKHPLEE  587

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCF  244
               A          DI  ++F+   +
Sbjct  588   AMAKDLLDRTTEPDINLKAFLADAY  612



>ref|XP_009356857.1| PREDICTED: CSC1-like protein At4g02900 [Pyrus x bretschneideri]
Length=757

 Score =   157 bits (396),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 95/301 (32%), Positives = 160/301 (53%), Gaps = 16/301 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             +SK EG+ S SH  R ++ KY  F ++NVF+G  +  T    L+ + + P++  +     
Sbjct  445   MSKIEGLTSLSHLDRRSAAKYHLFILINVFLGSIVAGTALQQLEKLMNEPSTEFTKTVGR  504

Query  852   lp-ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
                   TFF+T+V +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKGTFFITYVMVDGWSGIAAEILRLVPLILFHLKNTFLVKTEQDREQATDPGSLNFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L YSV+ PI++PF  ++F   +++ R+Q + VY   +ES    WP +
Sbjct  565   TNEPRTQLYFLLGLVYSVVTPILLPFILIFFAFAYVVYRHQIINVYDQKYESGAAFWPQV  624

Query  495   HTRVVAALILYQLTMIGYF---GVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTAL  325
             H RV+  LI+ Q+ ++G F   GV K  +  ++IP PIL+  F  VC  +F   F    L
Sbjct  625   HLRVIIGLIIAQVLLMGLFSTLGVAKSTF--ILIPQPILTIWFHRVCKGRFESAFLKFPL  682

Query  324   EA--VSAGKEKKEVPNMDIIF---RSFIPPCF-----GTEKSDEDHFEDALSQVSRSASN  175
             +   V    E+   PN++++     S++ P F        + D D  E +   V++  S 
Sbjct  683   QEAMVKDTVERATEPNLNLLNYLKDSYVHPVFKGGQMQNHEVDVDEEESSPLVVTKRTSQ  742

Query  174   V  172
             +
Sbjct  743   M  743



>gb|KJB51549.1| hypothetical protein B456_008G222200 [Gossypium raimondii]
Length=807

 Score =   157 bits (396),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 147/265 (55%), Gaps = 2/265 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R AS KY+YF ++NVF+G  +  T F  L S +   P  I   +  
Sbjct  446   MSKIEGHIAISTLERRASAKYYYFMLVNVFLGSIVTGTAFQQLHSFLHQPPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + Y 
Sbjct  506   SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDREMAMDPGSVDYP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  566   ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    K+   + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISQLLLMGLLSTKEAANSTPLLVILPILTLSFHKYCKSRFEPAFRKHPLEE  685

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCF  244
               A          DI  ++F+   +
Sbjct  686   AMAKDLLDRTTEPDINLKAFLADAY  710



>ref|XP_008384098.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=771

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/280 (33%), Positives = 157/280 (56%), Gaps = 10/280 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             ++K EG PS+S   R A+ +Y+ F ++NVF+G  I  T F+ L+S I  +   I   +  
Sbjct  448   MAKFEGYPSKSSLERRAASRYYLFCLVNVFLGSIITGTAFEQLESFIHQSATDIPKTIGV  507

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KTD + +EA  PG +G+ 
Sbjct  508   AIPMKATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNSFLVKTDKDREEAMDPGSIGFN  567

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L +++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568   TGEPRIQLYVLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYKQEYESAAAFWPDV  627

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL + G    KK   + P +I LP+L+  F   C  +F   F++  L+ 
Sbjct  628   HGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLXFHRYCKGRFEPAFKTFPLQE  687

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF---GTEKSDE  223
                    E+   PN+++   +  ++I P F   G E  +E
Sbjct  688   AMMKDTLEQARDPNLNLKGYLQSAYIHPVFKECGDEXDNE  727



>ref|XP_010261636.1| PREDICTED: CSC1-like protein At1g32090 [Nelumbo nucifera]
Length=780

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/299 (32%), Positives = 160/299 (54%), Gaps = 15/299 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R AS KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446   MSKVEGHLSISSLERKASAKYYYFMLVNVFLGSIVTGTAFEQLDSFLHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+  L+I+HLK  ++ KT+ + ++A  PG +G  
Sbjct  506   SIPMKATFFITYIMVDGWAGIASEILRLKSLVIYHLKNMFLVKTERDREKAMDPGSVGLP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+FG  +L+ R+Q + VY   +ES    WPH+
Sbjct  566   ETLPTLQLYFLLGIVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEYESVAAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++  L ++G    K    + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISHLLLMGLLSTKXAANSTPLLVVLPILTLWFHKYCKSRFEPAFRKYPLEE  685

Query  318   VSAGK--EKKEVPNMDI-----------IFRSFIPPCFGTEKSDEDHFEDALSQVSRSA  181
               A    E+   PN+++           IF+SF        + D++      +Q  R+ 
Sbjct  686   AMAKDTMERASEPNLNLKAYLADAYLHPIFQSFEDVELVEVRVDKNQSHMTTNQSPRTT  744



>emb|CDP11732.1| unnamed protein product [Coffea canephora]
Length=798

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 147/265 (55%), Gaps = 2/265 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  ++S   R A+ KY+YF ++NVF+G  I  T F  L++ +  +   I   +  
Sbjct  447   MSKVEGYVAKSTLERKAAAKYYYFMLVNVFLGSIIAGTAFQQLRAFLHQSATQIPRTIGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ +  +A  PG + + 
Sbjct  507   SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFIVKTERDRVKAMDPGSVDFP  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+V+ PI++PF  V+F   + + R+Q + VY   +ES G  WPH+
Sbjct  567   ETLPSLQLYFLLGLVYAVVTPILLPFILVFFAFAYFVYRHQVINVYNQQYESAGAFWPHV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++ +L++ QL ++G    KK   + PL+I LPIL+  F   C  +F   F+   LE 
Sbjct  627   HSRIIWSLLISQLLLMGLLSTKKAANSTPLIIVLPILTLAFHNYCKNRFEPAFRKYPLEE  686

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCF  244
                   +      D+  +SF+   +
Sbjct  687   AMDKDLEDRPSESDVNLKSFLADAY  711



>ref|XP_010276749.1| PREDICTED: CSC1-like protein At1g32090 [Nelumbo nucifera]
Length=739

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 148/265 (56%), Gaps = 2/265 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R+ + KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446   MSKVEGHLSISTIERSTAAKYYYFMLVNVFLGSIVTGTAFEQLDSFLHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+  L+IFHLK  ++ KT+ + ++A  PG +  +
Sbjct  506   SIPMKATFFITYIMVDGWAGIASEILRLKKLVIFHLKNMFLVKTERDKEKAMDPGSVKLS  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+FG  +L+ R+Q + VY   +ES    WPH+
Sbjct  566   ETLPTLQLYFLLGIVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQQYESVAAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++A+L++  L ++G    KK   + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HNRIIASLLISHLLLMGLLSTKKAANSTPLLVVLPILTLWFHKYCKSRFEPAFRRYPLEE  685

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCF  244
               A    +     D+  +S++   +
Sbjct  686   AMAKDTAERASEPDLNLKSYLADAY  710



>ref|XP_009357605.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Pyrus 
x bretschneideri]
Length=771

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/287 (33%), Positives = 157/287 (55%), Gaps = 8/287 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             ++K EG  S S   R A+ +Y+ F+++NVF+G  I  T F+ L S I  +   I   +  
Sbjct  448   MAKFEGYTSVSSLERRAASRYYLFSLVNVFLGSIITGTAFEQLDSFIHQSATDIPQTIGV  507

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KTD + +EA  PG +G+ 
Sbjct  508   AIPMKATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTDKDREEAMDPGSIGFN  567

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568   TGEPQIQLYFLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  627

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL + G    KK   + P +I LP+L+  F   C  +F   F +  L+ 
Sbjct  628   HGRIITALIISQLLLFGLLSTKKAASSTPFLIALPVLTLWFRSYCKGRFEPAFTTYPLQE  687

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDH-FEDALSQ  196
                    E+   PN+++   +  ++I P F     +EDH FE   S+
Sbjct  688   AMMKDTLERAREPNLNLKGYLQSAYIHPVFQECDEEEDHEFEKDESE  734



>ref|XP_008386531.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=757

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 160/301 (53%), Gaps = 16/301 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             +SK EG+ S SH  R ++ KY  F ++NVF+G  +  T    L+ + + P++  +     
Sbjct  445   MSKIEGLTSLSHLDRRSAAKYHLFILINVFLGSIVTGTALQQLEKLMNEPSTEFTKTVGR  504

Query  852   lp-ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
                   TFF+T+V +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKGTFFITYVMVDGWSGIAAEILRLVPLILFHLKNTFLVKTEQDREQATDPGSLNFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L YSV+ PI++PF  ++F   +++ R+Q + VY   +ES    WP +
Sbjct  565   TNEPRTQLYFLLGLVYSVVTPILLPFILIFFAFAYVVYRHQIINVYDQKYESGAAFWPQV  624

Query  495   HTRVVAALILYQLTMIGYF---GVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTAL  325
             H RV+  LI+ Q+ ++G F   GV K  +  ++IP PIL+  F  VC  +F   F    L
Sbjct  625   HLRVIIGLIIAQVLLMGLFSTLGVAKSTF--ILIPQPILTLWFHRVCKGRFESAFLKFPL  682

Query  324   EA--VSAGKEKKEVPNMDIIF---RSFIPPCF-----GTEKSDEDHFEDALSQVSRSASN  175
             +   V    E+   PN++++     +++ P F        + D D  E +   V++  S 
Sbjct  683   QEAMVKDTVERATEPNLNLLNYLKDAYVHPVFKGGQMQNHEVDVDEEESSPLVVTKRTSQ  742

Query  174   V  172
             +
Sbjct  743   M  743



>ref|XP_008455926.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
 ref|XP_008455927.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
Length=649

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 157/281 (56%), Gaps = 10/281 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ KY+ F  +NVF+G  I  T F  L K +  + N I   +  
Sbjct  325   MSKFEGFISRSSLERRSASKYYIFLFVNVFLGSIITGTAFQQLNKFLHQSANDIPKTIGV  384

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+TF+ +  + G   E+ R+ PLII+HL+  ++ KT+ + +EA  PG L + 
Sbjct  385   SIPMKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEAMDPGTLEFN  444

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ P+++PF   +FGL +++ R+Q + VY   +ES    WP +
Sbjct  445   TGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  504

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFY-RFFQSTALE  322
             H R++AAL++ QL ++G    K+   + PL+I LPIL+  F   C  ++   F Q    E
Sbjct  505   HGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRYEPAFVQYPLQE  564

Query  321   AVSAGK-EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFE  211
             A+     E+   PN+++   +  +++ P F   K DED  E
Sbjct  565   AMMKDTLERAREPNLNLKGFLQNAYVHPVF---KHDEDDVE  602



>ref|XP_008455928.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X3 
[Cucumis melo]
Length=629

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 157/281 (56%), Gaps = 10/281 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ KY+ F  +NVF+G  I  T F  L K +  + N I   +  
Sbjct  305   MSKFEGFISRSSLERRSASKYYIFLFVNVFLGSIITGTAFQQLNKFLHQSANDIPKTIGV  364

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+TF+ +  + G   E+ R+ PLII+HL+  ++ KT+ + +EA  PG L + 
Sbjct  365   SIPMKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEAMDPGTLEFN  424

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ P+++PF   +FGL +++ R+Q + VY   +ES    WP +
Sbjct  425   TGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  484

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFY-RFFQSTALE  322
             H R++AAL++ QL ++G    K+   + PL+I LPIL+  F   C  ++   F Q    E
Sbjct  485   HGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRYEPAFVQYPLQE  544

Query  321   AVSAGK-EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFE  211
             A+     E+   PN+++   +  +++ P F   K DED  E
Sbjct  545   AMMKDTLERAREPNLNLKGFLQNAYVHPVF---KHDEDDVE  582



>ref|XP_002969287.1| hypothetical protein SELMODRAFT_91711 [Selaginella moellendorffii]
 gb|EFJ29375.1| hypothetical protein SELMODRAFT_91711 [Selaginella moellendorffii]
Length=761

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 101/282 (36%), Positives = 152/282 (54%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             LSK EG  S S   R A+ K+FYF V NVF       +    LK  +  +P+ I  LL  
Sbjct  447   LSKVEGHLSLSKLDRMAAAKHFYFMVFNVFFASVFTGSALQQLKLFLHKSPSDIPQLLGD  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF++++ +  +     E+ R+ PL+ FH +     KT+ + ++A APG L   
Sbjct  507   AIPLKATFFISYIMVDGWASVAGEILRLKPLLFFHFRNMMFVKTEKDREKAMAPGGLSLN  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+VIAPII+PF   +FG  +L+ RNQ + VY P +ES G  WPH+
Sbjct  567   TALPHVGLYFLLGLVYAVIAPIILPFIVTFFGFSYLVYRNQVINVYHPEYESAGGFWPHI  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVVA++I+ QLT++G    K+   + P +  LP+L+F+F     + F   F    LE 
Sbjct  627   HNRVVASMIIMQLTLLGLLSTKRAASSTPFLAGLPVLTFIFHTYTKRCFESAFVKFPLEE  686

Query  318   VSAGK--EKKEVPNMDI--IFR-SFIPPCFGTEKSDEDHFED  208
               A    ++ + P+ D   +FR S+  P   TE+  E    D
Sbjct  687   ARAKDLIDQAKDPHTDFRSLFRNSYTHPVLKTEEDLEQGHRD  728



>ref|XP_007211353.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
 gb|EMJ12552.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
Length=773

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/279 (33%), Positives = 155/279 (56%), Gaps = 7/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             ++K EG  S+S   R A+ +Y+ FT +NVF+G  I  T F+ L S I  +   I   +  
Sbjct  448   MAKFEGFTSKSSLERRAASRYYLFTFVNVFLGSIIAGTAFEQLDSFIHQSATEIPKTIGV  507

