BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1335

Length=871
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          380   6e-126   Ipomoea batatas [batate]
dbj|BAG80542.1|  glycosyltransferase                                    373   3e-123   Lycium barbarum [Duke of Argyll's teatree]
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    369   9e-122   Gardenia jasminoides
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    369   2e-121   Solanum lycopersicum
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    367   1e-120   Solanum lycopersicum
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    365   6e-120   Solanum lycopersicum
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       363   1e-119   Solanum tuberosum [potatoes]
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    360   2e-118   Solanum lycopersicum
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                360   4e-118   Erythranthe guttata [common monkey flower]
emb|CDP01076.1|  unnamed protein product                                360   5e-118   Coffea canephora [robusta coffee]
ref|XP_008219404.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       354   3e-117   
gb|KCW66550.1|  hypothetical protein EUGRSUZ_F00348                     353   5e-117   Eucalyptus grandis [rose gum]
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                357   5e-117   Erythranthe guttata [common monkey flower]
gb|KCW45340.1|  hypothetical protein EUGRSUZ_L00994                     355   1e-116   Eucalyptus grandis [rose gum]
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       356   1e-116   Prunus mume [ume]
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             356   1e-116   Prunus persica
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       356   1e-116   Prunus mume [ume]
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             356   1e-116   Prunus persica
ref|XP_010064219.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    355   2e-116   Eucalyptus grandis [rose gum]
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    355   2e-116   Vitis vinifera
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    355   2e-116   
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         355   4e-116   Populus trichocarpa [western balsam poplar]
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       354   6e-116   Prunus mume [ume]
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       353   1e-115   Prunus mume [ume]
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             353   1e-115   Prunus persica
ref|XP_004299648.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    353   2e-115   Fragaria vesca subsp. vesca
ref|XP_004299647.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    353   2e-115   Fragaria vesca subsp. vesca
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       352   4e-115   Prunus mume [ume]
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             352   5e-115   Phaseolus vulgaris [French bean]
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             352   5e-115   
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       352   6e-115   
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    352   7e-115   Populus euphratica
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             351   1e-114   Prunus persica
ref|XP_012067889.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    350   4e-114   Jatropha curcas
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    350   4e-114   
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       350   4e-114   Solanum tuberosum [potatoes]
ref|XP_012067890.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    349   5e-114   Jatropha curcas
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    348   8e-114   Vitis vinifera
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          348   8e-114   Vitis vinifera
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             348   1e-113   Phaseolus vulgaris [French bean]
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    348   1e-113   Eucalyptus grandis [rose gum]
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             348   2e-113   Prunus persica
ref|XP_004136284.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    348   2e-113   Cucumis sativus [cucumbers]
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             347   3e-113   Prunus persica
dbj|BAG80547.1|  glycosyltransferase                                    347   4e-113   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    347   5e-113   Eucalyptus grandis [rose gum]
gb|KCW45338.1|  hypothetical protein EUGRSUZ_L009912                    340   6e-113   Eucalyptus grandis [rose gum]
ref|XP_008391482.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       341   6e-113   
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       346   8e-113   Prunus mume [ume]
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             346   9e-113   Prunus dulcis [sweet almond]
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       346   9e-113   Prunus mume [ume]
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    346   1e-112   Eucalyptus grandis [rose gum]
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       346   1e-112   Prunus mume [ume]
ref|XP_004300654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    346   1e-112   Fragaria vesca subsp. vesca
gb|AIL51400.1|  glycosyltransferase                                     345   2e-112   Actinidia deliciosa [Chinese gooseberry]
gb|AAB99950.1|  UDP-glucuronosyltransferase                             340   3e-112   Pisum sativum [garden pea]
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    345   4e-112   Solanum lycopersicum
dbj|BAD93690.1|  glycosyltransferase                                    344   5e-112   Nicotiana tabacum [American tobacco]
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             345   5e-112   Phaseolus vulgaris [French bean]
ref|XP_004299645.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    344   5e-112   Fragaria vesca subsp. vesca
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    344   6e-112   
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    344   6e-112   Nicotiana sylvestris
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    344   6e-112   Nelumbo nucifera [Indian lotus]
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    344   7e-112   Pyrus x bretschneideri [bai li]
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       344   8e-112   Solanum tuberosum [potatoes]
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    343   1e-111   Eucalyptus grandis [rose gum]
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    343   1e-111   Vitis vinifera
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    343   2e-111   Nicotiana tomentosiformis
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       342   3e-111   
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            341   3e-111   Glycine soja [wild soybean]
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    342   3e-111   Nicotiana tomentosiformis
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    342   6e-111   Eucalyptus grandis [rose gum]
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            342   7e-111   Cucumis melo [Oriental melon]
gb|KJB59011.1|  hypothetical protein B456_009G235700                    341   7e-111   Gossypium raimondii
gb|AFK34769.1|  unknown                                                 341   8e-111   Lotus japonicus
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       341   8e-111   Morus notabilis
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       341   1e-110   Glycine max [soybeans]
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      342   1e-110   
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    341   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    340   2e-110   Solanum lycopersicum
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    340   2e-110   Eucalyptus grandis [rose gum]
ref|XP_006363268.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       340   3e-110   
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    340   3e-110   Medicago truncatula
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    339   4e-110   Eucalyptus grandis [rose gum]
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    339   5e-110   Pyrus x bretschneideri [bai li]
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  339   5e-110   Medicago truncatula
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    339   1e-109   Populus euphratica
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       338   1e-109   
gb|EYU43443.1|  hypothetical protein MIMGU_mgv1a018722mg                337   2e-109   Erythranthe guttata [common monkey flower]
ref|XP_008229740.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       337   2e-109   Prunus mume [ume]
ref|XP_009592743.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    337   2e-109   Nicotiana tomentosiformis
gb|AFK33787.1|  unknown                                                 337   3e-109   Medicago truncatula
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    337   3e-109   Beta vulgaris subsp. vulgaris [field beet]
gb|AKA44599.1|  UGTPg32                                                 337   3e-109   Panax ginseng [Asiatic ginseng]
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  337   4e-109   Medicago truncatula
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     337   4e-109   Eucalyptus grandis [rose gum]
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             337   4e-109   Prunus persica
gb|ACJ84649.1|  unknown                                                 337   5e-109   Medicago truncatula
ref|XP_004305884.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    336   5e-109   Fragaria vesca subsp. vesca
ref|XP_006416207.1|  hypothetical protein EUTSA_v100074990mg            330   6e-109   
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       336   7e-109   Prunus mume [ume]
gb|KCW66542.1|  hypothetical protein EUGRSUZ_F00339                     335   8e-109   Eucalyptus grandis [rose gum]
ref|XP_006433963.1|  hypothetical protein CICLE_v10001630mg             331   1e-108   
gb|ABW96222.1|  glucosyltransferase                                     336   1e-108   Linum usitatissimum
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       335   1e-108   Prunus mume [ume]
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    335   1e-108   Eucalyptus grandis [rose gum]
gb|AFJ52992.1|  UDP-glycosyltransferase 1                               335   2e-108   Linum usitatissimum
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    335   2e-108   Eucalyptus grandis [rose gum]
ref|XP_008229741.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       335   2e-108   Prunus mume [ume]
gb|KCW66544.1|  hypothetical protein EUGRSUZ_F00340                     334   2e-108   Eucalyptus grandis [rose gum]
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    335   2e-108   Nicotiana tomentosiformis
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            334   3e-108   Glycine max [soybeans]
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            334   4e-108   Glycine soja [wild soybean]
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    334   4e-108   Eucalyptus grandis [rose gum]
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       334   4e-108   Malus domestica [apple tree]
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    334   4e-108   Eucalyptus grandis [rose gum]
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      334   5e-108   
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g             334   6e-108   
ref|XP_011467662.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    334   7e-108   Fragaria vesca subsp. vesca
ref|XP_004299646.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    333   8e-108   Fragaria vesca subsp. vesca
gb|AFJ52994.1|  UDP-glycosyltransferase 1                               333   8e-108   Linum usitatissimum
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    333   9e-108   Arabis alpina [alpine rockcress]
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       333   1e-107   
ref|XP_010098617.1|  UDP-glycosyltransferase 85A2                       333   1e-107   
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    333   1e-107   Vitis vinifera
ref|XP_002307921.2|  hypothetical protein POPTR_0006s02440g             332   1e-107   
emb|CDO97426.1|  unnamed protein product                                333   1e-107   Coffea canephora [robusta coffee]
ref|XP_008229792.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       333   2e-107   Prunus mume [ume]
gb|AFK37311.1|  unknown                                                 332   2e-107   Medicago truncatula
ref|XP_011659715.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    330   2e-107   Cucumis sativus [cucumbers]
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    332   4e-107   Arabis alpina [alpine rockcress]
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       331   4e-107   
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    332   4e-107   Eucalyptus grandis [rose gum]
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             332   4e-107   Citrus clementina [clementine]
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    331   7e-107   Eucalyptus grandis [rose gum]
ref|XP_010676201.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    331   7e-107   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW45703.1|  hypothetical protein EUGRSUZ_L005082                    325   9e-107   Eucalyptus grandis [rose gum]
ref|XP_011658802.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    331   9e-107   Cucumis sativus [cucumbers]
emb|CDY21357.1|  BnaA09g30700D                                          324   1e-106   Brassica napus [oilseed rape]
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    331   1e-106   Nelumbo nucifera [Indian lotus]
ref|XP_010676178.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    330   1e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010498707.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       330   1e-106   Camelina sativa [gold-of-pleasure]
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    330   1e-106   Arabis alpina [alpine rockcress]
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       330   1e-106   Tarenaya hassleriana [spider flower]
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    330   2e-106   Pyrus x bretschneideri [bai li]
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     330   2e-106   Eucalyptus grandis [rose gum]
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             330   2e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             330   2e-106   Eutrema salsugineum [saltwater cress]
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    330   2e-106   Brassica rapa
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    330   2e-106   Brassica rapa
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    330   2e-106   Brassica rapa
emb|CDY46643.1|  BnaA07g10530D                                          330   2e-106   Brassica napus [oilseed rape]
ref|XP_004305885.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    329   3e-106   Fragaria vesca subsp. vesca
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            329   3e-106   Stevia rebaudiana
gb|ADG65641.1|  glycosyltransferase                                     330   3e-106   Withania somnifera [ashwagandha]
ref|XP_009103242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       330   3e-106   Brassica rapa
gb|KCW73113.1|  hypothetical protein EUGRSUZ_E01564                     328   3e-106   Eucalyptus grandis [rose gum]
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       329   4e-106   Phoenix dactylifera
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       329   5e-106   Malus domestica [apple tree]
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    329   5e-106   Populus euphratica
ref|XP_008455179.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       329   5e-106   Cucumis melo [Oriental melon]
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       329   6e-106   Brassica rapa
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    329   6e-106   
ref|XP_008342285.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       323   6e-106   
emb|CDP01079.1|  unnamed protein product                                328   6e-106   Coffea canephora [robusta coffee]
gb|KCW66540.1|  hypothetical protein EUGRSUZ_F00337                     328   7e-106   Eucalyptus grandis [rose gum]
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             328   8e-106   Eutrema salsugineum [saltwater cress]
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    328   8e-106   Vitis vinifera
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    328   8e-106   Vitis vinifera
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    328   8e-106   
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    328   9e-106   Phoenix dactylifera
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    328   9e-106   Eucalyptus grandis [rose gum]
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       328   1e-105   Tarenaya hassleriana [spider flower]
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      328   1e-105   
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       328   1e-105   Malus domestica [apple tree]
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    328   1e-105   Phoenix dactylifera
gb|KCW56974.1|  hypothetical protein EUGRSUZ_I02647                     327   1e-105   Eucalyptus grandis [rose gum]
ref|XP_002323757.2|  hypothetical protein POPTR_0017s07890g             322   1e-105   
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    327   1e-105   Elaeis guineensis
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    328   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_007215295.1|  hypothetical protein PRUPE_ppa004989mg             328   2e-105   
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     327   2e-105   Eucalyptus grandis [rose gum]
gb|KCW66548.1|  hypothetical protein EUGRSUZ_F003462                    322   2e-105   Eucalyptus grandis [rose gum]
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                            326   2e-105   Glycine soja [wild soybean]
ref|XP_011004479.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    327   2e-105   Populus euphratica
ref|XP_010030029.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    327   2e-105   Eucalyptus grandis [rose gum]
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                  327   2e-105   Vitis vinifera
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       327   3e-105   Prunus mume [ume]
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    327   3e-105   Nicotiana sylvestris
ref|XP_009145352.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    325   3e-105   Brassica rapa
emb|CDO97427.1|  unnamed protein product                                323   3e-105   Coffea canephora [robusta coffee]
dbj|BAB86928.1|  glucosyltransferase-10                                 327   4e-105   Vigna angularis [azuki bean]
ref|XP_008245954.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       327   4e-105   Prunus mume [ume]
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    326   4e-105   Populus euphratica
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    327   4e-105   Catharanthus roseus [chatas]
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    327   4e-105   Arabis alpina [alpine rockcress]
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             327   5e-105   Prunus persica
ref|XP_012068368.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    327   5e-105   
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         327   5e-105   Jatropha curcas
ref|XP_009349616.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    326   6e-105   Pyrus x bretschneideri [bai li]
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    326   7e-105   Arabis alpina [alpine rockcress]
ref|XP_008229475.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    326   7e-105   Prunus mume [ume]
ref|XP_009110142.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       326   7e-105   Brassica rapa
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       326   7e-105   Cucumis melo [Oriental melon]
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    326   8e-105   Vitis vinifera
ref|XP_008229793.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       326   8e-105   
ref|XP_008229476.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    326   9e-105   
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    326   9e-105   Populus euphratica
ref|NP_173655.2|  UDP-glucosyl transferase 85A3                         325   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       325   1e-104   Phoenix dactylifera
ref|XP_009145349.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    325   1e-104   Brassica rapa
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    325   1e-104   Eucalyptus grandis [rose gum]
gb|KCW45705.1|  hypothetical protein EUGRSUZ_L00511                     324   2e-104   Eucalyptus grandis [rose gum]
ref|XP_008229788.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       325   2e-104   
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    325   2e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       325   2e-104   
emb|CDP01073.1|  unnamed protein product                                325   2e-104   Coffea canephora [robusta coffee]
ref|XP_010676253.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    325   2e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              325   2e-104   Ricinus communis
gb|KFK44619.1|  hypothetical protein AALP_AA1G282400                    320   2e-104   Arabis alpina [alpine rockcress]
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g             325   2e-104   Populus trichocarpa [western balsam poplar]
emb|CDY41486.1|  BnaA08g20880D                                          324   3e-104   Brassica napus [oilseed rape]
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    324   3e-104   Arabis alpina [alpine rockcress]
ref|XP_008373152.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       324   3e-104   Malus domestica [apple tree]
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    324   3e-104   Eucalyptus grandis [rose gum]
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    324   4e-104   Tarenaya hassleriana [spider flower]
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       324   4e-104   
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            324   5e-104   Camelina sativa [gold-of-pleasure]
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              324   6e-104   Ricinus communis
ref|XP_011467660.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    323   6e-104   Fragaria vesca subsp. vesca
ref|XP_008229473.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       323   6e-104   
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          323   6e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010060021.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    323   9e-104   
ref|XP_009377941.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    323   9e-104   Pyrus x bretschneideri [bai li]
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    323   9e-104   Pyrus x bretschneideri [bai li]
emb|CDP01087.1|  unnamed protein product                                323   1e-103   Coffea canephora [robusta coffee]
emb|CDY38225.1|  BnaC05g17420D                                          323   1e-103   Brassica napus [oilseed rape]
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    323   1e-103   Vitis vinifera
ref|XP_011467653.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    322   1e-103   Fragaria vesca subsp. vesca
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       322   1e-103   Camelina sativa [gold-of-pleasure]
gb|ADV71371.1|  glycosyltransferase GT14M03                             322   2e-103   Pueraria montana var. lobata [kudzu]
ref|XP_009349618.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    322   2e-103   Pyrus x bretschneideri [bai li]
ref|XP_002323974.2|  hypothetical protein POPTR_0017s07880g             322   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010060022.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    323   2e-103   Eucalyptus grandis [rose gum]
emb|CDY62992.1|  BnaC07g48400D                                          322   2e-103   Brassica napus [oilseed rape]
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    322   2e-103   Eucalyptus grandis [rose gum]
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       322   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_009350672.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    322   2e-103   Pyrus x bretschneideri [bai li]
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             322   3e-103   
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  322   3e-103   Vitis vinifera
ref|XP_008373154.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       322   3e-103   
emb|CAN60444.1|  hypothetical protein VITISV_032467                     321   3e-103   Vitis vinifera
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        322   3e-103   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_008229791.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       315   3e-103   
ref|XP_011008547.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    322   3e-103   Populus euphratica
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             322   4e-103   Capsella rubella
gb|KCW45699.1|  hypothetical protein EUGRSUZ_L00503                     320   4e-103   Eucalyptus grandis [rose gum]
ref|XP_004305879.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    323   5e-103   Fragaria vesca subsp. vesca
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             321   5e-103   
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       321   5e-103   Cucumis melo [Oriental melon]
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              321   5e-103   Ricinus communis
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    321   5e-103   Solanum lycopersicum
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    321   6e-103   Populus euphratica
ref|XP_004303931.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    321   7e-103   Fragaria vesca subsp. vesca
ref|XP_009349615.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    321   7e-103   Pyrus x bretschneideri [bai li]
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         320   9e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         320   9e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    321   9e-103   Pyrus x bretschneideri [bai li]
ref|XP_002530115.1|  UDP-glucuronosyltransferase, putative              320   9e-103   Ricinus communis
gb|AHL38933.1|  glycosyltransferase                                     320   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094135.1|  UDP-glycosyltransferase 85A2                       316   1e-102   
gb|AFJ52995.1|  UDP-glycosyltransferase 1                               320   1e-102   Linum usitatissimum
ref|XP_002323977.2|  hypothetical protein POPTR_0017s07900g             320   1e-102   
emb|CDX91674.1|  BnaC08g05930D                                          320   1e-102   
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          320   1e-102   Humulus lupulus [common hop]
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             320   1e-102   Capsella rubella
ref|XP_009377940.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    320   1e-102   
ref|XP_008375649.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       320   2e-102   
ref|XP_008386293.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       331   2e-102   
ref|XP_010477497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       320   2e-102   
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    330   2e-102   
ref|XP_002530117.1|  UDP-glucuronosyltransferase, putative              318   2e-102   
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       320   3e-102   
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          319   4e-102   
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    319   4e-102   
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    321   4e-102   
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             321   4e-102   
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            319   5e-102   
ref|XP_009377942.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    318   5e-102   
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             318   5e-102   
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             318   6e-102   
ref|XP_011014733.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    318   6e-102   
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             319   6e-102   
ref|XP_002891115.1|  predicted protein                                  318   7e-102   
ref|XP_010459993.1|  PREDICTED: UDP-glycosyltransferase 85A3            318   8e-102   
ref|XP_008219468.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       321   9e-102   
emb|CDP01082.1|  unnamed protein product                                323   9e-102   
ref|XP_011009482.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    318   9e-102   
ref|XP_009377935.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    318   1e-101   
gb|KDO60734.1|  hypothetical protein CISIN_1g022329mg                   311   1e-101   
ref|XP_004303932.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   1e-101   
ref|XP_009145344.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       318   1e-101   
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       318   1e-101   
ref|XP_008378325.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       318   1e-101   
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       317   1e-101   
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                    317   1e-101   
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             317   2e-101   
gb|EYU39132.1|  hypothetical protein MIMGU_mgv1a025300mg                311   2e-101   
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       318   2e-101   
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       317   2e-101   
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       318   2e-101   
ref|XP_006388605.1|  hypothetical protein POPTR_0140s002101g            308   3e-101   
ref|XP_011658777.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   3e-101   
ref|XP_011008546.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   3e-101   
ref|XP_010477499.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    317   3e-101   
ref|XP_010459992.1|  PREDICTED: UDP-glycosyltransferase 85A5            317   3e-101   
emb|CDY21360.1|  BnaA09g30670D                                          317   4e-101   
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          317   4e-101   
ref|XP_011462065.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   4e-101   
ref|XP_011658788.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    317   4e-101   
ref|XP_002893220.1|  UDP-glucuronosyltransferase                        314   4e-101   
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       317   4e-101   
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    316   6e-101   
ref|XP_002525852.1|  UDP-glucuronosyltransferase, putative              315   6e-101   
emb|CDP01078.1|  unnamed protein product                                316   7e-101   
ref|XP_008342288.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       316   7e-101   
ref|XP_010320181.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    315   1e-100   
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             315   1e-100   
ref|XP_002322559.2|  hypothetical protein POPTR_0016s02220g             315   1e-100   
ref|XP_008229477.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    315   1e-100   
emb|CDP01486.1|  unnamed protein product                                310   2e-100   
gb|KJB79650.1|  hypothetical protein B456_013G060700                    314   2e-100   
ref|XP_002307922.1|  hypothetical protein POPTR_0006s02450g             314   3e-100   
gb|AIS39470.1|  flavonoid UDP-glucosyltransferase 1                     308   3e-100   
ref|XP_009377947.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   3e-100   
ref|XP_011004477.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   4e-100   
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative              313   5e-100   
ref|XP_006388804.1|  hypothetical protein POPTR_0098s00310g             313   6e-100   
ref|XP_008229795.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       313   6e-100   
ref|XP_008391275.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       313   8e-100   
ref|XP_009377951.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   9e-100   
gb|KDO58793.1|  hypothetical protein CISIN_1g022321mg                   306   9e-100   
ref|XP_010030928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   9e-100   
ref|XP_008229744.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       313   1e-99    
ref|XP_006351765.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       313   1e-99    
ref|XP_011658803.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    313   1e-99    
gb|KJB79644.1|  hypothetical protein B456_013G060400                    313   1e-99    
ref|XP_010477496.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       313   2e-99    
ref|XP_002322567.2|  hypothetical protein POPTR_0016s02230g             312   2e-99    
ref|XP_011658789.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    312   2e-99    
ref|XP_008229743.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       312   2e-99    
ref|XP_002322563.2|  hypothetical protein POPTR_0016s02260g             312   2e-99    
ref|XP_008353241.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       312   2e-99    
ref|XP_007047908.1|  UDP-glucosyl transferase 85A2                      312   2e-99    
ref|XP_008455190.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    312   2e-99    
gb|KCW44219.1|  hypothetical protein EUGRSUZ_L023571                    302   2e-99    
ref|XP_002322561.2|  hypothetical protein POPTR_0016s02260g             311   2e-99    
ref|XP_004303933.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   3e-99    
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   3e-99    
ref|XP_008224051.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       311   3e-99    
ref|XP_006426368.1|  hypothetical protein CICLE_v10025476mg             311   3e-99    
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       311   3e-99    
ref|XP_006303659.1|  hypothetical protein CARUB_v10011698mg             311   4e-99    
ref|XP_006466242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       306   4e-99    
ref|NP_564170.1|  UDP-glucosyl transferase 85A5                         305   4e-99    
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       312   5e-99    
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   6e-99    
ref|XP_009377948.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    310   7e-99    
ref|XP_009377934.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    311   7e-99    
ref|XP_002323187.1|  hypothetical protein POPTR_0016s02180g             310   8e-99    
emb|CAN65645.1|  hypothetical protein VITISV_012510                     313   8e-99    
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             310   9e-99    
ref|XP_006466245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       310   9e-99    
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             310   9e-99    
gb|KJB79645.1|  hypothetical protein B456_013G060500                    310   1e-98    
ref|XP_006351766.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       310   1e-98    
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    310   1e-98    
dbj|BAF75889.1|  glucosyltransferase                                    310   1e-98    
ref|XP_008455194.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       310   1e-98    
ref|XP_012069147.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    310   2e-98    
gb|KHN42558.1|  UDP-glycosyltransferase 85A2                            308   2e-98    
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    310   2e-98    
ref|XP_002513939.1|  UDP-glucuronosyltransferase, putative              306   2e-98    
ref|XP_010646820.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    309   2e-98    
ref|XP_008455195.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       309   3e-98    
ref|XP_011008539.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    307   3e-98    
ref|XP_003618644.1|  Cytokinin-O-glucosyltransferase                    309   3e-98    
ref|XP_004231354.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    309   3e-98    
ref|XP_006388792.1|  hypothetical protein POPTR_0098s002202g            304   3e-98    
ref|XP_003544801.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       308   4e-98    
ref|XP_010477498.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    310   5e-98    
ref|XP_004489451.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       308   5e-98    
ref|XP_012065960.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    307   6e-98    
ref|XP_011465456.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    308   6e-98    
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg             316   6e-98    
gb|KDP43115.1|  hypothetical protein JCGZ_26648                         308   9e-98    
gb|AAV32498.1|  UDP-glucuronosyltransferase                             306   1e-97    
ref|XP_002447939.1|  hypothetical protein SORBIDRAFT_06g018460          308   1e-97    
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       307   1e-97    
ref|XP_008224048.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    307   1e-97    
ref|XP_006373648.1|  hypothetical protein POPTR_0016s021501g            301   1e-97    
ref|XP_008789394.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       307   1e-97    
ref|XP_009350108.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    307   1e-97    
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         307   2e-97    
ref|XP_002893221.1|  UDP-glycosyltransferase                            306   2e-97    
ref|XP_003618651.1|  UDP-glucuronosyltransferase 2A3                    306   2e-97    
gb|AAF87258.1|AC068562_5  Strong similarity to UDP-glucose glucos...    305   2e-97    
gb|KDO58792.1|  hypothetical protein CISIN_1g022811mg                   300   3e-97    
ref|XP_006853218.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    306   3e-97    
ref|XP_006852717.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    306   3e-97    
ref|XP_004953966.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       306   3e-97    
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             306   3e-97    
ref|NP_973885.1|  UDP-glucosyl transferase 85A5                         306   3e-97    
ref|XP_012065961.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    305   4e-97    
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            306   4e-97    
gb|AAV32497.1|  UDP-glucuronosyltransferase                             306   5e-97    
ref|XP_009377938.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    306   5e-97    
ref|XP_008455180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       306   5e-97    
ref|XP_009351186.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    300   5e-97    
ref|XP_003618661.1|  Cytokinin-O-glucosyltransferase                    306   5e-97    
ref|XP_011003867.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    306   6e-97    
ref|XP_012072922.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    305   6e-97    
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    305   6e-97    
ref|XP_008342462.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       305   7e-97    
gb|KCW45706.1|  hypothetical protein EUGRSUZ_L00512                     305   7e-97    
ref|XP_008347719.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       305   9e-97    
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         305   1e-96    
ref|XP_011014887.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    305   1e-96    
ref|XP_009341609.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    305   1e-96    
ref|XP_011008538.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    305   1e-96    
ref|XP_002308828.2|  hypothetical protein POPTR_0006s02330g             305   1e-96    
ref|XP_010937418.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    305   1e-96    
ref|XP_011014888.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    305   2e-96    
ref|XP_006304973.1|  hypothetical protein CARUB_v10011467mg             304   2e-96    
ref|XP_006380939.1|  hypothetical protein POPTR_0006s02350g             304   2e-96    
ref|XP_002885822.1|  hypothetical protein ARALYDRAFT_319356             305   2e-96    
ref|XP_011031049.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    304   2e-96    
ref|XP_004303934.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    304   2e-96    
gb|AFJ52993.1|  UDP-glycosyltransferase 1                               304   3e-96    
ref|XP_011031048.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    304   3e-96    
ref|XP_004303929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    305   3e-96    
ref|XP_006366314.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       303   3e-96    
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             303   3e-96    
ref|XP_003618668.1|  Cytokinin-O-glucosyltransferase                    303   3e-96    
ref|XP_011014886.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    304   3e-96    
ref|XP_008237171.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       303   4e-96    
gb|ABK95289.1|  unknown                                                 303   4e-96    
ref|XP_008375675.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       303   4e-96    
gb|AFW64428.1|  hypothetical protein ZEAMMB73_964153                    303   4e-96    
ref|XP_003618665.1|  Cytokinin-O-glucosyltransferase                    303   4e-96    
ref|XP_009350114.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    306   4e-96    
ref|XP_008679294.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       303   5e-96    
ref|XP_002306303.2|  hypothetical protein POPTR_0005s07500g             303   5e-96    
ref|XP_006853259.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    303   5e-96    
ref|XP_009377931.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    303   5e-96    
ref|XP_007148403.1|  hypothetical protein PHAVU_006G205600g             303   6e-96    
ref|XP_010676225.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    303   6e-96    
ref|XP_007151395.1|  hypothetical protein PHAVU_004G042900g             302   8e-96    
ref|XP_004975806.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       303   9e-96    
ref|XP_011468341.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    302   1e-95    
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          302   1e-95    
gb|EAY87581.1|  hypothetical protein OsI_08991                          302   1e-95    
ref|XP_008224046.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    302   1e-95    
ref|NP_001048165.1|  Os02g0755900                                       302   2e-95    
ref|XP_007199429.1|  hypothetical protein PRUPE_ppa026557mg             301   2e-95    
ref|XP_010676237.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    302   2e-95    
gb|EYU18466.1|  hypothetical protein MIMGU_mgv1a005711mg                301   3e-95    
pdb|2PQ6|A  Chain A, Crystal Structure Of Medicago Truncatula Ugt...    301   3e-95    
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    301   3e-95    
ref|XP_008357979.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       300   5e-95    
ref|XP_006466241.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       301   5e-95    
ref|XP_008391265.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       300   6e-95    
ref|XP_011658801.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    299   6e-95    
ref|XP_008347720.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       300   6e-95    
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       300   7e-95    
ref|XP_003618643.1|  Cytokinin-O-glucosyltransferase                    300   7e-95    
ref|XP_004230580.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    300   7e-95    
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    300   8e-95    
ref|XP_008380092.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       298   9e-95    
ref|XP_004489450.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       300   1e-94    
ref|XP_011087901.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    299   1e-94    
ref|XP_011467658.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    300   1e-94    
ref|NP_001149205.1|  cytokinin-O-glucosyltransferase 2                  298   1e-94    
gb|AID16086.1|  flavonol-3-O-glucoside L-rhamnosyltransferase           298   1e-94    
emb|CDY46645.1|  BnaA07g10510D                                          298   2e-94    
emb|CDY62991.1|  BnaC07g48390D                                          298   2e-94    
emb|CDP01480.1|  unnamed protein product                                299   2e-94    
dbj|BAO51834.1|  UDP-glycosyltransferase 85K11                          299   2e-94    
ref|XP_008811180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       299   2e-94    
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    299   2e-94    
ref|XP_012085929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    298   3e-94    
ref|XP_008224050.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       298   3e-94    
ref|XP_004489448.1|  PREDICTED: UDP-glycosyltransferase 85A7-like...    298   3e-94    
ref|XP_007151403.1|  hypothetical protein PHAVU_004G043600g             296   3e-94    
ref|XP_009377949.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    299   3e-94    
ref|XP_004489447.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       298   4e-94    
ref|NP_177950.1|  UDP-glucosyl transferase 85A4                         298   4e-94    
ref|XP_002893219.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    298   4e-94    
gb|KDP33203.1|  hypothetical protein JCGZ_12725                         298   5e-94    
ref|XP_002454243.1|  hypothetical protein SORBIDRAFT_04g027420          298   5e-94    



>dbj|BAO51842.1| UDP-glycosyltransferase 85A32 [Ipomoea batatas]
Length=485

 Score =   380 bits (975),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 212/238 (89%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            QSMLP VY +GPLQ L+ T V+D +V+A  SNLWKED +CL+WL+TK+PNSVVYVN+GSI
Sbjct  248  QSMLPPVYAVGPLQFLQ-TQVKDSNVRALASNLWKEDTSCLEWLDTKEPNSVVYVNYGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTPDQL+EFAWGLANSKK FLWI+RPD V+GE A++PPEFLEETK+RGML+SWC QE+
Sbjct  307  TVMTPDQLLEFAWGLANSKKPFLWIVRPDLVTGEAAIIPPEFLEETKDRGMLSSWCSQEQ  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTH+GWNSTLESIC+GVPM+CWPFFAEQQTNC Y  + WGIG EI++NVK
Sbjct  367  VLNHPAIGGFLTHNGWNSTLESICSGVPMLCWPFFAEQQTNCHYACSKWGIGKEIDSNVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE LV+ELM+GEKG EMK+KAMEWKKLA+++AT++ GSS++N++++ N  LL PK
Sbjct  427  RDEVEKLVRELMEGEKGGEMKKKAMEWKKLAEEAATSSIGSSHINIDKLINLHLLPPK  484



>dbj|BAG80542.1| glycosyltransferase [Lycium barbarum]
Length=484

 Score =   373 bits (957),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 209/238 (88%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++LP VY IGPL LL K  V D+++K   S+LWKE+  C+ WL+TK+PNSVVYVNFGSI
Sbjct  246  RTLLPPVYPIGPLHLLVKH-VDDENLKGLGSSLWKEEPECIQWLDTKEPNSVVYVNFGSI  304

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP+QL+EFAWGLANS++ FLWIIRPD VSG+EA++PPEF+EETK+RGMLASWC QE+
Sbjct  305  TVMTPNQLIEFAWGLANSQQDFLWIIRPDIVSGDEAILPPEFVEETKKRGMLASWCSQEE  364

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+  T WG+GMEI+NNVK
Sbjct  365  VLNHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWGVGMEIDNNVK  424

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVESLV+ELM GEKGK+MK+K +EWK LAQ+SA  ++GSSYVN+E++ N +LLS K
Sbjct  425  RDEVESLVRELMVGEKGKQMKKKTIEWKNLAQESAKQSTGSSYVNIEKVVNDILLSSK  482



>sp|F8WKW1.1|UGT2_GARJA RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Genipin glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 2; Short=GjUGT2; AltName: Full=UDP-glycosyltransferase 
85A24 [Gardenia jasminoides]
 dbj|BAK55737.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=481

 Score =   369 bits (947),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 206/235 (88%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +YTIGPLQ L+K  V+D+ +    SNLWKE+  CLDWL++KDPNSVVYVNFGSIT
Sbjct  248  AILPPIYTIGPLQFLQKE-VKDERLSVLGSNLWKEEPECLDWLDSKDPNSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP QLVEFAWGLANSK+TFLWIIRPD VSG+ A++PPEFLEETK+RG+LASWCPQE+V
Sbjct  307  VMTPGQLVEFAWGLANSKQTFLWIIRPDLVSGDSAILPPEFLEETKDRGLLASWCPQEQV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCW+C T W  G+EI+NNVKR
Sbjct  367  LSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWYNGLEIDNNVKR  426