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLIIFHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  508   AIPMKATFFITYIMVDGWAGIAAEILMLKPLIIFHLKNFFLVKTEKDREEAMDPGSIGFN  567

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568   TGEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  627

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVV+ALI+ QL + G    K+   + P +I LP+L+  F   C  +F   F +  L+ 
Sbjct  628   HGRVVSALIISQLLLFGLLSTKRAAQSTPFLIALPVLTIWFYRYCKGRFEPAFVTYPLQE  687

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDH  217
                    E+ + PN+++   +  +++ P F     DED+
Sbjct  688   AMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDEDN  726



>emb|CDP03600.1| unnamed protein product [Coffea canephora]
Length=756

 Score =   154 bits (389),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/296 (31%), Positives = 160/296 (54%), Gaps = 12/296 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ KY  F ++NVF G  I    F+ L+S ++  P  I      
Sbjct  445   MSKIEGFTSLSSLDRRSAAKYHLFLLVNVFFGSIITGAAFEQLQSFLKQAPTEIPKTAGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG + ++
Sbjct  505   AIPMKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNTFLVKTEQDREDAMDPGSINFS  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L YSV+ PI++PF  ++F   +++ R+Q + VY   +ES  K WP +
Sbjct  565   TSEPRIQLYFLLGLVYSVVTPILLPFIIIFFAFAYVVFRHQIINVYDQKYESGAKFWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ AL++ QL ++G    KK   + PL+I LP+L+  F   C  +F   F    L+ 
Sbjct  625   HRRIIVALVISQLLLMGLLSTKKAANSTPLLIVLPVLTIWFHLFCKGRFESAFVKFPLQD  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSD-----EDHFEDALSQVSRSA  181
               V    E+   PN+++   +  ++I P F   + D     +D   + L    R++
Sbjct  685   AMVKDTLERATEPNLNLKAYLHDAYIHPVFKCVQLDKPKAVDDEENNPLVATKRNS  740



>gb|KJB10672.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=608

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 160/292 (55%), Gaps = 9/292 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  284   MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNNFIHQSTNEIPKTIGA  343

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  344   SIPMKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  403

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+++ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  404   TGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEYESAAAYWPDV  463

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LPIL+  F   C  ++   F    L+ 
Sbjct  464   HLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRYEPAFVRNPLQE  523

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
                    E+   PN+++   +  ++I P F +  +D D  + A+ +     S
Sbjct  524   AMMKDTLERAREPNLNLKGFLQNAYIHPVFKS--ADGDKIDVAMEEWEEEPS  573



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/270 (33%), Positives = 154/270 (57%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             ++K EG  S S   R A+ +Y+ F ++NVF+G  I  +  + LK+ +  +P+ I   +  
Sbjct  449   MAKFEGHTSLSSLERRAASRYYLFALVNVFLGSIIAGSALEQLKTFMHQSPSEIPETIGV  508

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLI++HLK  ++ KTD + +EA  PG +G+ 
Sbjct  509   AIPIKATFFITYIMVDGWAGIAAEILMLKPLIMYHLKNTFLVKTDKDREEAMDPGSIGFH  568

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             TR P   L +++ L YS + P+++PF  V+FGL +L+ R+Q + VY   +ES    WP +
Sbjct  569   TREPRIQLYILLGLVYSTMTPVLLPFIVVFFGLAYLVFRHQIINVYNQEYESAAAFWPDV  628

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVV+ALIL QL ++G    K    + P ++PLPI++  F   C+ ++   F    L+ 
Sbjct  629   HGRVVSALILSQLVLMGLLSTKGAKISTPFLLPLPIMTVAFYKYCAGRYEPAFVRYPLQE  688

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF  244
                    E    PN+++   +  +++ P F
Sbjct  689   AKMKDTLEHAREPNLNLKGYLQSAYVHPVF  718



>ref|XP_010430277.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430278.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430279.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430280.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430281.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 162/288 (56%), Gaps = 7/288 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF+G  I  + F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFVSISSLERRAAFRYYIFNLVNVFLGSIITGSAFEQLDSFLKQSANDIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + +EA  PG + + 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGQIDFY  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + P+++PF   +FG  +L+ R+Q + VY   +ES    WP +
Sbjct  567   ATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEYESAAAFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVK-KFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+++ALI+ Q+ ++G    K K    P ++ L IL+F+F   C  ++   F    L+ 
Sbjct  627   HGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFVFHRFCKGRYESAFVINPLQE  686

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVS  190
               +    E+   PNM++   +  ++I P F  E+ ++D F++ L++ S
Sbjct  687   AMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDDQFDEGLTEDS  734



>ref|XP_010418218.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418219.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418220.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   154 bits (389),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 162/288 (56%), Gaps = 7/288 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF+G  I  + F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFVSISSLERRAAFRYYIFNLVNVFLGSIITGSAFEQLDSFLKQSANDIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + +EA  PG + + 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGQIDFY  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + P+++PF   +FG  +L+ R+Q + VY   +ES    WP +
Sbjct  567   ATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEYESAAAFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVK-KFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+++ALI+ Q+ ++G    K K    P ++ L IL+F+F   C  ++   F    L+ 
Sbjct  627   HGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFVFHRFCKGRYESAFVINPLQE  686

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVS  190
               +    E+   PNM++   +  ++I P F  E+ ++D F++ L++ S
Sbjct  687   AMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDDQFDEGLTEDS  734



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score =   154 bits (389),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 99/286 (35%), Positives = 160/286 (56%), Gaps = 10/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + +  + N I   +  
Sbjct  444   MSKFEGFSSISALERRSATRYYIFQFVNVFLGSIITGTAFQQLNNFMHQSANEIPKTVGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGSLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFY-RFFQSTALE  322
             H R++ ALI+ QL ++G    K   ++ PL+I LP+L+  F   C  ++   F +    E
Sbjct  624   HGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIWFHLFCKGRYEPAFIRYPLQE  683

Query  321   AVSAGK-EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQ  196
             AV     E+   PN ++   +  ++I P F   K +ED   DA S+
Sbjct  684   AVMKDTLERTREPNFNLKEYLQDAYIHPVF---KGEEDIESDAASE  726



>ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546613.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546622.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546631.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
Length=776

 Score =   154 bits (389),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 94/286 (33%), Positives = 160/286 (56%), Gaps = 9/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF+G  I  T F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFVSTSTLERRAAFRYYVFNLVNVFLGSIITGTAFEQLDSFLKQSTNQIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG + + 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMNPGQIDFY  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+ + P ++PF  ++FGL +L+ R+Q + VY   +ES    WP +
Sbjct  567   SSEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAFLVFRHQIINVYNQEYESGAAYWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ Q+ ++G    KK   + P +I LPIL+  F   C  ++   F    L+ 
Sbjct  627   HGRIITALIISQILLMGLMSTKKAAQSTPFLIALPILTLGFHRFCKGRYEPAFIRYPLQE  686

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQ  196
               +    E+   PN+D+   + +++I P F  E   ED F+D L +
Sbjct  687   AMIKDTLERAREPNLDLKPYLQKAYIHPVFKDE--GEDRFDDMLEK  730



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score =   154 bits (388),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 157/281 (56%), Gaps = 10/281 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ KY+ F  +NVF+G  I  T F  L K +  + N I   +  
Sbjct  444   MSKFEGFISRSSLERRSASKYYIFLFVNVFLGSIITGTAFQQLNKFLHQSANDIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+TF+ +  + G   E+ R+ PLII+HL+  ++ KT+ + +EA  PG L + 
Sbjct  504   SIPMKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEAMDPGTLEFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ P+++PF   +FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFY-RFFQSTALE  322
             H R++AAL++ QL ++G    K+   + PL+I LPIL+  F   C  ++   F Q    E
Sbjct  624   HGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRYEPAFVQYPLQE  683

Query  321   AVSAGK-EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFE  211
             A+     E+   PN+++   +  +++ P F   K DED  E
Sbjct  684   AMMKDTLERAREPNLNLKGFLQNAYVHPVF---KHDEDDVE  721



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score =   154 bits (388),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 160/286 (56%), Gaps = 10/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + +  + N I   +  
Sbjct  444   MSKFEGFSSISALERRSATRYYIFQFVNVFLGSIITGTAFQQLNNFMHQSANEIPKTVGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGSLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTAL-E  322
             H R++ ALI+ QL ++G    K   ++ PL+I LP+L+  F   C  ++   F    L E
Sbjct  624   HGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIWFHLFCKGRYEPAFVRYPLQE  683

Query  321   AVSAGK-EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQ  196
             AV     E+   PN ++   +  ++I P F   K +ED   DA S+
Sbjct  684   AVMKDTLERTREPNFNLKEYLQDAYIHPVF---KGEEDIESDAASK  726



>ref|XP_011463550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=718

 Score =   153 bits (386),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 94/286 (33%), Positives = 159/286 (56%), Gaps = 8/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  394   MSKFEGFTSISALERRSATRYYIFQFINVFLGSIITGTAFQQLDKFIHQSANDIPITIGV  453

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI++HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  454   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIMYHLKNTFLVKTEKDREEAMDPGTLGFN  513

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  514   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  573

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ AL++ QL ++G    K+   + PL+I LP+L+  F   C  ++   F+   L+ 
Sbjct  574   HGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTISFHRFCKGRYEPAFKKNPLQE  633

Query  318   VSAGKEKKEV--PNMDI---IFRSFIPPCF-GTEKSDEDHFEDALS  199
                    + V  PN+++   +  +++ P F G + SD D   + L 
Sbjct  634   AMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDSDSDGAAEELE  679



>ref|XP_008808245.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Phoenix dactylifera]
Length=759

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 154/268 (57%), Gaps = 7/268 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI--EDNPNsiislla  859
             +SK EG  S S   R ++ KY+ F ++NVF+   I    F+ L +   ++ PN    ++ 
Sbjct  444   MSKIEGYGSVSALERRSAAKYYLFILVNVFLANVIAGAAFEQLDTFVNKETPNKYPVIVG  503

Query  858   tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  679
             T++P+ ATFF+T++ L  + G   E+ R+ PLII+HLK  ++ KT+ + ++A  PG L +
Sbjct  504   TAIPAKATFFITYIMLDGWAGVASEIVRLKPLIIYHLKNAFLVKTEQDREQAMDPGSLDF  563

Query  678   ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  499
             A+  P   L  ++ L YSV+ PI +PF  V+F L +++ R+Q + VY   +ES    WP 
Sbjct  564   ASSEPRIQLYFLLGLVYSVVTPIFLPFIVVFFSLSYVVFRHQIINVYDQEYESGAAFWPD  623

Query  498   MHTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALE  322
             +H R++ A+I+ QLT++G    K   +A P++I LPIL+  F   C  +F   F    L+
Sbjct  624   VHRRLIIAMIISQLTLMGLMSTKDPKHATPVLIALPILTIWFHKYCKSRFEPAFVKFPLQ  683

Query  321   A--VSAGKEKKEVPNMDIIFRSFIPPCF  244
                V    E+ + PN+++  RS++   +
Sbjct  684   EAVVKDTLERAKDPNLNL--RSYLQDAY  709



>gb|KHG10946.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=740

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/284 (33%), Positives = 154/284 (54%), Gaps = 11/284 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++GKY  F ++NVF+G  I  T F  LK+ +   P  I   +  
Sbjct  444   MSKVEGFSSCSSLDRRSAGKYHLFLLINVFLGSIITGTAFQQLKTFLHQPPTEIPKTVGE  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + +EA  PG L +A
Sbjct  504   SIPMKATFFITYIMVDGWAGIAAEILRLVPLVIFHLKNMFLVKTEQDREEAMDPGCLNFA  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L YS + P+++PF  ++F   +++ R+Q + VY   +ES G  WP +
Sbjct  564   TYEPKIQLYFLLGLVYSTVTPVLLPFVIIFFAFSYVVFRHQVINVYAQRYESGGSFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  L++ QL ++G    K    + + ++PLPIL+  F   C  +F   F   +L+ 
Sbjct  624   HRRLLIGLLISQLLLMGLLSTKSVEKSTIALLPLPILTVWFHVYCKGRFQSAFVRFSLQD  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDAL  202
                    E+   PN+++   +  +++ P F        HFE  L
Sbjct  684   AMTKDTLERATEPNLNLRAYLKDAYVHPVF----KGRIHFESPL  723



>ref|XP_004289181.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=767

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/286 (33%), Positives = 159/286 (56%), Gaps = 8/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  443   MSKFEGFTSISALERRSATRYYIFQFINVFLGSIITGTAFQQLDKFIHQSANDIPITIGV  502

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI++HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  503   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIMYHLKNTFLVKTEKDREEAMDPGTLGFN  562

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  563   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  622

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ AL++ QL ++G    K+   + PL+I LP+L+  F   C  ++   F+   L+ 
Sbjct  623   HGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTISFHRFCKGRYEPAFKKNPLQE  682

Query  318   VSAGKEKKEV--PNMDI---IFRSFIPPCF-GTEKSDEDHFEDALS  199
                    + V  PN+++   +  +++ P F G + SD D   + L 
Sbjct  683   AMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDSDSDGAAEELE  728



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/286 (35%), Positives = 155/286 (54%), Gaps = 10/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S+S   R  + +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  444   MSKFEGFISQSSLERRCASRYYIFQFINVFLGSIITGTAFQQLDKFIHQSANEIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI +HLK   + KT+ + +EA  PG +G+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKNFLLVKTEKDREEAMDPGTIGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L YSV+ P ++P+  V+FGL +L+ R+Q + VY   +ES G  WP +
Sbjct  564   TGEPQIQLYFLLGLVYSVVTPFLLPYIIVFFGLAYLVYRHQIINVYNQEYESAGAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+V AL++ QL ++G    K+   + PL+I LP+L+  F   C   +   F +  L+ 
Sbjct  624   HGRIVFALVVSQLLLMGLLSTKEAANSTPLLIALPVLTIWFHRFCKGSYEPAFTTHPLQE  683

Query  318   --VSAGKEKKEVPNM---DIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
               V    E+ + PN    D +  ++I P F     D D   D +SQ
Sbjct  684   AMVKDTLERTKEPNFNLKDFLHDAYIHPVFN---DDGDTDSDVMSQ  726



>ref|XP_004507664.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=773

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 155/285 (54%), Gaps = 8/285 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP-Nsiisllat  856
             +SK EG  S S   R ++ +Y+ F+ +N+F+G  +  T F  L S    P N     + T
Sbjct  446   MSKFEGFGSISSLERRSASRYYLFSFVNIFLGNILTGTAFQQLDSFIHQPANQYPITIGT  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  A+FF+T++ +  + G   E+  + PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  506   AIPLKASFFITYIMVDGWSGIAAEVLMLKPLIIYHLKNFFLVKTEKDREEAMDPGSIGFN  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  566   TGEPRIQLYFLLGLVYAAVTPTVLPFIIIFFGLAYVVFRHQMINVYNQQYESAAAFWPDV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVV ALI+ QL ++G    KK   + P +I LPIL+  F   C  +F   F    L+ 
Sbjct  626   HVRVVIALIVSQLVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFESAFVKYPLQE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALS  199
                    EK   PN++I   +  +++ P F   + D D  EDA+S
Sbjct  686   AMMKDTLEKATDPNLNIKGYLQHAYVHPVFKASQDDVDE-EDAIS  729



>ref|XP_010455942.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Camelina sativa]
Length=770

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/282 (33%), Positives = 154/282 (55%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ K F+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKSFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  AT F+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATIFITYIMVDGWAGIAAEILRVVPLVVFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFP-YAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KK      L++P  IL+F F   C+ +F   F    L+ 
Sbjct  625   HRRLIICLIISQLLMMGLLSTKKLAKVTALLLPQLILTFWFNRYCAGRFESAFSKFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGKDFDRPRVVD  726



>ref|XP_008224710.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Prunus 
mume]
Length=773

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 155/279 (56%), Gaps = 7/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             ++K EG  S+S   R A+ +Y+ F+ +NVF+G  I  T F+ L + I  +   I   +  
Sbjct  448   MAKFEGFTSKSSLERRAASRYYLFSFVNVFLGSIIAGTAFEQLDTFIHQSATEIPKTIGV  507

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLIIFHLK  ++ KTD + +EA  PG +G+ 
Sbjct  508   AIPMKATFFVTYIMVDGWAGIAAEILMLKPLIIFHLKNFFLVKTDKDREEAMDPGSIGFN  567

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568   TGEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  627

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVV+ALI+ QL + G    K+   + P +I LP+L+  F   C  +F   F +  L+ 
Sbjct  628   HGRVVSALIISQLLLFGLLSTKEAAQSTPFLIALPVLTIWFYRYCKGRFEPAFVTYPLQE  687

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDH  217
                    E+ + PN+++   +  +++ P F     DED+
Sbjct  688   AMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDEDN  726



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 160/292 (55%), Gaps = 9/292 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  444   MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNNFIHQSTNEIPKTIGA  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+++ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEYESAAAYWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LPIL+  F   C  ++   F    L+ 
Sbjct  624   HLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRYEPAFVRNPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
                    E+   PN+++   +  ++I P F +  +D D  + A+ +     S
Sbjct  684   AMMKDTLERAREPNLNLKGFLQNAYIHPVFKS--ADGDKIDVAMEEWEEEPS  733



>gb|KJB10674.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=729

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 160/292 (55%), Gaps = 9/292 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  405   MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNNFIHQSTNEIPKTIGA  464

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  465   SIPMKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  524

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+++ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  525   TGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEYESAAAYWPDV  584

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LPIL+  F   C  ++   F    L+ 
Sbjct  585   HLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRYEPAFVRNPLQE  644

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVSRSAS  178
                    E+   PN+++   +  ++I P F +  +D D  + A+ +     S
Sbjct  645   AMMKDTLERAREPNLNLKGFLQNAYIHPVFKS--ADGDKIDVAMEEWEEEPS  694



>ref|XP_010455941.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Camelina sativa]
Length=779

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/282 (33%), Positives = 154/282 (55%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +S+ EG  S S+  R ++ K F+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445   MSQIEGYTSLSYLDRRSAEKSFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  AT F+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATIFITYIMVDGWAGIAAEILRVVPLVVFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565   TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFP-YAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL M+G    KK      L++P  IL+F F   C+ +F   F    L+ 
Sbjct  625   HRRLIICLIISQLLMMGLLSTKKLAKVTALLLPQLILTFWFNRYCAGRFESAFSKFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN+++   +  +++ P F  +  D     D
Sbjct  685   AMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGKDFDRPRVVD  726



>gb|KHG22816.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 154/277 (56%), Gaps = 7/277 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  325   MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNNFIHQSTNEIPKTIGA  384

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  385   SIPMKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  444

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+++ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  445   TGEPQIQLYFLLGLVYAIVTPILLPFIIVFFALAFVVFRHQIINVYNQEYESAAAYWPDV  504

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  505   HLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPVLTIWFHRFCKGRYEPAFVRNPLQE  564

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDE  223
                    E+   PN+++   +  ++I P F +   D+
Sbjct  565   AMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADDDK  601



>ref|XP_004151944.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Cucumis 
sativus]
 ref|XP_011649986.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Cucumis 
sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/281 (34%), Positives = 155/281 (55%), Gaps = 10/281 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ KY+ F  +NVF+G  I  T F  L K +  + N I   +  
Sbjct  444   MSKFEGFISRSSLERRSASKYYIFLFVNVFLGSIITGTAFQQLNKFLHQSANDIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+TF+ +  + G   E+ R+ PLII+HL+  ++ KT+ + +EA  PG L + 
Sbjct  504   SIPMKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEAMDPGTLEFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ P+++PF   +FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++AAL++ QL ++G    K+   + PL+I LPIL+  F   C  ++   F    L+ 
Sbjct  624   HGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFHRFCKGRYEPAFVRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFE  211
                    E+   PN+++   +  +++ P F   K DED  E
Sbjct  684   AMMKDTLERAREPNLNLKGFLQNAYVHPVF---KHDEDDVE  721



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 151/270 (56%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F ++NVF+G  I  T F  L K I  + N I   +  
Sbjct  444   MSKFEGFLSISGLERRSASRYYIFNIVNVFLGSIIAGTAFQQLNKFIHQSANEIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PLIIFHLK  +M KT+ +  EA  PG LG+ 
Sbjct  504   AIPMKATFFITYIMVDGWAGIAAEILRVRPLIIFHLKNFFMVKTEKDRDEAMDPGSLGFD  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQFYFLLGLVYAVVTPILLPFILVFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+++A+++ QL ++G    K    + P ++ LPIL+  F   C  ++   F+   L+ 
Sbjct  624   HGRIISAMVISQLLLMGLMSTKHAALSTPFLLALPILTISFHLYCKGRYEPAFRRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF  244
                    E+ + PN+++   +  ++I P F
Sbjct  684   AMMKDTLERAKEPNLNLKAYLQNAYIHPVF  713



>ref|XP_002301612.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE80885.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=763

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 94/280 (34%), Positives = 157/280 (56%), Gaps = 8/280 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +   I   +  
Sbjct  440   MSKFEGFISISGLERRSAARYYIFQFINVFLGSIITGTAFQQLDNFIHQSATEIPKTIGV  499

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  +M KT+ +++EA  PG LG+ 
Sbjct  500   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKMFFMVKTEKDMEEAMDPGTLGFN  559

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  560   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  619

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ A+I+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  620   HGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHLFCKGRYEPAFVRYPLQE  679

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF-GTEKSDEDH  217
                    E+ + PN+++   +  ++I P F G + SD D 
Sbjct  680   AMMKDTLERAKEPNLNLKSFLQNAYIHPVFKGEDDSDSDE  719



>gb|AFI41197.1| dehydration stress protein, partial [Arabidopsis thaliana]
Length=806

 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 147/257 (57%), Gaps = 4/257 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R A+ KY+YF ++NVF+G  I  T F+ L S +  +P+ I   +  
Sbjct  447   MSKIEGYIAISTLERRAAAKYYYFMLVNVFLGSIIAGTAFEQLHSFLHQSPSQIPRTIGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ +   A  PG + + 
Sbjct  507   SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFIVKTEEDRVRAMDPGFVDFK  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+ + PI++PF  ++F   +L+ R+Q + VY   +ES G  WPH+
Sbjct  567   ETIPSLQLYFLLGIVYTAVTPILLPFILIFFAFAYLVYRHQIINVYNQQYESCGAFWPHV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++A+L++ QL ++G    KK   + PL+I LP+L+  F   C  +F   F+   LE 
Sbjct  627   HGRIIASLLISQLLLMGLLASKKAADSTPLLIILPVLTLSFHKYCKHRFEPAFRQYPLEE  686

Query  318   VSAGK--EKKEVPNMDI  274
               A    EK+  P +++
Sbjct  687   AMAKDKLEKETEPELNM  703



>ref|XP_004300169.1| PREDICTED: CSC1-like protein At1g32090 [Fragaria vesca subsp. 
vesca]
Length=833

 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 158/291 (54%), Gaps = 4/291 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R  + KY+YF ++NVF+G  +  T F  L + +  +P  I   +  
Sbjct  447   MSKIEGHIALSTLERRTAAKYYYFMLVNVFLGSIVTGTAFQQLHAFLHQSPTQIPRNIGE  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++PS ATFF+T++ +  +     E+ R+ PL+IFHLK  ++ KT+ + ++A  PG + + 
Sbjct  507   TIPSKATFFITYIMVDGWAAVAGEILRLKPLVIFHLKNMFLVKTERDREKATNPGSVDFP  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WPH+
Sbjct  567   ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYDQQYESAAAFWPHV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    KK   + P ++ LPIL+  F   C  +F   F+   LE 
Sbjct  627   HSRIIASLLISQLLLMGLLSTKKAANSTPFLVALPILTLSFHKYCKYRFEPAFRKYPLEE  686

Query  318   VSAGKEKKEVPNMDIIFRSFIPPCFGTE--KSDEDHFEDALSQVSRSASNV  172
                  E  +    DI  +S++   +     +S E+  E    +V +  +++
Sbjct  687   AMEKDELDKTTEPDINLKSYLADAYLHPIFRSFEEQHESVKVRVDKQQTHI  737



>ref|XP_010686787.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010686788.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
Length=764

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 155/277 (56%), Gaps = 7/277 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R ++ +Y+ F  +NVF+   I  T  + LK+ +   PN I  ++  
Sbjct  444   MSKFEGFEALSKLERRSASRYYIFNFVNVFLASVITGTAINQLKTFLSQPPNKIFEIIGM  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + + A   G +G+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNWFLVKTEKDREAAMDAGSIGFD  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L +++ L Y+V+ PI++PF  V+FG  +L+ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYILLGLVYAVVTPILLPFILVFFGFSYLVYRHQIINVYNQEYESAAAFWPSV  623

Query  495   HTRVVAALILYQLTMIGYFGVKK-FPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+++A++  QL ++G  G KK    +P +I LPIL+  F   C  +F   F++  L+ 
Sbjct  624   HGRIISAMVFSQLLLMGLIGTKKAASSSPFLIALPILTIWFHRFCKGRFEPAFKTYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDE  223
                    E+   PN ++   +  ++I P F +E  D+
Sbjct  684   AMMKDTLERARDPNFNLKGYLQNAYIHPVFKSEDDDD  720



>ref|XP_010548889.1| PREDICTED: CSC1-like protein At3g21620 [Tarenaya hassleriana]
Length=764

 Score =   151 bits (382),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 157/279 (56%), Gaps = 7/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L S +  + N I   +  
Sbjct  447   MSKFEGFISLSTLERRSATRYYIFQFVNVFLGSIITGTAFQQLNSFLNQSANDIPKTIGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  507   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES G  WP +
Sbjct  567   TGEPQIQLYFLLGLVYAVVSPILLPFILVFFSLAYVVYRHQVINVYNQEYESAGAFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++AAL++ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  627   HGRIIAALVVSQLLLMGLLSTKQAAQSTPLLITLPVLTIWFHVFCRGRYEPAFVKYPLQE  686

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDH  217
               +    EK   PN+++   +  ++  P F   +++ + 
Sbjct  687   AMIKDTLEKTREPNLNLKAFLGNAYAHPVFKAAENEREE  725



>ref|XP_008363487.1| PREDICTED: uncharacterized protein RSN1-like [Malus domestica]
Length=567

 Score =   150 bits (378),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 152/278 (55%), Gaps = 7/278 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S     R ++ +Y+ F  +NVF+G  I  T F  L   I  + N I   +  
Sbjct  241   MSKFEGFGSIXALERRSASRYYIFQFVNVFLGSIITGTAFQQLDEFIHQSANEIPKTIGV  300

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  301   SIPMKATFFITYIMVDGWAGIAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTLGFN  360

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  361   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  420

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  421   HGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHXFCKGRYEPAFIRHPLQE  480

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDED  220
                    E+   PN+++   +  ++I P F  E   E+
Sbjct  481   AMMKDTLERTREPNLNMKGFLQNAYIHPVFKGEDDSEN  518



>ref|XP_010476146.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   151 bits (382),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 156/282 (55%), Gaps = 7/282 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF G  I  + F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFVSLSSLERRAASRYYMFNLVNVFFGSIIAGSAFEQLDSFLKQSANQIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PLI FH+K  ++ KT+ + +EA  PG + Y 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLIFFHIKNFFLVKTEKDREEAMNPGQINYH  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + P+++PF  V+F L +L+ R+Q + VY   +ES  + WP +
Sbjct  567   ATEPRIQLYFLLGLVYAPVTPVLLPFIIVFFALAYLVFRHQIINVYNQEYESGARFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALE-  322
             H R++AALI+ Q+ ++G    K    + P ++ LPIL+F F   C  ++   F    L+ 
Sbjct  627   HGRIIAALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCKGRYEPAFLRHPLKD  686