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +EVESLV ELM GEKG +MK+KA+EWK  A+++A ++ GSSY NLE++  +VLLS
Sbjct  427  DEVESLVTELMVGEKGMDMKKKALEWKNKAEEAAKSSGGSSYSNLEKVV-QVLLS  480



>ref|XP_004237926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=491

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 202/238 (85%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q+++P VY IGPL LL K  V D D+    SNLWKE+  CL+WL++K PNSVVYVNFGSI
Sbjct  250  QTLVPPVYVIGPLNLLVKH-VDDKDLADLGSNLWKEEPKCLEWLDSKKPNSVVYVNFGSI  308

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT + L+EFAWGLANS+  FLWIIRPD V GEEA++PPEFLEETKERGMLASWC QEK
Sbjct  309  TVMTMNHLIEFAWGLANSQLDFLWIIRPDVVLGEEAILPPEFLEETKERGMLASWCQQEK  368

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQ TNCW+C T  GIGMEINNNVK
Sbjct  369  VLNHPAIGGFLTHSGWNSTLESISNGVPMICWPFFAEQPTNCWFCCTKLGIGMEINNNVK  428

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE+LV+ELM GEKGKEMK KA EWKKLA+++A   +GSSYVN++++ N++LL+PK
Sbjct  429  RDEVEALVRELMTGEKGKEMKNKATEWKKLAEEAAAKPAGSSYVNIDKLINEILLAPK  486



>ref|XP_004237927.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 201/238 (84%), Gaps = 0/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q +LP +Y +GPL LL +  V D +++   SNLWKE+  CLDWL++K  NSVVYVNFGSI
Sbjct  246  QKLLPPIYAVGPLNLLMEHFVVDKNLEGLGSNLWKEETKCLDWLDSKKANSVVYVNFGSI  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QL EFAWGL NS+  FLWIIRPD VSGEEA++PPEF+EETKERGML SWCPQE+
Sbjct  306  TVMTANQLTEFAWGLVNSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            +L HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+  T WGIGMEI+NNVK
Sbjct  366  ILSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTKWGIGMEIDNNVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R EVESLV+ELM GEKGK+MK+KAMEWKK A+++A   +GSSYVN++++ N++LLS K
Sbjct  426  RAEVESLVRELMVGEKGKDMKKKAMEWKKSAEEAAAKTTGSSYVNIDKLINEILLSSK  483



>ref|XP_004237928.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   365 bits (936),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 204/235 (87%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q++LP VY IGPL  L K  ++D +++   SNLWKED   ++WL++K PNSVVYVNFGSI
Sbjct  247  QTLLPPVYAIGPLHFLVKH-IEDKNLERLGSNLWKEDPKSVEWLDSKKPNSVVYVNFGSI  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QL+EFAWGLANS+  FLWIIRPD VSGEEA++PPEF+EETKERGML SWCPQE+
Sbjct  306  TVMTANQLIEFAWGLANSEMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+  T WGIGMEI+NNVK
Sbjct  366  VLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGMEIDNNVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R+EVESLV+ELM GEKGK+MK+KAMEWKKLA+++A   +GSSYVN++++ N++LL
Sbjct  426  RDEVESLVRELMVGEKGKDMKKKAMEWKKLAEEAAAKPAGSSYVNIDKLINEILL  480



>ref|XP_006363270.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=482

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 204/235 (87%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q++LP VYTIGPL  L K  ++D +++   SNLWKED   ++WL++K PNSVVYVNFGSI
Sbjct  247  QTLLPPVYTIGPLHFLVKH-IEDKNLERLGSNLWKEDPKSVEWLDSKKPNSVVYVNFGSI  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QLVEFAWGLANS+  FLWIIRPD VSGEEA++PPEF+EETKERGML SWCPQE+
Sbjct  306  TVMTANQLVEFAWGLANSQIQFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+  T WGIGMEI+NNVK
Sbjct  366  VLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGMEIDNNVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R+EVESLV+EL+ GEKGK+MK+KAMEWKKL +++A   +GSSYVN++++ N++LL
Sbjct  426  RDEVESLVRELIVGEKGKDMKKKAMEWKKLTEEAAAKPTGSSYVNIDKLINEILL  480



>ref|XP_004237929.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   360 bits (925),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 201/235 (86%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q +LP VY IGPL  L K  ++D +++   SNLWKED   ++WL++K PNSVVYVNFGSI
Sbjct  247  QPLLPPVYAIGPLHFLVKH-IEDKNLEHLGSNLWKEDPKSVEWLDSKKPNSVVYVNFGSI  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QL+EFAWGLANS+  FLWIIRPD VSGEEA++PPEF+EETKERGML SWCPQE+
Sbjct  306  TVMTANQLIEFAWGLANSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+  T WGIGMEI+NNVK
Sbjct  366  VLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGMEIDNNVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R+EVESLV+ELM GEKGK+MK+KAMEWKK A+++A   +GSSYVN++++ N++L 
Sbjct  426  RDEVESLVRELMVGEKGKDMKKKAMEWKKSAEEAAAKPTGSSYVNIDKLINEILF  480



>gb|EYU19971.1| hypothetical protein MIMGU_mgv1a024760mg [Erythranthe guttata]
Length=483

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 201/234 (86%), Gaps = 3/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S LP +Y IGPL L+EK  ++D+ +K   SNLWKEDQ CL+WL+TK+PNSVVYVNFGSIT
Sbjct  250  SFLPPIYPIGPLNLIEKYHIKDEGLKELGSNLWKEDQECLEWLDTKEPNSVVYVNFGSIT  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTPDQL EFAWGLANSK+ FLWIIRP+ VSGE+AV+P  FL+ TKERGMLA+WCPQEKV
Sbjct  310  VMTPDQLNEFAWGLANSKQPFLWIIRPNLVSGEKAVLPDGFLDATKERGMLANWCPQEKV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H +VGGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCWYC T WG+GMEI+++VKR
Sbjct  370  LSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEIDSDVKR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            N VE+LV +LM GE+G++M+ KA+EWK LA+DS   A GSSY NL+ + ++VLL
Sbjct  430  NGVETLVTKLMVGEEGRQMRNKAVEWKNLARDS---AEGSSYRNLKNLIDQVLL  480



>emb|CDP01076.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   360 bits (923),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 201/235 (86%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y IGPLQ LEK  V+D+ +    SNLWKE+  CL+WL++KDPNSVVYVNFGSIT
Sbjct  248  AILPPIYAIGPLQFLEKE-VKDERLSVLGSNLWKEEPECLEWLDSKDPNSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT DQLVEFAWGL NSK+TFLWIIRPD VSG+ A++PPEFLEE K+RG+LASWCPQE+V
Sbjct  307  VMTADQLVEFAWGLVNSKQTFLWIIRPDLVSGDSAILPPEFLEEIKDRGLLASWCPQEQV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCW+C T WG G+EI+NNVKR
Sbjct  367  LSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWGNGLEIDNNVKR  426

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
              VESLV ELM   KGK+MK+KA+EWK  A+++A ++ GSSY NLE++  +VLLS
Sbjct  427  EGVESLVTELMVRGKGKDMKKKALEWKNKAEEAAKSSGGSSYANLEKVV-QVLLS  480



>ref|XP_008219404.1| PREDICTED: UDP-glycosyltransferase 85A2-like, partial [Prunus 
mume]
Length=385

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 199/237 (84%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y+IGPL L    +  D ++K  RSNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  148  TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  207

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA WCPQE+V
Sbjct  208  VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQV  267

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQ NC +C   WGIGMEI  +VKR
Sbjct  268  LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQINCRFCCKEWGIGMEIEGDVKR  327

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N +E LV++LM+GE+GKEM++KA+EWKKLA+++ T  +G S+V L+++ N+VLLSP+
Sbjct  328  NYIEGLVRKLMEGEEGKEMRKKALEWKKLAKEATTGPNGLSFVGLDKLVNQVLLSPR  384



>gb|KCW66550.1| hypothetical protein EUGRSUZ_F00348 [Eucalyptus grandis]
Length=356

 Score =   353 bits (905),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 202/238 (85%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YT+GPL LL K L  D++ + F+SNLWKE+  C++WL++K P+SVVYVNFGSI
Sbjct  119  KAMFPPIYTLGPLHLLTKQL-SDNNTRPFKSNLWKEEPGCIEWLDSKQPSSVVYVNFGSI  177

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +LASWCPQE+
Sbjct  178  TVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQER  237

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI++NVK
Sbjct  238  VLSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSNVK  297

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            RNEVE  VKELM+GEKGK MKRKAM+WK++A++ AT  SGSS++NL+++ NKVLLSPK
Sbjct  298  RNEVERQVKELMEGEKGKHMKRKAMKWKEMARE-ATRPSGSSFLNLDEVINKVLLSPK  354



>gb|EYU19973.1| hypothetical protein MIMGU_mgv1a005383mg [Erythranthe guttata]
Length=486

 Score =   357 bits (916),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 201/235 (86%), Gaps = 3/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP +Y IGPL L+EK ++++  +    SNLWKEDQ CL WL+TK+PNSVVYVNFGSIT
Sbjct  253  SILPPIYPIGPLNLIEKNVIENKGLNLLGSNLWKEDQECLKWLDTKEPNSVVYVNFGSIT  312

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTPDQL EFAWGLANS + FLWIIRP+ VSGE+AV+P  FL+ TKERGMLA+WCPQEKV
Sbjct  313  VMTPDQLNEFAWGLANSMQPFLWIIRPNLVSGEKAVLPDGFLDATKERGMLANWCPQEKV  372

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H +VGGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCWYC T WG+GMEI+++VKR
Sbjct  373  LSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEIDSDVKR  432

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            N VE+LV +LM GE+G++M+ KA+EWK LA+DS   A GSSY NL+++ ++VLLS
Sbjct  433  NGVETLVTKLMVGEEGRQMRNKAVEWKNLARDS---AEGSSYRNLKKLIDQVLLS  484



>gb|KCW45340.1| hypothetical protein EUGRSUZ_L00994 [Eucalyptus grandis]
Length=461

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 202/238 (85%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YT+GPL LL K L  D++ + FRSNLWKE+  C++WL++K P+SVVYVNFGSI
Sbjct  224  KAMFPPIYTLGPLHLLTKQL-SDNNTRPFRSNLWKEEPGCIEWLDSKQPSSVVYVNFGSI  282

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +LASWCPQE+
Sbjct  283  TVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQER  342

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI+++VK
Sbjct  343  VLSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSDVK  402

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            RNEVE  VKELM+GEKGK MKRKAMEWK++A++ AT  SGSS++NL+++ NKVLLSPK
Sbjct  403  RNEVERQVKELMEGEKGKHMKRKAMEWKEMARE-ATRPSGSSFLNLDEVINKVLLSPK  459



>ref|XP_008219459.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   356 bits (914),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 199/237 (84%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP VY++GPL L    +  DD +K+  SNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPVYSVGPLHLQLNQIPADDKLKSIGSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W+IRPD V GE AVVPPEF++ETKERG+LASWCPQE+V
Sbjct  306  VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLASWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNSTLES+C GVPMICWPFFAEQ  NC +C   WGIGMEI  +VKR
Sbjct  366  LSHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGMEIEGDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N VE LV++LM+GE+GKEM++KA+EWKKLA+++ T  +G S+V L+++ N+VLLSP+
Sbjct  426  NYVEGLVRKLMEGEEGKEMRKKALEWKKLAKEATTGPNGLSFVCLDKLVNQVLLSPR  482



>ref|XP_007222664.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
 gb|EMJ23863.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
Length=483

 Score =   356 bits (914),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 199/237 (84%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP VY++GPL L    +  D+ +K+  SNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPVYSVGPLHLQLNQIPADNKLKSIGSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EF+WGLANS +TF W+IRPD V GE AVVPPEF++ETKERG+LASWCPQE+V
Sbjct  306  VMTAEQLIEFSWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLASWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQ  NC +C   WGIGMEI  +VKR
Sbjct  366  LSHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGMEIEGDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N VE LV++LM+GE+GKEM+RKA+EWKKLA+++ T  +G S+V LE++ N+VLLSP+
Sbjct  426  NYVEELVRKLMEGEEGKEMRRKALEWKKLAKEATTGPNGLSFVGLEKLVNQVLLSPR  482



>ref|XP_008219456.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   356 bits (914),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/238 (67%), Positives = 200/238 (84%), Gaps = 1/238 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQD-DDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++LP +Y IGPLQL    +  D +++K+  SNLW+E+  CL+WL++K+PNSVVYVNFGSI
Sbjct  246  TLLPPIYCIGPLQLQVSQIPPDYNNLKSIESNLWREETECLEWLDSKEPNSVVYVNFGSI  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QL+EF WGLANS K FLW+IRPD V GE AVVPPEFLEETKERG+ ASWCPQE+
Sbjct  306  TVMTSEQLIEFVWGLANSNKAFLWVIRPDLVCGESAVVPPEFLEETKERGLFASWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTHSGWNS+LES+C GVPMICWPFFAEQQTNC +C   WG+G+EI  +VK
Sbjct  366  VLSHPAVGGFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCREWGVGIEIEGDVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            RN +E LV+ LM+GEKGKEM++KAMEWKKLA+++AT  +G S++ L+ + N+VLLSP+
Sbjct  426  RNYIEDLVRTLMEGEKGKEMRKKAMEWKKLAEEAATGPNGLSFLALDNMINRVLLSPR  483



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   356 bits (914),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 201/237 (85%), Gaps = 1/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y+IGPL L    +  D ++K  RSNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA WCPQE+V
Sbjct  306  VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGIGMEI N+VKR
Sbjct  366  LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIGMEIENDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N VE LV++LM+GE+GK+M++KA+EWKKLA + AT+ +GSS+V L+++ N+VLLSP+
Sbjct  426  NYVEGLVRKLMEGEEGKDMRKKALEWKKLAME-ATSPNGSSFVALDKMINQVLLSPR  481



>ref|XP_010064219.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=449

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 202/238 (85%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YT+GPL LL K L  D++ + F+SNLWKE+  C++WL++K P+SVVYVNFGSI
Sbjct  212  KAMFPPIYTLGPLHLLTKQL-SDNNTRPFKSNLWKEEPGCIEWLDSKQPSSVVYVNFGSI  270

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +LASWCPQE+
Sbjct  271  TVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQER  330

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI++NVK
Sbjct  331  VLSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSNVK  390

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            RNEVE  VKELM+GEKGK MKRKAM+WK++A++ AT  SGSS++NL+++ NKVLLSPK
Sbjct  391  RNEVERQVKELMEGEKGKHMKRKAMKWKEMARE-ATRPSGSSFLNLDEVINKVLLSPK  447



>ref|XP_002285779.1| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X2 [Vitis 
vinifera]
Length=474

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +M P +YTIGP+ LL    +QD D+K+  SNLWKED+ CL WL++K PN+VVYVNFGSIT
Sbjct  242  TMYPPIYTIGPISLLMNQ-IQDKDLKSIGSNLWKEDEECLQWLDSKGPNTVVYVNFGSIT  300

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VM P+ L+EFAWGL+NSK+ FLWIIRPD VSG  A++PPEFL ETK+RG+LASWC QE+V
Sbjct  301  VMKPEHLIEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLASWCSQEQV  360

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            LGHPAVGGFLTH+GWNS LES+C GV MICWPFFAEQQTNC YC T WGIGMEI+ +VKR
Sbjct  361  LGHPAVGGFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGMEIDGDVKR  420

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            ++VE LV+ELM+GEKG+EMK+K MEWKK+A ++ TA SGSS+ NL+++  ++LL
Sbjct  421  DDVERLVRELMEGEKGEEMKKKTMEWKKIAHEATTAPSGSSFFNLDRMIKQLLL  474



>ref|XP_010040275.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 202/238 (85%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YT+GPL LL K L  D++ + FRSNLWKE+  C++WL++K P+SVVYVNFGSI
Sbjct  249  KAMFPPIYTLGPLHLLTKQL-SDNNTRPFRSNLWKEEPGCIEWLDSKQPSSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +LASWCPQE+
Sbjct  308  TVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQER  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI+++VK
Sbjct  368  VLSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSDVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            RNEVE  VKELM+GEKGK MKRKAMEWK++A++ AT  SGSS++NL+++ NKVLLSPK
Sbjct  428  RNEVERQVKELMEGEKGKHMKRKAMEWKEMARE-ATRPSGSSFLNLDEVINKVLLSPK  484



>ref|XP_002302305.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
 gb|EEE81578.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
Length=483

 Score =   355 bits (910),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/237 (70%), Positives = 199/237 (84%), Gaps = 2/237 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VY+IGPL LL    V D D+K   SNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  248  SMLPPVYSIGPLHLLLNQ-VTDSDLKLIGSNLWIEESGCLEWLDSKEPNSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT DQL EFAWGLANS +TFLW+IRPD V+G+ A++PPEF+  TKERG+ ASWC QE+V
Sbjct  307  VMTSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFASWCSQEQV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTH+GWNST+ESIC GVPMICWPFFAEQQTNC YC T WGIGMEIN++VKR
Sbjct  367  LSHPSIGGFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEINSDVKR  426

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
             EVESLV+ELM GEKG EMK+K  EWKK+A+++ T ++GSS +NL+ + NKVLLSP+
Sbjct  427  GEVESLVRELMGGEKGSEMKKKTREWKKMAEEAIT-STGSSCMNLDDMINKVLLSPR  482



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   354 bits (909),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 202/237 (85%), Gaps = 1/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y+IGPL L    +  D ++K  RSNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA WCPQE+V
Sbjct  306  VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGIGMEI ++VKR
Sbjct  366  LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N VE LV++LM+GE+GK+M++KA+EWKKLA++ AT+ +GSS+V L+++ N+VLLSP+
Sbjct  426  NYVEGLVRKLMEGEEGKDMRKKALEWKKLAKE-ATSPNGSSFVPLDKMINQVLLSPR  481



>ref|XP_008219316.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 200/237 (84%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP VY++GPL +    +  D+++K+  SNLW E+  CLDWL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPVYSVGPLHIQLNQIPADNELKSIGSNLWTEEPVCLDWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W+IRPD V GE AVVPPEF++ET ERG+LASWCPQE+V
Sbjct  306  VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETNERGLLASWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNSTLES+C GVPMICWPFFAEQQ NC +C   WGIGMEI  +VKR
Sbjct  366  LSHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQINCRFCCKEWGIGMEIEGDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N +E LV++LM+GE+GKEM++KA+EWKKLA+++ +  +GSS+V L+++ N++LLS +
Sbjct  426  NYIEGLVRKLMEGEEGKEMRKKALEWKKLAKEATSGPNGSSFVGLDKLVNQMLLSRR  482



>ref|XP_007222658.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
 gb|EMJ23857.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
Length=483

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 199/237 (84%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP VY++GPL L    +  D+++K+  SNLW E+  CLDWL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPVYSVGPLHLQLNHIPADNELKSIGSNLWTEEPVCLDWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W++RPD V GE AVVPPEF+EETKERG+LASWCPQE+V
Sbjct  306  VMTAEQLIEFAWGLANSNQTFFWVVRPDLVGGEAAVVPPEFMEETKERGLLASWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H AVGGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIGMEI  +VKR
Sbjct  366  LSHAAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRFCCREWGIGMEIEGDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N VE LV++LM GE+GKEM++KA+EWKKLA+++ T  +G S+V L+++ N++LLS +
Sbjct  426  NYVEGLVRKLMAGEEGKEMRKKALEWKKLAKEATTGPNGFSFVGLDKLVNQMLLSTR  482



>ref|XP_004299648.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 197/234 (84%), Gaps = 0/234 (0%)
 Frame = -3

Query  857  PSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMT  678
            P+VY+IGPL L    +    +++  +SNLWKE+  CL+WL++KDP+SVVYVNFGSITVMT
Sbjct  254  PAVYSIGPLSLQLNQIPPGSELQTLKSNLWKEESECLEWLDSKDPDSVVYVNFGSITVMT  313

Query  677  PDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGH  498
              QL+EFAWGLANSKKTFLW+IRPD V G  AVVP EF+EET+ER MLA+WCPQE+VL H
Sbjct  314  ETQLIEFAWGLANSKKTFLWVIRPDLVGGSSAVVPAEFVEETRERSMLATWCPQEEVLRH  373

Query  497  PAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEV  318
            PAVGGFLTHSGWNSTLESIC GVPMICWPFFAEQQTNC +C   WGIGMEI  + KR+ V
Sbjct  374  PAVGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRFCCKEWGIGMEIEGDPKRDYV  433

Query  317  ESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            E LV++LM+GE+GKEMK+KA+EWK+LA ++AT   GSS+VNL+++ N+VLL+P+
Sbjct  434  EGLVRKLMEGEEGKEMKKKALEWKRLAMEAATGPKGSSFVNLDKMVNQVLLAPR  487



>ref|XP_004299647.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 204/239 (85%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQL-LEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            +++LP +Y+IGPL L L++   +  D+K+ +SNLWK++  CL+WL+++ PNSVVYVNFGS
Sbjct  243  KNLLPPIYSIGPLHLQLDQVQSEGTDLKSIQSNLWKDEPECLEWLDSRAPNSVVYVNFGS  302

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT +QL+EFAWGLANS KTFLW+IRPD V GE AVVPPEF+EETKER +L +WCPQE
Sbjct  303  ITVMTSEQLIEFAWGLANSSKTFLWVIRPDLVGGESAVVPPEFVEETKERSLLTTWCPQE  362

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPA+GGFLTHSGWNSTLES+CAGVPM+CWPFFAEQQTNC YC   WGIGMEI  +V
Sbjct  363  QVLNHPAIGGFLTHSGWNSTLESVCAGVPMLCWPFFAEQQTNCRYCCKEWGIGMEIEGDV  422

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
             R+ +E LV +LM+GE+GKEM++KAMEWKKLA+++AT  +G S+++L+++ N+VLLS K
Sbjct  423  HRSNIEELVTKLMEGEEGKEMRKKAMEWKKLAKEAATGPNGLSFLDLDKMVNEVLLSKK  481



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   352 bits (903),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 202/237 (85%), Gaps = 1/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y+IGPL L    +  D ++K  RSNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLA+S +TF W+IRPD V G+ AVVPPEF+EETKER +LA WCPQE+V
Sbjct  306  VMTAEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGIGMEI ++VKR
Sbjct  366  LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N +E LV++LM+GE+GK+M++KA+EWKKLA++ AT+ +GSS+V L+++ N+VLLSP+
Sbjct  426  NYIEGLVRKLMEGEEGKDMRKKALEWKKLAKE-ATSPNGSSFVPLDKMINQVLLSPR  481



>ref|XP_007141198.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
 gb|ESW13192.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
Length=484

 Score =   352 bits (903),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/234 (70%), Positives = 199/234 (85%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL K  V D ++ A  SNLWKED  C++WLNTK+PNSVVYVNFGSIT
Sbjct  245  SILPPVYSIGPLNLLLKN-VDDKELNAIESNLWKEDSECMEWLNTKEPNSVVYVNFGSIT  303

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+T  QLVEFAWGL NS KTFLW+IRPD V+GE  V+PPEF+E+TK RG+L+SWC QE+V
Sbjct  304  VVTSAQLVEFAWGLGNSNKTFLWVIRPDLVAGENVVLPPEFVEQTKNRGLLSSWCSQEQV  363

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+CAGVPMICWPFFAEQQTNC +C   WGIGMEI  +VKR
Sbjct  364  LNHPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEI-EDVKR  422

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++ESLVKELMDGEKGK+MK KA++WKKLA+ +A+   G+S++NL+ + ++VLL
Sbjct  423  DKIESLVKELMDGEKGKQMKEKALQWKKLAKSAASGPYGTSFLNLDNMVHEVLL  476



>ref|XP_007226586.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
 gb|EMJ27785.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
Length=474

 Score =   352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 200/236 (85%), Gaps = 1/236 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y+IGPL L    +  D ++K  RSNLW E+  CL+WLN+K+PNSVVYVNFGSIT
Sbjct  240  TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLNSKEPNSVVYVNFGSIT  299

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA+WCPQE+V
Sbjct  300  VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQV  359

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGI MEI ++VKR
Sbjct  360  LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIDMEIESDVKR  419

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            N VE LV++LM+G++GKEM++KA+EWKKLA + AT+ +GSS+V L+++ N+VLLSP
Sbjct  420  NHVEGLVRKLMEGDEGKEMRKKALEWKKLATE-ATSPNGSSFVGLDKMVNEVLLSP  474



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   352 bits (902),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 202/237 (85%), Gaps = 1/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y+IGPL L    +  D ++K  RSNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLA+S +TF W+IRPD V G+ AVVPPEF+EETKER +LA WCPQE+V
Sbjct  306  VMTAEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    WGIGMEI ++VKR
Sbjct  366  LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N +E LV++LM+GE+GK+M++KA+EWKKLA++ AT+ +GSS+V L+++ N+VLLSP+
Sbjct  426  NYIEGLVRKLMEGEEGKDMRKKALEWKKLAKE-ATSPNGSSFVPLDKMINQVLLSPR  481



>ref|XP_011016634.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Populus euphratica]
Length=483

 Score =   352 bits (902),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 199/237 (84%), Gaps = 2/237 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VY+IGPL LL    V D D+K   SNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  248  SMLPPVYSIGPLHLLLNQ-VTDSDLKLIGSNLWIEESGCLEWLDSKEPNSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT DQL EFAWGLANS +TFLW+IRPD V+G+ A++PPEF+  TKERG+ +SWC QE+V
Sbjct  307  VMTSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFSSWCSQEQV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTHSGWNST+ESIC GVPMICWPFFAEQQTNC YC T WGIGMEIN++VKR
Sbjct  367  LSHPSIGGFLTHSGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEINSDVKR  426

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
             EVESLV+ELM G+KG+EMK+K  E KK+A+++ T ++GSS +NL+ + NKVLLSP+
Sbjct  427  GEVESLVRELMGGDKGREMKKKTRELKKMAEEAIT-STGSSCMNLDDMINKVLLSPR  482



>ref|XP_007222427.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
 gb|EMJ23626.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
Length=486

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 199/238 (84%), Gaps = 1/238 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQD-DDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++LP +Y IGPLQL    +  D +++K+  SNLW+E+  CL+WL++K+PNSVVYVNFGSI
Sbjct  246  TLLPPIYCIGPLQLQVSQIPPDYNNLKSIESNLWREETECLEWLDSKEPNSVVYVNFGSI  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QL+EF WGLANS K FLW+IRPD V GE AVVPPEFLEET+ERG+ +SWCPQE+
Sbjct  306  TVMTSEQLIEFVWGLANSNKAFLWVIRPDLVLGESAVVPPEFLEETEERGLFSSWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTHSGWNS+LES+C GVPMICWPFFAEQQTNC +C   WG+G+EI  +VK
Sbjct  366  VLSHPAVGGFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCKEWGVGIEIEGDVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            RN +E LV+ LM+GEKGKEM++KA EWKKLA+++AT  +G S++ L+ + N+VLLSP+
Sbjct  426  RNYIEDLVRTLMEGEKGKEMRKKATEWKKLAEEAATGPNGLSFLALDNMINRVLLSPR  483



>ref|XP_012067889.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Jatropha 
curcas]
 gb|KDP41397.1| hypothetical protein JCGZ_15804 [Jatropha curcas]
Length=487

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IG LQLL    ++D+++K+  SNLWKED  CL WL++K+PNSVVYVNFGSIT
Sbjct  249  SLLPPVYSIGSLQLLLNN-IKDENLKSIESNLWKEDADCLQWLDSKEPNSVVYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT  QL+EFAWGLANS KTFLW+IRPD V+G+ AV+PPEF+  TKERG LASWCPQE+V
Sbjct  308  VMTNKQLIEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLASWCPQEQV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H ++GGFLTHSGWNSTLE ICAGVPMICWPFFAEQQTNC Y    WGIGMEIN++VK 
Sbjct  368  LSHSSIGGFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGMEINSDVKG  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +EVE LV+ELM+G KGKEMK+KAMEWKK+A+++ T   GSS+ NL++  N +LLS
Sbjct  428  DEVEILVRELMEGVKGKEMKKKAMEWKKMAEEAITCPKGSSFQNLDKFINLLLLS  482



>ref|XP_002285778.2| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X1 [Vitis 
vinifera]
Length=492

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 195/233 (84%), Gaps = 1/233 (0%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            M P +YTI PLQLL    + D +++   SNLWKED+ CL WL++K PN+VVYVNFGSITV
Sbjct  261  MYPPIYTIAPLQLLLDQ-IHDSELQLIGSNLWKEDEECLQWLDSKGPNTVVYVNFGSITV  319

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            M P+ L+EFAWGL+NSK+ FLWIIRPD VSG  A++PPEFL ETK+RG+LASWC QE+VL
Sbjct  320  MKPEHLIEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLASWCSQEQVL  379

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
            GHPAVGGFLTH+GWNS LES+C GV MICWPFFAEQQTNC YC T WGIGMEI+ +VKR+
Sbjct  380  GHPAVGGFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGMEIDGDVKRD  439

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +VE LV+ELM+GEKG+EMK+K MEWKK+A ++ TA SGSS+ NL+++  ++LL
Sbjct  440  DVERLVRELMEGEKGEEMKKKTMEWKKIAHEATTAPSGSSFFNLDRMIKQLLL  492



>ref|XP_006363269.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=485

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/235 (69%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q +LP VYTIGPL  L K  ++D +++   SNLWKE+   ++WL++K PNSVVYVNFGSI
Sbjct  250  QVLLPPVYTIGPLHFLLKH-IEDRNLECLGSNLWKEEPKTVEWLDSKKPNSVVYVNFGSI  308

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QL EFAWGLANS+  FLWIIRPD VSGE+A +P EF+EETKERGML SWC QE+
Sbjct  309  TVMTANQLTEFAWGLANSQMDFLWIIRPDTVSGEKATLPSEFMEETKERGMLTSWCAQEQ  368

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI  GVPMICWPFF EQQTNCW+  T W IGMEI+NNVK
Sbjct  369  VLSHPAIGGFLTHSGWNSTLESISNGVPMICWPFFTEQQTNCWFKCTQWRIGMEIDNNVK  428

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R+EVE LV++LM GEKGK+MK+KAMEWKKLA+++A  ++GSSYVN++++ N++LL
Sbjct  429  RDEVERLVRDLMVGEKGKDMKKKAMEWKKLAEEAAAKSTGSSYVNIDKLINEILL  483



>ref|XP_012067890.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Jatropha 
curcas]
 gb|KDP41399.1| hypothetical protein JCGZ_15806 [Jatropha curcas]
Length=487

 Score =   349 bits (896),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IG LQLL    ++D+++K+  SNLWKED  CL WL++K+PNSVVYVNFGSIT
Sbjct  249  SLLPPVYSIGSLQLLLNN-IKDENLKSIESNLWKEDADCLQWLDSKEPNSVVYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT  QL+EFAWGLANS KTFLW+IRPD V+G+ AV+PPEF+  TKERG LASWCPQE+V
Sbjct  308  VMTNKQLIEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLASWCPQEQV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H ++GGFLTHSGWNSTLE ICAGVPMICWPFFAEQQTNC Y    WGIGMEIN++VKR
Sbjct  368  LSHSSIGGFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGMEINSDVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +EVE LV+ELM G KG+EMK+KAMEWKK+A+++ T  +GSS+ NL++  N  LLS
Sbjct  428  DEVEILVRELMVGVKGQEMKKKAMEWKKMAEEAITCPNGSSFQNLDKFINHHLLS  482



>ref|XP_002285770.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=473

 Score =   348 bits (894),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            M P +YTIGPLQLL    + D ++K   SNLWKE+  CL WL++K+PNSVVYVN+GSITV
Sbjct  242  MYPPIYTIGPLQLLPDQ-IHDSELKLIGSNLWKEEPECLKWLDSKEPNSVVYVNYGSITV  300

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MTP QL+EFAWGLANS ++FLWI+RPD VSGE A++PPEF+ ET++RG+LA WCPQE+VL
Sbjct  301  MTPQQLIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWCPQEQVL  360

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             H A+GGFLTH+GWNST+E +CAGVPMICWPFFAEQQTNC YC T WG+GMEI+++VKR+
Sbjct  361  THQAIGGFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEIDSDVKRD  420

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            EV  LV+ELM GEKGK MK+K MEWK  A+ + T   GSSY+NLE+IF +VLL
Sbjct  421  EVAKLVRELMVGEKGKVMKKKTMEWKHRAEVATTGPDGSSYLNLEKIFEQVLL  473



>dbj|BAO51844.1| UDP-glycosyltransferase 85A28 [Vitis vinifera]
Length=473

 Score =   348 bits (894),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            M P +YTIGPLQLL    + D ++K   SNLWKE+  CL WL++K+PNSVVYVN+GSITV
Sbjct  242  MYPPIYTIGPLQLLPDQ-IHDSELKLIGSNLWKEEPECLKWLDSKEPNSVVYVNYGSITV  300

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MTP QL+EFAWGLANS ++FLWI+RPD VSGE A++PPEF+ ET++RG+LA WCPQE+VL
Sbjct  301  MTPQQLIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWCPQEQVL  360

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             H A+GGFLTH+GWNST+E +CAGVPMICWPFFAEQQTNC YC T WG+GMEI+++VKR+
Sbjct  361  THQAIGGFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEIDSDVKRD  420

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            EV  LV+ELM GEKGK MK+K MEWK  A+ + T   GSSY+NLE+IF +VLL
Sbjct  421  EVAKLVRELMVGEKGKVMKKKTMEWKHRAEVATTGPDGSSYLNLEKIFEQVLL  473



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 200/234 (85%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL K  V +  + A  SNLWKE+  C++WLNTK+PNSVVYVNFGSIT
Sbjct  245  SILPPVYSIGPLNLLVKN-VDNKALNAIESNLWKEESECMEWLNTKEPNSVVYVNFGSIT  303

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QLVEFAWGL NS K+FLW+IRPD V+GE A++PPEF+++TK RG+L+SWC QE+V
Sbjct  304  VMTSEQLVEFAWGLGNSNKSFLWVIRPDLVAGENAILPPEFVKQTKNRGLLSSWCSQEQV  363

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+CAGVPMICWPFFAEQQTNC +C   WGIGMEI  +VKR
Sbjct  364  LNHPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEI-EDVKR  422

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++ESLVKELMDGEKGK+MK KA++WKKLA+ +A+   G+S++NL+ + ++VLL
Sbjct  423  DKIESLVKELMDGEKGKQMKEKALQWKKLAKTAASGPYGTSFLNLDNMVHEVLL  476