Query  321   -AVSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
               V    EK   PN ++   + +++I P F  +  ++  F+D
Sbjct  687   AMVKDTLEKAREPNFNLKPYLQKAYIHPVFRDDHYEDSRFDD  728



>ref|XP_010089460.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB37853.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   151 bits (382),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 162/300 (54%), Gaps = 21/300 (7%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  444   MSKFEGFNSISALERRSATRYYIFQFINVFLGSIITGTAFQQLDTFIHQSANKIPETIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T+  +  + G   E+ R+ PLII+H K  ++ KT+ + +EA  PG LG+ 
Sbjct  504   SIPMKATFFITYTMVDGWAGVAGEILRLKPLIIYHFKNFFLVKTEKDREEAMDPGSLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVTPVLLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALE-  322
             H R++ AL++ QL ++G    K+   + PL+I LP+L+  F F C  ++   F +  L+ 
Sbjct  624   HRRIITALVVSQLLLMGLLSTKEATQSTPLLITLPVLTIWFHFFCKGRYEPAFVTYPLQL  683

Query  321   -----AVSAGK---------EKKEVPNMDI---IFRSFIPPCF-GTEKSDEDHFEDALSQ  196
                  + SAG          E+   PN+++   +  +++ P F G + SD D   + L +
Sbjct  684   FLLFVSSSAGSQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKGEDDSDSDAATEDLKE  743



>ref|XP_010458617.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   151 bits (381),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/285 (32%), Positives = 158/285 (55%), Gaps = 7/285 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF+G  I  + F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFVSLSSLERRAASRYYMFNLVNVFLGSIIAGSAFEQLDSFLKQSANQIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PLI FH+K  ++ KT+ + +EA  PG + Y 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLIFFHIKNFFLVKTEKDREEAMNPGQINYH  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + P+++PF  V+F L +L+ R+Q + VY   +ES  + WP +
Sbjct  567   ATEPRIQLYFLLGLVYAPVTPVLLPFIIVFFALAYLVFRHQIINVYNQEYESGARFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALE-  322
             H R+++ALI+ Q+ ++G    K    + P ++ LPIL+F F   C  ++   F    L+ 
Sbjct  627   HGRIISALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCKGRYEPAFLRHPLKD  686

Query  321   -AVSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALS  199
               V    EK   PN ++   + +++I P F  +  ++  F+D  S
Sbjct  687   AMVKDTLEKAREPNFNLKPYLQKAYIHPVFRDDHYEDSRFDDMSS  731



>ref|XP_003612662.1| Membrane protein, putative [Medicago truncatula]
 gb|AES95620.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=799

 Score =   151 bits (382),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 146/257 (57%), Gaps = 4/257 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R  + KY+YF ++NVF+G  I  T F+ L + +  +P  I   +  
Sbjct  446   MSKIEGYIALSTLERKTAAKYYYFMLVNVFLGSIITGTAFEQLHAFLHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+I+HLK  ++ KT+ +  +A  PG + + 
Sbjct  506   SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIYHLKNMFIVKTERDRGKAMDPGSVEFP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WP +
Sbjct  566   ETLPSLQLYFLLGIVYAVMTPILLPFILVFFAFAYLVYRHQIINVYHQQYESAAAFWPQV  625

Query  495   HTRVVAALILYQLTMIGYFGVKK-FPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+LIL Q+ + G    KK     PL+I LPIL+F F   C ++F   F+   +E 
Sbjct  626   HSRIIASLILSQILLFGLLSTKKAVKSTPLLIMLPILTFAFHKYCKRRFEPAFRKYPVEE  685

Query  318   VSAGK--EKKEVPNMDI  274
               A    EK   P+++I
Sbjct  686   AMAKDILEKTTEPDLNI  702



>dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus]
Length=755

 Score =   150 bits (380),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 158/286 (55%), Gaps = 10/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  444   MSKFEGFISLSGLERRSATRYYIFQFINVFLGSIITGTAFQQLDKFIHQSANEIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI +HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKNFFLVKTEKDREEAMDPGTIGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+VI P ++P+  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVITPFLLPYIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDI  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFY-RFFQSTALE  322
             H R++ AL++ QL ++G    K+   + PL+I LP+L+  F   C  ++   F Q    E
Sbjct  624   HGRIIFALVISQLLLMGLLSTKEAANSTPLLIILPVLTIWFHLFCKGRYEPAFVQHPLQE  683

Query  321   AVSAGK-EKKEVPNMD---IIFRSFIPPCFGTEKSDEDHFEDALSQ  196
             A+     E+   P ++    +  ++I P F   KSDED   D +SQ
Sbjct  684   AMMKDTLERAREPQLNYKEFLQNAYIHPVF---KSDEDSDSDVMSQ  726



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 152/278 (55%), Gaps = 7/278 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F  +NVF+G  I  T F+ L S ++ + N I   +  
Sbjct  448   MSKFEGFISLSSLERRAATRYYLFNFVNVFLGSIIAGTAFEQLNSFLKQSANDIPKTIGI  507

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLIIFHLK  ++ KT+ +  EA  PG LG+ 
Sbjct  508   AIPKKATFFITYIMVDGWAGIAGEILMLKPLIIFHLKNFFLVKTEKDRVEAMDPGSLGFN  567

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P      ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568   SGEPRIQFYFLLGLVYATVTPLLLPFIIVFFALAYVVFRHQIINVYNQRYESAAAFWPDV  627

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++AALI+ QL ++G    KK   + P +I LP+L+  F +    ++   F    L+ 
Sbjct  628   HRRIIAALIISQLLLMGLLSTKKAALSTPFLIALPVLTIWFHYFSKDRYESAFVKYPLQE  687

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDED  220
                    E+   PN+++   +  ++I P F  E  D+D
Sbjct  688   AMMKDTLERAREPNLNLKGYLRNAYIHPVFKGEDDDDD  725



>ref|XP_006850790.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Amborella 
trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/270 (33%), Positives = 152/270 (56%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R ++ KY+ F +++VF G  +  T F+ LK  +  +P+ I   +  
Sbjct  446   MSKIEGHIAHSVLERRSAAKYYLFILVSVFFGNVLAGTAFEQLKMFMHQSPDQIPKTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI++HLK   + KT+ + ++A  PG LG+A
Sbjct  506   SIPMKATFFITYILVDGWSGVAAEVLRLKPLIMYHLKNALLVKTEKDREDAMNPGSLGFA  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  566   SSEPQLQLYFLLGLVYAVVTPILLPFIVVFFGLAYMVYRHQIINVYNQEYESAASFWPDV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLV-IPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+V A+++ QL ++G    +    +  V IPLPIL+  F  VC  +F   F    L+ 
Sbjct  626   HGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILTIWFHLVCKSRFESAFVKFPLQE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF  244
                    E+   PN+++   +  ++I P F
Sbjct  686   AMMKDTLERATEPNLNLKVYLQDAYIHPVF  715



>ref|XP_009148626.1| PREDICTED: CSC1-like protein At1g11960 [Brassica rapa]
Length=768

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 161/288 (56%), Gaps = 12/288 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF+G  I  + F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFVSLSSLERRAAFRYYIFNLVNVFLGSIITGSAFEQLDSFLKQSANQIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PLI FH+K  ++ KT+ + +EA  PG + + 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLIFFHVKNFFLVKTEKDREEAMNPGQINFH  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + P+++PF  ++F L +L+ R+Q + VY   +ES G+ WP +
Sbjct  567   ATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEYESAGRFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+++ALI+ Q+ ++G    K    + P +I LP+L+F F   C  ++   F    L+ 
Sbjct  627   HGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLTFFFHRFCKGRYEPAFLRHPLQE  686

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVS  190
               +    E+   PN ++   + +++I P F      +D +ED  S+VS
Sbjct  687   AMIKDTLEQAREPNFNLKPYLKKAYIHPVF-----KDDEYEDVRSEVS  729



>emb|CDX98089.1| BnaA06g08400D [Brassica napus]
Length=768

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 161/288 (56%), Gaps = 12/288 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF+G  I  + F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFVSLSSLERRAAFRYYIFNLVNVFLGSIITGSAFEQLDSFLKQSANQIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PLI FH+K  ++ KT+ + +EA  PG + + 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLIFFHVKNFFLVKTEKDREEAMNPGQINFH  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + P+++PF  ++F L +L+ R+Q + VY   +ES G+ WP +
Sbjct  567   ATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEYESAGRFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+++ALI+ Q+ ++G    K    + P +I LP+L+F F   C  ++   F    L+ 
Sbjct  627   HGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLTFFFHRFCKGRYEPAFLRHPLQE  686

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVS  190
               +    E+   PN ++   + +++I P F      +D +ED  S+VS
Sbjct  687   AMIKDTLEQAREPNFNLKPYLKKAYIHPVF-----KDDEYEDVRSEVS  729



>ref|XP_010657219.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657220.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657221.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657222.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657223.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657224.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 emb|CBI28840.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/288 (33%), Positives = 159/288 (55%), Gaps = 9/288 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +++ F  +NVF+G  I  T F  L S I  + N I  ++ T
Sbjct  444   MSKFEGFISRSALERRSAARFYIFQFINVFLGSIITGTAFQQLNSFIHQSANDIPKIIGT  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ P+II+HLK  +  KT+ + +EA  PG L + 
Sbjct  504   SIPMKATFFITYIMVDGWAGVSGEILRLKPMIIYHLKNFFTVKTEKDREEAMDPGSLSFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVTPILLPFIIVFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ AL++ QL ++G    K+   + PL+I LP+L+  F F C  ++   F    L+ 
Sbjct  624   HMRIIVALVVSQLLLMGLLSTKQAAQSTPLLIALPVLTIWFHFFCKGRYEPAFVRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVS  190
                    E+   PN+++   +  ++  P F  +  D+D   D  ++V 
Sbjct  684   AMMKDTLERVREPNLNLKGYLREAYFHPIF--KAGDDDSEMDEANEVE  729



>ref|XP_011625695.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Amborella 
trichopoda]
Length=765

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/270 (33%), Positives = 152/270 (56%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R ++ KY+ F +++VF G  +  T F+ LK  +  +P+ I   +  
Sbjct  446   MSKIEGHIAHSVLERRSAAKYYLFILVSVFFGNVLAGTAFEQLKMFMHQSPDQIPKTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI++HLK   + KT+ + ++A  PG LG+A
Sbjct  506   SIPMKATFFITYILVDGWSGVAAEVLRLKPLIMYHLKNALLVKTEKDREDAMNPGSLGFA  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  566   SSEPQLQLYFLLGLVYAVVTPILLPFIVVFFGLAYMVYRHQIINVYNQEYESAASFWPDV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLV-IPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+V A+++ QL ++G    +    +  V IPLPIL+  F  VC  +F   F    L+ 
Sbjct  626   HGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILTIWFHLVCKSRFESAFVKFPLQE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF  244
                    E+   PN+++   +  ++I P F
Sbjct  686   AMMKDTLERATEPNLNLKVYLQDAYIHPVF  715



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 155/270 (57%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             ++K EG  S S   R A+ +Y+ F+++NVF+G  I  +  + LK+ +  +P+ I   + T
Sbjct  449   MAKFEGYASRSSLERRAASRYYLFSLVNVFLGSIIAGSALEQLKTFMHQSPSDIPVTIGT  508

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KTD + +EA  PG +G+ 
Sbjct  509   AVPIKATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNTFLVKTDKDREEAMDPGSIGFN  568

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L +++ L Y+ + P+++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  569   TGEPRIQLYILLGLVYATLTPVLLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  628

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+++AL++ QL ++G    KK   + P ++ LP+L+F F   C  +F   F    L+ 
Sbjct  629   HGRILSALLISQLVLLGLLTTKKAAQSTPFLLALPVLTFAFYKYCQGRFEPAFVRYPLQE  688

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF  244
                    E    PN+++   +  +++ P F
Sbjct  689   AKMKDTLESAREPNLNLKGYLQSAYVHPVF  718



>gb|EMS63788.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=792

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R  + KYF F  +NVF+G  +  T F  L S I  + N I   +  
Sbjct  446   MSKIEGHVSLSGLERKTASKYFLFIFVNVFLGSVVAGTAFQQLNSFIHQSTNKIPETIGE  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI+FH+K  ++ +T+ + ++A  PG L + 
Sbjct  506   SIPMKATFFITYIMVDGWAGIAAEVLRLKPLIMFHIKNTFLVRTEQDREQAMDPGSLEFG  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+V+ PII+PF  V+FGL +L+ R+Q + VY   +ES  + WP +
Sbjct  566   STEPRIQLYFLLGLVYAVVTPIILPFIIVFFGLAYLVFRHQIINVYNQQYESGAQFWPDV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKF  352
             H R+V AL++ Q+ +IG    ++   + + ++PLP+L+  F +VC  +F
Sbjct  626   HGRIVTALVISQILLIGLLSTQEADQSTVALLPLPVLTIWFHYVCKGRF  674



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 152/270 (56%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG+ S S   R ++ +Y+ F  +NVF+G  I  T F  L + +  + N I   +  
Sbjct  444   MSKFEGLISTSALERRSATRYYLFQFINVFLGSIITGTAFQQLNNFLHQSANEIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ P II+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAAEILRLKPFIIYHLKNSFLVKTEKDREEAMDPGTLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVTPILLPFILVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ A+I+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F+   L+ 
Sbjct  624   HGRIIFAMIISQLLLMGLLSTKEAAQSTPLLITLPVLTIGFHLFCKGRYEPAFRRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF  244
                    EK   PN+++   +  ++I P F
Sbjct  684   AMMKDTLEKVREPNLNLKGFLQTAYIHPVF  713



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/298 (33%), Positives = 160/298 (54%), Gaps = 14/298 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I    F+ L ++   + N I   +  
Sbjct  444   MSKFEGFCSISALERRSATRYYIFQFVNVFLGSIITGAAFNQLNNLLHQSANEIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGSLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LPIL+  F   C  +F   F    L+ 
Sbjct  624   HGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILTIWFHIFCKGRFEPAFVRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTE-------KSDEDHFEDALSQVSRSA  181
                    E+ + PN ++   +  ++I P F  E        S++   E +L Q  R +
Sbjct  684   TVRKDTLERTKEPNFNLKEFLQNAYIHPVFKGEVDSEIDAASEDGDLEPSLVQTKRQS  741



>ref|XP_006285697.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
 gb|EOA18595.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
Length=763

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 149/258 (58%), Gaps = 5/258 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R A+ +++ F  +NVF+G  +  T F  L K +  + N I   +  
Sbjct  447   MSKFEGFVSTSSLERRAASRFYMFQFINVFLGSIVTGTAFQQLNKFLNQSANDIPKTIGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ +T+ + +EA  PG +G+ 
Sbjct  507   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVRTEKDREEATDPGTIGFN  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ ++PI++PF  V+FGL +++ R+Q + VY   +ES GK WP +
Sbjct  567   TGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAYVVYRHQVINVYNQKYESAGKFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVV ALI+ QL ++G    K    + PL++ LP+L+  F   C  ++   F +  L+ 
Sbjct  627   HRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPMLTIGFHIHCKCRYQPAFVTYPLQQ  686

Query  318   VSAGK---EKKEVPNMDI  274
              +  K   E+   PN+++
Sbjct  687   EAMIKDTLERTREPNLNL  704



>ref|XP_008234907.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Prunus mume]
Length=756

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 154/289 (53%), Gaps = 13/289 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             +SK EG  S S   R ++ KY  F ++NVF+G  +  T    L+ + + P++  +     
Sbjct  445   MSKIEGFTSLSSLDRRSAAKYHLFILINVFLGSIVTGTALQQLEKLMNEPSTEFTKTVGR  504

Query  852   lp-ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
                  ATFF+T++ +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWSGVAAEIVRLVPLILFHLKNTFLVKTEEDREQAMDPGSLNFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y V+ PI++PF  ++F   +L+ R+Q + VY   +ES    WP +
Sbjct  565   TNEPRTQLYFLLGLVYCVVTPILLPFILIFFSFAYLVFRHQIINVYDQKYESAAAFWPQV  624

Query  495   HTRVVAALILYQLTMIGYF---GVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTAL  325
             H RV+  LI+ Q+ ++G F   GV K  +  +++  P+L+  F  VC  +F   F    L
Sbjct  625   HLRVIIGLIISQILLMGLFSTLGVAKSTF--ILVAQPVLTIWFHRVCKGRFESAFLKFPL  682

Query  324   EA--VSAGKEKKEVPNMDIIF---RSFIPPCF--GTEKSDEDHFEDALS  199
             +   V    EK   PN++++     +++ P F  G  +  ED  E+  S
Sbjct  683   QEAMVKDTVEKATEPNLNLMNYLKDAYVHPVFKGGQSQKHEDPDEEDSS  731



>gb|EMT11783.1| Putative membrane protein [Aegilops tauschii]
Length=792

 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 141/242 (58%), Gaps = 2/242 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R  + KYF F  +NVF+G  +  T F  L S I  + N I   +  
Sbjct  446   MSKIEGHVSLSGLERRTASKYFLFIFVNVFLGSVVAGTAFQQLNSFIHQSTNKIPETIGE  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI+FH+K  ++ +T+ + ++A  PG L + 
Sbjct  506   SIPMKATFFITYIMVDGWAGIAAEVLRLKPLIMFHIKNTFLVRTEQDREQAMDPGSLEFG  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+V+ PII+PF  V+FGL +L+ R+Q + VY   +ES  + WP +
Sbjct  566   STEPRIQLYFLLGLVYAVVTPIILPFIIVFFGLAYLVFRHQIINVYNQQYESGAQFWPGV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+V AL++ Q+ +IG    ++   + + ++PLP+L+  F +VC  +F   +    L+A
Sbjct  626   HGRIVTALVISQILLIGLLSTQEAEQSTVALLPLPVLTIWFHYVCKGRFEPAYIKCPLQA  685

Query  318   VS  313
              S
Sbjct  686   GS  687



>emb|CDY30043.1| BnaC05g09770D [Brassica napus]
Length=768

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/288 (31%), Positives = 161/288 (56%), Gaps = 12/288 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF+G  I  + F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFVSLSSLERRAAFRYYIFNLVNVFLGSIITGSAFEQLDSFLKQSANQIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PLI FH+K  ++ KT+ + +EA  PG + + 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLIFFHVKNFFLVKTEKDREEAMNPGQINFH  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + P+++PF  ++F L +L+ R+Q + VY   +ES G+ WP +
Sbjct  567   ATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEYESAGRFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+++ALI+ Q+ ++G    K    + P ++ LP+L+F F   C  ++   F    L+ 
Sbjct  627   HGRIISALIISQVLLLGLMSTKGAAQSTPFLVALPVLTFFFHRFCKGRYEPAFLRHPLQE  686

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVS  190
               +    E+   PN ++   + +++I P F      +D +ED  S+VS
Sbjct  687   AMIKDTLEQAREPNFNLKPYLKKAYIHPVF-----KDDEYEDVRSEVS  729



>gb|EMS63833.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=804

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 158/287 (55%), Gaps = 8/287 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  856
             +SK EG  S S   R  + KY+YF ++NVF+G  I  T F+ L S   D P+ I   +  
Sbjct  443   MSKVEGYVSLSSLERRTASKYYYFMLVNVFLGSIIAGTAFEQLDSFFHDPPSQIPRTIGV  502

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PL+I+HLK  ++ KT+ + + A  P  +   
Sbjct  503   AVPMKATFFMTYIMVDGWAGIANEILRVKPLVIYHLKNMFIVKTERDRERAMDPRSISLG  562

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WP +
Sbjct  563   ENLPSLQLYFLLGLVYAVVTPILLPFIIVFFAFAYLVYRHQIINVYNQEYESAAAFWPQV  622

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTAL-E  322
             H+R++A+L++  +T+ G     K  Y+ PL+I LP+L+  F   C  +F   F+   L E
Sbjct  623   HSRIIASLLISHVTLFGLMSTMKAAYSTPLLIFLPLLTIWFHKYCKSRFEPAFRKYPLEE  682

Query  321   AVSAGK-EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQV  193
             A+   + E    P++++   +  +++ P F   +  ED  E+A  +V
Sbjct  683   AMEKDRMEHASEPSLNLKTYLANAYLHPIFHMFE-QEDQKEEATIEV  728



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 156/282 (55%), Gaps = 10/282 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  444   MSKFEGCISLSVLERRSASRYYFFQFINVFLGSIIAGTAFQQLNNFIHQSTNQIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVTPILLPFIIVFFGLAYVVYRHQIINVYNQEYESGAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  624   HARIIVALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFCKGRYEPAFVRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFED  208
                    E+   PN+++   +  ++  P F   KS +D   D
Sbjct  684   AMMKDTLERAREPNLNLKGFLQSAYTHPVF---KSADDSESD  722



>gb|EMT13890.1| Putative membrane protein [Aegilops tauschii]
Length=801

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/300 (32%), Positives = 161/300 (54%), Gaps = 8/300 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  856
             +SK EG  S S   R  + KY+YF ++NVF+G  I  T F+ L S   D P+ I   +  
Sbjct  443   MSKVEGYVSLSSLERRTASKYYYFMLVNVFLGSIIAGTAFEQLDSFFHDPPSQIPRTIGV  502

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PL+I+HLK  ++ KT+ + + A  P  +   
Sbjct  503   AVPMKATFFMTYIMVDGWAGIANEILRMKPLVIYHLKNMFIVKTERDRERAMDPRSIALG  562

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WP +
Sbjct  563   ENLPSLQLYFLLGLVYAVVTPILLPFIIVFFAFAYLVYRHQIINVYNQEYESAAAFWPQV  622

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTAL-E  322
             H+R++A+L++  +T+ G     K  Y+ PL+I LP+L+  F   C  +F   F+   L E
Sbjct  623   HSRIIASLLISHVTLFGLLSTMKAAYSTPLLIFLPLLTIWFHKYCKSRFEPAFRKYPLEE  682

Query  321   AVSAGK-EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVSRSASNV*LHQFV  154
             A+   + E    P++++   +  +++ P F   +  ED  E+A  +V    S     Q V
Sbjct  683   AMEKDRMEHASEPSLNLKTYLANAYLHPIFHMFE-QEDQKEEATIEVRIDKSEHQQQQHV  741



>ref|XP_004491137.1| PREDICTED: uncharacterized protein RSN1-like [Cicer arietinum]
Length=766

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 156/286 (55%), Gaps = 10/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  444   MSKFEGFISLSALERRSATRYYIFQFINVFLGSIITGTAFQQLDKFIHQSANEIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI +HLK   + KT+ + +EA  PG  G+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKNFLLVKTEKDREEAMDPGTFGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ P ++P+  V+FGL +++ R+Q + VY   +ES G  WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVTPFLLPYIVVFFGLAYVVYRHQIINVYNQEYESAGAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+V AL++ QL ++G    KK   + PL+I LPIL+  F   C   +   F +  L+ 
Sbjct  624   HGRIVFALVISQLLLMGLLSTKKAANSTPLLITLPILTIWFHRFCKGSYEPAFITHPLQE  683

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQ  196
               V    E+ + PN ++   +  ++I P F     DED   D +S+
Sbjct  684   AMVKDTLERTKEPNFNLKEFLQNAYIHPVFN---GDEDTDSDVMSK  726



>ref|XP_010278603.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nelumbo nucifera]
Length=709

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/242 (36%), Positives = 136/242 (56%), Gaps = 1/242 (0%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++GKY  F ++N+F+G  I  T F  L + I   P+ I   +  
Sbjct  445   MSKIEGHTSLSSLERRSAGKYHLFVLVNIFLGSVITGTAFQQLYQFINQPPHEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T+V +  + G   E+ R+ PLI+FHLK  ++ KTD E +EA   G + +A
Sbjct  505   TIPMKATFFITYVMVDGWAGIAAEILRLFPLIVFHLKNTFLVKTDEEREEAMDAGSIDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++   YSV+ P+I+PF  ++F L +++ R+Q + VY   +ES    WP +
Sbjct  565   SFEPQIQLYFLLGFVYSVVTPVILPFIVIFFALSYVVFRHQIINVYDQKYESGAAFWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEAV  316
             H R+V  LI+ QL + G  G K    A L+IP+P+L+  F   C  +F   F    L+  
Sbjct  625   HRRLVIGLIISQLLLXGLMGTKGAGLASLLIPVPVLTIGFHRFCKVRFESAFVKFPLQVR  684

Query  315   SA  310
             S+
Sbjct  685   SS  686



>ref|XP_004146108.1| PREDICTED: CSC1-like protein At1g32090 [Cucumis sativus]
 gb|KGN55705.1| hypothetical protein Csa_3G006670 [Cucumis sativus]
Length=795

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/277 (34%), Positives = 159/277 (57%), Gaps = 7/277 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R A+ KY+YF ++NVF+G  +  T F+ L S I  +P  I   +  
Sbjct  446   MSKIEGHVAVSALERRAAAKYYYFMLVNVFLGSIVTGTAFEQLDSFIHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  +M KT+ +  +A  PG + + 
Sbjct  506   SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNLFMVKTERDRAKAMDPGSVEFP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + YSV+ PI++PF  V+F   +L+ R+Q + VY   +ES G  WPH+
Sbjct  566   ETLPSLQLYFLLGIVYSVVTPILLPFILVFFAFAYLVYRHQIINVYNQHYESVGAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISQLLLLGLLSTKKAANSTPLLVALPILTLFFHKYCKNRFEPAFRKYPLEE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDE  223
               A    E+   P++++   +  +++ P F + + +E
Sbjct  686   AMAKDTLERSTEPDLNVKAFLADAYLHPIFRSFEEEE  722



>gb|AFW81357.1| HYP1 isoform 1 [Zea mays]
 gb|AFW81358.1| HYP1 isoform 2 [Zea mays]
Length=768

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/279 (32%), Positives = 154/279 (55%), Gaps = 7/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG+ S+S   R ++ KY+ F   NVF+G  I  +  + LK+ +  + N I  ++  
Sbjct  444   MSKFEGLISQSSLERRSASKYYIFLFFNVFLGSVIAGSALEQLKTYLHTSANDIPRIIGD  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T+V +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG + + 
Sbjct  504   SIPMKATFFITYVMVDGWTGIAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGSICFD  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+ + P ++PF  V+FG  +++ R+Q + VY   +ES  + WP +
Sbjct  564   STEPRIQLYFLLGLVYAAVTPFLLPFILVFFGFAYVVFRHQIINVYNQQYESAAQFWPSV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G      F    P+++ LP+L+F F   C  +F   F    L+ 
Sbjct  624   HGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLTFGFYKYCKNRFEPAFVRNPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDH  217
                    E+   PN+D+   +  S++ P F  ++ D+ +
Sbjct  684   AMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDRY  722



>ref|NP_001147493.1| LOC100281102 [Zea mays]
 gb|ACG27714.1| HYP1 [Zea mays]
Length=768