>ref|XP_010039907.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45644.1| hypothetical protein EUGRSUZ_L00599 [Eucalyptus grandis]
Length=487

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 199/238 (84%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YT+GPL LL K L  D++ K F SNLWKE+  C++WL++K P SV+YVNFGSI
Sbjct  250  KAMFPPIYTVGPLHLLTKQL-SDNNTKPFGSNLWKEEPGCIEWLDSKQPGSVMYVNFGSI  308

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +L SWCPQE+
Sbjct  309  TVMSPVQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWCPQER  368

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTH+GWNST+ESI AGVP++CWPFF +QQTNCWY    WGIGMEI+NNVK
Sbjct  369  VLSHSAVGGFLTHNGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDNNVK  428

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            RNEVE  VKELM+GEKGK+MKRKAMEWK++A++ AT  SGSS++NL+++ NKVLLS +
Sbjct  429  RNEVERQVKELMEGEKGKQMKRKAMEWKEMARE-ATRPSGSSFLNLDEVINKVLLSTR  485



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 199/236 (84%), Gaps = 1/236 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y+IGPL L    +  D ++K  RSNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA+WCPQE+V
Sbjct  306  VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNST+ES+CAGVPMICWPFFAEQQTNC Y    W IGMEI ++VKR
Sbjct  366  LSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWAIGMEIESDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            N VE LV++LM+G++GKEM++KA+EWKKLA + A + +GSS+V L+++ N+VLLSP
Sbjct  426  NYVEGLVRKLMEGDEGKEMRKKALEWKKLATE-AISPNGSSFVGLDKMVNQVLLSP  480



>ref|XP_004136284.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 193/236 (82%), Gaps = 2/236 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLV--QDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            S+LP V++IGPLQLL + +     D +K   SNLWKED +CL WL+ K PNSVVYVNFGS
Sbjct  248  SLLPPVFSIGPLQLLLQQVASHDSDHLKFLGSNLWKEDTSCLQWLDQKSPNSVVYVNFGS  307

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT DQL EFAWGLANS +TFLWIIRPD V+G+ AV+PPEF++ TKERGML +WCPQE
Sbjct  308  ITVMTKDQLKEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDVTKERGMLTNWCPQE  367

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPA+GGFLTH+GWNST ESI AGVPMICWPFFAEQQTNC YC T WGIGME++++V
Sbjct  368  EVLQHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGIGMEVDSDV  427

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR E+E  VKELM+GEKGKEM+ +A EWKKL  D+AT  SGSS  NL  + +KVLL
Sbjct  428  KREEIEKQVKELMEGEKGKEMRNRAEEWKKLVGDAATPHSGSSSRNLNDLVHKVLL  483



>ref|XP_007227474.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
 gb|EMJ28673.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
Length=483

 Score =   347 bits (891),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/238 (69%), Positives = 200/238 (84%), Gaps = 2/238 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQD-DDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++LP +Y+IGPLQL    +  + +D+KA  SNLW E+  CL+WL+TK+PNSVVYVNFGS 
Sbjct  246  TLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYVNFGST  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QLVEF+WGLANSKK FLWIIRP  V+GE AVVPPEFLEETKERGMLASWCPQE+
Sbjct  306  TVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H A+GGFLTHSGWNSTLE++C GVP+ICWPFFAEQQTN  Y  T WGIG+EI+  VK
Sbjct  366  VLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDGEVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+ ++ LV+ LMDGE+GK+M++KA+EWKKLA+D ATA  GSSY+ LE + +KVLLSP+
Sbjct  426  RDYIDGLVRTLMDGEEGKKMRKKALEWKKLAED-ATAPKGSSYLALENVVSKVLLSPR  482



>dbj|BAG80547.1| glycosyltransferase [Lycium barbarum]
Length=490

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 203/238 (85%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q++LP VY IGPL LL +  V D +++   SNLWKED  CL+WL++K PNSVVYVNFGSI
Sbjct  249  QALLPPVYAIGPLHLLMEH-VDDKNLEKLGSNLWKEDPKCLEWLDSKKPNSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            T MTP+QL+EFAWGLANS+  FLWIIRPD VSG +AV+PPEFLEETKERGMLASWC Q++
Sbjct  308  TPMTPNQLIEFAWGLANSQVDFLWIIRPDIVSGNKAVLPPEFLEETKERGMLASWCQQQQ  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+C T W IGMEI+NNVK
Sbjct  368  VLSHVAVGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFCCTQWEIGMEIDNNVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EV+SLV+EL+  EKG EMK+KA+EWKKLA+++A    GSSYVN++++ N++LLS K
Sbjct  428  RDEVKSLVRELLTWEKGNEMKKKALEWKKLAKEAAKKPGGSSYVNIDKLINEILLSSK  485



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   347 bits (890),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/238 (67%), Positives = 199/238 (84%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++ P +YT+GPL LL K L  D+D K+  SNLWKED  CL+WL++K P+SVVYVNFGSI
Sbjct  249  KAIFPPIYTLGPLHLLTKQL-PDNDTKSIGSNLWKEDLGCLEWLDSKPPSSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLA+S +TFLW+IRPD V G+ A++PPEF   T+ER +LASWCPQE+
Sbjct  308  TVMSPAQLVEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLLASWCPQER  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTHSGWNST+ESI AGVPM+CWPFF EQQTNC Y    WGIGMEI++NVK
Sbjct  368  VLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIGMEIDSNVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EV   V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS +NL+++ +KVLLSP+
Sbjct  428  RDEVSRQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDKVLLSPR  484



>gb|KCW45338.1| hypothetical protein EUGRSUZ_L009912, partial [Eucalyptus grandis]
Length=311

 Score =   340 bits (873),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 198/238 (83%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M PS+ T+GPL LL + L  DDD K+  SNLWKED  CL+WL++K P SVVYVNFGSI
Sbjct  74   KAMFPSICTLGPLHLLTEQL-PDDDTKSIGSNLWKEDLGCLEWLDSKPPGSVVYVNFGSI  132

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++P EF   T+ER +LASWCPQE+
Sbjct  133  TVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLLASWCPQER  192

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTHSGWNST+ESI AGVP++CWPFFAEQQTNC Y    WGIGMEI+ +VK
Sbjct  193  VLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIGMEIDGDVK  252

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R++VE  V+ELM+GE+GKEMKRKAMEW+++A++ A   SGSSY+NL+++ +KVLL P+
Sbjct  253  RDKVERQVRELMEGERGKEMKRKAMEWQQMARE-AMRPSGSSYLNLDEVMDKVLLLPR  309



>ref|XP_008391482.1| PREDICTED: UDP-glycosyltransferase 85A1-like, partial [Malus 
domestica]
Length=317

 Score =   341 bits (874),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 195/237 (82%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP VY+IGPL L    +  D+++K   SNLW E+  CL+WL+TK+PNSVVYVNFGSIT
Sbjct  80   TLLPPVYSIGPLNLQIGQIPADNELKLIGSNLWNEEPECLEWLDTKEPNSVVYVNFGSIT  139

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VM  +QL+EFAWGLAN +KTFLW+IRPD V G+  VVPPEF+EETK+R +LASWCPQE+V
Sbjct  140  VMKSEQLIEFAWGLANCRKTFLWVIRPDLVGGDSDVVPPEFVEETKDRSLLASWCPQEQV  199

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFL HSGWNSTLES+C GVP+ICWPFFAEQQTNC +    WGIG+EI  +VKR
Sbjct  200  LSHPAIGGFLMHSGWNSTLESVCCGVPVICWPFFAEQQTNCRFSCKDWGIGLEIEGDVKR  259

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
              VE LV++LMDGE+GK+M++KA+EWKKLA+ + +   GSS+VN +++ N+VLLSP+
Sbjct  260  KYVEELVRKLMDGEEGKQMRKKALEWKKLAKQAISGPDGSSFVNFDKMVNQVLLSPR  316



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   346 bits (888),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 201/236 (85%), Gaps = 1/236 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y+IGPL +    +  D ++K  RSNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPIYSIGPLHVQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+E+TKER +LA+WCPQE+V
Sbjct  306  VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEDTKERSLLANWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNST+ES+C+GVPMICWPFFAEQQTNC Y    WGIGMEI ++VKR
Sbjct  366  LKHPAVGGFLTHSGWNSTIESVCSGVPMICWPFFAEQQTNCRYSEKEWGIGMEIESDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            N VE LV++LM+G++GKEM++KA+EWKKLA + AT+ +GSS++ L+++ N+VLLSP
Sbjct  426  NYVEGLVRKLMEGDEGKEMRKKALEWKKLATE-ATSPNGSSFLCLDKMVNQVLLSP  480



>gb|ABV68925.1| mandelonitrile glucosyltransferase UGT85A19 [Prunus dulcis]
Length=483

 Score =   346 bits (888),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 200/238 (84%), Gaps = 2/238 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQD-DDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++LP +Y+IGPLQL    +  + +D+KA  SNLW E+  CL+WL+TK+PNSVVYVNFGS 
Sbjct  246  TLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYVNFGST  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QLVEF+WGLANSKK FLWIIRP  V+GE AVVPPEFLEETKERGMLASWCPQE+
Sbjct  306  TVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H A+GGFLTHSGWNSTLE++C GVP+ICWPFFAEQQTN  Y  T WGIG+EI+  VK
Sbjct  366  VLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDGEVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+ ++ LV+ LMDGE+GK+M++KA+EWKKLA+D AT+  GSSY+ LE + +KVLLSP+
Sbjct  426  RDYIDGLVRTLMDGEEGKKMRKKALEWKKLAED-ATSPKGSSYLALENVVSKVLLSPR  482



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   346 bits (888),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 198/236 (84%), Gaps = 1/236 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y+IGPL L    +  D ++K  RSNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS +TF W+IRPD V G+ AVVPPEF+EETKER +LA+WCPQE+V
Sbjct  306  VMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H AVGGFLTHSGWNSTLES+CAGVPMICWPFFAEQQTN  Y    WGIGMEI  +VKR
Sbjct  366  LSHSAVGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNSRYSEKEWGIGMEIERDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            N +E LV++LM+G++GKEM++KA+EWKKLA + AT+ +GSS+V L+++ N+VLLSP
Sbjct  426  NYIEGLVRKLMEGDEGKEMRKKALEWKKLATE-ATSPNGSSFVGLDKMVNQVLLSP  480



>ref|XP_010035387.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84253.1| hypothetical protein EUGRSUZ_B01109 [Eucalyptus grandis]
Length=488

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 199/238 (84%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YT+GPL LL K L  D++ + F SNLWKE+  C++WL++K P+SVVYVNFGSI
Sbjct  251  KAMFPPIYTLGPLHLLTKQL-SDNNTRPFGSNLWKEEPGCIEWLDSKQPSSVVYVNFGSI  309

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++PP+FL  T+ER +L SWCPQE+
Sbjct  310  TVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWCPQER  369

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VLGH AVGGFLTHSGWNST+ESI AGVP++CWPFF +QQTNCWY    W IGMEI+++VK
Sbjct  370  VLGHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWRIGMEIDSDVK  429

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            RNEVE  VKELM+GEKGK+MKRKAMEWK++A++ AT   G S++NL+++ NKVLLSP+
Sbjct  430  RNEVERQVKELMEGEKGKQMKRKAMEWKEMARE-ATRPFGPSFLNLDEVINKVLLSPR  486



>ref|XP_008219457.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 200/238 (84%), Gaps = 2/238 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQD-DDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++LP +Y+IGPLQL    +  + +D+KA  SNLW E+  CL+WL+TK+PNSVVYVNFGS 
Sbjct  246  TLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYVNFGST  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QLVEF+WGLANSKK FLWIIRP  V+GE AVVPPEFLEETKERGMLASWCPQE+
Sbjct  306  TVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H A+GGFLTHSGWNSTLE++C GVP+ICWPFFAEQQTN  Y  T WGIG+EI+  VK
Sbjct  366  VLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDGEVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+ ++ LV+ LMDGE+GK+M++KA+EWKKLA++ ATA  GSSY+ LE + +KVLLSP+
Sbjct  426  RDYIDGLVRTLMDGEEGKKMRKKALEWKKLAEE-ATAPKGSSYLALENVVSKVLLSPR  482



>ref|XP_004300654.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011465520.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 197/237 (83%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL    + + +DDD K   +NLWKE+  CLDWL +K+PNSVVYVNFGSIT
Sbjct  245  SLLPPVYSIGPLHQQLRHIQEDDDSKRIGANLWKEEPECLDWLESKEPNSVVYVNFGSIT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS  TFLW+IRPD V+G+ AVVPPEF+EETK R  LASWCPQE+V
Sbjct  305  VMTDEQLIEFAWGLANSSMTFLWVIRPDLVAGKSAVVPPEFVEETKGRSWLASWCPQEQV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTH GWNS +ES+C GVPMICWPFFA+QQTNC +C   WG+ M+I  +VKR
Sbjct  365  LNHPAIGGFLTHCGWNSMVESLCGGVPMICWPFFADQQTNCRFCCKEWGVAMQIEGDVKR  424

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N +E LV++LM G++GK+M++K++EWKKLA+++ TA +GSS++NL ++ N+VLLSPK
Sbjct  425  NYIEDLVRKLMGGQEGKQMRKKSLEWKKLAEEAITAPNGSSFLNLNKMVNQVLLSPK  481



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 199/237 (84%), Gaps = 1/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM P +YTIGPL LL    ++++ +K   SNLWKE+  C++WLN+K+P SVVYVNFGSIT
Sbjct  248  SMFPPIYTIGPLNLLMNQ-IKEESLKMIGSNLWKEEPMCIEWLNSKEPKSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP+QLVEFAWGLANS ++FLWIIRPD V GE AV+PPEF+  TKERGMLASW PQE+V
Sbjct  307  VMTPNQLVEFAWGLANSNQSFLWIIRPDLVVGESAVLPPEFVAVTKERGMLASWAPQEEV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H +VGGFLTH GWNSTLESI +GV ++CWPFFAEQQTNCWYC    GIGMEI+++VKR
Sbjct  367  LAHSSVGGFLTHCGWNSTLESISSGVAVVCWPFFAEQQTNCWYCCGELGIGMEIDSDVKR  426

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
             EVE LV+ELM GEKGKEMK +AM WK+LA+++  ++SGSS++NL+++ ++VLLSP+
Sbjct  427  EEVERLVRELMVGEKGKEMKERAMGWKRLAEEATQSSSGSSFLNLDKLVHQVLLSPR  483



>gb|AAB99950.1| UDP-glucuronosyltransferase [Pisum sativum]
Length=347

 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 196/232 (84%), Gaps = 2/232 (1%)
 Frame = -3

Query  860  LPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVM  681
             P VY+IGPL LL K  V D ++ +F SNLWKE+  CL+WLN+K+PNSVVYVN GSITVM
Sbjct  118  FPPVYSIGPLHLLLKE-VTDKELNSFGSNLWKEEPECLEWLNSKEPNSVVYVNLGSITVM  176

Query  680  TPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLG  501
            T +Q++EFAWGLANSK  FLW+IRPD V+GE +V+P EFLEETK RGML+SWCPQE+VL 
Sbjct  177  TNEQMIEFAWGLANSKIPFLWVIRPDLVAGENSVLPQEFLEETKNRGMLSSWCPQEEVLD  236

Query  500  HPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNE  321
            H A+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI  + KR++
Sbjct  237  HSAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCHEWGIGLEI-EDAKRDK  295

Query  320  VESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +ESLVKE+++GEKGKEMK KA+EWKKLA ++A+  +GSS++NLE++F  VLL
Sbjct  296  IESLVKEMVEGEKGKEMKEKALEWKKLAPNAASGPNGSSFMNLEKMFRDVLL  347



>ref|XP_004252533.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   345 bits (884),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 206/238 (87%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q++LP VY IGPL LL K  V D+++K   S+LWKE+  CL WL++K+PNSVVYVN+GSI
Sbjct  249  QTLLPPVYPIGPLHLLVKH-VDDENLKGLGSSLWKEEPECLQWLDSKEPNSVVYVNYGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTPDQL+EFAWGLANS+  FLWIIRPD VSG E+++PPEF+EETK RGMLASWC QE+
Sbjct  308  TVMTPDQLIEFAWGLANSQHEFLWIIRPDIVSGYESILPPEFVEETKNRGMLASWCSQEE  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI +GVPM+CWPFFAEQQTNCW+  T WGIGMEI+NNVK
Sbjct  368  VLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWFSETKWGIGMEIDNNVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVESLV+ELM GEKGKEMK+KAMEWKKLA+ SA  ++GSSY N++++ N VLLS K
Sbjct  428  RDEVESLVRELMVGEKGKEMKKKAMEWKKLAEISAQKSTGSSYGNIDKVINDVLLSSK  485



>dbj|BAD93690.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   344 bits (883),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 206/238 (87%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++LP VY IGPL  L K  V D+++K  RS+LWKE+  C+ WL+TK+PNSVVYVNFGSI
Sbjct  248  RNLLPPVYPIGPLHFLVKH-VDDENLKGLRSSLWKEEPECIQWLDTKEPNSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP+QL+EFAWGLANS+++FLWIIRPD VSG+ +++PPEF+EETK+RGMLASWC QE+
Sbjct  307  TVMTPNQLIEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLASWCSQEE  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+  T W +GMEI+ +VK
Sbjct  367  VLSHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGMEIDCDVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVESLV+ELM G KGK+MK+KAMEWK+LA+ SA   SGSSYVN+E++ N +LLS K
Sbjct  427  RDEVESLVRELMVGGKGKKMKKKAMEWKELAEASAKEHSGSSYVNIEKVVNDILLSSK  484



>ref|XP_007141191.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
 gb|ESW13185.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
Length=491

 Score =   345 bits (884),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 194/234 (83%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL K  + D+D+   RSNLWKE+  C++WL+TK+PNSV+YVNFGSIT
Sbjct  254  SILPPVYSIGPLNLLVKD-IDDEDLNVIRSNLWKEEFECVEWLDTKEPNSVIYVNFGSIT  312

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL EFAWGLANS K+FLW+IRPD V GE  V+PPEF+E+TK+RG L+SWCPQE+V
Sbjct  313  VMTSEQLNEFAWGLANSNKSFLWVIRPDVVGGENVVLPPEFVEQTKDRGFLSSWCPQEQV  372

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI  +VKR
Sbjct  373  LAHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKEWGIGLEI-EDVKR  431

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++E LV+ELMDGEKGKEMK KA++WK LA  +     GSS++NLE +  +VL+
Sbjct  432  DKIERLVRELMDGEKGKEMKEKAIQWKDLAVSATYGPHGSSFLNLENMIREVLV  485



>ref|XP_004299645.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   344 bits (883),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 196/237 (83%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL      + +DDD K   SNLWKE+  CL+WL +K+PNSVVYVNFGSIT
Sbjct  245  SLLPPVYSIGPLHQQLSHIQEDDDSKTIGSNLWKEEPECLEWLESKEPNSVVYVNFGSIT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS  TFLW+IRPD V+G  AVVPPEF+EETK R  LASWCPQE+V
Sbjct  305  VMTDEQLIEFAWGLANSNMTFLWVIRPDLVAGNSAVVPPEFVEETKGRSWLASWCPQEQV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTH GWNST+ES+C GVPMICWPFFA+QQ NC +C   WG+ M+I  +V+R
Sbjct  365  LNHPAIGGFLTHCGWNSTVESLCGGVPMICWPFFADQQINCRFCCKEWGVAMQIEGDVRR  424

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N +E LV++LM+G++GK+M++K++EWKKLA+++ TA +GSS++NL ++ N+VLLSPK
Sbjct  425  NYIEVLVRKLMEGQEGKQMRKKSLEWKKLAEEAVTAPNGSSFLNLNKMVNQVLLSPK  481



>ref|XP_011069754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=485

 Score =   344 bits (883),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 200/236 (85%), Gaps = 4/236 (2%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP +Y IGPL LLE   V D  ++   SNLWK++  CL+WL++K+ NSVVYVNFGSIT
Sbjct  249  SILPPIYAIGPLHLLENQ-VDDKALEQLGSNLWKDEPQCLEWLDSKEANSVVYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT DQL+EFAWGLANS   FLWIIRPD VSG++AV+PPEFLE TKERG+LA+WCPQE+V
Sbjct  308  VMTSDQLLEFAWGLANSNLPFLWIIRPDLVSGDKAVLPPEFLEATKERGLLANWCPQERV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCWYC T W IGMEI++NVKR
Sbjct  368  LRHPSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWNIGMEIDSNVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            +EVE LV++LM GE+G+EMKR+AMEWKKLA  SA ++S     NLE++ ++VLL+P
Sbjct  428  DEVEILVRKLMIGEEGQEMKRRAMEWKKLAVASAQSSSSE---NLEKVISRVLLAP  480



>ref|XP_009791953.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=484

 Score =   344 bits (882),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 205/235 (87%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++LP +Y IGPL  L K  ++D +++   SNLWKED  CLDWL++K PNSVVYVNFGSI
Sbjct  249  RTLLPPIYAIGPLHFLVKH-IEDKNLECLGSNLWKEDVQCLDWLDSKKPNSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP+QL+EFAWGLANS+  FLWIIRPD VSGE+A++PPEF+ ETKERGMLASWCPQE+
Sbjct  308  TVMTPNQLIEFAWGLANSQMEFLWIIRPDIVSGEQAILPPEFVGETKERGMLASWCPQEQ  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+ GT WGIGMEI+NNVK
Sbjct  368  VLSHPAIGGFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGMEIDNNVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R+EVESLV+ELM GEKGKEMK+KAMEWKKLA+++     GSS+V ++++ N++LL
Sbjct  428  RDEVESLVRELMAGEKGKEMKKKAMEWKKLAEEATQKPEGSSFVAIDKLINEILL  482



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   344 bits (882),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 198/234 (85%), Gaps = 2/234 (1%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            M P VY+IGPLQLL    + ++ +K+  SNLW+E   CLDWL+++ PNSVVYVNFGSITV
Sbjct  251  MFPRVYSIGPLQLLHNQ-IPENGLKSIGSNLWQEQPGCLDWLDSQKPNSVVYVNFGSITV  309

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MTP+QLVEFAWGLANS  TFLW+IRPD V G+ A++PP+F+ +T+ERG+LASWCPQE+VL
Sbjct  310  MTPEQLVEFAWGLANSNXTFLWVIRPDLVVGDSALLPPKFITDTRERGLLASWCPQEQVL  369

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HP++G FLTH+GWNST+ESIC GVPMICWPFFAEQQTNC Y  T WG+GMEI++NVKR+
Sbjct  370  NHPSIGAFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYVCTEWGMGMEIDSNVKRD  429

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            EVESLVK++M+GEKGKEMK++ +EWKK A++ AT   GSSY NL+++  +VLLS
Sbjct  430  EVESLVKQIMEGEKGKEMKKRTLEWKKKAEE-ATYQDGSSYSNLDKMIKEVLLS  482



>ref|XP_009341754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   344 bits (882),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 199/237 (84%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP VY+IGPL L       D ++K+  SNLW E+  CL+WL+TK+PNSVVYVNFGSIT
Sbjct  246  TLLPPVYSIGPLNLQIGQNPVDKELKSIGSNLWTEEPECLEWLDTKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLAN KKTFLW+IRPD V G+ AVVPPEF+EETK+R +LASWCPQE+V
Sbjct  306  VMTNEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPEFVEETKDRSLLASWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +    WGIG+EI  +VKR
Sbjct  366  LSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCKEWGIGLEIEGDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
              VE LV++LMDGE+GKEM++K++EWKK A+++++  +G S+V+L+++ N+VLL+P+
Sbjct  426  KYVEGLVRKLMDGEEGKEMRKKSLEWKKSAKEASSGPNGLSFVDLDKMVNQVLLTPR  482



>ref|XP_006360268.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=486

 Score =   344 bits (882),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 207/238 (87%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++LP VY IGPL LL K  V D+++K   S+LWKE+  C+ WL+ K+PNSVVYVN+GSI
Sbjct  249  RTLLPPVYPIGPLHLLVKH-VDDENLKGLESSLWKEEPECIQWLDNKEPNSVVYVNYGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTPDQL+EFAWGLANS++ FLWIIRPD VSG E+++PPEF+EETK RGMLASWC QE+
Sbjct  308  TVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSGYESILPPEFVEETKNRGMLASWCSQEE  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI +GVPM+CWPFFAEQQTNCW+  T WG+GMEI+NNVK
Sbjct  368  VLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWFSETKWGVGMEIDNNVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVESLV+ELM GEKGKEMK+KAMEWK+LA+ SA  ++GSSYVN+E++ N VLL+ K
Sbjct  428  RDEVESLVRELMVGEKGKEMKKKAMEWKELAEISAKKSTGSSYVNIEKVINDVLLASK  485



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/238 (67%), Positives = 199/238 (84%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M PS+ T+GPL LL + L  DDD K+  SNLWKED  CL+WL++K P SVVYVNFGSI
Sbjct  249  KAMFPSICTLGPLHLLTEQL-PDDDTKSIGSNLWKEDLGCLEWLDSKPPGSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++P EF   T+ER +LASWCPQE+
Sbjct  308  TVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLLASWCPQER  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTHSGWNST+ESI AGVP++CWPFFAEQQTNC Y    WGIGMEI+ +VK
Sbjct  368  VLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIGMEIDGDVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R++VE  V+ELM+GE+GKEMKRKAMEW+++A++ AT  SGSSY+NL+++ +KVLL P+
Sbjct  428  RDKVERQVRELMEGERGKEMKRKAMEWQQMARE-ATRPSGSSYLNLDEVMDKVLLLPR  484



>ref|XP_002263158.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=475

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 194/236 (82%), Gaps = 4/236 (2%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM P++ T+GPL LL   +  D+ ++   SNLW+E+  CL WLN+K PNSVVYVNFGSIT
Sbjct  244  SMFPTICTVGPLPLLLNQIPDDNSIE---SNLWREETECLQWLNSKQPNSVVYVNFGSIT  300

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP+QLVEFAWGLANS K FLWIIRPD V G+  ++PPEF+ ET +RG++A WCPQEKV
Sbjct  301  VMTPEQLVEFAWGLANSHKPFLWIIRPDLVVGDSVILPPEFVNETIQRGLMAGWCPQEKV  360

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ESICAGVPMICWPFFAEQQTNC Y  T WG+GMEI+NNV+R
Sbjct  361  LNHPSVGGFLTHSGWNSTIESICAGVPMICWPFFAEQQTNCRYACTEWGVGMEIDNNVER  420

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            +EVE LVKELM+GEKGK MK+ AMEW+  A++ ATA  GSSY+NL+++ + +L  P
Sbjct  421  DEVEKLVKELMEGEKGKSMKKAAMEWRTKAEE-ATAPCGSSYLNLDKLVDILLTKP  475



>ref|XP_009612691.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
 dbj|BAD93689.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 205/238 (86%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++LP VY IGPL  L K  V D+++K  RS+LWKE+  C+ WL+TK+PNSVVYVNFGSI
Sbjct  248  RNLLPPVYPIGPLHFLVKH-VDDENLKGLRSSLWKEEPECIQWLDTKEPNSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP+QL+EFAWGLANS++TFLWIIRPD VSG+ +++PPEF+EETK RGMLASWC QE+
Sbjct  307  TVMTPNQLIEFAWGLANSQQTFLWIIRPDIVSGDASILPPEFVEETKNRGMLASWCSQEE  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+ GFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+  T W +GMEI+++VK
Sbjct  367  VLSHPAIVGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGMEIDSDVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVESLV+ELM G KGK+MK+KAMEWK+LA+ SA   SGSSYVN+E++ N +LLS K
Sbjct  427  RDEVESLVRELMVGGKGKKMKKKAMEWKELAEASAKEHSGSSYVNIEKLVNDILLSSK  484



>ref|XP_008359320.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=484

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 197/237 (83%), Gaps = 1/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP VY IGPL L    +  D+++K+  SNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPVYAIGPLNLQISQIPADNELKSIGSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLAN KKTFLW+IRPD V G+ AVVPP+FLEETK+R +LASWCPQE+V
Sbjct  306  VMTSEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPKFLEETKDRSLLASWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC      WGIG+EI  +VKR
Sbjct  366  LSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRVSCKEWGIGLEIEGDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
              VE LV++LMDGE+GKEM++KA+EWKK A++ A+   G SYV+L+++ N+VLL+P+
Sbjct  426  KYVEGLVRKLMDGEEGKEMRKKALEWKKSAKE-ASCPIGLSYVDLDKMVNQVLLTPR  481



>gb|KHN34757.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=459

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 197/234 (84%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL K  V D D+ A  SNLWKE+  C++WL+TK+PNSVVYVNFGSI 
Sbjct  220  SILPPVYSIGPLNLLVKH-VDDKDLNAIGSNLWKEESECVEWLDTKEPNSVVYVNFGSIA  278

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS KTFLW+IRPD V+GE A++P EF+++T++RG+L+SWC QE+V
Sbjct  279  VMTSEQLIEFAWGLANSNKTFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSSWCSQEQV  338

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNCW+C   WGIG+EI  +V+R
Sbjct  339  LTHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEI-EDVER  397

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++ESLV+ELMDGEKGKEMK KA++WK+LA+ +A    GSS+ NL+ +   VLL
Sbjct  398  DKIESLVRELMDGEKGKEMKEKALQWKELAKSAAFGPVGSSFANLDNMVRDVLL  451



>ref|XP_009590778.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   342 bits (877),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 204/238 (86%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++LP VY IGPL  L K  V D+++K  RS+LWKE+  C+ WL+TK+PNSVVYVNFGSI
Sbjct  248  RNLLPPVYPIGPLHFLVKH-VDDENLKGLRSSLWKEEPECIQWLDTKEPNSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP QL+EFAWGLANS+++FLWIIRPD VSG+ +++PPEF+EETK+RGMLASWC QE+
Sbjct  307  TVMTPSQLIEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLASWCSQEE  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+  T W +GMEI+ +VK
Sbjct  367  VLSHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGMEIDCDVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVESLV+ELM G KGK+MK+K MEWK+LA+ SA   SGSSYVN+E++ N +LLS K
Sbjct  427  RDEVESLVRELMVGGKGKKMKKKTMEWKELAEASAKEHSGSSYVNIEKVVNDILLSSK  484



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   342 bits (876),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 198/238 (83%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M PS+ T+GPL LL + L  DDD K+  SNLWKED  CL+WL++K P SVVYVNFGSI
Sbjct  249  KAMFPSICTLGPLHLLTEQL-PDDDTKSIGSNLWKEDLGCLEWLDSKPPGSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++P EF   T+ER +LASWCPQE+
Sbjct  308  TVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLLASWCPQER  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTHSGWNST+ESI AGVP++CWPFFAEQQTNC Y    WGIGMEI+ +VK
Sbjct  368  VLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIGMEIDGDVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R++VE  V+ELM+GE+GKEMKRKAMEW+++A++ A   SGSSY+NL+++ +KVLL P+
Sbjct  428  RDKVERQVRELMEGERGKEMKRKAMEWQQMARE-AMRPSGSSYLNLDEVMDKVLLLPR  484



>ref|XP_008466222.1| PREDICTED: UDP-glycosyltransferase 85A2 [Cucumis melo]
Length=487

 Score =   342 bits (876),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 190/233 (82%), Gaps = 2/233 (1%)
 Frame = -3

Query  857  PSVYTIGPLQLLEKTLV--QDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            P V++IGPLQLL K +     D +K+  SNLWKED +CL WL+    NSVVYVNFGSITV
Sbjct  252  PPVFSIGPLQLLLKQVASHDSDSLKSLGSNLWKEDTSCLQWLDQMSANSVVYVNFGSITV  311

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MT DQL EFAWGLANS +TFLWIIRPD V+G+ AV+PPEF++ TKERGML +WCPQE+VL
Sbjct  312  MTKDQLKEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDMTKERGMLTNWCPQEEVL  371

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HPA+GGFLTH+GWNST ESI AGVPMICWPFFAEQQTNC YC T WGIGMEI+++VKR 
Sbjct  372  QHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGIGMEIDSDVKRE  431

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            E+E  V+ELM+G+KGKEM+++A EWKKL  D+A   SGSS+ NL  + +KVLL
Sbjct  432  EIEKQVRELMEGDKGKEMRKRAQEWKKLMADAAEPHSGSSFRNLNHLVHKVLL  484



>gb|KJB59011.1| hypothetical protein B456_009G235700 [Gossypium raimondii]
Length=483

 Score =   341 bits (875),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 195/238 (82%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
             SMLP VY++GPL L+    V + ++K   SNLWKE+  CL WL++K+PNSVVYVNFGSI
Sbjct  246  NSMLPPVYSVGPLHLVLNHNVDNSELKQIGSNLWKEEPECLQWLDSKEPNSVVYVNFGSI  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT DQL EFAWGLANSK+ FLW+IRPD V  E AVVP EF+ ETK+RGMLA+WCPQE+
Sbjct  306  TVMTADQLNEFAWGLANSKQPFLWVIRPDLVGDESAVVPAEFVAETKDRGMLATWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HP+VGGFLTHSGWNST+ESI  GVPM CWPFFAEQQTNCWY  T WGIG EI+NNVK
Sbjct  366  VLNHPSVGGFLTHSGWNSTIESISGGVPMTCWPFFAEQQTNCWYSCTKWGIGEEIDNNVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVESLV+EL+ GEKGK+MK+KA+EW++ A+ +   + GSSY NL++I  ++L +P+
Sbjct  426  RDEVESLVRELIKGEKGKDMKKKAVEWERKAKAATVNSDGSSYRNLDKII-QLLCTPR  482



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   341 bits (875),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/238 (69%), Positives = 189/238 (79%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
             S+LP VY+IGPL LL K  V D ++ +  SNLWKED  CL WL+TK+PNSVVYVNFGSI
Sbjct  248  SSILPPVYSIGPLHLLIKD-VTDKNLNSLGSNLWKEDSECLKWLDTKEPNSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
             VMT +Q+VEFAWGLANS KTFLW+IRPD V+G+ AV+P EF+  T +RG L+SW PQE 
Sbjct  307  AVMTSEQMVEFAWGLANSNKTFLWVIRPDLVAGKHAVLPEEFVAATNDRGRLSSWTPQED  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESIC GVPMICWPFFAEQQTNC YC   WGIG+EI  + K
Sbjct  367  VLTHPAIGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRYCCEEWGIGLEI-EDAK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+ VESLV+ELMDGEKGK MK  A++WKKLA DSA    GSS+VNLE +F  VLL  K
Sbjct  426  RDRVESLVRELMDGEKGKLMKENALKWKKLAHDSAVGPKGSSFVNLENMFRGVLLLEK  483