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/279 (32%), Positives = 154/279 (55%), Gaps = 7/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG+ S+S   R ++ KY+ F   NVF+G  I  +  + LK+ +  + N I  ++  
Sbjct  444   MSKFEGLISQSSLERRSASKYYIFLFFNVFLGSVIAGSALEQLKTYLHTSANDIPRIIGD  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T+V +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG + + 
Sbjct  504   SIPMKATFFITYVMVDGWTGIAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGSICFD  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+ + P ++PF  V+FG  +++ R+Q + VY   +ES  + WP +
Sbjct  564   STEPRIQLYFLLGLVYAAVTPFLLPFILVFFGFAYVVFRHQIINVYNQQYESAAQFWPSV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G      F    P+++ LP+L+F F   C  +F   F    L+ 
Sbjct  624   HGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLTFGFYKYCKNRFEPAFVRNPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDH  217
                    E+   PN+D+   +  S++ P F  ++ D+ +
Sbjct  684   AMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDRY  722



>ref|XP_007200309.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
 gb|EMJ01508.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
Length=756

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 154/289 (53%), Gaps = 13/289 (4%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             +SK EG  S S   R ++ KY  F ++NVF+G  +  T    L+ + + P++  +     
Sbjct  445   MSKIEGFTSLSSLDRRSAAKYHLFILINVFLGSIVTGTALQQLEKLMNEPSTEFTKTVGR  504

Query  852   lp-ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
                  ATFF+T++ +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505   SIPMKATFFITYIMVDGWSGVAAEIVRLVPLILFHLKNTFLVKTEEDREQAMDPGSLNFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y V+ PI++PF  ++F   +L+ R+Q + VY   +ES    WP +
Sbjct  565   TNEPRTQLYFLLGLVYCVVTPILLPFILIFFSFAYLVFRHQIINVYDQKYESAAAFWPQV  624

Query  495   HTRVVAALILYQLTMIGYF---GVKKFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTAL  325
             H RV+  LI+ Q+ ++G F   GV K  +  +++  P+L+  F  VC  +F   F    L
Sbjct  625   HLRVIIGLIISQILLMGLFSTLGVAKSTF--ILVAQPVLTIWFHRVCKGRFESAFLKFPL  682

Query  324   EA--VSAGKEKKEVPNMDIIF---RSFIPPCF--GTEKSDEDHFEDALS  199
             +   V    EK   PN++++     +++ P F  G  +  ED  E+  S
Sbjct  683   QEAMVKDTVEKATEPNLNLMNYLKDAYVHPVFKEGQPQKHEDLDEEDSS  731



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 151/270 (56%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG+ S S   +  +GKY+ F ++NVF+G  I  T F  L K I  +P  I   +  
Sbjct  445   MSKIEGLISLSSLEQRTAGKYYLFILVNVFLGSIITGTAFQQLHKFINQSPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L ++
Sbjct  505   SIPMKATFFITYIMVDGWAGVAAEILRLVPLIMFHLKNAFLVKTEQDREQAMDPGCLNFS  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + PI++PF  ++F   +++ R+Q + VY   +ES    WP +
Sbjct  565   ISEPRIQLYFLLGLVYAAVTPILLPFIIIFFSFAYMVFRHQIINVYDQKYESGAAFWPSV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RV+  L++ QL ++G    K F  + P +I LP+L+F F   C+ +F   F    L+ 
Sbjct  625   HQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLTFWFHRFCNGRFESAFVRFPLQE  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCF  244
               V    E+   PN+++   +  ++I P F
Sbjct  685   AMVKDTLERATEPNLNLKNYLQDAYIHPVF  714



>ref|XP_006843810.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Amborella 
trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/283 (34%), Positives = 155/283 (55%), Gaps = 8/283 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP-Nsiisllat  856
             +SK EG  + S   R A+ KY+ F ++NVF+G  I  T F  L +    P N I   +  
Sbjct  444   MSKFEGYIAVSILERRAAAKYYLFQLVNVFLGSIIAGTAFQQLHTFIHQPANQIPITIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T+V L  + G   E+ R+ PL+I+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504   SIPMKATFFITYVMLDGWAGIAAEILRLKPLVIYHLKNFFLVKTEKDREEAMDPGSLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+V+ P+++PF  V+FG  +++ R+Q + VY   +ES    WP +
Sbjct  564   SSEPQIQLYFLLGLVYAVVTPVLLPFIVVFFGFAYVVFRHQVINVYNQEYESGAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVK-KFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ AL++ QL ++G    K      PL++ LP+L+  F   C  +F   F    LE 
Sbjct  624   HGRIITALVISQLLLLGLLSTKLAAQSTPLLLALPVLTIWFHRFCKDRFESAFVKFPLEE  683

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCF-GTEKSDEDHFED  208
               +    E+   PN+++   +  ++I P F G E+SD     D
Sbjct  684   AMIKDTLERATDPNLNLKGYLSNAYIHPVFKGGEESDSVSLAD  726



>dbj|BAJ96091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP-Nsiisllat  856
             +SK EG  S S   R  + KYF F  +NVF+G  +  T F  L    + P N I   +  
Sbjct  446   MSKIEGHVSLSGLERRTASKYFLFIFVNVFLGSVVAGTAFQQLNRFINQPANKIPETIGE  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI+FH+K  ++ +T+ + ++A  PG L + 
Sbjct  506   SIPMKATFFITYIMVDGWAGIAAEVLRLKPLIMFHIKNTFLVRTEQDREQAMDPGSLEFG  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+V++PII+PF  V+FGL +L+ R+Q + VY   +ES  + WP +
Sbjct  566   STEPRIQLYFLLGLVYAVVSPIILPFIIVFFGLAYLVFRHQIINVYNQQYESGAQFWPDV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKF  352
             H R+V AL++ Q+ +IG    ++   + + ++PLP+L+  F +VC  +F
Sbjct  626   HGRIVTALVISQVLLIGLLSTQEAEQSTVALLPLPVLTIWFRYVCKGRF  674



>ref|XP_010473449.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473450.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473451.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=779

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 157/281 (56%), Gaps = 7/281 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF+G  I  + F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFVSISSLERRAAFRYYIFNLVNVFLGSIITGSAFEQLDSFLKQSANDIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + +EA  PG + + 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGQIDFY  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + P+++PF   +FG  +L+ R+Q + VY   +ES    WP +
Sbjct  567   ATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEYESAAAFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVK-KFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R+++ALI+ Q+ ++G    K K    P ++ L IL+F+F   C  ++   F    L+ 
Sbjct  627   HGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFVFHRFCKGRYESAFVINPLQE  686

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFE  211
               +    E+   PN+++   +  ++I P F  E+ ++D FE
Sbjct  687   AMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEFEDDQFE  727



>ref|XP_010278586.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
 ref|XP_010278595.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
Length=756

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/294 (32%), Positives = 157/294 (53%), Gaps = 8/294 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++GKY  F ++N+F+G  I  T F  L + I   P+ I   +  
Sbjct  445   MSKIEGHTSLSSLERRSAGKYHLFVLVNIFLGSVITGTAFQQLYQFINQPPHEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T+V +  + G   E+ R+ PLI+FHLK  ++ KTD E +EA   G + +A
Sbjct  505   TIPMKATFFITYVMVDGWAGIAAEILRLFPLIVFHLKNTFLVKTDEEREEAMDAGSIDFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++   YSV+ P+I+PF  ++F L +++ R+Q + VY   +ES    WP +
Sbjct  565   SFEPQIQLYFLLGFVYSVVTPVILPFIVIFFALSYVVFRHQIINVYDQKYESGAAFWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKK----FYRFFQSTA  328
             H R+V  LI+ QL + G  G K    A L+IP+P+L+  F   C  +    F +F    A
Sbjct  625   HRRLVIGLIISQLLLXGLMGTKGAGLASLLIPVPVLTIGFHRFCKVRFESAFVKFPLQDA  684

Query  327   LEAVSAGKEKKEVPNMDIIFR-SFIPPCFGTEKSDEDHF--EDALSQVSRSASN  175
             +   +  + K+   N+ I  + +++ P     +S+      E+  +Q  ++  N
Sbjct  685   MRKDTLERAKEPKFNLKIYLQDAYMHPVLKDNQSERSSSINEEEYNQPVQTKRN  738



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 151/270 (56%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG+ S S   +  +GKY+ F ++NVF+G  I  T F  L K I  +P  I   +  
Sbjct  455   MSKIEGLISLSSLEQRTAGKYYLFILVNVFLGSIITGTAFQQLHKFINQSPTEIPKTVGV  514

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L ++
Sbjct  515   SIPMKATFFITYIMVDGWAGVAAEILRLVPLIMFHLKNAFLVKTEQDREQAMDPGCLNFS  574

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + PI++PF  ++F   +++ R+Q + VY   +ES    WP +
Sbjct  575   ISEPRIQLYFLLGLVYAAVTPILLPFIIIFFSFAYMVFRHQIINVYDQKYESGAAFWPSV  634

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RV+  L++ QL ++G    K F  + P +I LP+L+F F   C+ +F   F    L+ 
Sbjct  635   HQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLTFWFHRFCNGRFESAFVRFPLQE  694

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCF  244
               V    E+   PN+++   +  ++I P F
Sbjct  695   AMVKDTLERATEPNLNLKNYLQDAYIHPVF  724



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 155/280 (55%), Gaps = 8/280 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +   I   +  
Sbjct  444   MSKFEGFISISGLERRSAARYYIFQFINVFLGSIITGTAFQQLDNFIHQSATEIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  +M KT+ +++EA  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKMFFMVKTEKDMEEAMDPGTLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ A+I+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  624   HGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLIALPVLTIWFHLFCKGRYEPAFVRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF-GTEKSDEDH  217
                    E+   P +++   +  ++I P F G + SD D 
Sbjct  684   AMMKDTLERAREPKLNLKSFLQNAYIHPVFKGEDDSDSDE  723



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/279 (34%), Positives = 154/279 (55%), Gaps = 7/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  444   MSKFEGFNSISALERRSATRYYIFQFVNVFLGSIITGTAFQQLDKFIHQSANEIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + ++A  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREDAMDPGTLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C   +   F    L+ 
Sbjct  624   HGRIITALIISQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFCKGCYEPAFIRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDH  217
                    E+   PN+++   +  ++I P F  E   E+ 
Sbjct  684   AMMKDTLERATEPNLNLKSFLQNAYIHPVFKGEDDGENE  722



>ref|XP_006283166.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
 gb|EOA16064.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
Length=771

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/291 (31%), Positives = 157/291 (54%), Gaps = 8/291 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F ++NVF+   +    F+ L S +  +PN I   +  
Sbjct  448   MSKFEGFTSISSLERRSAFRYYIFNLVNVFLASVVTGAAFEQLNSFLNQSPNQIPKTIGV  507

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  508   AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEKDREEAMDPGSIGFN  567

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568   TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  627

Query  495   HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RV+AAL++ QL ++G  G K     AP +I LP+L+  F   C  ++   F    L+ 
Sbjct  628   HGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYEPAFIRYPLQE  687

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVSRSA  181
                    E    PN+++   +  ++I P F  ++ D D+  D L +    A
Sbjct  688   AMMKDTLENAREPNLNLKGYLQNAYIHPVFKGDE-DGDNINDKLGKFEDEA  737



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 94/280 (34%), Positives = 154/280 (55%), Gaps = 8/280 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +   I   +  
Sbjct  444   MSKFEGFISLSGLERRSAARYYIFQFVNVFLGSIITGTAFQQLDNFIHQSATQIPKTVGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + KEA  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDKKEAMDPGTLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ A+I+ QL ++G    K+   + PL+I LPIL+  F   C  ++   F    L+ 
Sbjct  624   HGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHLFCKGRYEPAFVRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF-GTEKSDEDH  217
                    E+   PN+++   +  ++  P F G + SD D 
Sbjct  684   AMMKDTLERAREPNLNLKSFLQNAYSHPVFKGEDDSDSDE  723



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 156/279 (56%), Gaps = 7/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  +  + L + ++ +PN I   +  
Sbjct  446   MSKFEGFISISSLERRSASRYYLFNFVNVFLGSIITGSALEQLNTFMKQSPNQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF++++ +  + G   E+  + PLIIFHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  506   AIPMKATFFISYIMVDGWAGIAAEILMLKPLIIFHLKNFFLVKTEKDREEAMDPGSIGFN  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  566   TGEPRIQLYFLLGLVYAVVTPVLLPFIIVFFCLAYVVFRHQIINVYNQEYESGAAFWPDV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + P +I LPIL+  F + C  +F   F    L+ 
Sbjct  626   HGRIIGALIISQLLLMGLLSTKQAAQSTPFLIALPILTISFHYYCKGRFEPAFIRYPLQE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDH  217
                    E+   P++++   +  ++I P F + + DE+ 
Sbjct  686   AKMKDTLERAREPHLNLKGYLQTAYIHPVFKSAEDDEEE  724



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 154/280 (55%), Gaps = 8/280 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +   I   +  
Sbjct  444   MSKFEGFISLSSLERRSAARYYIFQFINVFLGSIITGTAFQQLDNFIHQSATQIPKTVGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ A+I+ QL ++G    K+   + PL+I LPIL+  F   C  ++   F    L+ 
Sbjct  624   HGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHLFCKGRYEPAFVRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF-GTEKSDEDH  217
                    E+   PN+++   +  ++  P F G + SD D 
Sbjct  684   AMMKDTLERAREPNLNLKSFLQNAYSHPVFKGEDDSDSDE  723



>gb|KDP20707.1| hypothetical protein JCGZ_21178 [Jatropha curcas]
Length=694

 Score =   147 bits (372),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 87/257 (34%), Positives = 144/257 (56%), Gaps = 4/257 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y++F ++NVF+G  I  T F+ LKS ++ + N I   +  
Sbjct  366   MSKFEGFTSLSSLERRSAARYYFFNIVNVFLGSIIAGTAFEQLKSFMKQSANDIPKTIGV  425

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  426   AIPMKATFFITYIMVDGWAGIAGEVLMLKPLILFHLKNFFLVKTEKDREEAMDPGSLGFN  485

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P      ++ L Y+ + P ++PF  V+FG  +++ R+Q + VY   +ES    WP +
Sbjct  486   TGEPRIQFYFLLGLVYATVTPALLPFIIVFFGFAYVVFRHQIINVYNQEYESAAAYWPDV  545

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVV ALI+ Q+ MIG    K+   + P +I LPIL+  F   C  ++   F    L+ 
Sbjct  546   HGRVVTALIISQVLMIGLLSTKRAALSTPFLIALPILTIWFHRFCKGRYEPAFVKYPLQE  605

Query  318   VSAGK--EKKEVPNMDI  274
                    E+   PN+++
Sbjct  606   AMMRDTLERAREPNLNL  622



>ref|XP_008448614.1| PREDICTED: uncharacterized protein RSN1 [Cucumis melo]
 ref|XP_008448615.1| PREDICTED: uncharacterized protein RSN1 [Cucumis melo]
Length=795

 Score =   148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 93/277 (34%), Positives = 159/277 (57%), Gaps = 7/277 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R A+ KY+YF ++NVF+G  +  T F+ L S I  +P  I   +  
Sbjct  446   MSKIEGHVAVSALERRAAAKYYYFMLVNVFLGSIVTGTAFEQLDSFIHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  +M KT+ +  +A  PG + + 
Sbjct  506   SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNLFMVKTERDRAKAMDPGSVEFP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES G  WPH+
Sbjct  566   ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNQHYESVGAFWPHV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F   F+   LE 
Sbjct  626   HSRIIASLLISQLLLLGLLSTKKAANSTPLLVALPILTLFFHKYCKNRFEPAFRKYPLEE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDE  223
               A    E+   P++++   +  +++ P F + + +E
Sbjct  686   AMAKDTLERSTEPDLNVKAFLADAYLHPIFRSFEEEE  722



>ref|XP_003549667.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Glycine max]
 ref|XP_006600300.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Glycine max]
 gb|KHN03500.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=775

 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 153/285 (54%), Gaps = 7/285 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F  +N+F+G  +  T F+ L S I    N     + T
Sbjct  446   MSKFEGFGSISSLERRAASRYYLFNFVNIFLGNILTGTAFEQLDSFIHQAANEYPITIGT  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  A+FF+T++ +  + G   E+  + PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  506   AIPLKASFFITYIMVDGWAGIAAEVLMLKPLIIYHLKNFFLVKTEKDREEAMDPGSIGFN  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ + P ++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  566   TGEPRIQLYFLLGLVYASVTPTVLPFIIVFFGLAYVVFRHQIINVYNQEYESGAAFWPDV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RV+ ALI+ Q+ ++G    KK   + P +I LP+L+  F   C  +F   F    L+ 
Sbjct  626   HFRVIIALIVSQIVLMGLLTTKKAASSTPFLIVLPVLTIWFHIYCKGRFEPAFVRYPLQE  685

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALS  199
                    E+   PN ++   +  +++ P F     DED  E+ +S
Sbjct  686   AMMKDTLERATDPNFNLKAYLQNAYVHPVFKASLFDEDEDEEVMS  730



>ref|XP_002986828.1| hypothetical protein SELMODRAFT_425683 [Selaginella moellendorffii]
 gb|EFJ12158.1| hypothetical protein SELMODRAFT_425683 [Selaginella moellendorffii]
Length=657

 Score =   147 bits (371),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 135/242 (56%), Gaps = 2/242 (1%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             LSK EG  S S   R A+ K+FYF V NVF       +    LK  +  +P+ I  LL  
Sbjct  416   LSKVEGHLSLSKLDRMAAAKHFYFMVFNVFFASVFTGSALQQLKLFLHKSPSDIPQLLGD  475

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF++++ +  +     E+ R+ PL+ FH +     KT+ + ++A APG L   
Sbjct  476   AIPLKATFFISYIMVDGWASVAGEILRLKPLLFFHFRNMMFVKTEKDREKAMAPGGLSLN  535

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+VIAPII+PF   +FG  +L+ RNQ + VY P +ES G  WPH+
Sbjct  536   TALPHVGLYFLLGLVYAVIAPIILPFIVTFFGFSYLVYRNQVINVYHPEYESAGGFWPHI  595

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVVA++I+ QLT++G    K+   + P +  LP+L+F+F     + F   F    LE 
Sbjct  596   HNRVVASMIIMQLTLLGLLSTKRAASSTPFLAGLPVLTFIFHTYTKRCFESAFVKFPLEV  655

Query  318   VS  313
              S
Sbjct  656   SS  657



>ref|XP_007050676.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX94833.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=751

 Score =   148 bits (373),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 152/274 (55%), Gaps = 8/274 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP-Nsiisllat  856
             +SK EG  S S   R ++GKY  F ++NVF+G  I  T F  LKS  D P   I   +  
Sbjct  444   MSKIEGFSSLSSLDRRSAGKYHLFILVNVFLGSIITGTAFQQLKSFLDQPPTEIPKTVGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T+V +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  504   SIPMKATFFITYVMVDGWAGIAAEILRLVPLVIFHLKNTFLVKTEQDREQAMDPGCLDFA  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P     +++ L YS I P+++PF  ++F   +L+ R+Q + VY   +ES    WP +
Sbjct  564   TSEPRIQFYILLGLVYSAITPVLLPFIIIFFAFAYLVFRHQVINVYDQRYESGASFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++  LI+ QL ++G    KK   + + ++PLPIL+  F   C  +F   F    L+ 
Sbjct  624   HRRLIIGLIISQLLLMGLLSTKKIDKSTIALLPLPILTIWFHRYCKGRFESAFVKFPLQD  683

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCF-GTE  235
               +    E    PN+++   +  ++I P F GT+
Sbjct  684   AMIKDTLEHATEPNLNLKAYLKDAYIHPVFKGTD  717



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   148 bits (373),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 92/288 (32%), Positives = 159/288 (55%), Gaps = 10/288 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +++ F  +NVF+G  +  T F  L S +  + N I   +  
Sbjct  447   MSKFEGFVSTSSLERRAATRFYMFQFINVFLGSIVTGTAFQQLNSFLNQSANDIPKTIGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ +T+ + +EA  PG +G+ 
Sbjct  507   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVRTEKDREEATDPGTIGFN  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ ++PI++PF  V+FGL +++ R+Q + VY   +ES GK WP +
Sbjct  567   TGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAFVVYRHQVINVYNQKYESAGKFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVV AL++ QL ++G    K    + P ++ LP+L+  F   C  ++   F +  L+ 
Sbjct  627   HRRVVTALVVSQLLLMGLLSTKHASKSTPFLLVLPLLTIGFHMHCKNRYQPAFVTYPLQQ  686

Query  318   VSAGK---EKKEVPNMDI---IFRSFIPPCF--GTEKSDEDHFEDALS  199
              +  K   ++   PN ++   +  ++  P F  G +   E+  E  +S
Sbjct  687   EAMIKDTLDRIREPNFNLKAFLRDAYAHPEFRVGEDPEPEEKLESDMS  734



>ref|XP_006396700.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 ref|XP_006396701.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38153.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38154.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
Length=770

 Score =   148 bits (373),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 92/290 (32%), Positives = 157/290 (54%), Gaps = 9/290 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F  +NVF+   I    F+ L S +  +PN I   +  
Sbjct  447   MSKFEGFTSLSSLERRAASRYYIFNFVNVFLANVIAGAAFEQLNSFLNQSPNQIPKTIGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KT+ + + A  PG +G+ 
Sbjct  507   AIPMKATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNAFLVKTEKDREAAMDPGSIGFN  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ + P+++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  567   TGEPQIQLYFLLGLVYAPVTPMLLPFILVFFGLAYIVYRHQIINVYNQEYESGAAFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RV++ALI+ QL ++G  G K     AP +I LP+L+  F   C  ++   F    L+ 
Sbjct  627   HGRVISALIISQLLLMGLLGTKHAASAAPFLIVLPVLTIGFHRFCKGRYEPAFVRYPLQE  686

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVSRS  184
                    E+ + PN+++   +  ++I P F  +  D+D   D L ++   
Sbjct  687   AMMKDTLERAKEPNLNLKGYLQDAYIHPVF--KGGDDDDESDMLGKLEEE  734



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 151/277 (55%), Gaps = 7/277 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG+ S S   R ++ KY+ F   NVF+G  I  +  + L+S +  + N I   +  
Sbjct  444   MSKVEGLTSVSSLERRSASKYYIFLFFNVFLGSIIAGSALEQLQSYLHQSANQIPRTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T+V +  + G   E+ R+ PL+IFHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  504   AIPMKATFFITYVMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGSIGFD  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+V+ P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  564   SNEPQIQLYFLLGLVYAVVTPFLLPFILIFFGLAYVVYRHQIINVYNQEYESAAAFWPSV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL  +G    K    + P+++ LP+++F F   C  ++   F    L+ 
Sbjct  624   HGRIITALIISQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRYEPAFVEYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDE  223
                    E+   P  D+   +  ++I P F  +  DE
Sbjct  684   AMRKDTLERAREPGFDLKTYLASAYIHPVFKGDDDDE  720



>ref|XP_008451393.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X3 [Cucumis melo]
Length=745

 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 155/303 (51%), Gaps = 14/303 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  853
             +S+ EG  S S   R ++ KY  F ++NVF G  I  T    L+   + P++  +     
Sbjct  444   MSQIEGFTSLSALDRRSAEKYHMFILVNVFFGSVITGTALQQLQKFLNEPSTEFTKTVGD  503

Query  852   lp-ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
                  ATFF+T++ +  + G   E+ R+VPLIIFHLK  ++ KTD +  +A  PG L + 
Sbjct  504   SIPMKATFFITYIMVDGWAGIAAEILRLVPLIIFHLKNTFLVKTDQDRDQAMDPGCLDFP  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L +++   YSV+ PI++PF  V+F   +L+ R+Q + VY   +ES    WPH+
Sbjct  564   VSEPRIQLYILLGFVYSVVTPILLPFIIVFFSFSYLVYRHQIINVYNQKYESGAAFWPHV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKFYRFFQSTALE-  322
             H RV+  LIL QL ++G F +++   + L ++ LPIL+      C  +F   F    L+ 
Sbjct  624   HRRVIIGLILAQLLLMGLFSMREAEKSSLFLVALPILTIWVHKFCKGRFESAFVKFPLQD  683

Query  321   -AVSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDE-----DHFEDALSQVSRSASNV*  169
               V    EK   PN+D+   +  +++ P F +   ++     D   + L    R++  V 
Sbjct  684   AMVKDTLEKATEPNLDLKAYLKDAYVHPVFKSSSIEQTLLIDDEENNTLVPTKRTSHRV-  742

Query  168   LHQ  160
              HQ
Sbjct  743   -HQ  744



>ref|NP_001056508.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|AAV59379.1| putative early-responsive to dehydration stress protein (ERD4) 
[Oryza sativa Japonica Group]
 dbj|BAF18422.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|EAY99267.1| hypothetical protein OsI_21231 [Oryza sativa Indica Group]
 dbj|BAG93571.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34629.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Oryza sativa]
Length=766

 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 153/278 (55%), Gaps = 8/278 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG+ S+S   R ++ KY+ F   NVF+G  +  +  D LK+ I  + N I   +  
Sbjct  444   MSKFEGLISQSSLERRSASKYYIFLFFNVFLGSIVTGSALDQLKAYIHQSANEIPRTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T+V +  + G   E+ R+  LIIFHLK  ++ KT+ + +EA  PG + + 
Sbjct  504   AIPMRATFFITYVMVDGWTGVAGEILRLRALIIFHLKNFFLVKTEKDREEAMDPGSICFD  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+V+ P+++PF  V+FGL +++ R+Q + VY   +ES  + WP +
Sbjct  564   WCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVYNQQYESGAQFWPSV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL +IG    K F    P+++ LP+L+F F   C  +F   F    L+ 
Sbjct  624   HGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRFEPAFVRNPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF-GTEKSDE  223
                    E+   P  D+   +  +++ P F G E+ D 
Sbjct  684   AMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEEDN  721



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 159/286 (56%), Gaps = 10/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +PN I   +  
Sbjct  453   MSKFEGFSSISALERRSATRYYIFQFINVFLGSIITGTAFQQLNNFIHQSPNEIPKTIGV  512

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  +M KT+ + +EA  PG LG+ 
Sbjct  513   SIPMKATFFITYIMVDGWAGVAGEILRLRPLIIYHLKNFFMVKTETDREEAMNPGSLGFN  572

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  573   TGEPQIQLYFLLGLVYAVVSPILLPFIVIFFGLAYIVYRHQIMNVYNQEYESAAAFWPDV  632

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKK----FYRF-FQS  334
             H R++ ALI+ QL ++G    K    + P +I LP+L+  F   C  +    F R+  Q 
Sbjct  633   HGRIIIALIVSQLLLLGLLSTKDASQSTPFLITLPVLTICFDRYCKGRYEPAFVRYPLQQ  692

Query  333   TALEAVSAGKEKKEVPNMDIIFRSFIPPCFGTEKSDEDHFEDALSQ  196
               ++ +     +  V   D +  ++I P F   K+ +D+  + +S+
Sbjct  693   AMMKDILNRTREPNVNLKDYLRSAYIHPVF---KAGDDYENNLVSE  735



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 148/270 (55%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDN-PNsiisllat  856
             +SK EG  S S     ++GKY  F ++NVF+G  I  T    LKS  D  P  I   +  
Sbjct  445   MSKIEGFASLSSLETRSAGKYHLFVLVNVFLGSIITGTALQQLKSFLDQAPTEIPKTVGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG LG+A
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNTFLVKTEKDREQAMDPGCLGFA  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++   YSV+ P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  565   TSEPRIQLYFLLGFVYSVVTPVLLPFIIVFFALAYMVFRHQVINVYDQKYESGAAFWPDV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
               R++  +++ QL ++G    K    + PL+I LPIL+  F   C  +F   F    L+ 
Sbjct  625   QRRLIIGMVISQLLLMGLMSTKGAKSSTPLLIVLPILTIWFHLFCKGRFESAFVKFPLQD  684