>ref|XP_010098615.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB75354.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=481

 Score =   341 bits (875),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 195/237 (82%), Gaps = 6/237 (3%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VYT+GPL LL    + D +V++  SNLWKED  CL+WLN+K P+SVVYVNFGSIT
Sbjct  249  SILPPVYTVGPLALLVNQ-IPDKNVRSIGSNLWKEDPYCLEWLNSKKPSSVVYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QLVEFAWGLANS+KTFLWIIRPD V G+ A+VPPEF+ ETK+RG++ SWCPQE+V
Sbjct  308  VMTSEQLVEFAWGLANSQKTFLWIIRPDLVVGDAAIVPPEFVSETKDRGLMPSWCPQEQV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            LGHPA+GGFLTH GWNST+ESI  GVP+ICWPFFAEQQTNC YC   WGIGMEI  NV+R
Sbjct  368  LGHPAIGGFLTHCGWNSTIESISCGVPVICWPFFAEQQTNCRYCCRAWGIGMEI-ENVER  426

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
              +E LV++LMDGEKGKEMK++AMEWKK  +DS      SS +NL+++  +VLL+P+
Sbjct  427  GNIERLVRKLMDGEKGKEMKKRAMEWKKSTEDSI----ASSQLNLDKMIEQVLLAPR  479



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 197/234 (84%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL K  V D D+ A  SNLWKE+  C++WL+TK+PNSVVYVNFGSI 
Sbjct  246  SILPPVYSIGPLNLLVKH-VDDKDLNAIGSNLWKEESECVEWLDTKEPNSVVYVNFGSIA  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS KTFLW+IRPD V+GE A++P EF+++T++RG+L+SWC QE+V
Sbjct  305  VMTSEQLIEFAWGLANSNKTFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSSWCSQEQV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNCW+C   WGIG+EI  +V+R
Sbjct  365  LTHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEI-EDVER  423

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++ESLV+ELMDGEKGKEMK KA++WK+LA+ +A    GSS+ NL+ +   VLL
Sbjct  424  DKIESLVRELMDGEKGKEMKEKALQWKELAKSAAFGPVGSSFANLDNMVRDVLL  477



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/234 (69%), Positives = 194/234 (83%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP +YTIGPLQLL   + Q   +++  SNLWKE+  CL WLN+K+P SVVYVNFGSIT
Sbjct  245  SMLPRIYTIGPLQLLLNQIPQTP-LESIGSNLWKEEPECLQWLNSKEPKSVVYVNFGSIT  303

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT  QLVEFAWGLANSK TFLWIIRPD V G+ +++PPEFLEET+ERG++ASWCPQE+V
Sbjct  304  VMTAQQLVEFAWGLANSKHTFLWIIRPDLVRGDSSILPPEFLEETEERGLMASWCPQEQV  363

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+ GFLTHSGWNST+ESI  GVPMI WPFFAEQQTNC +  T WG+GMEI+NNVKR
Sbjct  364  LNHPAIAGFLTHSGWNSTVESIGYGVPMISWPFFAEQQTNCRFACTEWGVGMEIDNNVKR  423

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELM+GEKGK M+ KAMEWKK A+ +A+  +GSS++NLE++   VLL
Sbjct  424  EEVERLVRELMEGEKGKGMRNKAMEWKKKAEQAAS-PNGSSFLNLEKLIKDVLL  476



>ref|XP_010248035.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=488

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 198/235 (84%), Gaps = 1/235 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM P VY+IGPL LL    + D+ +++  SNLW+E+  CL+WL+++ PNSVVYVNFGSIT
Sbjct  250  SMFPRVYSIGPLPLLHDQ-ISDNGLESIGSNLWQEELGCLEWLDSQKPNSVVYVNFGSIT  308

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QLVEFAWGLANS +TFLW+IRPD V G+ A++PPEF+ +TKER +LASWCPQ++V
Sbjct  309  VMTREQLVEFAWGLANSNQTFLWVIRPDLVVGDSALLPPEFIRDTKERSLLASWCPQKQV  368

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTH+GWNST+ESIC+GVPMICWPFFA+QQT C Y  T WG+GMEI++NVKR
Sbjct  369  LNHPSVGGFLTHNGWNSTVESICSGVPMICWPFFADQQTICRYACTEWGVGMEIDSNVKR  428

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +EVESL++ELM+GEKGKEMK KAMEWK+ A+++A      S+ NL+++ N+VLLS
Sbjct  429  DEVESLIRELMEGEKGKEMKYKAMEWKRRAEEAAYQGGXPSHTNLDKMINEVLLS  483



>ref|XP_004252531.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 205/238 (86%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++LP VY IGPL LL K  V D+++K   S+LWKE+  C+ WL+TK+PNSVVYVN+GSI
Sbjct  249  RTLLPPVYPIGPLHLLVKH-VDDENLKGLGSSLWKEEPECIQWLDTKEPNSVVYVNYGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTPDQL+EFAWGLANSK  FLWIIRPD VSG E+++PPEF+EETK RGMLASWC QE+
Sbjct  308  TVMTPDQLIEFAWGLANSKLEFLWIIRPDIVSGYESILPPEFVEETKNRGMLASWCSQEE  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI +GVPM+CWPFFAEQQTNCWY  T W +GMEI+NNVK
Sbjct  368  VLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWYSETKWDVGMEIDNNVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVESLV+ELM GEKGKEMK+KAMEWKKLA+ SA  ++GSSY N++++ N VLL+ K
Sbjct  428  RDEVESLVRELMVGEKGKEMKKKAMEWKKLAEISAQKSTGSSYGNIDKVVNDVLLASK  485



>ref|XP_010060024.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 198/238 (83%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++MLP +YT+GPL LL + L   +D ++  SNLWKEDQ CL+WL+ K P+SVVYVNFGS+
Sbjct  248  KAMLPPIYTLGPLHLLTEQL-PSNDTRSIGSNLWKEDQGCLEWLDLKSPSSVVYVNFGSV  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++PPEF   T+ER +LASWCPQ +
Sbjct  307  TVMSPTQLVEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLASWCPQVQ  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H A+GGFLTHSGWNST+ESI AGVP++CWPFFAEQQ NC Y    WGIGMEI+ +VK
Sbjct  367  VLRHQAIGGFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGMEIDGDVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS +NL+++ +KVLLSP+
Sbjct  427  RDEVERQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDKVLLSPR  483



>ref|XP_006363268.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=492

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 203/238 (85%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q+++P VY IGPL LL K  V D ++    SNLWKE+  CL+WL++K PNSVVYVNFGSI
Sbjct  251  QTLVPPVYVIGPLNLLVKH-VDDKNLADLGSNLWKEEPKCLEWLDSKKPNSVVYVNFGSI  309

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT + L+EFAWGLANS+  FLWIIRPD V GE+A++PPEF+EETKERGMLASWC QEK
Sbjct  310  TVMTMNHLIEFAWGLANSQLDFLWIIRPDVVLGEQAILPPEFVEETKERGMLASWCQQEK  369

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI +GVPMICWPFFAEQ TNCW+C T  GIGMEINNNVK
Sbjct  370  VLNHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQPTNCWFCCTKLGIGMEINNNVK  429

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R EVE+LV+ELM GEKGKEMK+KAMEWK LA+++A   +GSSYVN++++ N++LLSPK
Sbjct  430  RGEVEALVRELMTGEKGKEMKKKAMEWKILAEEAAAKPAGSSYVNIDKLINEILLSPK  487



>ref|XP_003615138.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES98096.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|KEH28099.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=480

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 197/234 (84%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL K  V + ++ +  SNLWKE+  CL+WLN+K+PNSVVYVNFGSIT
Sbjct  248  SILPPVYSIGPLHLLIKD-VTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +Q++EFAWGL+NSK  FLW+IRPD V+GE AV+P EFLEETK RG+L+SWCPQE+V
Sbjct  307  VMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLSSWCPQEEV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            LGH ++GGFLTH+GWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI  + KR
Sbjct  367  LGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI-EDAKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++E LVKELM+GEKGKEMK KA++WKKLA ++A+   GSS++NLE + + VLL
Sbjct  426  DKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVLL  479



>ref|XP_010060020.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   339 bits (870),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 196/238 (82%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++  PS+ T+GPL LL + L  DDD K+  SNLWKED  CL+WL++K P SVVYVNFGSI
Sbjct  249  KATFPSICTLGPLHLLTEQL-PDDDTKSIGSNLWKEDLGCLEWLDSKPPGSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS + FLW+IRPD V G+ A++P EF   T+ER +LASWCPQE+
Sbjct  308  TVMSPTQLVEFAWGLANSGQMFLWVIRPDLVVGDTAILPSEFSATTRERSLLASWCPQER  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTHSGWNST+ESI AGVPM+CWPFFAEQQTNC Y    WGIGMEI+ +VK
Sbjct  368  VLNHPAVGGFLTHSGWNSTIESITAGVPMLCWPFFAEQQTNCRYSCEEWGIGMEIDGDVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R++VE  V+ELM+GE GKEMKRKAMEW+++A++ AT  SGSS +NL+++ +KVLLSP+
Sbjct  428  RDKVEKQVRELMEGETGKEMKRKAMEWQEMARE-ATRPSGSSCLNLDEVMDKVLLSPR  484



>ref|XP_009341757.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   339 bits (870),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 197/237 (83%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++ P VY+IGPL L    +  D+++ +  SNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLFPPVYSIGPLNLQIGQIPADNELNSIGSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLAN KKTFLW+IRPD V G+ AV+PPEFLEETK+R +LASWCPQE+V
Sbjct  306  VMTSEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVIPPEFLEETKDRSLLASWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L +PA+GGFLTHSGWNSTLES+C GVP+ICWPFFAEQQTNC +    WGIG+EI  +VKR
Sbjct  366  LNNPAIGGFLTHSGWNSTLESVCGGVPIICWPFFAEQQTNCRFSCKEWGIGLEIEGDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
              VE LV++LMDGE+GKEM++KA+EWKKLA++++   +G S+V+ +++ N+VLLS K
Sbjct  426  KYVEGLVRKLMDGEEGKEMRKKALEWKKLAKEASGGPNGLSFVDFDKMVNQVLLSQK  482



>gb|KEH28097.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=483

 Score =   339 bits (870),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 193/232 (83%), Gaps = 2/232 (1%)
 Frame = -3

Query  860  LPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVM  681
            LP VY+IGP+  L K  V D+++ +  SNLWK++  CL+WL +K+PNSVVYVNFGSITVM
Sbjct  252  LPPVYSIGPINFLLKN-VTDEELNSIGSNLWKDETDCLEWLASKEPNSVVYVNFGSITVM  310

Query  680  TPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLG  501
            T DQLVEFAWGLANSKKTFLW+IRPD VSG+ AV+P EFLEETK RG+L+SWCPQE+VLG
Sbjct  311  TNDQLVEFAWGLANSKKTFLWVIRPDLVSGKNAVLPQEFLEETKNRGLLSSWCPQEEVLG  370

Query  500  HPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNE  321
            H ++GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI  + KR++
Sbjct  371  HSSIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI-EDAKRDK  429

Query  320  VESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +E LVKELM+GEKGKEMK KA+  K+LA D+A  A GSS VNL+ + + VLL
Sbjct  430  IEILVKELMEGEKGKEMKEKALRLKELAHDNAYGAFGSSLVNLDNMIHHVLL  481



>ref|XP_011016624.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=505

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 200/237 (84%), Gaps = 1/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S LP +YTIGPLQLLE    Q++ + +  SNLWKE+   ++WL+ K+P+SV+YVNFGSIT
Sbjct  249  STLPHLYTIGPLQLLENQ-DQENALNSIASNLWKEEPGFIEWLDFKEPHSVIYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP QL+EFAWGLANS  TFLW+IR D V G+ A+VPPEF+ ETKERG++A WCPQE+V
Sbjct  308  VMTPQQLIEFAWGLANSMCTFLWVIRSDLVVGDSAIVPPEFVAETKERGLVAGWCPQERV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTHSGWNSTL+S+C GVP+ICWPFF+EQQTNCW+C    GIGMEI+++VKR
Sbjct  368  LQHPSIGGFLTHSGWNSTLDSLCCGVPVICWPFFSEQQTNCWFCCNKLGIGMEIDSDVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            NE+ESLV+ELM+G++G+ MK KA EWK+ A+++A + +GSS +NLE++ NKVLL+P+
Sbjct  428  NEIESLVRELMEGDQGQVMKYKAKEWKRKAEEAAASPTGSSCLNLEKMINKVLLAPR  484



>ref|XP_008372493.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 192/236 (81%), Gaps = 1/236 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P  Y++GPL LL   +  D+++KA  S+LW ED+ CLDWL+TK+PNSVVYVNFGS T
Sbjct  239  SLFPPTYSVGPLNLLFSQIPADNELKAIASSLWTEDKECLDWLDTKEPNSVVYVNFGSTT  298

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QLVEF+WGLANS KTFLWIIRP  V+G+ AVVPPEFLEET  RG LASWCPQE+V
Sbjct  299  VMTNEQLVEFSWGLANSNKTFLWIIRPGLVAGDSAVVPPEFLEETXGRGKLASWCPQEQV  358

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC Y   HWGIG+EI + VKR
Sbjct  359  LTHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACKHWGIGIEIEDEVKR  418

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            + +E LV+ LM+GE+GKEM++ A+ WKK   + AT+  GSS ++L+ + N+VL++P
Sbjct  419  DYIEGLVRRLMEGEEGKEMRKNALGWKK-KIEKATSPKGSSVLDLDNLINQVLIAP  473



>gb|EYU43443.1| hypothetical protein MIMGU_mgv1a018722mg [Erythranthe guttata]
Length=475

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/234 (68%), Positives = 193/234 (82%), Gaps = 14/234 (6%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP +Y IGPL L+E  +++D+ +K   SNLWKEDQ CL WL+T++PNSVVYVNFGSIT
Sbjct  253  SILPPIYPIGPLNLIENLVIEDEGLKELGSNLWKEDQECLKWLDTREPNSVVYVNFGSIT  312

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTPDQL EFAWGLANSK+ FLW+           V+P  FLEETKERGMLA+WCPQEKV
Sbjct  313  VMTPDQLNEFAWGLANSKQPFLWV-----------VLPRGFLEETKERGMLANWCPQEKV  361

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H +VGGFLTHSGWNSTLESIC+GVPMICWPFFAEQQTNCWYC T WG+GMEI+++VKR
Sbjct  362  LSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEIDSDVKR  421

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            N VE+LV +LM GE+G++M+ KA+EWK LA+DS   A GSSY NL+++ ++VLL
Sbjct  422  NGVETLVTKLMIGEEGRQMRNKAVEWKNLARDS---AEGSSYRNLKKLIDQVLL  472



>ref|XP_008229740.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/234 (68%), Positives = 191/234 (82%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VY IGP QLL   L  +D +K  R +LWKE+  CL+WL +K PNSVVYVNFGSI 
Sbjct  252  SMLPLVYAIGPDQLLLNQL-PEDPLKHIRYSLWKEETECLEWLKSKAPNSVVYVNFGSIA  310

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+TP QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETKERG++ASWCPQE+V
Sbjct  311  VLTPQQLVEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLIASWCPQEQV  370

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L  P+VGGFLTH GWNST+ES+CAGVPM+CWPFFA+QQTNC+Y    WGIG+EINN+VKR
Sbjct  371  LNDPSVGGFLTHGGWNSTIESLCAGVPMLCWPFFADQQTNCYYVCNDWGIGLEINNDVKR  430

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            ++VE LVKELM+GEKGK+MK K MEWKK+A++ AT+  GSS  NL+ + N+VLL
Sbjct  431  DQVEKLVKELMEGEKGKKMKNKVMEWKKIAEE-ATSPHGSSSRNLDNLVNQVLL  483



>ref|XP_009592743.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            Q++LP VY IGPL L+ K  V D++++    NLWKED+ CL+WL++K  NSVVYVNFGSI
Sbjct  248  QTLLPPVYAIGPLHLILKH-VDDNNLEELELNLWKEDEKCLEWLDSKKLNSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
             V+T +QL+EFAWGLANS+  FLWIIRPD V GE+A++PPEF+EETK+R MLASWCPQE+
Sbjct  307  AVVTSNQLIEFAWGLANSRMEFLWIIRPDIVLGEQAILPPEFVEETKDRAMLASWCPQEQ  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTH  WNS LESI  GVPMICWPFFAEQ TNCW+C T  GIGMEI++NVK
Sbjct  367  VLSHPAIGGFLTHGEWNSILESISCGVPMICWPFFAEQPTNCWFCCTKLGIGMEIDSNVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R+EV SLV+ELM G+KGKEMK+KA+EWKKLA+++A   +GSSYVN+++I N++ L
Sbjct  427  RDEVASLVRELMAGDKGKEMKKKALEWKKLAEEAAKKPTGSSYVNIDKIINEISL  481



>gb|AFK33787.1| unknown [Medicago truncatula]
Length=480

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 196/234 (84%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL K  V + ++ +  SNLWKE+  CL+WLN+K+PNSVVYVNFGSIT
Sbjct  248  SILPPVYSIGPLHLLIKD-VTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +Q++EFAWGL+NSK  FLW+IRPD V+GE AV+P EFLEETK RG+L+SWCPQE+V
Sbjct  307  VMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLSSWCPQEEV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            LGH ++GGFLTH+ WNSTLES+C GVPMICWPFFAEQQTNC +C   WGIG+EI  + KR
Sbjct  367  LGHSSIGGFLTHNDWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI-EDAKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++E LVKELM+GEKGKEMK KA++WKKLA ++A+   GSS++NLE + + VLL
Sbjct  426  DKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVLL  479



>ref|XP_010676190.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 193/236 (82%), Gaps = 2/236 (1%)
 Frame = -3

Query  860  LPSVYTIGPLQLLEKTL-VQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
             PS++T+GPL LL  ++  ++++      +LWKED TC++WL++  PNSVVY+NFGSITV
Sbjct  248  FPSLFTLGPLMLLLDSIEAKEEEATTINPSLWKEDSTCIEWLDSHAPNSVVYINFGSITV  307

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MT DQLVEFAWGLANS + FLWI RPD V+G+ +V+PPEFLEETK+R ++ASWC QEKVL
Sbjct  308  MTNDQLVEFAWGLANSNQPFLWITRPDLVAGDSSVLPPEFLEETKDRRLIASWCNQEKVL  367

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             H A+G FLTHSGWNSTLESI  GVPMICWPFFAEQQTNCW+C   WGIG+EIN NVKRN
Sbjct  368  AHQAIGVFLTHSGWNSTLESISNGVPMICWPFFAEQQTNCWFCCKKWGIGIEINVNVKRN  427

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            EVE+ V+ELM GEKGKEMKRKA+EWKKLA ++A + +GSSY NL+ +  KVL S K
Sbjct  428  EVETQVRELMQGEKGKEMKRKAIEWKKLAHEAAASPNGSSYSNLDNVI-KVLKSKK  482



>gb|AKA44599.1| UGTPg32 [Panax ginseng]
Length=484

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 193/235 (82%), Gaps = 1/235 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P +YT+GPLQL+    +QD  +K+  SNLWKE+  C+DWL+TK+ NSVVYVNFGSIT
Sbjct  249  SIQPRIYTVGPLQLMVNQ-IQDHRLKSMSSNLWKEEVGCIDWLDTKEANSVVYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT  QL EFAWGLANSKK FLWI+RPD V G  A++P EF+ +T+ RGMLASWCPQE+V
Sbjct  308  VMTAKQLTEFAWGLANSKKHFLWIVRPDIVVGVSAMLPGEFITDTENRGMLASWCPQEEV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTH+GWNST+ESI  GVP+ICWPFFAEQQTNC Y    WGIGMEI+N VKR
Sbjct  368  LKHPAIGGFLTHNGWNSTVESISGGVPVICWPFFAEQQTNCRYSCVEWGIGMEIDNEVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +EVE LV+ELMDGEKGKEM+R A+EWKK A+++A    GSS +NL+++ ++VLL+
Sbjct  428  DEVEVLVRELMDGEKGKEMRRNALEWKKKAEEAAGQVDGSSRMNLDKVVDQVLLA  482



>gb|KEH17174.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   337 bits (864),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 195/234 (83%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P +Y+IGPL LL K  V ++++ +  SNLWKED  CL WLN K+PN+VVYVNFGS+T
Sbjct  248  SIFPPIYSIGPLNLLLKD-VTNEELNSIGSNLWKEDSKCLKWLNNKEPNTVVYVNFGSVT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +Q++EFAWGL+NSKK FLW+IRPD V+GE AV+P EFLEETK+RG+L+SWC Q +V
Sbjct  307  VMTKEQMIEFAWGLSNSKKPFLWVIRPDLVAGENAVLPLEFLEETKDRGLLSSWCLQGEV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H A+GGFLTHSGWNSTLES+CAGVPMICWPFFAEQQTNC +C   W IG+EI  + KR
Sbjct  367  LAHSAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCNEWEIGLEI-EDAKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++ESLVKEL+DGEKGKEMK KA++WKKLA ++A+   GSS++NLE +F  VLL
Sbjct  426  DKIESLVKELLDGEKGKEMKAKALQWKKLAHNAASGPHGSSFMNLENLFRDVLL  479



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 193/232 (83%), Gaps = 2/232 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++ P +YT+GPL LL K L  D+D K+  SNLWKED  CL+WL++K P+SVVYVNFGSI
Sbjct  249  KAIFPPIYTLGPLHLLTKQL-PDNDTKSIGSNLWKEDLGCLEWLDSKPPSSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLA+S +TFLW+IRPD V G+ A++PPEF   T+ER +LASWCPQE+
Sbjct  308  TVMSPAQLVEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLLASWCPQER  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTHSGWNST+ESI AGVPM+CWPFF EQQTNC Y    WGIGMEI++NVK
Sbjct  368  VLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIGMEIDSNVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNK  174
            R+EV   V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS +NL+++ +K
Sbjct  428  RDEVSRQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDK  478



>ref|XP_007225655.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
 gb|EMJ26854.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
Length=484

 Score =   337 bits (864),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 194/237 (82%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP VY+IGPL L  K +  ++++K+  SNLW E+  CL WL+TK+PNSVVYVNFGSI 
Sbjct  247  TLLPPVYSIGPLNLQLKQIPAENELKSIVSNLWTEEPECLQWLDTKEPNSVVYVNFGSIA  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V T +QL+EFAWGLANSKK FLW+IRPD V GE AVVP EFLEETK+R +LA WCPQE+V
Sbjct  307  VTTNEQLIEFAWGLANSKKKFLWVIRPDLVRGESAVVPAEFLEETKDRSLLAHWCPQEQV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFLTHSGWNSTLES+C GVP+ICW F  EQ TNC Y    WG+G+E+ ++VKR
Sbjct  367  LSHPAVGGFLTHSGWNSTLESLCGGVPLICWSFCGEQPTNCRYSCREWGVGLEVGDDVKR  426

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N VE LV++LM+GE+GK+M++KA+EWKKLA+++ T   GSS+++LEQ+ NKVLLS K
Sbjct  427  NYVEELVRKLMEGEEGKKMRKKALEWKKLAEEATTGPYGSSFLDLEQMVNKVLLSSK  483



>gb|ACJ84649.1| unknown [Medicago truncatula]
Length=480

 Score =   337 bits (863),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 196/234 (84%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL K  V + ++ +  SNLWKE+  CL+WLN+K+PNSVVYVNFGSIT
Sbjct  248  SILPPVYSIGPLHLLIKD-VTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +Q++EFAWGL+NSK  FLW+IRPD V+GE AV+P EFLEET+ RG+L+SWCPQE+V
Sbjct  307  VMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLSSWCPQEEV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            LGH ++GGFLTH+GWNSTLES+C GVPMICWPFF EQQTNC +C   WGIG+EI  + KR
Sbjct  367  LGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEI-EDAKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++E LVKELM+GEKGKEMK KA++WKKLA ++A+   GSS++NLE + + VLL
Sbjct  426  DKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVLL  479



>ref|XP_004305884.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   336 bits (862),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 190/233 (82%), Gaps = 1/233 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP +Y IGPLQLL   + QD  +++   +LWKE+  CL WL++K PNSVVYVNFGS+ 
Sbjct  244  SMLPQIYAIGPLQLLLNKIPQDQYLESLGYSLWKEETECLQWLDSKAPNSVVYVNFGSVV  303

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP QLVEF WGLANSK +FLW+IRPD V GE A++PPEF+ ETKERG +ASWCPQE+V
Sbjct  304  VMTPKQLVEFGWGLANSKLSFLWVIRPDLVVGESAILPPEFVAETKERGAVASWCPQEEV  363

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+V GFLTHSGWNST+ES+ AGVPM+CWPFFAEQQTN WY     GIGMEI+N+VKR
Sbjct  364  LNHPSVRGFLTHSGWNSTIESLSAGVPMLCWPFFAEQQTNTWYARNGLGIGMEIDNDVKR  423

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            +EVE LV+ELM+GEKGKEMK+ A EWKKLA++ AT + GSS++NLE +   +L
Sbjct  424  DEVEKLVRELMEGEKGKEMKKNANEWKKLAEE-ATDSQGSSFINLENVVQVLL  475



>ref|XP_006416207.1| hypothetical protein EUTSA_v100074990mg, partial [Eutrema salsugineum]
 gb|ESQ34560.1| hypothetical protein EUTSA_v100074990mg, partial [Eutrema salsugineum]
Length=311

 Score =   330 bits (847),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 187/236 (79%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKT-LVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY+IGPL LL K  +V+D ++    SNLWKE+  C+DWLNTK PNSVVYVNFGS
Sbjct  74   QSILPPVYSIGPLHLLAKQEIVEDSEIGRLGSNLWKEETACMDWLNTKTPNSVVYVNFGS  133

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            I VMT  QL EFAWGLA + K FLW+IRPD V+G+ A V PEFL ET +R MLASWCPQE
Sbjct  134  IIVMTAKQLEEFAWGLAATGKEFLWVIRPDLVAGDVAKVSPEFLTETVDRRMLASWCPQE  193

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC +C   W +G+EI  +V
Sbjct  194  KVLSHPAIGGFLTHNGWNSTLESLCGGVPMVCWPFFAEQQTNCKFCCDEWEVGIEIGGDV  253

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             R EVE++V+ELMDGEKGK+M+ KA EW++LA+ +     GSS VN E++ +K+LL
Sbjct  254  NREEVEAVVRELMDGEKGKKMREKAEEWRRLAEKATEHEFGSSVVNFEKVVSKILL  309



>ref|XP_008229739.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=490

 Score =   336 bits (862),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 189/232 (81%), Gaps = 1/232 (0%)
 Frame = -3

Query  860  LPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVM  681
            +P VYTIGP++LL   + +D    +   +LWKE+  CL WLN+K PNSVVYVNFGSITVM
Sbjct  257  IPPVYTIGPIELLLNQIPKDPLENSVGYSLWKEETECLQWLNSKAPNSVVYVNFGSITVM  316

Query  680  TPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLG  501
            TP+QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETKERG+LASWCPQE+VL 
Sbjct  317  TPNQLVEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLLASWCPQEQVLN  376

Query  500  HPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNE  321
            H +VGGFLTHSGWNSTLES+ AGVPM+CWPFFA+QQT+C+Y    WGIGMEI+N+VKR+E
Sbjct  377  HASVGGFLTHSGWNSTLESLTAGVPMLCWPFFADQQTDCYYTCNEWGIGMEIDNDVKRDE  436

Query  320  VESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            VE LVKELM+GEKGK+MK KAMEWKKLA++ AT   GSS    + + N+VLL
Sbjct  437  VEKLVKELMEGEKGKKMKNKAMEWKKLAEE-ATGPHGSSSTGFDNLVNQVLL  487



>gb|KCW66542.1| hypothetical protein EUGRSUZ_F00339 [Eucalyptus grandis]
Length=460

 Score =   335 bits (859),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 195/238 (82%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YTIGP+ LL + L  DDD +  R NLWKED  CL+WL++K P+SV+YVNFGSI
Sbjct  223  KAMFPPIYTIGPIHLLLEQL-SDDDTRLIRFNLWKEDLGCLEWLDSKPPSSVLYVNFGSI  281

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TV++P QLVEFAWGLANS + FLW+IRPD V G  A++PP+FL  T+ER +LASWCPQE+
Sbjct  282  TVISPAQLVEFAWGLANSGQVFLWVIRPDLVIGNTAILPPDFLAATRERSLLASWCPQER  341

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTH GWNS +ESI A VP++CWPFFA+QQTNC Y    WGIGMEI+N+V+
Sbjct  342  VLSHSAVGGFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGMEIDNDVR  401

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+G +GKEMKRK MEWK++A++ AT  SGSS++NL+++ NKVLLSP+
Sbjct  402  RDEVERQVRELMEGGRGKEMKRKVMEWKEMARE-ATHPSGSSFLNLDEVINKVLLSPR  458



>ref|XP_006433963.1| hypothetical protein CICLE_v10001630mg [Citrus clementina]
 gb|ESR47203.1| hypothetical protein CICLE_v10001630mg [Citrus clementina]
Length=358

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 195/235 (83%), Gaps = 0/235 (0%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            +LP VY+IG LQ     + ++D +    SNLWKE+  C+DWL+TK+PNSVVYVNFGSITV
Sbjct  122  LLPPVYSIGHLQFQLNQIPENDSIMRIGSNLWKEETECMDWLDTKEPNSVVYVNFGSITV  181

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MT +QL+EFAWGLANSK+TF+W+IRPD V G+ A++PPEF+ ETKER +LASWCPQE+VL
Sbjct  182  MTANQLIEFAWGLANSKQTFMWVIRPDLVVGDSAILPPEFVTETKERSLLASWCPQEQVL  241

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HPA+GGFLTHSGWNSTLESIC GVP+ICWPFFAEQQTNC Y    WGIGMEI++NVKR 
Sbjct  242  NHPAIGGFLTHSGWNSTLESICGGVPLICWPFFAEQQTNCRYSCREWGIGMEIDSNVKRE  301

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            EVE LV++LM GEKG+EMK KA+E KK A+++AT   GSSYVNLE++   VLLSP
Sbjct  302  EVEVLVRDLMVGEKGQEMKLKALELKKKAKEAATGPVGSSYVNLEKLITHVLLSP  356



>gb|ABW96222.1| glucosyltransferase [Linum usitatissimum]
Length=491

 Score =   336 bits (861),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 188/231 (81%), Gaps = 1/231 (0%)
 Frame = -3

Query  851  VYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMTP  675
            VY+IGPLQLL     + D  VK   S+LWKE+  CLDWL TK  NSVVYVNFGSITVMT 
Sbjct  257  VYSIGPLQLLANDQTITDPSVKNISSSLWKEESECLDWLETKPKNSVVYVNFGSITVMTN  316

Query  674  DQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGHP  495
            DQLVEFAWGLANSKK FLW+IRPD V+GE AV+PPEF+ +T++RG+LASWCPQE+VL H 
Sbjct  317  DQLVEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKTRDRGLLASWCPQEQVLNHE  376

Query  494  AVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEVE  315
            +V GFLTH+GWNSTLES+ AGVPMICWPFFAEQQTNCW+    WG+GMEIN++VKR+EVE
Sbjct  377  SVAGFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFACNEWGVGMEINSDVKRDEVE  436

Query  314  SLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            + V+EL+DG KG EM++KA EWK++A ++ T   GSS+  L+ +  +VLLS
Sbjct  437  AQVRELVDGRKGGEMRKKAAEWKRIAAEAVTGGGGSSFAGLDSLIERVLLS  487



>ref|XP_008219322.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 196/237 (83%), Gaps = 0/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++L  ++ IGPL LL   +  D+++K+  SNLW E+  CL+WL+TK+PNSVVYVNFGSIT
Sbjct  246  TLLSPIHCIGPLHLLLNQIPADNELKSIGSNLWTEEPECLEWLDTKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANS  TFLW IRPD V GE AVVP EF++ETKER +LA+WCPQE+V
Sbjct  306  VMTSEQLIEFAWGLANSMHTFLWAIRPDLVGGESAVVPKEFVDETKERSLLANWCPQEQV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC +    WGIG+EI+ +VKR
Sbjct  366  LSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCREWGIGLEIDPDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            + VE LV++LM+GE+GKEM++K +EWKKLA+++ T  SG S+V+ E++ ++V+L+ +
Sbjct  426  DYVEGLVRKLMEGEEGKEMRKKTLEWKKLAKEATTGPSGLSFVDFEKVVSQVILAQR  482



>ref|XP_010056397.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 193/238 (81%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YT+GPL LL   L  DD   +  SNLWKE+  CL WL++K P SVVYVNFGSI
Sbjct  248  KAMFPPIYTLGPLHLLTAQL-PDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS +TFLWIIRPD V+G+ AV+PPEF   T+ER +LASWCPQE+
Sbjct  307  TVMSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWCPQER  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VLGH AVGGFLTHSGWNST+ESI AGVP++CWPFFAEQ  NC Y    WGIGMEI+++VK
Sbjct  367  VLGHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEIDSDVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GKEMKRKAMEWK++A+++A   SG S++NL+++ N VL  P+
Sbjct  427  RDEVERQVRELMEGERGKEMKRKAMEWKEMAREAA-CPSGPSFLNLDELINSVLRLPR  483



>gb|AFJ52992.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 188/231 (81%), Gaps = 1/231 (0%)
 Frame = -3

Query  851  VYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMTP  675
            VY+IGPLQLL     + D  VK   S+LWKE+  CLDWL TK  NSVVYVNFGSITVMT 
Sbjct  257  VYSIGPLQLLANDQTITDPSVKNISSSLWKEESECLDWLETKPKNSVVYVNFGSITVMTN  316

Query  674  DQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGHP  495
            DQLVEFAWGLANSKK FLW+IRPD V+GE AV+PPEF+ +T++RG+LASWCPQE+VL H 
Sbjct  317  DQLVEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKTRDRGLLASWCPQEQVLNHE  376

Query  494  AVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEVE  315
            +V GFLTH+GWNSTLES+ AGVPMICWPFFAEQQTNCW+    WG+GMEIN++VKR+EVE
Sbjct  377  SVAGFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFACNEWGVGMEINSDVKRDEVE  436

Query  314  SLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            + V+EL+DG KG EM++KA EWK++A ++ T   GSS+  L+ +  +VLLS
Sbjct  437  AQVRELVDGRKGGEMRKKAAEWKRIAAEAVTGGGGSSFAGLDSLIERVLLS  487



>ref|XP_010064217.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 195/238 (82%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YTIGP+ LL + L  DDD +  R NLWKED  CL+WL++K P+SV+YVNFGSI
Sbjct  248  KAMFPPIYTIGPIHLLLEQL-SDDDTRLIRFNLWKEDLGCLEWLDSKPPSSVLYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TV++P QLVEFAWGLANS + FLW+IRPD V G  A++PP+FL  T+ER +LASWCPQE+
Sbjct  307  TVISPAQLVEFAWGLANSGQVFLWVIRPDLVIGNTAILPPDFLAATRERSLLASWCPQER  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTH GWNS +ESI A VP++CWPFFA+QQTNC Y    WGIGMEI+N+V+
Sbjct  367  VLSHSAVGGFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGMEIDNDVR  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+G +GKEMKRK MEWK++A++ AT  SGSS++NL+++ NKVLLSP+
Sbjct  427  RDEVERQVRELMEGGRGKEMKRKVMEWKEMARE-ATHPSGSSFLNLDEVINKVLLSPR  483



>ref|XP_008229741.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=485

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 190/234 (81%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VY IGP QLL   L  +D +K    +LWKE+  CL+WL +K PNSVVYVNFGSI 
Sbjct  252  SMLPLVYAIGPDQLLLNQL-PEDPLKHIGYSLWKEETECLEWLKSKTPNSVVYVNFGSIA  310

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+TP QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETKERG++ASWCPQE+V
Sbjct  311  VLTPQQLVEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLIASWCPQEQV  370

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L  P+VGGFLTH GWNST+ES+CAGVPM+CWPFFA+QQTNC+Y    WGIG+EINN+VKR
Sbjct  371  LNDPSVGGFLTHGGWNSTIESLCAGVPMLCWPFFADQQTNCYYVCNEWGIGLEINNDVKR  430

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            ++VE LVKELM+GEKGK+MK K MEWKKLA++ AT+  GSS  NL+ + N+V+L
Sbjct  431  DQVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATSPHGSSSTNLDNLVNQVIL  483



>gb|KCW66544.1| hypothetical protein EUGRSUZ_F00340 [Eucalyptus grandis]
Length=460

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 192/238 (81%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YTIGP+ LL + L  DDD +  R NLWKED  CL+WL+ K P SVVYVNFGSI
Sbjct  223  KAMFPPIYTIGPIHLLLEQL-SDDDTRLIRFNLWKEDLGCLEWLDLKPPGSVVYVNFGSI  281

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS + FLW+IRPD V G  A++PP+FL  T+ER +L SWCPQE+
Sbjct  282  TVMSPAQLVEFAWGLANSGQVFLWVIRPDLVKGNTAILPPDFLAATRERSLLVSWCPQER  341

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTH GWNS +ESI A VP+ CWPFFA+QQTNC Y    WGIGMEI+++V+
Sbjct  342  VLSHSAVGGFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEIDSDVR  401

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS++NL+++ +KVLLS +
Sbjct  402  RDEVERQVRELMEGERGKEMKRKAMEWKEMARE-ATCPSGSSFLNLDEVIDKVLLSSR  458



>ref|XP_009612740.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 204/235 (87%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++LP +Y IGPL  L K  ++D +++   SNLWKED  CL+WL++K PNSVVYVNFGSI
Sbjct  249  RTLLPPIYAIGPLHFLVKH-IEDKNLECLGSNLWKEDLQCLEWLDSKKPNSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP+QL+EFAWGLANS+  FLWIIRPD V+GE+A++P EF+E+TKERGMLASWCPQE+
Sbjct  308  TVMTPNQLIEFAWGLANSQMEFLWIIRPDIVTGEQAILPSEFVEQTKERGMLASWCPQEQ  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H A+GGFLTHSGWNSTLESI +GVPMICWPFFAEQQTNCW+ GT WGIGMEI+NNVK
Sbjct  368  VLSHSAIGGFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGMEIDNNVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R+EV+SLV+ELM GEKGKEMK+K+MEWKKLA+++     GSS+V ++++ N++LL
Sbjct  428  RDEVKSLVRELMAGEKGKEMKKKSMEWKKLAEEATQKPEGSSFVAIDKLINEILL  482



>ref|XP_003546715.1| PREDICTED: UDP-glycosyltransferase 85A3 [Glycine max]
Length=478

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 194/236 (82%), Gaps = 3/236 (1%)
 Frame = -3

Query  863  MLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +LP +Y+IGPL LL    +  ++++K   SNLWKE+  CL+WLN+K+PNSVVYVNFGSI 
Sbjct  239  LLPPIYSIGPLNLLLNNDVTNNEELKTIGSNLWKEEPKCLEWLNSKEPNSVVYVNFGSIM  298

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGE-EAVVPPEFLEETKERGMLASWCPQEK  510
            VMT DQL E AWGLANS K FLW+IRPD V+GE    +P EF++ETK+RGMLASWCPQE+
Sbjct  299  VMTSDQLTELAWGLANSNKNFLWVIRPDLVAGEINCALPNEFVKETKDRGMLASWCPQEE  358

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +C   WGIG+EI  +VK
Sbjct  359  VLAHPAVGGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEI-EDVK  417

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            R +VE+LV+ELM+GEKGKEMK +A+EWKKLA ++A++  GSS+VN++ +  +VL++
Sbjct  418  REKVEALVRELMEGEKGKEMKERALEWKKLAHEAASSPHGSSFVNMDNVVRQVLMN  473



>gb|KHN13067.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=478

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 194/236 (82%), Gaps = 3/236 (1%)
 Frame = -3

Query  863  MLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +LP +Y+IGPL LL    +  ++++K   SNLWKE+  CL+WLN+K+PNSVVYVNFGSI 
Sbjct  239  LLPPIYSIGPLNLLLNNDVTNNEELKTIGSNLWKEEPKCLEWLNSKEPNSVVYVNFGSIM  298

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGE-EAVVPPEFLEETKERGMLASWCPQEK  510
            VMT DQL E AWGLANS K FLW+IRPD V+GE    +P EF++ETK+RGMLASWCPQE+
Sbjct  299  VMTSDQLTELAWGLANSNKNFLWVIRPDLVAGEINCALPNEFVKETKDRGMLASWCPQEE  358

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +C   WGIG+EI  +VK
Sbjct  359  VLAHPAVGGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEI-EDVK  417

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            R +VE+LV+ELM+GEKGKEMK +A+EWKKLA ++A++  GSS+VN++ +  +VL++
Sbjct  418  REKVEALVRELMEGEKGKEMKERALEWKKLAHEAASSPHGSSFVNMDNVVRQVLMN  473



>ref|XP_010056400.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 192/238 (81%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YT+GPL LL   L  DD   +  SNLWKE+  CL WL++K P SVVYVNFGS+
Sbjct  248  KAMFPPIYTLGPLHLLTAQL-PDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSV  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS +TFLWIIRPD V+G+ AV+PPEF   T+ER +LASWCPQE+
Sbjct  307  TVMSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWCPQEQ  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VLGH AVGGFLTHSGWNST+ESI AGVP++CWPFFAEQ  NC Y    WGIGMEI+++VK
Sbjct  367  VLGHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEIDSDVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GKEMKRK MEWK++A++ AT  SG S++NL+++ N VL  P+
Sbjct  427  RDEVERQVRELMEGERGKEMKRKVMEWKEMARE-ATCPSGPSFLNLDELINSVLRLPR  483



>ref|XP_008386104.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 192/236 (81%), Gaps = 1/236 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P  Y++GPL LL   + +D+++KA  S+LW ED  CLDWL+TK+PNSVVYVNFGS T
Sbjct  239  SLFPPTYSVGPLNLLFSQIPEDNELKAIASSLWTEDTACLDWLDTKEPNSVVYVNFGSTT  298

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QLVEF+WGLANS KTFLWIIRP  V+G+ AVVPP FLEET+ RG LASWCPQE+V
Sbjct  299  VMTNEQLVEFSWGLANSNKTFLWIIRPGLVAGDTAVVPPLFLEETEGRGKLASWCPQEQV  358

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWPFFAEQQTNC Y   HWGIG+EI + VKR
Sbjct  359  LTHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACEHWGIGIEIEDEVKR  418

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            + +E LV+ LM+G++GKEM++ A+ WKK  ++  T+  GSS ++L+ + N+VL++P
Sbjct  419  DYIEGLVRRLMEGKEGKEMRKNALGWKKKIEE-VTSRKGSSVLDLDNLINQVLIAP  473



>ref|XP_010060018.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 192/238 (81%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YTIGP+ LL + L  DDD +  R NLWKED  CL+WL+ K P SVVYVNFGSI
Sbjct  248  KAMFPPIYTIGPIHLLLEQL-SDDDTRLIRFNLWKEDLGCLEWLDLKPPGSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS + FLW+IRPD V G  A++PP+FL  T+ER +L SWCPQE+
Sbjct  307  TVMSPAQLVEFAWGLANSGQVFLWVIRPDLVKGNTAILPPDFLAATRERSLLVSWCPQER  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTH GWNS +ESI A VP+ CWPFFA+QQTNC Y    WGIGMEI+++V+
Sbjct  367  VLSHSAVGGFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEIDSDVR  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS++NL+++ +KVLLS +
Sbjct  427  RDEVERQVRELMEGERGKEMKRKAMEWKEMARE-ATCPSGSSFLNLDEVIDKVLLSSR  483



>ref|XP_007018744.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOY15969.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=487

 Score =   334 bits (856),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 162/236 (69%), Positives = 199/236 (84%), Gaps = 0/236 (0%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            MLP +Y++GPL L     V D+D+K   SNLWKE+  C+ WL++K+PNSVVYVNFGSI V
Sbjct  249  MLPPIYSVGPLHLALNHHVHDNDLKQLGSNLWKEEPECIQWLDSKEPNSVVYVNFGSIAV  308

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MT DQL EFAWGLANS +TFLW+IRPD V GE AVVP EF+ ETK+RG++A+WCPQE+VL
Sbjct  309  MTADQLTEFAWGLANSNQTFLWVIRPDLVGGESAVVPAEFVAETKDRGLMATWCPQEQVL  368

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HP+VGGFLTHSGWNST+ESI  GVPMICWPFFAEQQTNC Y  T WGIGMEIN++VKR+
Sbjct  369  SHPSVGGFLTHSGWNSTIESISGGVPMICWPFFAEQQTNCRYSCTKWGIGMEINSDVKRD  428

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            EVE LV+ELM+GEKGKEMK+KA+EWK+ A+++  ++ GSSY NL+Q+ N+VLLSP+
Sbjct  429  EVEGLVRELMEGEKGKEMKKKALEWKRKAEEATGSSKGSSYKNLDQMINQVLLSPR  484



>ref|XP_002301060.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
 gb|EEE80333.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
Length=505

 Score =   334 bits (857),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 201/237 (85%), Gaps = 1/237 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S LP +YTIGPLQLLE    Q++ + +  SNLWKE+  C++WL+ K+P+SV+YVNFGS+T
Sbjct  249  STLPHLYTIGPLQLLENQ-DQENALNSIASNLWKEEPGCIEWLDFKEPDSVIYVNFGSVT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP QL+EFAWGLANSK TFLW+IRPD V G+ A+VPPEF+ ETKERG+LA WCPQE+V
Sbjct  308  VMTPQQLIEFAWGLANSKCTFLWVIRPDLVVGDSAIVPPEFVAETKERGLLAGWCPQEQV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTHSGWNSTL+S+C GVPMICWPFFAEQQTNCW+C    GIGMEI+++VKR
Sbjct  368  LQHPSIGGFLTHSGWNSTLDSLCGGVPMICWPFFAEQQTNCWFCCNKLGIGMEIDSDVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            NE+ESLV+ELM+G++G+ MK KA +WK+  +++  + +GSS +NLE++ NKVLL+P+
Sbjct  428  NEIESLVRELMEGDQGQVMKYKAKKWKRKVEEATASPTGSSCLNLEKMINKVLLAPR  484



>ref|XP_011467662.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   334 bits (856),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 188/232 (81%), Gaps = 2/232 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VY IGPLQLL    + +D +K    +LWKED  CL+WLN+K PNSVVYVNFGSI 
Sbjct  256  SMLPPVYAIGPLQLLLNH-IPEDPLKPIGYSLWKEDTECLEWLNSKAPNSVVYVNFGSIV  314

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+TP QLVEF WGLA +K  FLW+IRPD V GE AV+PPEF+ ETKERG++ASWCPQE+V
Sbjct  315  VLTPQQLVEFGWGLAKTKLPFLWVIRPDLVVGESAVLPPEFVAETKERGLIASWCPQEQV  374

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ES+CAGVPM+  PFFAEQQTNC+Y    WGIGMEINN+VKR
Sbjct  375  LNHPSVGGFLTHSGWNSTIESLCAGVPMLSLPFFAEQQTNCYYTCRKWGIGMEINNDVKR  434

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKV  171
            +EV+ LVKELM+ EKGKEM+ K MEW KLA++ ATA  GSS  NL+++  ++
Sbjct  435  DEVQKLVKELMEREKGKEMRNKVMEWNKLAEE-ATAPHGSSSKNLDKLVKRL  485



>ref|XP_004299646.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   333 bits (855),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 195/237 (82%), Gaps = 1/237 (0%)
 Frame = -3

Query  863  MLPSVYTIGPLQL-LEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +LP +Y+IGPL L L +   +D + K   +NLW+E+  C +WL++K+P+SV+YVNFGS T
Sbjct  249  LLPPIYSIGPLYLQLNQIPAEDSNFKLIGANLWREEPDCFEWLDSKEPSSVIYVNFGSST  308

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLA+S KTF W+IRPD V GE  V+PPEF+E+TKERG+LASWC QE+V
Sbjct  309  VMTDEQLIEFAWGLADSSKTFFWVIRPDLVGGESPVLPPEFIEQTKERGLLASWCCQEQV  368

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNST+ES+C GVPMICWPF  EQQTNC YC   WGIG+E+  +VKR
Sbjct  369  LSHPAIGGFLTHSGWNSTIESVCGGVPMICWPFNGEQQTNCRYCCKEWGIGIEMEGDVKR  428

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            N +ES+V++LM+GE+GKEM++K+MEWKKLA+ + T   GSS+++L+ + N+VLLSP+
Sbjct  429  NYIESVVRKLMEGEEGKEMRKKSMEWKKLAEKATTGPHGSSFLDLDNMVNQVLLSPR  485



>gb|AFJ52994.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=457

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 193/236 (82%), Gaps = 3/236 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++ P +YT+GPL L+    ++++D+ +  SNLWKE+  CL+WL+ K+PNSVVYVNFGSI
Sbjct  223  RTLAPPIYTLGPLDLMT---LRENDLDSLGSNLWKEESGCLEWLDQKEPNSVVYVNFGSI  279

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP QLVEFAWGLA SKKTFLW+IRPD V G  A++P EF +E KERG+L SWCPQ++
Sbjct  280  TVMTPHQLVEFAWGLAKSKKTFLWVIRPDLVQGASAILPGEFSDEVKERGLLVSWCPQDR  339

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HP++GGFLTH GWNSTLES+ +GVPMICWPFFAEQQTNCW+    W +G+EI+++VK
Sbjct  340  VLKHPSIGGFLTHCGWNSTLESLTSGVPMICWPFFAEQQTNCWFVCNKWRVGVEIDSDVK  399

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            R+E++ LVKEL+DG KGKEMK  AMEWK+LA+++A    G +Y+NLE + N VLL+
Sbjct  400  RDEIDELVKELIDGVKGKEMKETAMEWKRLAEEAAQCEIGHAYLNLESVINNVLLN  455



>gb|KFK44335.1| hypothetical protein AALP_AA1G244700 [Arabis alpina]
Length=485

 Score =   333 bits (855),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/239 (66%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY+IGPL LL  + + +  ++    SNLW+E+  CLDWLNTK  NSVVYVNFGS
Sbjct  247  QSILPLVYSIGPLHLLANREIEKGSEIGKMGSNLWREEADCLDWLNTKTRNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT  QLVEFAWGLA S K FLW+IRPD V+GEEA+VPPEFL+ET  R ML SWCPQE
Sbjct  307  ITVMTAKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPEFLKETAGRRMLVSWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH+GWNSTLES+C GVPM+CWPFFAEQQTNC +    W +GMEI  +V
Sbjct  367  KVLSHPAIGGFLTHNGWNSTLESLCGGVPMVCWPFFAEQQTNCKFTCDEWEVGMEIGGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            KR EVE++V+ELMDGEKGK+M+ KA EW++LA ++     GSS VN E + NK LL  K
Sbjct  427  KREEVEAVVRELMDGEKGKKMREKAEEWRRLAGEATEHKLGSSVVNFETVVNKALLGQK  485



>ref|XP_007042919.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
 gb|EOX98750.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
Length=488

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 195/236 (83%), Gaps = 2/236 (1%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            +LP VY+IGPL LL    ++DD+ +   SNLWKE   C++WLN+K+PNSVVYVN+GSITV
Sbjct  252  LLPPVYSIGPLHLL-VDWIRDDESEDINSNLWKEQTECIEWLNSKEPNSVVYVNYGSITV  310

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MTP+QL+EFAWGLANS++ FLWIIRPD V+GE A++PP+F+ ETK+RGMLASWCPQE+VL
Sbjct  311  MTPEQLIEFAWGLANSQRQFLWIIRPDLVAGETAILPPDFVSETKDRGMLASWCPQEQVL  370

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HP++GGFL+H GWNSTLES+C GVPM+CWPFFAEQQ NC +   +WGIGMEI+ NVKR 
Sbjct  371  KHPSIGGFLSHMGWNSTLESLCCGVPMVCWPFFAEQQLNCRFACRNWGIGMEIDTNVKRE  430

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            +VE LV+EL++GEKG EMK KAMEWK+ A++ A    GSS+ NLE++  +VL + K
Sbjct  431  DVEKLVRELLEGEKGMEMKTKAMEWKREAEE-AIRPGGSSFQNLEKLVAEVLQTDK  485



>ref|XP_010098617.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
 gb|EXB75356.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
Length=471

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -3

Query  857  PSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMT  678
            P VYT+G LQLL       + +K+  SNLWKED  CL+WL++K+PNSVVYVNFGSITVMT
Sbjct  225  PPVYTLGSLQLLLNQFPITEHLKSLESNLWKEDHKCLEWLDSKEPNSVVYVNFGSITVMT  284

Query  677  PDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGH  498
             +QLVEFAWGLANSKK FLW++RPD V+GE AV+PPEF EET ERG L SWCPQEKVLGH
Sbjct  285  SEQLVEFAWGLANSKKEFLWVLRPDLVAGESAVLPPEFSEETSERGFLTSWCPQEKVLGH  344

Query  497  PAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEV  318
            PAVGGFLTH GWNST+ESIC+GVPM+CWPFFAEQQTNCWY    WGIGMEI+ + KR E+
Sbjct  345  PAVGGFLTHCGWNSTIESICSGVPMLCWPFFAEQQTNCWYSCGEWGIGMEIDGDAKREEI  404

Query  317  ESLVKELMDGEKGKEMKRKAMEWKKLAQD  231
            E +V+ELMDGEKG+EMKR+  +WK+LA++
Sbjct  405  ERIVRELMDGEKGREMKRRVEKWKRLAEE  433



>ref|XP_002271368.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=483

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 188/238 (79%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++ LP VYTIGPLQ L    + DD +K F S+LWKE   CL WL++K+PNSVVYVNFGS+
Sbjct  248  RATLPPVYTIGPLQHLVHQ-ISDDKLKFFGSSLWKEQPECLQWLDSKEPNSVVYVNFGSV  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
             VMTP QL E AWGLANS K FLWIIRPD V G+ A +PPEF+ ET++RG+LASWCPQE+
Sbjct  307  IVMTPQQLTELAWGLANSNKPFLWIIRPDLVPGDSAPLPPEFVTETRDRGLLASWCPQEQ  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGF+THSGWNST E IC GVP+IC PF AEQ TNC YC + WGIGMEI+ NVK
Sbjct  367  VLKHPAVGGFVTHSGWNSTSEGICGGVPLICMPFRAEQPTNCRYCCSEWGIGMEIDGNVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R++VE LV+ELMDGE GK+MK+KAMEWKKLA++ A    GSSY N  ++ + VLLS K
Sbjct  427  RDKVEKLVRELMDGENGKKMKKKAMEWKKLAEE-AIMPGGSSYNNFNKLLSDVLLSKK  483



>ref|XP_002307921.2| hypothetical protein POPTR_0006s02440g [Populus trichocarpa]
 gb|EEE91444.2| hypothetical protein POPTR_0006s02440g [Populus trichocarpa]
Length=453

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 192/235 (82%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++ P VY+IGP QLL K  +QDD +K+   NLWKE+  CL WL+TK   SVVYVNFGSIT
Sbjct  217  TIFPRVYSIGPFQLLLKQ-IQDDGLKSIGYNLWKEESECLQWLDTKKLKSVVYVNFGSIT  275

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QLVEFA GLANSK +FLWIIRPD V G+ A++P EF  ET++RG +ASWCPQE+V
Sbjct  276  VMTAEQLVEFAMGLANSKISFLWIIRPDLVIGDSAILPAEFAVETQKRGFIASWCPQEEV  335

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTHSGWNST+ES+CAGVPMICWPFFA+Q  NC Y G+ WG+GMEI+N VKR
Sbjct  336  LNHPSIGGFLTHSGWNSTVESLCAGVPMICWPFFADQAINCSYSGSEWGVGMEIDNKVKR  395

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
             EVE LV+ELM+GEKG++M+ KAMEWKKLA+++A A  GSS +NL++  N++L S
Sbjct  396  EEVEKLVRELMEGEKGEKMRGKAMEWKKLAEEAA-APHGSSSINLDKFINEILQS  449



>emb|CDO97426.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 192/234 (82%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +M P V++IGPLQL+    +QD+ +K+  SNLWKED  C++WL+ K+PNSVVYVNFGSIT
Sbjct  249  AMYPRVFSIGPLQLMLNQ-IQDEGLKSIGSNLWKEDPVCIEWLDDKEPNSVVYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT  QL EFAWGLANSKK+FLWIIRPD V+G+ A++PPEF+ ETKERG LASWCPQE+V
Sbjct  308  VMTAHQLTEFAWGLANSKKSFLWIIRPDIVAGDTAMLPPEFVTETKERGKLASWCPQEEV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GG LTHSGWNSTLES+C GVP+ICWPFFAEQQTNC Y    W +GMEI+N+VKR
Sbjct  368  LKHPAIGGSLTHSGWNSTLESVCGGVPVICWPFFAEQQTNCRYSCVEWEMGMEIDNDVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +EVE LV+ELMDGEKG++M+ KA+EWK  A+ +A    G  + NL+Q+ N +LL
Sbjct  428  DEVELLVRELMDGEKGEKMRNKALEWKSKAE-AAAGPDGPCFQNLDQLINDLLL  480



>ref|XP_008229792.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=484

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 183/235 (78%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
             SMLP VY IGPLQLL   + Q+  +K    +LWKE+  C  WLN K PNSVVYVNFGSI
Sbjct  248  SSMLPPVYAIGPLQLLLNKIPQEYPLKPMGYSLWKEETECFKWLNDKAPNSVVYVNFGSI  307

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
             VMTP+ LVEF WGLANSK  FLWIIRPD V G  A++PPEF+ ETKER ++ASWCPQE+
Sbjct  308  AVMTPECLVEFGWGLANSKNPFLWIIRPDLVVGASAILPPEFVAETKERALIASWCPQEQ  367

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HP++GGFLTHSGWNST+ES+ AGVPM+CWP FA+Q  NCWY    WG GMEI+ NVK
Sbjct  368  VLNHPSIGGFLTHSGWNSTIESLSAGVPMVCWPLFADQPINCWYTCNEWGCGMEIDKNVK  427

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R EVE LV+ELM+GEKGK+MK KAMEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  428  REEVEKLVRELMEGEKGKKMKNKAMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  481



>gb|AFK37311.1| unknown [Medicago truncatula]
Length=480

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 193/234 (82%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL K  V + ++ +  SNLWKE+  CL+WLN+K+PNSVVYVNFGSIT
Sbjct  248  SILPPVYSIGPLHLLIKD-VTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +Q++EFAWGL+NSK  FLW+IRPD V+GE AV+P EFLEET+ RG+L+SWCPQE+V
Sbjct  307  VMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLSSWCPQEEV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            LGH ++GGFLTH+GWNSTLES+C GVPMICWPFF EQQTNC +C   WGIG+EI  + KR
Sbjct  367  LGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEI-EDAKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++E  VKELM+GEKGKEMK KA++WKKLA ++A    GSS++NLE + + V L
Sbjct  426  DKIEIFVKELMEGEKGKEMKEKALQWKKLAHNAAFGPHGSSFMNLENLIHDVFL  479



>ref|XP_011659715.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis 
sativus]
Length=426

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 189/235 (80%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+L S+YTIGPL +L    + D+ + A  SNLW E+  C++WLN+K PNSVVYVNFGSIT
Sbjct  189  SILQSIYTIGPLHMLGNQ-IDDEKLTAIGSNLWAEESECIEWLNSKQPNSVVYVNFGSIT  247

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP Q+VEFAWGLA+S K+FLWI RPD + G+ A++P EF+ +TK+R +++SWC QE+V
Sbjct  248  VMTPQQMVEFAWGLADSGKSFLWITRPDLIVGDSAIMPQEFVTQTKDRSLISSWCSQEQV  307

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTHSGWNSTLESICAGVPMI WPFFAEQQTNC YC T WGIGMEI+NNVKR
Sbjct  308  LSHPSIGGFLTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGIGMEIDNNVKR  367

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            NEVE LV+ELMDGEKGK+MK   M  K  A++ A    GS+Y  L+++ N+VLLS
Sbjct  368  NEVEELVRELMDGEKGKKMKENVMYLKSKAEE-AYKPGGSAYKQLDKLINEVLLS  421



>gb|KFK44336.1| hypothetical protein AALP_AA1G244800 [Arabis alpina]
Length=491

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY++GPL LL  + + +D ++    SNLWKE+  CLDWL+ K  NSVVYVNFGS
Sbjct  247  QSILPPVYSVGPLHLLANREITEDSEIGKMGSNLWKEETECLDWLDNKPQNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT  QLVEFAWGLA S K FLW+IRPD V+GEEA+VPPEFL ET +R MLASWCPQE
Sbjct  307  ITVMTAKQLVEFAWGLAGSGKQFLWVIRPDLVAGEEAMVPPEFLTETADRRMLASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTHSGWNSTLES+  GVPM+CWPFFAEQQTNC +    W +G+EI  +V
Sbjct  367  KVLSHPAIGGFLTHSGWNSTLESLSGGVPMVCWPFFAEQQTNCKFTCDEWEVGIEIGGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            KR EVE++V+ELMDGEKGK+M+ KA EW++LA+++     GSS VN E + NK  L  +
Sbjct  427  KREEVEAVVRELMDGEKGKKMREKAEEWRRLAKEATEHKLGSSVVNFETVVNKAFLGQR  485



>ref|XP_008219458.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=471

 Score =   331 bits (849),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 196/238 (82%), Gaps = 1/238 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y IGPL L    +  D+++K+  SNLW E+  CL WL++K+PNSVVYVNFGS T
Sbjct  233  TLLPPIYCIGPLYLQLDHIPADNELKSIGSNLWTEETECLQWLDSKEPNSVVYVNFGSST  292

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVS-GEEAVVPPEFLEETKERGMLASWCPQEK  510
            VMT +QL EFAWGLANSKK F W+IRPD V  G+  VV PEF+EETKERG+LASWCPQE+
Sbjct  293  VMTSEQLTEFAWGLANSKKAFFWVIRPDLVGEGKSVVVAPEFVEETKERGLLASWCPQEQ  352

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTH+GWNST+ES+  GVPMICWPF A+QQTNC +C + WGIG+EI  +VK
Sbjct  353  VLSHPAIGGFLTHNGWNSTIESVGGGVPMICWPFNADQQTNCRFCCSEWGIGLEIEGDVK  412

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R  +E LV+ELM+GE+GK++++KA EWKKLA+++ T ++GSS+++L+Q+ NKVLLSP+
Sbjct  413  RYYIEGLVRELMEGEEGKKLRKKASEWKKLAKEATTGSNGSSFLDLDQMVNKVLLSPR  470



>ref|XP_010056398.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   332 bits (850),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 192/238 (81%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YT+GPL L    L  DD   +  SNLWKE+  CL WL++K P SVVYVNFGSI
Sbjct  248  KAMFPPIYTLGPLHLFTAQL-PDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS +TFLWIIRPD V+G+ AV+PPEF   T ER +LASWCPQE+
Sbjct  307  TVMSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATGERSLLASWCPQER  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VLGH AVGGFLTHSGWNST+ESI AGVP++CWPFFAEQ TNC Y    WG+GMEI+++VK
Sbjct  367  VLGHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPTNCRYSREEWGMGMEIDSDVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+G++GKEMKRKAMEWK++A+++A   SG S++NL+++ N VL  P+
Sbjct  427  RDEVERQVRELMEGKRGKEMKRKAMEWKEMAREAA-CPSGPSFLNLDELINSVLRLPR  483



>ref|XP_006433961.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
 gb|ESR47201.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
Length=489

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 195/235 (83%), Gaps = 0/235 (0%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            +LP VY+IG LQ     + ++D +    SNLWKE+  C+DWL+TK+PNSVVYVNFGSITV
Sbjct  250  LLPPVYSIGHLQFQLNQIPENDSIMRIGSNLWKEETECIDWLDTKEPNSVVYVNFGSITV  309

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MT +QL+EFAWGLANSK+TF+W+IRPD V G+ A++PPEF+ ETKER +LASWCPQE+VL
Sbjct  310  MTANQLIEFAWGLANSKQTFMWVIRPDLVVGDSAILPPEFVTETKERSLLASWCPQEQVL  369

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HPA+GGFLTHSGWNSTLESIC GVP+ICWPFFAEQQTNC Y    WGIGMEI++NVKR 
Sbjct  370  NHPAIGGFLTHSGWNSTLESICGGVPLICWPFFAEQQTNCRYSCREWGIGMEIDSNVKRE  429

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            EVE LV++LM GEKG+EMK KA+E KK A+++AT   GSSYVNLE++   VLLSP
Sbjct  430  EVEVLVRDLMVGEKGQEMKLKALELKKKAKEAATGPVGSSYVNLEKLITHVLLSP  484



>ref|XP_010039816.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   331 bits (849),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/234 (65%), Positives = 193/234 (82%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P++YTIGP+ LL    ++DD+     SNLWKED  CL WL++K+PNSV+++NFGSI 
Sbjct  251  SIFPNLYTIGPIHLLLNK-IEDDNSCRIGSNLWKEDFACLGWLDSKEPNSVLFINFGSIA  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+T +QL+EF+WGLANS+K FLWIIRPD V+G++ V+P EFL ETK+RGMLA WCPQE+V
Sbjct  310  VVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQERV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+N+V+R
Sbjct  370  LRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWGIGMEIDNSVRR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + ++VL+
Sbjct  430  EEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQVLV  482



>ref|XP_010676201.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   331 bits (849),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 187/236 (79%), Gaps = 2/236 (1%)
 Frame = -3

Query  860  LPSVYTIGPLQLLEKTL-VQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
             P +YT+GP+QLL  ++   D   K+   +L K D TCL WL++  PNSVVYV+FGS TV
Sbjct  248  FPPLYTLGPMQLLLDSVEANDGKTKSISPSLLKADPTCLKWLDSYTPNSVVYVSFGSTTV  307

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MT DQL+EFAWGLANS + FLWI RPD V+G+ +V+PPEFLE+TK+RG++ASWC QEKVL
Sbjct  308  MTNDQLIEFAWGLANSNQPFLWITRPDLVAGDSSVLPPEFLEKTKDRGLIASWCNQEKVL  367

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             H AVGGFLTHSGWNSTLESI  GVPMICWPFFAEQ TNCW+C   WGIGMEIN NVKRN
Sbjct  368  AHQAVGGFLTHSGWNSTLESISNGVPMICWPFFAEQHTNCWFCCNKWGIGMEINVNVKRN  427

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            EVE  V+E+M+GEKGKEMKRKAMEWK LA ++AT+  GSSY N+  +  KVL S K
Sbjct  428  EVERQVREMMEGEKGKEMKRKAMEWKTLAHEAATSPCGSSYSNMNSLI-KVLQSKK  482



>gb|KCW45703.1| hypothetical protein EUGRSUZ_L005082, partial [Eucalyptus grandis]
Length=303

 Score =   325 bits (832),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 190/231 (82%), Gaps = 2/231 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P +YTIGPLQLL    +QD+ +++   +LW+E+  CL WL++K+P SVVYVNFGSIT
Sbjct  75   SVFPHIYTIGPLQLLADQ-IQDEALRSVGGSLWREEPECLPWLDSKEPGSVVYVNFGSIT  133

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT  QL+EFAWGLANS+K FLWIIRPD V+ E AV+PPEF+EE   RGMLA WC QE+V
Sbjct  134  VMTAGQLIEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFMEEIAGRGMLARWCRQEEV  193

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H A+GGFLTHSGWNSTLES+C+GVP+ICWPFF +QQTNC Y  T WGIGMEI+N+VKR
Sbjct  194  LKHQAIGGFLTHSGWNSTLESLCSGVPVICWPFFGDQQTNCLYSCTEWGIGMEIDNDVKR  253

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNK  174
            +EVE LV+ELM+GEKGKEM++KAMEWK  A++ A   SG+SY N++++ ++
Sbjct  254  DEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMPSGTSYNNVDKLISE  303



>ref|XP_011658802.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis 
sativus]
Length=489

 Score =   331 bits (848),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 189/235 (80%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+L S+YTIGPL +L    + D+ + A  SNLW E+  C++WLN+K PNSVVYVNFGSIT
Sbjct  252  SILQSIYTIGPLHMLGNK-IDDEKLTAIGSNLWAEESECIEWLNSKQPNSVVYVNFGSIT  310

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP Q+VEFAWGLA+S K FLWI RPD + G+ A++P EF+ +TK+R ++ASWC QE+V
Sbjct  311  VMTPQQMVEFAWGLADSGKPFLWITRPDLIVGDSAIMPQEFVTQTKDRSLIASWCSQEQV  370

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTHSGWNSTLESICAGVPMI WPFFAEQQTNC YC T WGIGMEI+NNVKR
Sbjct  371  LNHPSIGGFLTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGIGMEIDNNVKR  430