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCF  244
               V    E+   PN+++   +  +++ P F
Sbjct  685   AMVKDTLERATEPNLNLKAYLHDAYVHPVF  714



>ref|XP_002529341.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33058.1| conserved hypothetical protein [Ricinus communis]
Length=726

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 137/228 (60%), Gaps = 4/228 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  441   MSKFEGFISLSGLERRSATRYYIFQFINVFLGSIITGTAFQQLNNFIHQSANDIPKTIGV  500

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  501   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTLGFN  560

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L YSV++PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  561   TGEPQIQLYFLLGLVYSVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  620

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKK  355
             H R+V ALI+ QL ++G    K+   + PL+I LP+L+    F+CS K
Sbjct  621   HGRIVTALIVSQLLLMGLLSTKQAAQSTPLLITLPVLTIW--FICSAK  666



>ref|XP_011626939.1| PREDICTED: CSC1-like protein At1g32090 isoform X3 [Amborella 
trichopoda]
Length=753

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/286 (33%), Positives = 153/286 (53%), Gaps = 22/286 (8%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R  + KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  447   MSKVEGHLSLSKLERKTAEKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG +  +
Sbjct  507   SIPMKATFFVTYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDRENAMDPGSIELS  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+V+ PI++PF  V+FG  +L+ R+         +ES    WPH+
Sbjct  567   NSLPTLQLYFLLGLVYAVVTPILLPFILVFFGFAYLVYRHS-------KYESVAAFWPHV  619

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++A+L++ Q  ++G    KK   + PL+I LP+L+  F   C  +F   F+   LE 
Sbjct  620   HGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLTIWFHKYCKSRFEPAFRKYPLEE  679

Query  318   VSAGK--EKKEVPNMDI-----------IFRSFIPPCFGTEKSDED  220
               A    E+ E PN+++           IF+SF     G  + D++
Sbjct  680   AMARDTMERAEEPNLNLMAYLADAYLHPIFQSFDDVEMGEVRVDKN  725



>ref|XP_008363043.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Malus domestica]
Length=660

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/286 (33%), Positives = 154/286 (54%), Gaps = 10/286 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +N F+G  I  T F  L   I  + N I   +  
Sbjct  337   MSKFEGFXSXSALERRSAXRYYIFQFVNXFLGSIITGTAFQQLDEFIHQSANEIPKTIGV  396

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P   TFF+T++ +  + G    + R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  397   SIPMKTTFFITYIMVDGWAGISGGILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTLGFN  456

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R Q + VY   +ES    WP +
Sbjct  457   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRRQIINVYNQEYESAAAFWPDV  516

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  517   HGRIITALIVSQLLLMGLLSTKEAAXSTPLLITLPVLTIWFHRFCKGRYKPAFIRHPLQE  576

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQ  196
                    E    PN+++   +  ++I P F   KS++D   DA +Q
Sbjct  577   AMMKDTLECTREPNLNLKXFLQNAYIHPVF---KSEDDSKNDAPAQ  619



>ref|XP_006363038.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363039.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006363040.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Solanum 
tuberosum]
Length=768

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/298 (32%), Positives = 159/298 (53%), Gaps = 14/298 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  856
             +SK EG  S +   R ++ +Y+ F  +NVF+G  I    F+ L ++   + N I   +  
Sbjct  444   MSKFEGFCSIAALERRSATRYYIFQFVNVFLGSIITGAAFNQLNNLLHQSANEIPKTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGSLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ ++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAAVSPILLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G    K+   + PL+I LPIL+  F   C  ++   F    L+ 
Sbjct  624   HGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILTIWFHIFCKGRYEPAFVRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTE-------KSDEDHFEDALSQVSRSA  181
                    ++ + PN D+   +  ++I P F  E        S++   E +L Q  R +
Sbjct  684   TVRKDTLDRTKEPNFDLKEFLQNAYIHPVFKGEVDSEIDAASEDGELEPSLVQTKRQS  741



>ref|NP_192343.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849296.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849297.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9XEA1.1|CSCL5_ARATH RecName: Full=Protein OSCA1; AltName: Full=CSC1-like protein 
At4g04340; AltName: Full=Protein reduced hyperosmolality-induced 
[Ca(2+)]i increase 1 [Arabidopsis thaliana]
 gb|AAD36947.1|AF069441_7 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB77902.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAM13208.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82380.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82381.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82382.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34613.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Arabidopsis 
thaliana]
Length=772

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/270 (33%), Positives = 149/270 (55%), Gaps = 7/270 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F ++NVF+G  I    F+ L S +  +PN I   +  
Sbjct  449   MSKFEGFTSVSFLERRSASRYYIFNLVNVFLGSVIAGAAFEQLNSFLNQSPNQIPKTIGM  508

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  509   AIPMKATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNAFLVKTEKDREEAMNPGSIGFN  568

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  569   TGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  628

Query  495   HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RV+ ALI+ QL ++G  G K     AP +I LP+++  F   C  +F   F    L+ 
Sbjct  629   HGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVITIGFHRFCKGRFEPAFVRYPLQE  688

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF  244
                    E+   PN+++   +  ++I P F
Sbjct  689   AMMKDTLERAREPNLNLKGYLQDAYIHPVF  718



>ref|XP_002440380.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
 gb|EES18810.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
Length=766

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 153/279 (55%), Gaps = 7/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG+ S+S   R ++ KY+ F   NVF+   I  +  + LK+ +  + N I  ++  
Sbjct  444   MSKFEGLISQSSLERRSASKYYIFLFFNVFLTSVIAGSALEQLKTYLHTSANDIPRIIGD  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T+V +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG + + 
Sbjct  504   SIPMKATFFITYVMVDGWTGIAGEILRLKPLIFFHLKNLFLVKTEKDREEAMDPGSICFD  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             +  P   L  ++ L Y+ + P ++PF  V+FG  +++ R+Q + VY   +ES  + WP +
Sbjct  564   STEPRIQLYFLLGLVYAAVTPFLLPFILVFFGFAYVVFRHQIINVYNQQYESAAQFWPSV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL ++G      F  + P+++ LP+L+F F   C  +F   F    L+ 
Sbjct  624   HGRIITALIVSQLLLLGLMSTNDFEQSTPVLLVLPVLTFWFYKYCKNRFEPAFVRNPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGTEKSDEDH  217
                    E+   PN D+   +  S++ P F  ++ D+ +
Sbjct  684   AMKKDTLERAREPNFDLKAYLANSYLHPVFKGDEGDDRY  722



>gb|KJB42871.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=788

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 152/272 (56%), Gaps = 7/272 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L   I  + + I   +  
Sbjct  465   MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNHFIHQSTSQIPKTIGV  524

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  525   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVKTEKDREEAMDPGTIGFN  584

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V+ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  585   TGEPQIQLYFLLGLVYAVVTPILLPFIIVFFALAYVVYRHQIINVYHQEYESAAAFWPDV  644

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H RVVAALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  645   HVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLTICFHRFCKGRYEPAFVRYPLQE  704

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCFGT  238
                    E+ +  N+++   +  ++I P F +
Sbjct  705   AMMKDTLERAKEANLNLKGFLQNAYIHPVFKS  736



>ref|XP_007158205.1| hypothetical protein PHAVU_002G133000g [Phaseolus vulgaris]
 gb|ESW30199.1| hypothetical protein PHAVU_002G133000g [Phaseolus vulgaris]
Length=857

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/273 (32%), Positives = 151/273 (55%), Gaps = 15/273 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R  + KY+YF ++NVF+G  +  T F  L + +  +P  I   +  
Sbjct  446   MSKIEGYTALSTLERKTAAKYYYFMLVNVFLGSIVTGTAFQQLHAFLHQSPTQIPRTIGV  505

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+I+HLK  ++ KT+ +  +A  PG + + 
Sbjct  506   SIPMKATFFMTYIMVDGWAGIASEILRLKPLVIYHLKNMFIVKTERDKGKAMDPGSVDFP  565

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WP +
Sbjct  566   ETIPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNQQYESAAAFWPLV  625

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++A++++ Q  ++G    KK   + PL++ LP+L+F F   C ++F   F+   +E 
Sbjct  626   HSRIIASMLISQFLLLGLLSTKKAAKSTPLLVILPVLTFAFHKYCQRRFEPAFRKYPIEE  685

Query  318   VSAGK--EKKEVPNMDI-----------IFRSF  259
               +    EK   P+++I           IFRSF
Sbjct  686   AMSKDLLEKSTEPDLNIKAYLADAYLHPIFRSF  718



>ref|XP_011016279.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016280.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016281.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/279 (33%), Positives = 154/279 (55%), Gaps = 8/279 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +   I   +  
Sbjct  444   MSKFEGFISLSGLERRSAARYYIFQFINVFLGSIITGTAFQQLDNFIHQSATQIPKTVGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504   SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTLGFN  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
             T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564   TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ A+I+ QL ++G    K+   + PL+I LP+L+  F   C  ++   F    L+ 
Sbjct  624   HGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHLFCKGRYEPAFVRYPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF-GTEKSDED  220
                    E+   PN+++   +  ++  P F G + SD D
Sbjct  684   AMMKDTLERAREPNLNLKSFLQNAYSHPVFKGEDDSDSD  722



>ref|XP_010056204.1| PREDICTED: CSC1-like protein At1g32090 [Eucalyptus grandis]
 gb|KCW72814.1| hypothetical protein EUGRSUZ_E01258 [Eucalyptus grandis]
Length=772

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 154/273 (56%), Gaps = 15/273 (5%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  + S   R A+ KY+YF ++NVF+G  I  T F  L S +  +   I   +  
Sbjct  445   MSKIEGYIAISTLERRAAAKYYYFMLVNVFLGSIITGTAFQQLHSFMHQSATQIPRTIGV  504

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             S+P  ATFF+T++ +  + G   E+ R+ PL+I+HLK  ++ KTD + + A  PG + + 
Sbjct  505   SIPMKATFFITYIMVDGWAGIAAEILRLKPLVIYHLKNMFLVKTDRDRERAMDPGSVDFP  564

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ + Y+V+ PI++PF  V+F L +L+ R+Q + VY   +ES    WPH+
Sbjct  565   ETLPTLQLYFLLGIVYAVVTPILLPFILVFFALAYLVYRHQIINVYNQRYESVAAFWPHV  624

Query  495   HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H+R++AAL++ QL ++G    K+   + PL++ LP+ + +F   C  +F   F+   LE 
Sbjct  625   HSRIIAALLISQLLLLGLLSTKEAANSTPLLVVLPVFTLVFHKYCKHRFEPAFRKHPLEE  684

Query  318   VSAGK--EKKEVPNMDI-----------IFRSF  259
               A    E++E PN+++           IFRSF
Sbjct  685   AMAKDLAEREEEPNLNLKAYLADAYLHPIFRSF  717



>gb|EEE64912.1| hypothetical protein OsJ_19772 [Oryza sativa Japonica Group]
Length=893

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 153/278 (55%), Gaps = 8/278 (3%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG+ S+S   R ++ KY+ F   NVF+G  +  +  D LK+ I  + N I   +  
Sbjct  444   MSKFEGLISQSSLERRSASKYYIFLFFNVFLGSIVTGSALDQLKAYIHQSANEIPRTIGV  503

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T+V +  + G   E+ R+  LIIFHLK  ++ KT+ + +EA  PG + + 
Sbjct  504   AIPMRATFFITYVMVDGWTGVAGEILRLRALIIFHLKNFFLVKTEKDREEAMDPGSICFD  563

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+V+ P+++PF  V+FGL +++ R+Q + VY   +ES  + WP +
Sbjct  564   WCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVYNQQYESGAQFWPSV  623

Query  495   HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ QL +IG    K F    P+++ LP+L+F F   C  +F   F    L+ 
Sbjct  624   HGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRFEPAFVRNPLQE  683

Query  318   VSAGK--EKKEVPNMDI---IFRSFIPPCF-GTEKSDE  223
                    E+   P  D+   +  +++ P F G E+ D 
Sbjct  684   AMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEEDN  721



>ref|XP_006300401.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
 gb|EOA33299.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
Length=774

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/288 (31%), Positives = 159/288 (55%), Gaps = 7/288 (2%)
 Frame = -3

Query  1032  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  856
             +SK EG  S S   R A+ +Y+ F ++NVF+G  I  + F+ L S ++ + N I   +  
Sbjct  447   MSKFEGFISISSLERRAAFRYYIFNLVNVFLGSIITGSAFEQLDSFLKQSANDIPRTVGV  506

Query  855   slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  676
             ++P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + +EA  PG + + 
Sbjct  507   AIPIKATFFITYIMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGQIDFY  566

Query  675   TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  496
                P   L  ++ L Y+ + P+++PF   +FG  +L+ R+Q + VY   +ES    WP +
Sbjct  567   ATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEYESAAAFWPDV  626

Query  495   HTRVVAALILYQLTMIGYFGVK-KFPYAPLVIPLPILSFLFAFVCSKKFYRFFQSTALEA  319
             H R++ ALI+ Q+ ++G    K K    P ++ L IL+F F  +C  ++   F    L+ 
Sbjct  627   HGRIITALIISQILLLGLMSTKGKVQSTPFLLVLSILTFGFHRICKGRYESAFVINPLQE  686

Query  318   --VSAGKEKKEVPNMDI---IFRSFIPPCFGTEKSDEDHFEDALSQVS  190
               +    E+   PN+++   +  ++I P F  E+ +ED   + L++ S
Sbjct  687   AMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEYEEDDQFERLTEDS  734



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2638581950854