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            NEVE LV+ELMDGEKGK+MK  AM  K  A++ A    GS+Y  L+++ N+VLLS
Sbjct  431  NEVEKLVRELMDGEKGKKMKENAMFLKSKAEE-AYKPGGSAYKQLDKLINEVLLS  484



>emb|CDY21357.1| BnaA09g30700D [Brassica napus]
Length=290

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 186/235 (79%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQ-DDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            +SMLP VY+IGPL LL    V  D D+     NLW+E+  CLDWL+TK PNSVV+VNFG 
Sbjct  56   KSMLPPVYSIGPLNLLASQEVYVDSDMGQMGLNLWREETECLDWLDTKAPNSVVFVNFGC  115

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+ +QL EFAWGLA S K FLW+IRPD V+GE A VPPEF+ ET++RGM+ASWCPQE
Sbjct  116  ITVMSVEQLDEFAWGLAGSGKEFLWVIRPDLVAGEAAAVPPEFIRETEDRGMMASWCPQE  175

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH GWNSTLES+  GVPMICWPFFAEQ TNC +C   WG+GMEI  +V
Sbjct  176  KVLSHPAIGGFLTHCGWNSTLESLSGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGDV  235

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            KR EVE++++ELMDGEKGK+++ KA +W++LA+++    SGSS V+ E + NKVL
Sbjct  236  KREEVEAVIRELMDGEKGKKLREKAEKWQRLAKEATEYPSGSSNVSFETLVNKVL  290



>ref|XP_010267412.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=492

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 196/238 (82%), Gaps = 4/238 (2%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLV-QDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            SM   VY++GPL L     + ++DD+K+  SNLWKE+  C++WL++K PNSVVYVNFGSI
Sbjct  249  SMFCRVYSVGPLHLFASNQISENDDLKSIDSNLWKEEAGCMEWLDSKKPNSVVYVNFGSI  308

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT +QLVEFAWGLANS +TFLW+IRPD V G+ A++PPEF++ TKERG+LA+WCPQE+
Sbjct  309  TVMTGEQLVEFAWGLANSNQTFLWVIRPDLVKGDSALLPPEFVQHTKERGLLANWCPQEQ  368

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGT--HWGIGMEINNN  336
            +L HP++G FLTH GWNSTLESIC GVPM+CWPFFAEQQTNC Y  T   WGIGMEINN+
Sbjct  369  ILNHPSIGVFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCRYTCTESEWGIGMEINND  428

Query  335  VKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            VKR++VESLV++L++G+KGKE+K K MEWKK AQ+ A    GSS +N +++ ++VLLS
Sbjct  429  VKRDDVESLVRQLINGDKGKELKNKVMEWKKKAQE-AICLGGSSRLNFDKMIDQVLLS  485



>ref|XP_010676178.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 189/235 (80%), Gaps = 3/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTL--VQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            S  P +YT+GPLQLL  ++    D++++   +NLWKED  CL WL++ +PNSVVYVNFGS
Sbjct  249  SDFPPLYTLGPLQLLLDSIPGSNDEEIQTISTNLWKEDTHCLGWLDSYEPNSVVYVNFGS  308

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT DQL+EFAWGLANS + FLWIIRPD V G+ AV+PPEF+EETK RG++ASWC Q+
Sbjct  309  ITVMTNDQLIEFAWGLANSNQPFLWIIRPDLVIGDSAVLPPEFIEETKNRGLIASWCNQD  368

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPAVGGFLTH GWNS +E++  G P+ICWPFFAEQQTNCW+    WGIGMEI+ NV
Sbjct  369  QVLAHPAVGGFLTHCGWNSIIETLINGAPIICWPFFAEQQTNCWFSCNKWGIGMEIDVNV  428

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            KR+EVE  V+ELMDGEKGKEMKRK MEW+KL  ++  A +GSSY NL+++  KVL
Sbjct  429  KRSEVERQVRELMDGEKGKEMKRKVMEWRKLGHEATAAPNGSSYKNLDKVI-KVL  482



>ref|XP_010498707.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=486

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 188/236 (80%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            +S++P VY+IGPLQLL  + + +D +     +NLW+ED+ CLDWL+TK PNSV+YVNFGS
Sbjct  247  KSIIPQVYSIGPLQLLVNREMDKDSETGKMETNLWREDRECLDWLDTKSPNSVIYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+   LVEFAWGLA +KK FLW+IRPD V G+ A+VPPEFL ET +R MLASWCPQE
Sbjct  307  ITVMSAKHLVEFAWGLAATKKDFLWVIRPDLVVGDVAMVPPEFLIETADRRMLASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPAVGGFLTHSGWNSTLES+  GVPM+CWPFFAEQQTNC YC   W +GMEI+ +V
Sbjct  367  KVLSHPAVGGFLTHSGWNSTLESLSCGVPMLCWPFFAEQQTNCKYCCDEWEVGMEISGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +R EVE L++ELMDG+KGK+M+ KA EW++LA+++     GSS  + E +  KVLL
Sbjct  427  RREEVEELIRELMDGDKGKKMREKAEEWRRLAEEATKHMCGSSERSFEMVVGKVLL  482



>gb|KFK44333.1| hypothetical protein AALP_AA1G244500 [Arabis alpina]
Length=483

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 187/236 (79%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKA-FRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY+IGPL LL   ++++D   A    NLW+E+  CLDWLNTK  NSVVYVNFGS
Sbjct  247  QSVLPPVYSIGPLHLLANQVIKEDSETAQMGLNLWREETKCLDWLNTKTQNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT  QLVEFAWGLA S K FLW+IRPD V+GEEA+VP +FL ET  R ML SWCPQE
Sbjct  307  ITVMTTKQLVEFAWGLARSGKEFLWVIRPDLVAGEEAIVPSDFLTETTGRRMLVSWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTHSGWNSTLES+ +GVPM+CWPFFA+QQTNC +C   W +GMEI  +V
Sbjct  367  KVLSHPAIGGFLTHSGWNSTLESLSSGVPMVCWPFFADQQTNCKFCCDKWEVGMEIGGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELMDGEKGK+M+ KA EW++LA+ ++    GSS +N E + NKVLL
Sbjct  427  KREEVEAVVRELMDGEKGKKMREKAEEWRRLAEKASERKLGSSILNFETLVNKVLL  482



>ref|XP_010534080.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Tarenaya hassleriana]
Length=486

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 186/236 (79%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP V+ +GPL LL  + + +D ++    SNLWKED  CL WL+ K PNSVVYVNFGS
Sbjct  248  QSILPPVHPVGPLHLLVNREIDKDSEIGRLGSNLWKEDTECLAWLDAKAPNSVVYVNFGS  307

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+  QLVEFAWGLA S+K FLW+IRPD V G+ AVVPPEF+ ET +RGMLA+WCPQE
Sbjct  308  ITVMSEKQLVEFAWGLAGSRKEFLWVIRPDLVGGDAAVVPPEFMAETADRGMLANWCPQE  367

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPAVGGFLTH+GWNST+ESI  GVPMICWPFFAEQQ NC +C   WG G EI  +V
Sbjct  368  EVLSHPAVGGFLTHNGWNSTIESISGGVPMICWPFFAEQQMNCKFCCDEWGTGKEIGGDV  427

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELMDGE GK+M+ KA EW++ A+ S  A SGSS+VN E + ++VLL
Sbjct  428  KRGEVEAVVRELMDGEMGKKMRNKAEEWRRSAEASVAAPSGSSFVNFEAVVDRVLL  483



>ref|XP_009341756.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = -3

Query  851  VYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMTPD  672
            VY+IGPL L    +  D ++K+ RSNLW E+  CL+WL+TK+PNSVVYVNFGSITVMT +
Sbjct  251  VYSIGPLNLQIGQIPVDKELKSIRSNLWIEEPECLEWLHTKEPNSVVYVNFGSITVMTNE  310

Query  671  QLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGHPA  492
            QL EFAWGLAN KKTFLW+IRPD V G+ AVVP EF+EETK+R ++ASWCPQE+VL HPA
Sbjct  311  QLTEFAWGLANCKKTFLWVIRPDLVGGDSAVVPQEFVEETKDRSLMASWCPQEQVLSHPA  370

Query  491  VGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEVES  312
            +GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +     GIG+EI  +VKR  VE 
Sbjct  371  IGGFLTHCGWNSTLESVCGGVPMVCWPFFAEQQTNCRFSCKELGIGLEIEGDVKRKYVEG  430

Query  311  LVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            LV++LMDG++GKEM++KA+EWKKLA+++++  +G S+V+ + + N+VLLS K
Sbjct  431  LVRKLMDGKEGKEMRKKALEWKKLAKEASSGPNGLSFVDFDTMVNQVLLSQK  482



>gb|KCW66555.1| hypothetical protein EUGRSUZ_F00353, partial [Eucalyptus grandis]
Length=477

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 192/232 (83%), Gaps = 2/232 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++MLP +YT+GPL LL + L   +D ++  SNLWKEDQ CL+WL+ K P+SVVYVNFGS+
Sbjct  248  KAMLPPIYTLGPLHLLTEQL-PSNDTRSIGSNLWKEDQGCLEWLDLKSPSSVVYVNFGSV  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QLVEFAWGLANS +TFLW+IRPD V G+ A++PPEF   T+ER +LASWCPQ +
Sbjct  307  TVMSPTQLVEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLASWCPQVQ  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H A+GGFLTHSGWNST+ESI AGVP++CWPFFAEQQ NC Y    WGIGMEI+ +VK
Sbjct  367  VLRHQAIGGFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGMEIDGDVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNK  174
            R+EVE  V+ELM+GE+GKEMKRKAMEWK++A++ AT  SGSS +NL+++ +K
Sbjct  427  RDEVERQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDK  477



>ref|XP_002298702.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
 gb|EEE83507.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
Length=474

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 191/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +M P +YT+GPLQLL      + ++K F SNLWKE+  C++WL++K+PNSVVYVNFGSIT
Sbjct  239  TMFPPIYTLGPLQLLVDQF-PNGNLKNFGSNLWKEEPGCIEWLDSKEPNSVVYVNFGSIT  297

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+TP Q++EFAWGLANS K FLWIIRPD V GE A++P EF+ ETK+RGMLA+WCPQE V
Sbjct  298  VITPQQMMEFAWGLANSNKPFLWIIRPDLVEGESAMLPSEFVSETKKRGMLANWCPQELV  357

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFL H GWNST++SICAGVP+ICWPFFA+QQTNC +  T WGIGM+I+NNVKR
Sbjct  358  LKHPSIGGFLCHMGWNSTMDSICAGVPLICWPFFADQQTNCMFACTEWGIGMQIDNNVKR  417

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPKC  153
            +EVE LV+ELM+GEKGK+MKRKAMEWK  A++  T   GSS+ NLE +   +     C
Sbjct  418  DEVEKLVRELMEGEKGKDMKRKAMEWKTKAEE-VTRPGGSSFENLEALVKVLACKQTC  474



>ref|XP_006416204.1| hypothetical protein EUTSA_v10007489mg [Eutrema salsugineum]
 gb|ESQ34557.1| hypothetical protein EUTSA_v10007489mg [Eutrema salsugineum]
Length=487

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 188/239 (79%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY+IGPL LL  + L  D++++   +NLW+E+  CLDWL+TK  NSVVYVNFGS
Sbjct  242  QSILPPVYSIGPLHLLVNRELDDDNEIRRMETNLWREETKCLDWLDTKPRNSVVYVNFGS  301

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+  QLVEFAWGLA + K FLW+IRPD V+G+ AVVP EFL ET +R MLASWCPQE
Sbjct  302  ITVMSAKQLVEFAWGLAATGKDFLWVIRPDLVAGDVAVVPAEFLTETADRRMLASWCPQE  361

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+G FLTHSGWNSTLES+C GVPM+CWP+FAEQQTNC +C   W +GMEI  +V
Sbjct  362  KVLSHPAIGVFLTHSGWNSTLESLCGGVPMVCWPYFAEQQTNCKFCCDEWEVGMEIGGDV  421

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            KR E+E +++ELMDGEKGK M+ KA EW++LA+ +     GSS +N + + +KVLL+ K
Sbjct  422  KREEIEKVIRELMDGEKGKRMREKAEEWRRLAEKATAQKDGSSELNFQMVVDKVLLASK  480



>ref|XP_009145347.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X3 [Brassica 
rapa]
Length=483

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 188/236 (80%), Gaps = 2/236 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQL-LEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS++P VY+IGPL L +++ + +D ++    SNLWKE+  C+DWLNTK PNSVVYVNFGS
Sbjct  247  QSIVPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNTKAPNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT  QLVEFAWGLA + K FLW+IRPD V+GE ++VPPEFL ET +R MLASWCPQE
Sbjct  307  ITVMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC +C   W IG+EI  +V
Sbjct  367  EVLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIGGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +R EVE++V+ELMDGEKGK+M+ KA EW+ LA+ +     GSS VN + +  KVLL
Sbjct  427  RREEVEAVVRELMDGEKGKKMREKAAEWRSLAEKATECKRGSSVVNFDNVV-KVLL  481



>ref|XP_009145346.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X2 [Brassica 
rapa]
Length=484

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 188/236 (80%), Gaps = 2/236 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQL-LEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS++P VY+IGPL L +++ + +D ++    SNLWKE+  C+DWLNTK PNSVVYVNFGS
Sbjct  248  QSIVPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNTKAPNSVVYVNFGS  307

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT  QLVEFAWGLA + K FLW+IRPD V+GE ++VPPEFL ET +R MLASWCPQE
Sbjct  308  ITVMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQE  367

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC +C   W IG+EI  +V
Sbjct  368  EVLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIGGDV  427

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +R EVE++V+ELMDGEKGK+M+ KA EW+ LA+ +     GSS VN + +  KVLL
Sbjct  428  RREEVEAVVRELMDGEKGKKMREKAAEWRSLAEKATECKRGSSVVNFDNVV-KVLL  482



>ref|XP_009145345.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X1 [Brassica 
rapa]
Length=487

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 188/236 (80%), Gaps = 2/236 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQL-LEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS++P VY+IGPL L +++ + +D ++    SNLWKE+  C+DWLNTK PNSVVYVNFGS
Sbjct  251  QSIVPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNTKAPNSVVYVNFGS  310

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT  QLVEFAWGLA + K FLW+IRPD V+GE ++VPPEFL ET +R MLASWCPQE
Sbjct  311  ITVMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQE  370

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC +C   W IG+EI  +V
Sbjct  371  EVLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIGGDV  430

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +R EVE++V+ELMDGEKGK+M+ KA EW+ LA+ +     GSS VN + +  KVLL
Sbjct  431  RREEVEAVVRELMDGEKGKKMREKAAEWRSLAEKATECKRGSSVVNFDNVV-KVLL  485



>emb|CDY46643.1| BnaA07g10530D [Brassica napus]
Length=491

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 188/236 (80%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY+IGPL LL  + + +  + +   SNLW+E+  CLDWL+TK  NSVVYVNFGS
Sbjct  247  QSILPPVYSIGPLHLLVNREIEEGTETERLGSNLWREETECLDWLDTKAQNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT  QLVEFAWGLA S+K FLW+IRPD V+GEEAV+P EFL ET+ R ML SWCPQE
Sbjct  307  ITVMTAKQLVEFAWGLAASRKEFLWVIRPDLVAGEEAVIPTEFLTETEGRRMLLSWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPAVGGFLTH+GWNSTLESI AGVPM+CWPFFAEQQTN  YC   WG+GMEI  +V
Sbjct  367  KVLSHPAVGGFLTHNGWNSTLESISAGVPMVCWPFFAEQQTNAKYCCDEWGVGMEIGEDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELMDGEKGK+++ KA EW++LA+ +     GSS VN + + +K+LL
Sbjct  427  KREEVEAVVRELMDGEKGKKLREKAEEWRRLAEKATEHPCGSSVVNFKTVVDKILL  482



>ref|XP_004305885.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=478

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 188/233 (81%), Gaps = 2/233 (1%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            MLP VY IGPLQLL    + +D +++   +LWKED  CL WLN K PNSVVYVNFGS+ V
Sbjct  245  MLPHVYAIGPLQLLLNQ-IPEDPLESMGYSLWKEDTECLPWLNAKAPNSVVYVNFGSVVV  303

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MTP+ LVEF WGLANSK  FLW+IRPD V GE A++PPEF+ ETK RG++ASWCPQE+VL
Sbjct  304  MTPEHLVEFGWGLANSKHPFLWVIRPDLVVGESAILPPEFVAETKGRGIIASWCPQEEVL  363

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HP+VGGFLTH+GWNST+ES+ AGVPM+CWPFFAEQQTNCWY     GIGMEI+NNVKR+
Sbjct  364  NHPSVGGFLTHNGWNSTIESVTAGVPMLCWPFFAEQQTNCWYVCNGLGIGMEIDNNVKRD  423

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            EVE LV+ELM+G+ G+EM+ KA   KKLA+++A    GSSY NL+++ N+VLL
Sbjct  424  EVEKLVRELMEGQNGEEMRNKANVLKKLAEEAAD-PQGSSYKNLDKVVNQVLL  475



>gb|AAR06913.1| UDP-glycosyltransferase 85A8 [Stevia rebaudiana]
Length=479

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 186/231 (81%), Gaps = 1/231 (0%)
 Frame = -3

Query  857  PSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMT  678
            P +YTIGPL ++++ +  D+ +K   SNLWKED +C++WL+TK PNSVVYVNFGSITVMT
Sbjct  248  PQIYTIGPLHMMQQYVDHDERLKHIGSNLWKEDVSCINWLDTKKPNSVVYVNFGSITVMT  307

Query  677  PDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGH  498
             +QL+EF WGLANSKK FLWI RPD V G EA++P EF+EETKERGM+ SWC QE+VL H
Sbjct  308  KEQLIEFGWGLANSKKDFLWITRPDIVGGNEAMIPAEFIEETKERGMVTSWCSQEEVLKH  367

Query  497  PAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEV  318
            P++G FLTHSGWNST+ESI  GVPMICWPFFAEQQTNC YC   W IG+EI+ +VKR EV
Sbjct  368  PSIGVFLTHSGWNSTIESISNGVPMICWPFFAEQQTNCRYCCVEWEIGLEIDTDVKREEV  427

Query  317  ESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            E+ V+E+MDG KGK MK KA+EWKK A++ A +  GSSY+N E++   VLL
Sbjct  428  EAQVREMMDGSKGKMMKNKALEWKKKAEE-AVSIGGSSYLNFEKLVTDVLL  477



>gb|ADG65641.1| glycosyltransferase [Withania somnifera]
Length=485

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 203/238 (85%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++L  VY+IGPL LL K  V D+++K   S+LWKE+  C+ WL+TK+P SVVYVNFGSI
Sbjct  248  RTLLQPVYSIGPLNLLVKD-VDDENLKGLGSSLWKEEPECIQWLDTKEPKSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTPDQL+EFAWGLANS++ FLWIIRPD VSG E+++PP+F+EETK RGMLA WC QE+
Sbjct  307  TVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSGYESILPPDFVEETKNRGMLAGWCSQEE  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTH+GWNSTLESIC+GVPMICWPFFAEQQTNCWY  T W IGMEI+NNVK
Sbjct  367  VLNHPAIGGFLTHNGWNSTLESICSGVPMICWPFFAEQQTNCWYTVTKWDIGMEIDNNVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE LV+ELM GEKGKEMK+KAM+WK LA+ SA  + GSSYVN+E++ N +LLS K
Sbjct  427  RDEVECLVRELMVGEKGKEMKKKAMKWKTLAEISAQKSEGSSYVNIEKVVNDILLSSK  484



>ref|XP_009103242.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Brassica rapa]
Length=491

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 188/236 (80%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY+IGPL LL  + + +  + +   SNLW+E+  CLDWL+TK  NSVVYVNFGS
Sbjct  247  QSILPPVYSIGPLHLLVNREIEEGTETERLGSNLWREETECLDWLDTKAQNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT  QLVEFAWGLA S+K FLW+IRPD V+GEEAV+P EFL ET+ R ML SWCPQE
Sbjct  307  ITVMTAKQLVEFAWGLATSRKEFLWVIRPDLVAGEEAVIPTEFLTETEGRRMLLSWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPAVGGFLTH+GWNSTLESI AGVPM+CWPFFAEQQTN  YC   WG+GMEI  +V
Sbjct  367  KVLSHPAVGGFLTHNGWNSTLESISAGVPMVCWPFFAEQQTNAKYCCDEWGVGMEIGEDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELMDGEKGK+++ KA EW++LA+ +     GSS VN + + +K+L+
Sbjct  427  KREEVEAVVRELMDGEKGKKLREKAEEWRRLAEKATEHPCGSSVVNFKMVVDKILI  482



>gb|KCW73113.1| hypothetical protein EUGRSUZ_E01564, partial [Eucalyptus grandis]
Length=433

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 186/227 (82%), Gaps = 2/227 (1%)
 Frame = -3

Query  857  PSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMT  678
            P +YT+GPL LL   L  DD   +  SNLWKE+  CL WL++K P SVVYVNFGSITVM+
Sbjct  208  PPIYTLGPLHLLTAQL-PDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSITVMS  266

Query  677  PDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGH  498
            P QLVEFAWGLANS +TFLWIIRPD V+G+ AV+PPEF   T ER +LASWCPQE+VLGH
Sbjct  267  PAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATGERSLLASWCPQERVLGH  326

Query  497  PAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEV  318
             AVGGFLTHSGWNST+ESI AGVP++CWPFFAEQ TNC Y    WGIGMEI+++VKR+EV
Sbjct  327  QAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPTNCRYSREEWGIGMEIDSDVKRDEV  386

Query  317  ESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFN  177
            E  V+ELM+GEKGKEMKRKAMEWK++A+++A   SG S++NL+++ N
Sbjct  387  ERQVRELMEGEKGKEMKRKAMEWKEMAREAA-CPSGPSFLNLDELIN  432



>ref|XP_008804762.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   329 bits (843),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 185/234 (79%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP +YTIGPL LL +  +    + +  SNLWKED TCL+WL  ++P SVVYVN+GSIT
Sbjct  246  SMLPPIYTIGPLSLLSRQ-ITTSPLTSISSNLWKEDPTCLEWLQGREPGSVVYVNYGSIT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANSK  F W+IRPD V G+ AV+P EFL ETKERG+LASWCPQE V
Sbjct  305  VMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASWCPQEAV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++G FLTHSGWNSTLESIC GVP I WPFFAEQQTNC Y  T WGIGMEI++NVKR
Sbjct  365  LSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEIDSNVKR  424

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELM+GEKGKEM+R+A+EWK+ A   AT   GSS+ N +++  + LL
Sbjct  425  EEVERLVRELMEGEKGKEMRRRAVEWKESAI-RATQPGGSSFQNFDRLVKEALL  477



>ref|XP_008386105.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 145/236 (61%), Positives = 196/236 (83%), Gaps = 0/236 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y++GPL L    +  ++++K+  SNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPIYSVGPLHLQLNQIPAENELKSIGSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+T +QL EFAWGLANS +TFLW+IRPD + GE AVVP EF EETKER ++ASWCPQ++V
Sbjct  306  VLTEEQLTEFAWGLANSNQTFLWVIRPDLLVGESAVVPSEFSEETKERSLVASWCPQQEV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNS LES+C GVPMICWPFFAEQQ NC +    WGIGMEI  +VKR
Sbjct  366  LSHPAIGGFLTHSGWNSILESLCGGVPMICWPFFAEQQMNCRFSCKVWGIGMEIEGDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            + +E LV+++M+GE+GKEM++KA+EWKKLA ++ T+ +G+S+V+L+++ ++VL SP
Sbjct  426  DYIEGLVRKIMEGEEGKEMRKKALEWKKLATEATTSPNGTSFVDLDRMASQVLQSP  481



>ref|XP_011009481.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/234 (65%), Positives = 189/234 (81%), Gaps = 3/234 (1%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            M P +YT+GPLQLL    + +D++K   SNLWK+   C++WL++K PNSVVYVNFGSITV
Sbjct  248  MFPPIYTLGPLQLLVDQ-IPNDNLKNIGSNLWKDHPECIEWLDSKGPNSVVYVNFGSITV  306

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            +T  Q++EFAWGLANS K FLWIIRPD + GE A++PPEFL  TK+R +L SWCPQE++L
Sbjct  307  ITAQQMIEFAWGLANSNKPFLWIIRPDLIGGEAAMLPPEFLSATKDRSLLVSWCPQEQIL  366

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HP++GGFL+H GWNSTLESIC GVPM+CWPFF EQQTNCW+  T WGIGMEI NNVKR+
Sbjct  367  KHPSIGGFLSHMGWNSTLESICGGVPMVCWPFFGEQQTNCWFACTKWGIGMEIENNVKRD  426

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            EVE LV+ELM+GEKGK+MKRKAMEWK  A+++A     +SY NL+++  KVL S
Sbjct  427  EVEKLVRELMEGEKGKDMKRKAMEWKTKAEEAAWTGD-ASYRNLDRLV-KVLAS  478



>ref|XP_008455179.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]
Length=488

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 189/235 (80%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+L S+YTIGPL +L    + D+++ A  SNLW E+  C++WLN+K PNSVVYVNFGSIT
Sbjct  251  SILQSIYTIGPLHMLANQ-IDDENLTAIGSNLWAEESECIEWLNSKQPNSVVYVNFGSIT  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP Q++EFAWGLA+S K FLWI RPD + G+ A++P EF+ +TK+R ++A+WC QE+V
Sbjct  310  VMTPQQMIEFAWGLADSGKPFLWITRPDLIVGDSAILPHEFVTQTKDRSLIANWCCQEQV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTHSGWNSTLESICAGVPMI WPFFAEQQTNC YC T WGIGMEI+NNVKR
Sbjct  370  LNHPSIGGFLTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGIGMEIDNNVKR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            NEVE LV+ELMDGEKGK+MK   M  K  A++ A    GS+Y  L+++ N+VLLS
Sbjct  430  NEVEELVRELMDGEKGKKMKENVMYLKSKAEE-AYKPDGSAYKQLDKLINEVLLS  483



>ref|XP_009103241.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Brassica rapa]
Length=488

 Score =   329 bits (843),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 186/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDD-DVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            Q +   VY++GPL LL+  +++D  +V    SNLWKE   CL WL+TK P+SVVYVNFGS
Sbjct  247  QPIFSPVYSVGPLHLLDNRVIEDSGEVGRMGSNLWKEKIECLAWLDTKAPDSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITV +  QL EFA GLA S K FLW+IRPD V+GE AVVPPEFL ET++RGM+ASWCPQE
Sbjct  307  ITVTSAKQLAEFALGLAGSGKEFLWVIRPDLVAGEAAVVPPEFLVETRDRGMMASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPAVGGFLTH GWNS LES+C GVPMICWPFFAEQ TNC +C   WG+GMEIN NV
Sbjct  367  KVLSHPAVGGFLTHCGWNSMLESLCGGVPMICWPFFAEQPTNCKFCCEEWGVGMEINENV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            KR E+E++VKELMDGEKG++M+ KA EW++LA+ +  +  GSS +N E + +KV+L  +
Sbjct  427  KREEIEAVVKELMDGEKGRKMREKAREWRRLAEKATESKYGSSVINFETVVSKVVLRQR  485



>ref|XP_010039828.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=490

 Score =   329 bits (843),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 192/233 (82%), Gaps = 2/233 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P +YTIGPLQLL    +QD+ +++   +LW+E+  CL WL++K+P SVVYVNFGSIT
Sbjct  256  SVFPHIYTIGPLQLLADQ-IQDEALRSVGGSLWREEPECLPWLDSKEPGSVVYVNFGSIT  314

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT  QL+EFAWGLANS+K FLWIIRPD V+ E AV+PPEF+EE   RGMLA WC QE+V
Sbjct  315  VMTAGQLIEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFMEEIAGRGMLARWCRQEEV  374

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H A+GGFLTHSGWNSTLES+C+GVP+ICWPFF +QQTNC Y  T WGIGMEI+N+VKR
Sbjct  375  LKHQAIGGFLTHSGWNSTLESLCSGVPVICWPFFGDQQTNCLYSCTEWGIGMEIDNDVKR  434

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            +EVE LV+ELM+GEKGKEM++KAMEWK  A++ A   SG+SY N++++ ++VL
Sbjct  435  DEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMPSGTSYNNVDKLISEVL  486



>ref|XP_008342285.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=317

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 187/234 (80%), Gaps = 3/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VYTIGPLQL    + +      +  +LWKE+  CL+WLNTK  NSVVYVNFGSIT
Sbjct  84   SMLPLVYTIGPLQLHLNQIPEHPLNIGY--SLWKEETECLEWLNTKAENSVVYVNFGSIT  141

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP  L EF WGLANSK  F W+IRPD V GE A++PPEF+ ETKER ++ASWCPQE+V
Sbjct  142  VMTPAHLAEFGWGLANSKMPFFWVIRPDLVIGESAILPPEFVAETKERSLIASWCPQEQV  201

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFFA+QQ +C Y    WG+GMEI+N+VKR
Sbjct  202  LNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWGVGMEISNDVKR  261

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +EVE L++ELMDGEKGK+MK KAMEWKKLA++ AT+  GSS  NL+ + N+VLL
Sbjct  262  DEVEKLIRELMDGEKGKKMKNKAMEWKKLAEE-ATSPHGSSSKNLDNLVNQVLL  314



>emb|CDP01079.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   328 bits (842),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 194/236 (82%), Gaps = 5/236 (2%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S LP +YTIGPL LLE  +  D  +   +SNLWKE+  CL+WL+ KDPNSVVYVNFGSI 
Sbjct  249  SHLPPIYTIGPLHLLENHM-HDKSLTDLQSNLWKEEPECLEWLDLKDPNSVVYVNFGSIA  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP+QLVEFAWGLANSK+ FLWI+RPD VSG  A++P EFLEETKER M A WCPQEKV
Sbjct  308  VMTPEQLVEFAWGLANSKQNFLWILRPDLVSGNSAILPSEFLEETKERSMFAGWCPQEKV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ESI  GVPMICWPFFA+QQTNCW+C T WGIGMEI+NNVKR
Sbjct  368  LSHPSVGGFLTHSGWNSTIESISYGVPMICWPFFADQQTNCWFCCTKWGIGMEIDNNVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            +EVE LV ELM GEKGKEMK+KAM+WKKLA+ + T     S +NLE + ++VLL+P
Sbjct  428  DEVEGLVSELMAGEKGKEMKKKAMDWKKLAETAVT----DSNLNLENLIHQVLLNP  479



>gb|KCW66540.1| hypothetical protein EUGRSUZ_F00337 [Eucalyptus grandis]
Length=460

 Score =   328 bits (840),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 191/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YTIGP+ LL + L  DDD +  RSNL +ED  CL+WL++K P SVVYVNFGSI
Sbjct  223  KAMFPPIYTIGPIHLLVEQL-SDDDTRPIRSNLLEEDLGCLEWLDSKPPGSVVYVNFGSI  281

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
             VM+P QLVEFAWGLANS + FLW+IRPD + G  A++PP+FL  T+ER +LASWCPQE+
Sbjct  282  IVMSPAQLVEFAWGLANSGQVFLWVIRPDLIIGNTAILPPDFLAATRERSLLASWCPQER  341

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTH  WNST+ESI A VP+ CWPFF +QQTNC Y    WGIGMEI+++V+
Sbjct  342  VLSHSAVGGFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEIDSDVR  401

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GKEMKRKAMEW++ A++ AT  SGSS++NLE + N+VLLSP+
Sbjct  402  RDEVERQVRELMEGERGKEMKRKAMEWQETARE-ATRPSGSSFLNLEGVINEVLLSPR  458



>ref|XP_006416205.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
 gb|ESQ34558.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
Length=483

 Score =   328 bits (842),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 193/239 (81%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLV-QDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP V++IGPL LL K  + +D ++    SNLW+ED  CLDWL+TK  NSVVYVNFGS
Sbjct  243  QSILPPVHSIGPLHLLAKQEIGEDSEIGRMGSNLWREDTNCLDWLDTKPRNSVVYVNFGS  302

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            +TVM+  QLVEFAWGLA+++K FLW+IRPD V+G+ AVVP EFL+ET++R ML+SWCPQ+
Sbjct  303  VTVMSAKQLVEFAWGLASTEKDFLWVIRPDLVAGDVAVVPTEFLKETEDRRMLSSWCPQQ  362

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH+GWNSTLESI +GVPM+CWPFFAEQQTNC +C   W +GMEI  +V
Sbjct  363  KVLSHPAIGGFLTHNGWNSTLESISSGVPMVCWPFFAEQQTNCKFCCDEWEVGMEIGGDV  422

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            KR EVE++V+ELMDGEKGK+M+ KA EW++LA+++     GSS  N + + +KVLL  K
Sbjct  423  KREEVEAVVRELMDGEKGKKMREKAEEWRRLAENATEHMRGSSGSNFQMVVDKVLLGYK  481



>ref|XP_002285767.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   328 bits (841),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 197/233 (85%), Gaps = 1/233 (0%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            M P +YTIGPL  L  + +QD+D+K   SNLWKE+  CL+WL++K+PNSVVYVNFGS+TV
Sbjct  245  MFPPIYTIGPLHKL-MSQIQDNDLKLMESNLWKEEPECLEWLDSKEPNSVVYVNFGSVTV  303

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MT  QL EFAWGL NS +TFLWIIRPD VSG+ A++PPEF+ ETKERG+LA WCPQE+VL
Sbjct  304  MTSQQLNEFAWGLVNSNQTFLWIIRPDLVSGDAAILPPEFVAETKERGLLAGWCPQEQVL  363

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HPAVGGFLTH+GWNST+ES+ AGVPMICWPFFAEQQTNC YC T WGIGMEI+++VKR+
Sbjct  364  SHPAVGGFLTHNGWNSTIESVSAGVPMICWPFFAEQQTNCRYCCTEWGIGMEIDSDVKRD  423

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            E+E LVKELM+GEKGKE+K+KA+EWK LA+++    +GSS+ NL+++  + LL
Sbjct  424  EIERLVKELMEGEKGKELKKKALEWKALAEEATRGPNGSSFSNLDKMITQALL  476



>ref|XP_002285771.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   328 bits (841),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 196/233 (84%), Gaps = 1/233 (0%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            M P +YTIGPL  L  + +QD+D+K   SNLWKE+  CL+WL++K+PNSVVYVNFGSITV
Sbjct  245  MFPPIYTIGPLHQL-MSQIQDNDLKLMESNLWKEEPECLEWLDSKEPNSVVYVNFGSITV  303

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MT  QL EFAWGL NS +TFLWIIRPD VSG+ A++PPEF+ ETKERG+LA WCPQE+VL
Sbjct  304  MTSQQLNEFAWGLVNSNQTFLWIIRPDLVSGDAAILPPEFVAETKERGLLAGWCPQEQVL  363

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HPAVGGFLTH+GWNST+ES+ AGVPMICWPFFAEQQTNC YC T WGIGMEI+++VKR+
Sbjct  364  SHPAVGGFLTHNGWNSTIESVSAGVPMICWPFFAEQQTNCRYCCTEWGIGMEIDSDVKRD  423

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            E+E LVKELM+GEKGKE+K+KA+EWK LA+++     GSS+ NL+++  + LL
Sbjct  424  EIERLVKELMEGEKGKELKKKALEWKTLAEEATRGPKGSSFSNLDKMITQALL  476



>ref|XP_008789349.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X2 [Phoenix 
dactylifera]
Length=477

 Score =   328 bits (841),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 184/234 (79%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP +YTIGPL LL + +     + +  SNLWKED  CL+WL  ++P SVVYVN+GSIT
Sbjct  246  SMLPPIYTIGPLSLLSRQITASP-LTSISSNLWKEDPACLEWLQGREPGSVVYVNYGSIT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANSK  F W+IRPD V G+ AV+P EFL ETKERG+LASWCPQE V
Sbjct  305  VMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASWCPQEAV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++G FLTHSGWNSTLESIC GVP I WPFFAEQQTNC Y  T WGIGMEI++NVKR
Sbjct  365  LSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEIDSNVKR  424

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELM+GEKGKEM+R+A+EWK+ A   AT   GSS+ N +++  + LL
Sbjct  425  EEVERLVRELMEGEKGKEMRRRAVEWKESAI-RATQPGGSSFQNFDRLVKEALL  477



>ref|XP_008789350.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X3 [Phoenix 
dactylifera]
Length=477

 Score =   328 bits (841),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 184/234 (79%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP +YTIGPL LL + +     + +  SNLWKED  CL+WL  ++P SVVYVN+GSIT
Sbjct  246  SMLPPIYTIGPLSLLSRQITASP-LTSISSNLWKEDPACLEWLQGREPGSVVYVNYGSIT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANSK  F W+IRPD V G+ AV+P EFL ETKERG+LASWCPQE V
Sbjct  305  VMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASWCPQEAV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++G FLTHSGWNSTLESIC GVP I WPFFAEQQTNC Y  T WGIGMEI++NVKR
Sbjct  365  LSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEIDSNVKR  424

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELM+GEKGKEM+R+A+EWK+ A   AT   GSS+ N +++  + LL
Sbjct  425  EEVERLVRELMEGEKGKEMRRRAVEWKESAI-RATQPGGSSFQNFDRLVKEALL  477



>ref|XP_010060016.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=480

 Score =   328 bits (841),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 191/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M P +YTIGP+ LL + L  DDD +  RSNL +ED  CL+WL++K P SVVYVNFGSI
Sbjct  243  KAMFPPIYTIGPIHLLVEQL-SDDDTRPIRSNLLEEDLGCLEWLDSKPPGSVVYVNFGSI  301

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
             VM+P QLVEFAWGLANS + FLW+IRPD + G  A++PP+FL  T+ER +LASWCPQE+
Sbjct  302  IVMSPAQLVEFAWGLANSGQVFLWVIRPDLIIGNTAILPPDFLAATRERSLLASWCPQER  361

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL H AVGGFLTH  WNST+ESI A VP+ CWPFF +QQTNC Y    WGIGMEI+++V+
Sbjct  362  VLSHSAVGGFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEIDSDVR  421

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GKEMKRKAMEW++ A++ AT  SGSS++NLE + N+VLLSP+
Sbjct  422  RDEVERQVRELMEGERGKEMKRKAMEWQETARE-ATRPSGSSFLNLEGVINEVLLSPR  478



>ref|XP_010521179.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Tarenaya hassleriana]
Length=482

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 184/236 (78%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS++P VY IGPL LL  + + +D ++    SNLWKED  CL WL+TK PN+VVYVNFGS
Sbjct  244  QSIIPPVYPIGPLHLLVNREIEKDSEIGRLGSNLWKEDTECLSWLDTKAPNTVVYVNFGS  303

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+  QL+EFAWGLA S K FLW+IRPD ++G+ AVVPPEF+ ET ERGMLASWCPQE
Sbjct  304  ITVMSEKQLLEFAWGLAGSGKAFLWVIRPDLIAGKSAVVPPEFMVETAERGMLASWCPQE  363

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPAVGGFLTH GWNSTLESI  GVPMICWPFFA+Q TNC +C   W +G EI  +V
Sbjct  364  EVLSHPAVGGFLTHCGWNSTLESISGGVPMICWPFFADQPTNCKFCCDEWAVGKEIGGDV  423

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELM+GE GK+M+ K  EW++LA  +    SGSS+ NLE + +KVLL
Sbjct  424  KREEVEAVVRELMEGEMGKKMREKVKEWRRLAVAATATPSGSSFANLETVVDKVLL  479



>ref|XP_002893224.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69483.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 189/239 (79%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQD-DDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY++GPL LL    +++  ++    SNLWKE+  CLDWL+TK  NSV+Y+NFGS
Sbjct  248  QSILPPVYSVGPLHLLANREIEEGSEIGMMSSNLWKEEMECLDWLDTKTKNSVIYINFGS  307

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITV++  QLVEFAWGLA S K FLW+IRPD V+GEEAVVPPEFL ETK+R MLASWCPQE
Sbjct  308  ITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAVVPPEFLTETKDRSMLASWCPQE  367

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH GWNS LES+ +GVPM+CWPFFA+QQ NC +C   W +G+EI  +V
Sbjct  368  KVLSHPAIGGFLTHCGWNSILESLSSGVPMVCWPFFADQQMNCKFCCDEWDVGIEIGGDV  427

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            KR EVE++V+ELMDGEKGK+M++KA+EW++LA+ +     GSS VN E + +K L+  K
Sbjct  428  KREEVETVVRELMDGEKGKKMRQKAVEWRRLARGATEHKLGSSVVNFETVISKYLVGQK  486



>ref|XP_008380053.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=486

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 188/233 (81%), Gaps = 2/233 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM+P +Y IGPLQLL    +++D +K+   +LWKE+  C+ WL+TK PNSVVYVNFGS+ 
Sbjct  252  SMIPHLYPIGPLQLLINQ-IEEDPLKSLGYSLWKEEAECIPWLDTKAPNSVVYVNFGSVV  310

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP+ LVEF WGLANSK  FLW+IRPD V GE A++PPEF+ ETKER ++A WCPQE+V
Sbjct  311  VMTPEHLVEFGWGLANSKHHFLWVIRPDLVIGESAILPPEFVAETKERCLIAGWCPQEEV  370

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ES+ AGVPM+ WPFFAEQQTNCWY     G GMEI+N+VKR
Sbjct  371  LNHPSVGGFLTHSGWNSTIESVTAGVPMLSWPFFAEQQTNCWYTCNGLGTGMEIDNDVKR  430

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            +EVE LV+ELM+GEKGK+MKRKA EWKKLA++ AT   GSS  NL+ + N VL
Sbjct  431  DEVEKLVRELMEGEKGKKMKRKANEWKKLAEE-ATGPHGSSIKNLDFVVNNVL  482



>ref|XP_008789348.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X1 [Phoenix 
dactylifera]
Length=477

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 184/234 (79%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP +YTIGPL LL + +     + +  SNLWKED  CL+WL  ++P SVVYVN+GSIT
Sbjct  246  SMLPPIYTIGPLSLLSRQITASP-LTSISSNLWKEDPACLEWLQGREPGSVVYVNYGSIT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EFAWGLANSK  F W+IRPD V G+ AV+P EFL ETKERG+LASWCPQE V
Sbjct  305  VMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASWCPQEAV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++G FLTHSGWNSTLESIC GVP I WPFFAEQQTNC Y  T WGIGMEI++NVKR
Sbjct  365  LSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEIDSNVKR  424

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELM+GEKGKEM+R+A+EWK+ A   AT   GSS+ N +++  + LL
Sbjct  425  EEVERLVRELMEGEKGKEMRRRAVEWKESAI-RATQPGGSSFQNFDRLVKEALL  477



>gb|KCW56974.1| hypothetical protein EUGRSUZ_I02647 [Eucalyptus grandis]
Length=464

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 192/234 (82%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+  ++YTIGP+ LL    ++DD+     SNLWKED  CL WL++K+PNSV+++NFGSI 
Sbjct  228  SIFLNLYTIGPIHLLLNK-IEDDNSCRIGSNLWKEDFACLGWLDSKEPNSVLFINFGSIA  286

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+T +QL+EF+WGLANS+K FLWIIRPD V+G++ V+P EFL ETK+RGMLA WCPQE+V
Sbjct  287  VVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQERV  346

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+N+V+R
Sbjct  347  LRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDNSVRR  406

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + ++VL+
Sbjct  407  EEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQVLV  459



>ref|XP_002323757.2| hypothetical protein POPTR_0017s07890g [Populus trichocarpa]
 gb|EEF03890.2| hypothetical protein POPTR_0017s07890g [Populus trichocarpa]
Length=330

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 188/234 (80%), Gaps = 3/234 (1%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            M P +YT+GPLQLL    + + ++K   SNLWK+   C++WL++K PNSVVYVNFGSITV
Sbjct  96   MFPPIYTLGPLQLLVDQ-IPNGNLKNIGSNLWKDHPECIEWLDSKGPNSVVYVNFGSITV  154

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            +T  Q++EFAWGLANS K FLWIIRPD + GE A++PPEFL  TK+R +L SWCPQE+VL
Sbjct  155  ITAQQMIEFAWGLANSNKPFLWIIRPDLIVGEAAMLPPEFLSVTKDRSLLVSWCPQEQVL  214

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HP++GGFL+H GWNSTLESIC GVPM+CWPFF EQQTNCW+  T WGIGMEI NNVKR+
Sbjct  215  KHPSIGGFLSHMGWNSTLESICGGVPMVCWPFFGEQQTNCWFACTKWGIGMEIENNVKRD  274

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            EVE LV+ELM+GEKGK+MKRKAMEWK  A+++A     +S+ NL+++  KVL S
Sbjct  275  EVEKLVRELMEGEKGKDMKRKAMEWKTKAEEAAWTGD-ASHRNLDRLV-KVLAS  326



>ref|XP_010910271.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=476

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 185/234 (79%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP +YTIGPL LL +  +    + +  SNLWKED TCL+WL  ++P SVVYVN+GSIT
Sbjct  245  SMLPPIYTIGPLSLLSRQ-ITTGPLTSISSNLWKEDTTCLEWLQGREPGSVVYVNYGSIT  303

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL+EF WGLANSK  FLW+IRPD V G+ AV+P EFL ETKERG+LA+WCPQE V
Sbjct  304  VMTNEQLIEFTWGLANSKHDFLWVIRPDLVKGDTAVLPQEFLNETKERGLLANWCPQEAV  363

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++G FLTHSGWNSTLESIC GVP+I WPFFAEQQTNC Y  T WGIGMEI+NNVKR
Sbjct  364  LSHPSIGVFLTHSGWNSTLESICGGVPVISWPFFAEQQTNCRYACTEWGIGMEIDNNVKR  423

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             +VE LV+ELM GEKGKEM+R+A+EWK+ A   AT   GSS+ N E++  + LL
Sbjct  424  GDVERLVRELMVGEKGKEMRRRAVEWKESAT-RATQPGGSSFQNFERLVKEALL  476



>ref|XP_009334337.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
 ref|XP_009334338.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 193/236 (82%), Gaps = 0/236 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y++GPL L    +  ++++K+  SNLW E+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  246  TLLPPIYSVGPLHLQLNQIPAENELKSIGSNLWTEEPECLEWLDSKEPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QL EFAWGLANS +TFLW+IRPD V GE AVVP EF EETKER ++ASWC Q++V
Sbjct  306  VMTEEQLTEFAWGLANSNQTFLWVIRPDLVGGESAVVPSEFSEETKERSLVASWCLQQEV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNSTLES+C GVPMICWP FA+QQ NC +    WGIGMEI  +VKR
Sbjct  366  LSHPAIGGFLTHSGWNSTLESVCGGVPMICWPVFADQQMNCRFSCKEWGIGMEIEGDVKR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            + +E LV++LM+GE+GKEM++KA EWKKLA ++ T+ +G S+V+L++I ++VL SP
Sbjct  426  DYIEGLVRKLMEGEEGKEMRKKAQEWKKLATEATTSPNGMSFVDLDRIASQVLQSP  481



>ref|XP_007215295.1| hypothetical protein PRUPE_ppa004989mg [Prunus persica]
 gb|EMJ16494.1| hypothetical protein PRUPE_ppa004989mg [Prunus persica]
Length=482

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 190/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
             SMLP VYTIGPLQLL   L  +D +K+   +LWKE+  CL WLNTK PNSVVYVNFGS+
Sbjct  247  SSMLPLVYTIGPLQLLVNQL-PEDPLKSVGYSLWKEETGCLQWLNTKAPNSVVYVNFGSV  305

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
             VMTP+QLVEF WGLANSK  FLW+IRPD V G+ A++P EF++ETKERG++ASWCPQE+
Sbjct  306  VVMTPEQLVEFGWGLANSKHFFLWVIRPDLVVGDSAILPAEFVDETKERGLIASWCPQEQ  365

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HP+VGGFLTHSGWNST+ES+ AGVPMICWPF +EQ TNCWY     G GMEI++NVK
Sbjct  366  VLNHPSVGGFLTHSGWNSTIESLSAGVPMICWPFVSEQLTNCWYTCNELGCGMEIDSNVK  425

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE LV+EL++GEKG++M+  A  WKKLA++ AT A GSS +NL+ + N V L  K
Sbjct  426  RDEVEKLVRELIEGEKGEKMRNTADGWKKLAEE-ATGAQGSSVINLDNLVNHVELVSK  482



>gb|KCW45698.1| hypothetical protein EUGRSUZ_L00502, partial [Eucalyptus grandis]
Length=479

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 190/231 (82%), Gaps = 2/231 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P++YTIGP+ LL    ++DD+     SNLWKED  CL WL++K+PNSV+++NFGSI 
Sbjct  251  SIFPNLYTIGPIHLLLNK-IEDDNSCRIGSNLWKEDFACLGWLDSKEPNSVLFINFGSIA  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+T +QL+EF+WGLANS+K FLWIIRPD V+G++ V+P EFL ETK+RGMLA WCPQE+V
Sbjct  310  VVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQERV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+N+V+R
Sbjct  370  LRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWGIGMEIDNSVRR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNK  174
             EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + ++
Sbjct  430  EEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQ  479



>gb|KCW66548.1| hypothetical protein EUGRSUZ_F003462, partial [Eucalyptus grandis]
Length=312

 Score =   322 bits (824),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 190/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M+P +YT+GPL +L + L  DDD K+  SN WKED  CL+WL++  P SVVYVNFGSI
Sbjct  75   KAMVPPIYTLGPLHILTEQL-PDDDTKSIGSNPWKEDLGCLEWLDSNPPVSVVYVNFGSI  133

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QL E AWGLANS + FLW+IRPD V G  A++PP+FL  T++R +L SWCPQE+
Sbjct  134  TVMSPAQLGELAWGLANSGQAFLWVIRPDLVLGNMAILPPDFLAATRQRSLLVSWCPQER  193

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTH GW ST+ESI AGVP++CWPFF EQQ NCWY    WGIG+EI+++VK
Sbjct  194  VLNHPAVGGFLTHGGWKSTIESIVAGVPVVCWPFFVEQQRNCWYSCEEWGIGLEIDDDVK  253

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GK MKRK MEW+++A+++A   SGSS  NL+++ +KVLLSP+
Sbjct  254  RDEVERQVRELMEGERGKAMKRKVMEWQEMAREAAR-PSGSSCSNLDEVIDKVLLSPR  310



>gb|KHN24338.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=456

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 195/234 (83%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL LL +  V D+D+KA  SNLWKE+  C+ WL+TK+PNSVVYVNFGSIT
Sbjct  219  SILPPVYSIGPLNLLVED-VDDEDLKAIGSNLWKEEPECMKWLDTKEPNSVVYVNFGSIT  277

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            +MT +QL+EF+WGLANS K+FLW++RPD V+GE  V+  EF++ET+ RGML+SWCPQE+V
Sbjct  278  IMTNEQLIEFSWGLANSNKSFLWVVRPDLVAGENVVLSLEFVKETENRGMLSSWCPQEQV  337

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+G FLTHSGWNSTLES+C GVPMICWPFFAEQQ NC +C   WGIG+EI  +VK 
Sbjct  338  LTHPAIGVFLTHSGWNSTLESVCGGVPMICWPFFAEQQINCRFCCKEWGIGLEI-EDVKM  396

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +++ESLV+ELMDGE GK+MK K ++WK+LA+++ +  +GSS++NL+ + + +LL
Sbjct  397  DKIESLVRELMDGENGKKMKDKVLQWKELAKNATSGPNGSSFLNLDNMVHNILL  450



>ref|XP_011004479.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=479

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 191/235 (81%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++ P VY+IGP QLL    +QDD +K+   NLWKE+  CL WL+TK+  SVVYVNFGSIT
Sbjct  243  TIFPRVYSIGPFQLLLNQ-IQDDGLKSIGYNLWKEESECLQWLDTKELQSVVYVNFGSIT  301

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +QLVEFA GLA+SK +FLWIIRPD V G+ A++P EF  ET++RG +ASWCPQE+V
Sbjct  302  VMTAEQLVEFAMGLADSKISFLWIIRPDLVIGDSAILPAEFAVETQKRGFIASWCPQEEV  361

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTHSGWNST+ES+CAGVPMICWPFFA+Q  NC Y G+ WG+GMEI N VKR
Sbjct  362  LNHPSIGGFLTHSGWNSTVESLCAGVPMICWPFFADQAINCSYAGSEWGVGMEIGNKVKR  421

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +EVE  V+ELM+GEKG++M+ KAMEWKKLA+++A A  GSS +NL++  N++L S
Sbjct  422  DEVEKRVRELMEGEKGEKMRGKAMEWKKLAEEAA-APHGSSSINLDKFINEILQS  475



>ref|XP_010030029.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 192/234 (82%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+  ++YTIGP+ LL    ++DD+     SNLWKED  CL WL++K+PNSV+++NFGSI 
Sbjct  253  SIFLNLYTIGPIHLLLNK-IEDDNSCRIGSNLWKEDFACLGWLDSKEPNSVLFINFGSIA  311

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+T +QL+EF+WGLANS+K FLWIIRPD V+G++ V+P EFL ETK+RGMLA WCPQE+V
Sbjct  312  VVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQERV  371

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+N+V+R
Sbjct  372  LRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDNSVRR  431

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + ++VL+
Sbjct  432  EEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQVLV  484



>ref|NP_001277170.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51845.1| UDP-glycosyltransferase 85A30 [Vitis vinifera]
Length=484

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +M P +YTIGPLQLL   +  D+D+K+  SNLWKE+  CL+WL+ K+P SVVYVNFGS+T
Sbjct  247  TMFPPIYTIGPLQLLLNQM-PDNDLKSIESNLWKEEPGCLEWLDAKEPESVVYVNFGSVT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP QLVEFAWGLAN+   FLWIIRPD V+G+ A++P +F+ +TKER +LASWCPQE+V
Sbjct  306  VMTPQQLVEFAWGLANANLKFLWIIRPDLVAGDAAILPADFVAQTKERSLLASWCPQERV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNST+E +C GVPMICWPFFAEQ TNC YC T WG+GMEI N+V R
Sbjct  366  LTHPAIGGFLTHSGWNSTIEGLCGGVPMICWPFFAEQMTNCRYCCTEWGVGMEIGNDVTR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +EVESLV+ LM+GEKGKEMK+KAMEWK++A+ + T  +GSSY NL+++ N+VLLS
Sbjct  426  DEVESLVRGLMEGEKGKEMKKKAMEWKRMAEAATTTPAGSSYSNLDKMINQVLLS  480



>ref|XP_008229481.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 188/232 (81%), Gaps = 2/232 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM P VY IGPLQLL    + +  +K+   +LWKE+  CL WLN+   NSVVYVNFGSIT
Sbjct  249  SMSPPVYAIGPLQLLLNQ-IPEHPLKSLGYSLWKEETECLQWLNSNTTNSVVYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP+QLVEF WGLANSK  F W+IRPD V GE A++PPEF+EETKER ++ASWCPQE+V
Sbjct  308  VMTPNQLVEFGWGLANSKLHFFWVIRPDLVIGESAILPPEFVEETKERSLIASWCPQEQV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTH+GWNST+ES+ AGVPM+CWPFFA+QQTNC Y    WGIGMEINN+VKR
Sbjct  368  LNHPSVGGFLTHNGWNSTIESLSAGVPMLCWPFFADQQTNCHYTCKEWGIGMEINNDVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKV  171
            ++VE LV+ELM+GEKGK++K KAMEWK LA++ AT+  GSS  NL+ + N++
Sbjct  428  DDVEKLVRELMEGEKGKKIKNKAMEWKTLAEE-ATSLHGSSSTNLDNLANQM  478



>ref|XP_009775754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=485

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 203/238 (85%), Gaps = 1/238 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            +++LP VY IGPL  L K    D+++K  RS+LWKE+  C+ WL+TK+PNSVVYVNFGSI
Sbjct  248  RNLLPPVYPIGPLHFLVKH-ADDENLKGLRSSLWKEEPECIQWLDTKEPNSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP+QLVEFAWGLANS++TFLWIIRPD V G+ +++PPEF+EETK RGMLASWC QE+
Sbjct  307  TVMTPNQLVEFAWGLANSQQTFLWIIRPDIVLGDASILPPEFVEETKNRGMLASWCSQEE  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTHSGWNSTLESI +G+PMICWPFFAEQQTNCW+  T W +GMEI+++VK
Sbjct  367  VLSHPAIGGFLTHSGWNSTLESISSGLPMICWPFFAEQQTNCWFSVTKWDVGMEIDSDVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVESLV+ELM GEKGK+MK+KAME K+LA+ SA   SGSSY N+E++ N +LLS K
Sbjct  427  RDEVESLVRELMVGEKGKKMKKKAMELKELAEASAIEHSGSSYENIEKVVNDILLSSK  484



>ref|XP_009145352.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X2 [Brassica 
rapa]
Length=434

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 186/235 (79%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQ-DDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            +SMLP VY+IGPL LL    V  D D+     NLW+E+  CLDWL+TK PNSVV+VNFG 
Sbjct  200  KSMLPPVYSIGPLNLLASQEVYVDSDMGQMGLNLWREETECLDWLDTKAPNSVVFVNFGC  259

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+ +QL EFAWGLA S K FLW+IRPD V+GE A VPPEF+ ET++RGM+ASWCPQE
Sbjct  260  ITVMSVEQLDEFAWGLAGSGKEFLWVIRPDLVAGEAAAVPPEFIRETEDRGMMASWCPQE  319

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH GWNSTLES+  GVPMICWPFFAEQ TNC +C   WG+GMEI  +V
Sbjct  320  KVLSHPAIGGFLTHCGWNSTLESLSGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGDV  379

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            KR EVE++++ELMDGEKGK+++ KA +W++LA+++    SGSS V+ E + NKVL
Sbjct  380  KREEVEAVIRELMDGEKGKKLREKAEKWQRLAKEATEYPSGSSNVSFETLVNKVL  434



>emb|CDO97427.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 183/235 (78%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM P +Y IGPLQLL   L QD   ++  SNLWKED  C+ WLNTK+ NSV+YVNFGSI 
Sbjct  120  SMCPPIYAIGPLQLLFNQLPQDSH-QSIGSNLWKEDAECIQWLNTKEANSVLYVNFGSIA  178

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+TP+QLVEFAWGLANS K+FLWI+RPD V G+ A++PPEF EETKERGM+  WC QE+V
Sbjct  179  VLTPEQLVEFAWGLANSNKSFLWILRPDLVVGDSAILPPEFAEETKERGMITGWCAQEQV  238

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H + GGFLTHSGWNS LES+C GVP+ICWPFFA+Q  NC Y    WGIGMEI+ NVKR
Sbjct  239  LKHSSTGGFLTHSGWNSILESLCCGVPVICWPFFADQLINCRYSCQEWGIGMEIDTNVKR  298

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            NEVE +V+EL++G+KG+EMKRKA +W KL  + AT    SSY+N  ++  +V+LS
Sbjct  299  NEVEKIVRELIEGDKGREMKRKATDW-KLKAEEATGLDSSSYLNFNRLVKEVILS  352



>dbj|BAB86928.1| glucosyltransferase-10 [Vigna angularis]
Length=485

 Score =   327 bits (837),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 191/233 (82%), Gaps = 2/233 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL  L    V D  + A  SNLW+E+  CL+WL+TK+ N+VVYVNFGS+T
Sbjct  246  SILPPVYSIGPLSFLLNN-VTDKRLNAIGSNLWREEPGCLEWLDTKEANTVVYVNFGSVT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT +Q++EFAWGLANSKK+F+W+IRPD V GE AV+P EF+ +TK RGML+ WCPQE+V
Sbjct  305  VMTNEQMIEFAWGLANSKKSFVWVIRPDLVVGERAVLPQEFVTQTKNRGMLSGWCPQEQV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            LGHPA+G FLTHSGWNSTLES+CAGVPMICWPFFAEQQTNC +C   WGIG+EI  +V+R
Sbjct  365  LGHPAIGVFLTHSGWNSTLESLCAGVPMICWPFFAEQQTNCRFCCKEWGIGVEI-EDVER  423

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            + +E LV+ +MDGEKGK+MKRKA+ WK LA+ +A+A +GSS+V  +++  +VL
Sbjct  424  DHIERLVRAMMDGEKGKDMKRKAVNWKILAEKAASAPTGSSFVQFQKLIREVL  476



>ref|XP_008245954.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=485

 Score =   327 bits (837),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 186/233 (80%), Gaps = 2/233 (1%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            MLP VY+IGPLQL     + +  +K    +LWKE+  CL+WL+TK PNSVVYVNFGSI V
Sbjct  252  MLPHVYSIGPLQL-HINEIPEHHLKMVGYSLWKEETECLEWLSTKTPNSVVYVNFGSIAV  310

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            +TP+QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETK R ++A WCPQE+VL
Sbjct  311  ITPEQLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKGRSLIAGWCPQEQVL  370

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HP+VGGFLTHSGWNST+ESI AGVPM+CWPFFA+QQ +C Y    WGIGMEI+N+VKR+
Sbjct  371  NHPSVGGFLTHSGWNSTVESITAGVPMLCWPFFADQQMDCRYTCNEWGIGMEISNDVKRD  430

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  431  EVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  482



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 190/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +M P +YT+GPLQLL      + ++K   SNLWKE+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  239  AMFPPIYTLGPLQLLVDQF-PNGNLKNIGSNLWKEEPECLEWLDSKEPNSVVYVNFGSIT  297

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+TP Q++EFAWGLANS   FLWIIRPD V GE +++P EF+ ETK+RGMLA+WCPQE V
Sbjct  298  VITPQQMMEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWCPQELV  357

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFL+H+GWNST++SICAGVP+ICWPFFA+QQTNC +  T WGIGM+I+NNVKR
Sbjct  358  LKHPSIGGFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQIDNNVKR  417

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPKC  153
            +EVE LV+ELM GEKGK+MKRKAMEWK  A++  T   GSS+ NLE +   +     C
Sbjct  418  DEVEKLVRELMKGEKGKDMKRKAMEWKTKAEE-VTRPGGSSFENLEALVKVLACKQTC  474



>sp|F8WLS6.1|UGT6_CATRO RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Iridoid 1-O-glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 6; Short=CrUGT6; AltName: Full=UDP-glycosyltransferase 
85A23 [Catharanthus roseus]
 dbj|BAK55749.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=487

 Score =   327 bits (837),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 199/235 (85%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y IGPLQ+L+   V D+ +K   SNLWKE+  CL+WL+TKDPNSVVYVNFGSIT
Sbjct  251  TLLPPIYPIGPLQILQNQ-VDDESLKVLGSNLWKEEPECLEWLDTKDPNSVVYVNFGSIT  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT DQL+EFAWGLANSK+ FLWIIRPD +SGE +++  EF+EETKERG++ASWC QE+V
Sbjct  310  VMTNDQLIEFAWGLANSKQNFLWIIRPDLISGESSILGEEFVEETKERGLIASWCHQEQV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            + HPA+GGFLTH+GWNST+ESI +GVPMICWPFFAEQQTNC +C   WGIGMEIN++VKR
Sbjct  370  INHPAIGGFLTHNGWNSTIESISSGVPMICWPFFAEQQTNCRFCCNKWGIGMEINSDVKR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +EVESLVKELM GEKGKEMK+KA+EWK +A+ + T   GSSY NLE++  KVL S
Sbjct  430  DEVESLVKELMVGEKGKEMKKKALEWKNIAEVTTTKPDGSSYSNLEKLI-KVLKS  483



>gb|KFK44329.1| hypothetical protein AALP_AA1G244100 [Arabis alpina]
Length=483

 Score =   327 bits (837),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 188/236 (80%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLE-KTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY+IGPL LLE + + +D D+    SNLW+E+  CLDWL+TK  NSVVY+NFGS
Sbjct  247  QSILPPVYSIGPLHLLENRHIDKDSDMGRMGSNLWREETECLDWLDTKSRNSVVYINFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            +TVM+   LVEFAWGLA S K FLW+IRPD V GE+A+VP +FL+ET  R MLASWCPQE
Sbjct  307  LTVMSVKHLVEFAWGLAGSGKDFLWVIRPDLVVGEDAMVPSDFLKETAGRRMLASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL H A+GGFLTHSGWNSTLES+ +GVPM+CWPFFAEQQTNC +C   W +GMEI  +V
Sbjct  367  KVLSHQAIGGFLTHSGWNSTLESLSSGVPMVCWPFFAEQQTNCKFCCDEWEVGMEIGGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++++ELMDGEKGK+M+ KA EW++LA+++     GSS VN E + NKVLL
Sbjct  427  KREEVETVIRELMDGEKGKKMREKAEEWRRLAEEAVEHKLGSSNVNFETLVNKVLL  482



>ref|XP_007224375.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
 gb|EMJ25574.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
Length=487

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 194/238 (82%), Gaps = 1/238 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            ++LP +Y IGPL L    +  D+++K+  SNLW E+  CL WL++K+PNSVVYVNFGS T
Sbjct  249  TLLPPIYCIGPLYLQLDHIPADNELKSIGSNLWTEETECLQWLDSKEPNSVVYVNFGSST  308

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAV-SGEEAVVPPEFLEETKERGMLASWCPQEK  510
            VMT +QL EFAWGLANS K F W+IRPD V  G+  VV PEF+EETKERG+LASWCPQE+
Sbjct  309  VMTSEQLTEFAWGLANSNKAFFWVIRPDLVCEGKSVVVAPEFVEETKERGLLASWCPQEQ  368

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTH GWNST+ES+  GVPMICWPF A+QQTNC +C + WGIG+EI  +VK
Sbjct  369  VLIHPAIGGFLTHCGWNSTIESVGGGVPMICWPFNADQQTNCRFCCSEWGIGLEIEGDVK  428

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R  +E LV+ELM+G +GK++++KA+EWKKLA+++ T ++GSS+++L+Q+ NKVLLSP+
Sbjct  429  RYYIEGLVRELMEGGEGKKLRKKALEWKKLAKEATTGSNGSSFLDLDQMVNKVLLSPR  486



>ref|XP_012068368.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Jatropha 
curcas]
Length=493

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 193/231 (84%), Gaps = 2/231 (1%)
 Frame = -3

Query  851  VYTIGPLQLLEKTL--VQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMT  678
            +YTIGPLQ  +     V+++ +   +SNLWKE   CL+WL++K P SV+YVNFGS+TVM+
Sbjct  259  IYTIGPLQQFQDDQDQVKENYLNRIKSNLWKEQPGCLEWLDSKKPESVIYVNFGSVTVMS  318

Query  677  PDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGH  498
            P+QL+EFAWGLANSKK FLW+IRPD V+G+ A++P EFL+ETKERG+LASW  QE+VL H
Sbjct  319  PEQLIEFAWGLANSKKPFLWVIRPDLVNGDSAIIPVEFLQETKERGLLASWSSQEEVLRH  378

Query  497  PAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEV  318
            P++GGFLTH+GWNSTLES+C GVP+ICWPFFAEQQTNCW+C   W IG+EI  +VKRNE+
Sbjct  379  PSIGGFLTHNGWNSTLESLCGGVPLICWPFFAEQQTNCWFCCNKWKIGIEIEKDVKRNEI  438

Query  317  ESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            E LV+EL+DG++GKE+K+K MEWK  A+++  +A+GSSY NL+++ N+VLL
Sbjct  439  ERLVQELIDGKQGKELKKKVMEWKLKAEEATASANGSSYANLDRVINEVLL  489



>gb|KDP41398.1| hypothetical protein JCGZ_15805 [Jatropha curcas]
Length=493

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 193/231 (84%), Gaps = 2/231 (1%)
 Frame = -3

Query  851  VYTIGPLQLLEKTL--VQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMT  678
            +YTIGPLQ  +     V+++ +   +SNLWKE   CL+WL++K P SV+YVNFGS+TVM+
Sbjct  259  IYTIGPLQQFQDDQDQVKENYLNRIKSNLWKEQPGCLEWLDSKKPESVIYVNFGSVTVMS  318

Query  677  PDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGH  498
            P+QL+EFAWGLANSKK FLW+IRPD V+G+ A++P EFL+ETKERG+LASW  QE+VL H
Sbjct  319  PEQLIEFAWGLANSKKPFLWVIRPDLVNGDSAIIPVEFLQETKERGLLASWSSQEEVLRH  378

Query  497  PAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEV  318
            P++GGFLTH+GWNSTLES+C GVP+ICWPFFAEQQTNCW+C   W IG+EI  +VKRNE+
Sbjct  379  PSIGGFLTHNGWNSTLESLCGGVPLICWPFFAEQQTNCWFCCNKWKIGIEIEKDVKRNEI  438

Query  317  ESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            E LV+EL+DG++GKE+K+K MEWK  A+++  +A+GSSY NL+++ N+VLL
Sbjct  439  ERLVQELIDGKQGKELKKKVMEWKLKAEEATASANGSSYANLDRVINEVLL  489



>ref|XP_009349616.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=486

 Score =   326 bits (836),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 187/236 (79%), Gaps = 2/236 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
             SMLP VY IGPLQLL    + +  +K    +LWKE+  CL WLN K PNSV+YVNFGS+
Sbjct  246  SSMLPLVYAIGPLQLLLNQ-IPEHPLKPVGYSLWKEETECLQWLNAKAPNSVIYVNFGSL  304

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
             VMTP+ ++EF WGLANSK  FLWIIRPD V+GE A++PP+F+ +TKERGM+ SWCPQEK
Sbjct  305  AVMTPEHVIEFGWGLANSKHPFLWIIRPDLVAGETAILPPDFVADTKERGMIVSWCPQEK  364

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HP+VGGFLTHSGWNST+ES+ AGVPM+CWP F +QQTNC++    WG GMEIN+ VK
Sbjct  365  VLNHPSVGGFLTHSGWNSTIESLSAGVPMLCWPLFGDQQTNCYFTCNEWGSGMEINSKVK  424

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            R+EVE LV+ELM+GEKGK+MK KA+EWKKLA++ AT   GSS  NL+ +  +VLL+
Sbjct  425  RDEVEKLVRELMEGEKGKKMKNKAIEWKKLAEE-ATGPHGSSSKNLDNLVKQVLLN  479



>gb|KFK44334.1| hypothetical protein AALP_AA1G244600 [Arabis alpina]
Length=482

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 184/236 (78%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QSMLP VY+IGPL L   + + +  D+    SNLW+E+  CLDWL+TK  NSV+YVNFGS
Sbjct  246  QSMLPPVYSIGPLHLFANREIAEGSDIGQMGSNLWREETKCLDWLDTKSRNSVLYVNFGS  305

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            + VMT  QLVEFAWGLA S K FLW+IRPD V+G+EA VPPEFL+ET  R MLASWCPQE
Sbjct  306  LIVMTTKQLVEFAWGLAGSGKEFLWVIRPDLVAGDEAKVPPEFLKETTGRRMLASWCPQE  365

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTHSGWNSTLES+ +GVPM+CWPFFAEQQTNC +    WG+GM+I  +V
Sbjct  366  KVLSHPAIGGFLTHSGWNSTLESLSSGVPMVCWPFFAEQQTNCKFTCDEWGVGMKIGGDV  425

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELMDGE+G+ M+ KA EW++LA+++     GSS VN E    K+LL
Sbjct  426  KREEVEAVVRELMDGERGRRMREKAEEWQRLAEEATYHKRGSSVVNFETFVTKLLL  481



>ref|XP_008229475.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X1 [Prunus 
mume]
Length=485

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 187/234 (80%), Gaps = 3/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VYT+GPLQL     + +  +K   S LWKE+  CL+WLNT+ PNSVVYVNFGSI 
Sbjct  252  SMLPHVYTVGPLQL-HLNQIPEHPLKMGYS-LWKEETECLEWLNTEAPNSVVYVNFGSIA  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP+QLVEF WGLAN+K  F W+IRPD V GE A++PPEF+ ETKER ++A WCPQE+V
Sbjct  310  VMTPEQLVEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWCPQEQV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+N+VKR
Sbjct  370  LNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDVKR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  430  DEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  482



>ref|XP_009110142.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Brassica rapa]
Length=480

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 186/236 (79%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            Q + P VY+IGPL L+  + + +D ++    SNLW+ED  C+DWL+TK PNSVVYVNFGS
Sbjct  242  QYITPPVYSIGPLHLIVNRDIDKDSEIGRMGSNLWREDTKCVDWLDTKAPNSVVYVNFGS  301

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+   LVEFAWGLA + K FLW+IRPD V G+ AVVPPEFL ET +R M+A+WCPQE
Sbjct  302  ITVMSAKHLVEFAWGLAATGKDFLWVIRPDLVDGKLAVVPPEFLTETADRRMIATWCPQE  361

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTHSGWNSTLES+C GVPM+CWPFFAEQQTNC +C   W +GMEI  +V
Sbjct  362  KVLSHPAIGGFLTHSGWNSTLESLCCGVPMVCWPFFAEQQTNCKFCRDEWEVGMEIGGDV  421

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EV+++V+ELMDGEKGK+M+ KA +W+ LA+++     GSS +N E + +KVLL
Sbjct  422  KREEVDAVVRELMDGEKGKKMREKAEKWRLLAEEATEPKRGSSELNFETVVDKVLL  477



>ref|XP_008455233.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]
Length=494

 Score =   326 bits (836),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 185/235 (79%), Gaps = 1/235 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S LP +Y IGP+  L   L++DD VK  RSNLW E   C+ WL+++ PNSVVYVNFGSIT
Sbjct  251  SKLPPIYPIGPINSLVTELIKDDKVKGIRSNLWDEQSECMKWLDSQQPNSVVYVNFGSIT  310

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VM+P  LVEFAWGLANS+K FLWI+RPD V GE A++P EF+ ETKERGML  WC QE+V
Sbjct  311  VMSPQHLVEFAWGLANSEKPFLWIVRPDLVEGETALLPAEFVAETKERGMLGDWCNQEEV  370

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ESI  GV MI WPFFAEQQTNC YC T WG G+EI++NV+R
Sbjct  371  LKHPSVGGFLTHSGWNSTMESIAGGVAMISWPFFAEQQTNCRYCKTEWGNGLEIDSNVRR  430

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
             +VE LV+ELM+GEKG++MKR A EWK+ A++ A    GSS  NL+Q+ +++LLS
Sbjct  431  EDVEKLVRELMEGEKGEDMKRNAKEWKRKAEE-ACKIGGSSLTNLDQVISEILLS  484



>ref|XP_002268162.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=480

 Score =   326 bits (835),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 191/233 (82%), Gaps = 2/233 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S  PS+YTIGPL LL  ++     + +FR +LW +D TCL+WL+ ++PNSV+YVN+GS+T
Sbjct  246  SKFPSIYTIGPLSLL-TSVAPKSQLTSFRPSLWVDDTTCLEWLDQREPNSVIYVNYGSVT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VM+   L EFAWGLANS+ +FLWIIRPD V G+ AV+P EF EETK+RG+LASWCPQE+V
Sbjct  305  VMSDQHLKEFAWGLANSQYSFLWIIRPDVVMGDSAVLPEEFREETKDRGLLASWCPQEQV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+V  FLTHSGWNSTLE++CAGVP+ICWPFFAEQQTNC Y  T WGIGME+N++VKR
Sbjct  365  LSHPSVAVFLTHSGWNSTLETVCAGVPVICWPFFAEQQTNCRYACTEWGIGMEVNHDVKR  424

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            +++E+LVKE+M+GEKGK+MK+ AMEWKK A++ AT   GSSY N +++  +VL
Sbjct  425  HDIEALVKEMMEGEKGKQMKKTAMEWKKKAEE-ATGVGGSSYNNFDRLVKEVL  476



>ref|XP_008229793.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=493

 Score =   326 bits (836),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 186/234 (79%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM P VY IGPLQLL   L +D  +     +LWKE+  CL WLN+K PNSVVYVNFGS+ 
Sbjct  260  SMPPPVYAIGPLQLLLNHLPKDP-LNPMGYSLWKEETECLQWLNSKAPNSVVYVNFGSLV  318

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VM P QLVEF WGLANSK  FLW+IRPD + GE A++PPEF  ETK+RG++ASWCPQE+V
Sbjct  319  VMAPQQLVEFGWGLANSKVPFLWVIRPDLIVGESAILPPEFEFETKDRGLIASWCPQEQV  378

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ES+ AGVPM+CWP FAEQ TNC+Y    WG G+EI+NNVKR
Sbjct  379  LNHPSVGGFLTHSGWNSTIESLTAGVPMLCWPVFAEQHTNCYYTCNEWGSGLEIDNNVKR  438

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +EVE LV+EL +GEKGK+MK KAMEW+KLA++ AT   GSS +N++ + N+VLL
Sbjct  439  DEVEKLVRELTEGEKGKKMKIKAMEWRKLAEE-ATGPHGSSSINMDNLVNQVLL  491



>ref|XP_008229476.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X2 [Prunus 
mume]
Length=485

 Score =   326 bits (835),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 187/234 (80%), Gaps = 3/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VYT+GPLQL     + +  +K   S LWKE+  CL+WLNT+ PNSVVYVNFGSI 
Sbjct  252  SMLPHVYTVGPLQL-HLNQIPEHPLKMGYS-LWKEETECLEWLNTEAPNSVVYVNFGSIA  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP+QLVEF WGLAN+K  F W+IRPD V GE A++PPEF+ ETKER ++A WCPQE+V
Sbjct  310  VMTPEQLVEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWCPQEQV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+N+VKR
Sbjct  370  LNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDVKR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  430  DEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  482



>ref|XP_011045674.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=503

 Score =   326 bits (836),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 190/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +M P +YT+GPLQLL      + ++K   SNLWKE+  CL+WL++K+PNSVVYVNFGSIT
Sbjct  268  AMFPPIYTLGPLQLLVDQF-PNGNLKNIGSNLWKEEPECLEWLDSKEPNSVVYVNFGSIT  326

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+TP Q++EFAWGLANS   FLWIIRPD V GE +++P EF+ ETK+RGMLA+WCPQE V
Sbjct  327  VITPQQMMEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWCPQELV  386

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFL+H+GWNST++SICAGVP+ICWPFFA+QQTNC +  T WGIGM+I+NNVKR
Sbjct  387  LKHPSIGGFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQIDNNVKR  446

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPKC  153
            +EVE LV+ELM GEKGK+MKRKAMEWK  A++  T   GSS+ NLE +   +     C
Sbjct  447  DEVEKLVRELMKGEKGKDMKRKAMEWKTKAEE-VTRPGGSSFENLEALVKVLACKQTC  503



>ref|NP_173655.2| UDP-glucosyl transferase 85A3 [Arabidopsis thaliana]
 sp|Q9LMF1.2|U85A3_ARATH RecName: Full=UDP-glycosyltransferase 85A3 [Arabidopsis thaliana]
 gb|AEE30236.1| UDP-glucosyl transferase 85A3 [Arabidopsis thaliana]
 gb|AHL38931.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=488

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 185/236 (78%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY IGPL LL  + + +D ++    SNLWKE+  CL WLNTK  NSVVYVNFGS
Sbjct  247  QSILPPVYPIGPLHLLVNREIEEDSEIGRMGSNLWKEETECLGWLNTKSRNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            IT+MT  QL+EFAWGLA + K FLW++RPD+V+GEEAV+P EFL ET +R ML SWCPQE
Sbjct  307  ITIMTTAQLLEFAWGLAATGKEFLWVMRPDSVAGEEAVIPKEFLAETADRRMLTSWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPAVGGFLTH GWNSTLES+  GVPM+CWPFFAEQQTNC +    W +G+EI  +V
Sbjct  367  KVLSHPAVGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFSCDEWEVGIEIGGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELMDGEKGK+M+ KA+EW++LA+ +     GSS +N E I NKVLL
Sbjct  427  KRGEVEAVVRELMDGEKGKKMREKAVEWRRLAEKATKLPCGSSVINFETIVNKVLL  482



>ref|XP_008779905.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 185/234 (79%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP +YTIGPL LL + +          SNLWKED  CL+WL  ++P SVVYVN+GSIT
Sbjct  246  SILPPIYTIGPLSLLSRQITTSPTTSI-SSNLWKEDPACLEWLQGREPGSVVYVNYGSIT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            +MT +QL+EFAWGLANSK  FLW+IRPD V G+  V+P EFL ETKERG+LASWCPQE V
Sbjct  305  MMTNEQLIEFAWGLANSKHDFLWVIRPDLVKGDSTVLPQEFLSETKERGLLASWCPQEAV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTHSGWNSTLESIC+GVP I WPFFAEQQTNC Y  T WGIGMEI++NVKR
Sbjct  365  LSHPSIGGFLTHSGWNSTLESICSGVPTISWPFFAEQQTNCRYACTEWGIGMEIDSNVKR  424

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELM+GEKGKEM+R+A+EWK  A  SAT   GSS+ N +++ N+ LL
Sbjct  425  EEVERLVRELMEGEKGKEMRRRAVEWKGSAI-SATQPGGSSFQNFDRLVNEALL  477



>ref|XP_009145349.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
 ref|XP_009145350.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
Length=482

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 186/235 (79%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQ-DDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            +SMLP VY+IGPL LL    V  D D+     NLW+E+  CLDWL+TK PNSVV+VNFG 
Sbjct  248  KSMLPPVYSIGPLNLLASQEVYVDSDMGQMGLNLWREETECLDWLDTKAPNSVVFVNFGC  307

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+ +QL EFAWGLA S K FLW+IRPD V+GE A VPPEF+ ET++RGM+ASWCPQE
Sbjct  308  ITVMSVEQLDEFAWGLAGSGKEFLWVIRPDLVAGEAAAVPPEFIRETEDRGMMASWCPQE  367

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH GWNSTLES+  GVPMICWPFFAEQ TNC +C   WG+GMEI  +V
Sbjct  368  KVLSHPAIGGFLTHCGWNSTLESLSGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGDV  427

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            KR EVE++++ELMDGEKGK+++ KA +W++LA+++    SGSS V+ E + NKVL
Sbjct  428  KREEVEAVIRELMDGEKGKKLREKAEKWQRLAKEATEYPSGSSNVSFETLVNKVL  482



>ref|XP_010030028.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 188/233 (81%), Gaps = 2/233 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P +YTIGPLQLL    +QD+ ++    NLW+E+  CL WL++K+P SVVYVNFGSIT
Sbjct  249  SVFPHIYTIGPLQLLADQ-IQDEALRLVGGNLWREEPECLSWLDSKEPGSVVYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+T  QL EFAWGLANS+K FLWIIRPD V+ E AV+PPEF+EE   RGMLA WC QE+V
Sbjct  308  VITAGQLTEFAWGLANSQKPFLWIIRPDLVATESAVLPPEFVEEIAGRGMLAHWCRQEEV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H A+GGFLTHSGWNSTLES+C GVP+ICWPFF +QQTNC Y  T WGIGMEI+N+VKR
Sbjct  368  LKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFGDQQTNCRYSCTEWGIGMEIDNDVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            +EVE LV+ELM+GEKGKEM++KAMEWK  A++ A    G+SY N+E++ ++VL
Sbjct  428  DEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMPGGTSYNNVEKLISEVL  479



>gb|KCW45705.1| hypothetical protein EUGRSUZ_L00511 [Eucalyptus grandis]
Length=462

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 190/234 (81%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+  ++YTIGP+ LL   + +DD+     SNLWKED  CL WL++K+PNSV+++NFGSI 
Sbjct  226  SIFLNLYTIGPIHLLLNKM-EDDNWCRIGSNLWKEDFACLGWLDSKEPNSVLFINFGSIA  284

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+T +QL+EF+WGLANS+K FLWIIRPD V+G+  V+P EFL ETK+RGMLA WCPQE+V
Sbjct  285  VVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGMLAGWCPQERV  344

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+N+V+R
Sbjct  345  LRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDNSVRR  404

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + + VL+
Sbjct  405  EEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSHVLV  457



>ref|XP_008229788.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=485

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 186/234 (79%), Gaps = 3/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VYT+GPLQL     + +  +K   S LWKE+  CL+WLNT+ PNSVVYVNFGSI 
Sbjct  252  SMLPHVYTVGPLQL-HLNQIPEHPLKMGYS-LWKEETECLEWLNTRAPNSVVYVNFGSIA  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            ++TP QLVEF WGLANSK  F W+IRPD V GE A++PPEF+ ET+ER ++A WCPQE+V
Sbjct  310  IVTPQQLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETRERSLIAGWCPQEQV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ESI AGVPM+CWPFF +QQ +C Y    WGIGMEI+N+VKR
Sbjct  370  LNHPSVGGFLTHSGWNSTVESITAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDVKR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  430  DEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  482



>ref|XP_010676160.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=483

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 191/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTL-VQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            S  P  Y +GPL LL +++   +++ K+  ++LWKED  CL+WL++ +PNSVVYVNFGSI
Sbjct  247  SNFPPTYALGPLHLLLESMEAINEETKSISTSLWKEDPHCLEWLDSYEPNSVVYVNFGSI  306

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMT DQL+EFAWGLANS + FLWI RPD V G+ AV+PP+FLEETK RG++ SWC QE 
Sbjct  307  TVMTNDQLIEFAWGLANSNQPFLWIARPDLVIGDSAVLPPDFLEETKNRGLITSWCDQEH  366

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPA+GGFLTH GWNST+E++  GVP++CWPFFAEQQTNCWY  T WGIGMEI+ NVK
Sbjct  367  VLAHPAIGGFLTHCGWNSTIETLINGVPIVCWPFFAEQQTNCWYSCTKWGIGMEIDANVK  426

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GKEMKR AM+WKKLA ++   ++GSSY NL+++  K+L S K
Sbjct  427  RSEVERQVRELMEGEQGKEMKRNAMKWKKLAYEATAVSTGSSYNNLDEVI-KILGSIK  483



>ref|XP_003526577.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
 gb|KHN08945.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 185/235 (79%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VY IGPL LL    V D+D+K   SNLWKED+ CL WL+T +P SV+YVNFGSIT
Sbjct  248  SMLPPVYPIGPLTLLLNH-VTDEDLKTIGSNLWKEDRECLKWLDTNEPKSVIYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT  QL+EFAWGLANS KTFLW+IRPD V  E  ++P EF+ ETK+RG L+ WCPQE+V
Sbjct  307  VMTNHQLIEFAWGLANSGKTFLWVIRPDLVD-ENTILPYEFVLETKDRGQLSGWCPQEEV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNST+ES+C GVPMICWPFFAEQ TNC +C   WG+GM+I  +V R
Sbjct  366  LAHPAIGGFLTHSGWNSTIESLCNGVPMICWPFFAEQPTNCRFCCKEWGVGMQIEGDVTR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            + VE LV+ELM+G+KGKE+  KA+EWKKLA+D+     GSS++N + +  +VLLS
Sbjct  426  DRVERLVRELMEGQKGKELTMKALEWKKLAEDATILKEGSSFLNYDNMVRQVLLS  480



>emb|CDP01073.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 196/235 (83%), Gaps = 1/235 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP+VYT+GPL L+E  L  D+++K+  SNLWKE+  C++WL++K+PNSVVYVNFGS+T
Sbjct  248  SILPAVYTLGPLHLIEDQL-PDNELKSLGSNLWKEELGCIEWLDSKEPNSVVYVNFGSVT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP QLVEFAWGLA S +TFLWIIRPD V GE A++PPEF+ +TKERG+LASWCPQ  V
Sbjct  307  VMTPQQLVEFAWGLAKSGRTFLWIIRPDLVIGETAILPPEFVLDTKERGLLASWCPQVDV  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP++GGFLTH GWNSTLESICAGV M+CWPFFAEQQTNCWYC  H G  MEI+NNVK 
Sbjct  367  LKHPSIGGFLTHCGWNSTLESICAGVAMVCWPFFAEQQTNCWYCCNHLGTAMEIDNNVKS  426

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +EVE LV ELM G++G+EMK+KA E KKLA+++ TA SGSS  NLE + + VL+S
Sbjct  427  DEVEKLVNELMFGDRGQEMKKKAAELKKLAEEAITAPSGSSIKNLESLVHNVLIS  481



>ref|XP_010676253.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=497

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -3

Query  848  YTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVMTPDQ  669
            YTIGP+QL  K +  D  VK+  SNLWKED  C +WL++K P SVVYV+FGSIT MT + 
Sbjct  259  YTIGPMQLQLKNVSDDAGVKSLGSNLWKEDSECFNWLDSKKPKSVVYVSFGSITTMTNEN  318

Query  668  LVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLGHPAV  489
            L+EFAWGLANSK  FLWI+RPD VSG+ AV+PPEFL ETK+RG++ SWC QE VL H ++
Sbjct  319  LIEFAWGLANSKHPFLWILRPDIVSGDSAVIPPEFLAETKDRGLITSWCDQETVLDHASI  378

Query  488  GGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNEVESL  309
            G FLTH GWNS L++IC+GVP+ICWPFFAEQQTNCW+    WGIGMEI+NNV+R+EVE  
Sbjct  379  GAFLTHCGWNSILDTICSGVPVICWPFFAEQQTNCWFISEKWGIGMEIDNNVRRSEVEKQ  438

Query  308  VKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            V+ELM+ EKG EM RKAMEWKKLA+++A   SGSS  N + + N+V+L  K
Sbjct  439  VRELMEEEKGGEMTRKAMEWKKLAEEAAATPSGSSCSNFDNLVNQVILPLK  489



>ref|XP_002525851.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36545.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 187/228 (82%), Gaps = 1/228 (0%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            +M P +Y+IGPLQLL   +  D ++    SNLWKE   C+DWL+TK+PNSVVYVNFGSIT
Sbjct  247  TMFPPIYSIGPLQLLVDQIPIDRNLGNIGSNLWKEQPECIDWLDTKEPNSVVYVNFGSIT  306

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+TP Q++EFAWGLA+SKK FLWIIRPD V GE A++P EF+ ETK+RGMLASW PQE++
Sbjct  307  VITPQQMIEFAWGLASSKKPFLWIIRPDLVIGENAMLPAEFVSETKDRGMLASWGPQEQI  366

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPAVGGFL+H GWNSTL+S+  GVPM+CWPFFAEQQTNC +  T WG+GMEI+NNVKR
Sbjct  367  LKHPAVGGFLSHMGWNSTLDSMSGGVPMVCWPFFAEQQTNCRFACTEWGVGMEIDNNVKR  426

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQI  183
            +EV+ LV+ LMDG+KGKEMK KAMEWK  A+++A    GSS+ NL+++
Sbjct  427  DEVKKLVEVLMDGKKGKEMKSKAMEWKTKAEEAAKPG-GSSHNNLDRL  473



>gb|KFK44619.1| hypothetical protein AALP_AA1G282400 [Arabis alpina]
Length=359

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 182/239 (76%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY+IGPL LL  + + +D  +    SNLWKE+  CLDWL+TK  NSVVYVNFGS
Sbjct  119  QSILPPVYSIGPLHLLANREIAEDSKIGKMGSNLWKEETECLDWLDTKPRNSVVYVNFGS  178

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
             TV+T  QLVEFAWGLA   K FLW+IRPD ++GEEA+VPPEFL ET  R MLASWCPQE
Sbjct  179  TTVVTAKQLVEFAWGLAGCGKEFLWVIRPDLIAGEEAIVPPEFLVETANRRMLASWCPQE  238

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGF+THSGWNSTLES+ +GVPMICWPFFAEQQTNC +    W +GMEI  +V
Sbjct  239  KVLSHPAMGGFITHSGWNSTLESLSSGVPMICWPFFAEQQTNCKFTCDEWEVGMEIGGDV  298

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            KR EVE++V+ELM G KGK+M+ KA EW +LA+++     GSS VN E   NK LL  +
Sbjct  299  KREEVEAVVRELMGGNKGKKMREKAEEWCRLAEEATKHKVGSSVVNFETFVNKALLGQR  357



>ref|XP_002323978.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
 gb|EEF04111.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
Length=482

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 186/233 (80%), Gaps = 2/233 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM P +Y++GPL LL     Q+D + +  S+LWKE+  CL WL++KDPNSVVYVNFGSIT
Sbjct  247  SMFPPIYSVGPLNLLLDQ-TQNDYLASIGSSLWKEETECLQWLDSKDPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VM P QL+EF+WGLANSKK FLWIIRPD V GE AV+PPEFLEET+ERG++ASWC QEKV
Sbjct  306  VMNPQQLLEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMASWCAQEKV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H ++GGFL+H GWNST+ES+  GVPM+CWPFF+EQQTNC +    WG+GMEI ++  R
Sbjct  366  LKHSSIGGFLSHMGWNSTIESMSNGVPMLCWPFFSEQQTNCKFACVDWGVGMEIESDANR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            +EVE LV EL+DGEKGKEMKRKAMEWK  A+ + T  +GSS +N +++ N VL
Sbjct  426  DEVEKLVIELIDGEKGKEMKRKAMEWKSKAE-ATTGINGSSSMNFDKLVNDVL  477



>emb|CDY41486.1| BnaA08g20880D [Brassica napus]
Length=480

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 186/237 (78%), Gaps = 1/237 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            Q + P VY+IGPL L+  + + +D ++    SNLW+ED  C+DWL+TK PNSVVYVNFGS
Sbjct  242  QYITPPVYSIGPLHLVVNRDIDKDSEIGRMGSNLWREDTKCVDWLDTKAPNSVVYVNFGS  301

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+   LVEFAWGLA + K FLW+IRPD V G+ AVVPPEFL ET +R M+A+WCPQE
Sbjct  302  ITVMSAKHLVEFAWGLAATGKDFLWVIRPDLVDGKLAVVPPEFLTETADRRMIATWCPQE  361

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTHSGWNSTLES+C GVPM+CWPFFAEQQTNC +C   W +GMEI  +V
Sbjct  362  KVLSHPAIGGFLTHSGWNSTLESLCCGVPMVCWPFFAEQQTNCKFCRDEWEVGMEIGGDV  421

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            KR EV+++V+ELMDGEKG +M+ KA +W+ LA+++     GSS +N E + +KVLL+
Sbjct  422  KREEVDAVVRELMDGEKGNKMREKAEKWRLLAEEATEPKRGSSELNFETVVDKVLLA  478



>gb|KFK44331.1| hypothetical protein AALP_AA1G244300 [Arabis alpina]
Length=483

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 184/236 (78%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY+IGPL LL  + + +  ++     NLWKE+  CLDWL+TK  NSV+Y++FG 
Sbjct  247  QSILPPVYSIGPLHLLANQDIDEGSEIARMGLNLWKEETECLDWLDTKSRNSVMYISFGC  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            I VM+  QLVEFAWGLA S K FLW+IRPD V+G+ AV+PPEFL ET++R MLASWCPQE
Sbjct  307  IAVMSAKQLVEFAWGLAASGKDFLWVIRPDLVAGDAAVIPPEFLAETEDRRMLASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH GWNSTLES+C GVPMICWPFFAEQ TNC +C   WG+GMEI  NV
Sbjct  367  KVLSHPAIGGFLTHCGWNSTLESLCGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGNV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR E+E++V+ELMDGEKGK+M+ KA EW+ LA+++     GSS VN   + NKVLL
Sbjct  427  KREELETVVRELMDGEKGKKMREKAEEWRHLAEEATKDKLGSSVVNFNTLVNKVLL  482



>ref|XP_008373152.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
 ref|XP_008373153.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=478

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 186/234 (79%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+ P VY+IGPLQLL      D  +K    ++WKE+  CL+WLNTK  NSVVYVNFGS+ 
Sbjct  244  SIPPPVYSIGPLQLLLNQFALDP-LKPMGYSMWKEETECLEWLNTKARNSVVYVNFGSLI  302

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
             +TP QL+EF WGLANSK  FLW IRPD V GE A+ PPEF  ETKERG+LASWCPQE+V
Sbjct  303  SLTPQQLLEFGWGLANSKLPFLWAIRPDLVIGESAIFPPEFEFETKERGLLASWCPQEQV  362

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFFA+Q TNC+Y    WGIGMEI+N+VKR
Sbjct  363  LNHPSVGGFLTHSGWNSTIESLSAGVPMLCWPFFADQTTNCYYTCNEWGIGMEIDNDVKR  422

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +EVE LV+ELM+GEKGK+MK K MEWKKLA++ AT+  GSS  NL+ + N+VLL
Sbjct  423  DEVEKLVRELMEGEKGKKMKNKVMEWKKLAEE-ATSPQGSSTRNLDNLVNQVLL  475



>ref|XP_010039829.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 190/234 (81%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+  ++YTIGP+ LL   + +DD+     SNLWKED  CL WL++K+PNSV+++NFGSI 
Sbjct  251  SIFLNLYTIGPIHLLLNKM-EDDNWCRIGSNLWKEDFACLGWLDSKEPNSVLFINFGSIA  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            V+T +QL+EF+WGLANS+K FLWIIRPD V+G+  V+P EFL ETK+RGMLA WCPQE+V
Sbjct  310  VVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGMLAGWCPQERV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTH GWNS LESIC GVP++CWPFFAEQQTNC+Y    WGIGMEI+N+V+R
Sbjct  370  LRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDNSVRR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
             EVE LV+ELMDGEKGK MK+KA+EWK+ A++ AT   GSSY NLE + + VL+
Sbjct  430  EEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSHVLV  482



>ref|XP_010535401.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535409.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X2 [Tarenaya 
hassleriana]
Length=487

 Score =   324 bits (831),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 183/235 (78%), Gaps = 1/235 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLL-EKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY +GPL LL  +T+  D +++   SNLWKED  CL WL+TK P SV+YVNFGS
Sbjct  249  QSLLPPVYPVGPLHLLVNRTIDNDSEIRRLGSNLWKEDTECLKWLDTKAPRSVIYVNFGS  308

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVM+  QLVEFAWGLA S K FLW+IRPD + GE AVVPPEF+ ET ERG+LASWCPQE
Sbjct  309  ITVMSEKQLVEFAWGLAGSGKEFLWVIRPDLLGGETAVVPPEFVAETAERGLLASWCPQE  368

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH GWNSTLESI  GVP+ICWPFFA+Q TN  +C   WG+GMEI ++ 
Sbjct  369  KVLSHPAIGGFLTHCGWNSTLESISGGVPVICWPFFADQSTNRRFCCDEWGMGMEIGSDA  428

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            KR EVE++V+ELMDGEKG +M+    + ++LA+ + T  SGSS+VN E + +KVL
Sbjct  429  KREEVEAVVRELMDGEKGNKMRETMEKLRRLAEAATTPPSGSSFVNFETVVDKVL  483



>ref|XP_008378324.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=488

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 186/235 (79%), Gaps = 2/235 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
             SMLP VY IGPLQLL   L +D  +     +LW+E+  CL+WLN+K PNSVVYVNFGSI
Sbjct  252  SSMLPLVYAIGPLQLLLNHLPKDP-LNDMGYSLWREETECLEWLNSKPPNSVVYVNFGSI  310

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
             VMTP+ LVEFAWGLANSK  F W+IRPD   GE A++ PEF+ ETKERG++ASWCPQE+
Sbjct  311  AVMTPEHLVEFAWGLANSKLPFFWVIRPDLXVGESAILSPEFVAETKERGLIASWCPQEQ  370

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HP+VGGFLTHSGWNS  ES+CAGVPM+CWPFFA+QQTN W     W IGMEI+N+VK
Sbjct  371  VLSHPSVGGFLTHSGWNSXXESLCAGVPMLCWPFFADQQTNTWCACNEWDIGMEISNDVK  430

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R EV+ LV+ELM+GEKGK+MK K M+WKKLA++S T+ +GSS  NL+ + N VLL
Sbjct  431  RVEVQELVRELMEGEKGKKMKIKVMQWKKLAEES-TSPNGSSSTNLDNLVNNVLL  484



>ref|XP_010459988.1| PREDICTED: UDP-glycosyltransferase 85A2 [Camelina sativa]
Length=484

 Score =   324 bits (830),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 186/236 (79%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLV-QDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS++P VY++GPL LLEK  + +D ++    SNLWKE+  CLDWL+TK  NSVVYVNFGS
Sbjct  247  QSIIPPVYSVGPLHLLEKQEIGEDSEIGRMGSNLWKEETECLDWLDTKARNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITV+   QL EFAWGLA + K FLW+IRPD V+G+EA+VP EFL ET++R MLASWCPQE
Sbjct  307  ITVLNAKQLAEFAWGLAATGKEFLWVIRPDLVAGDEAMVPHEFLTETEDRRMLASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +    W +G EI  +V
Sbjct  367  QVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGNEIGGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELMDGEKGK+M+ KA EW++LA+++     GSS VN E   +KVLL
Sbjct  427  KREEVEAVVRELMDGEKGKKMREKAQEWRRLAKEATEHKHGSSVVNFETFVSKVLL  482



>ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48520.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=492

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 196/234 (84%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPS-VYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            S+LP+ + TIGPLQLL +  VQ+  V + +SNLW+E   CL+WL++K+PNSV+YVNFGS+
Sbjct  259  SILPNPILTIGPLQLLLQDQVQESVVNSIKSNLWEEQPGCLEWLDSKEPNSVIYVNFGSV  318

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP QLVEFAWGLANSKKTFLW+IRPD V+GE A++PPEFL+ETKERG+LA+WCPQE+
Sbjct  319  TVMTPQQLVEFAWGLANSKKTFLWVIRPDLVTGESAIIPPEFLKETKERGLLANWCPQEE  378

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HP++GGFLTHSGWNST+ES+  GVPMICWPFFAEQQTN W+C   W IGMEI+N+  
Sbjct  379  VLMHPSIGGFLTHSGWNSTIESLAGGVPMICWPFFAEQQTNSWFCCNKWCIGMEIDNDAN  438

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            R E+E LVKELM+ + G E+K KAMEWK  A++ AT+ +GSSY+NL+++   VL
Sbjct  439  RTEIERLVKELMNSKPGSEVKNKAMEWKMKAEE-ATSRTGSSYMNLDKMITMVL  491



>ref|XP_011467660.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 187/232 (81%), Gaps = 2/232 (1%)
 Frame = -3

Query  860  LPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVM  681
            LP VY IGP QL    L  +D +K    +LWKE+  CL WL++K+PNSV+YV+FGSI VM
Sbjct  243  LPPVYAIGPQQLHLNQL-PEDPLKNMGYSLWKEEAECLKWLDSKEPNSVIYVSFGSIAVM  301

Query  680  TPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLG  501
            +P  LVEF WGLANSK  F+W+IRPD V GE A++PPEF+ ETKERG++A+WCPQE+VL 
Sbjct  302  SPQHLVEFGWGLANSKVCFIWVIRPDLVVGESAILPPEFVAETKERGLIANWCPQEQVLN  361

Query  500  HPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNE  321
            HP+VGGFLTH GWNS +ES+CAGVPM+CWPFFA+QQTNCW     WGIGMEINN+VKR+E
Sbjct  362  HPSVGGFLTHCGWNSMIESLCAGVPMLCWPFFADQQTNCWSACNEWGIGMEINNDVKRDE  421

Query  320  VESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            VE LV+++M GEKG++M+ KA+EWKKLA++ ATA  GSS  NLE + N+V+L
Sbjct  422  VEKLVRQMMGGEKGEKMRSKALEWKKLAEE-ATAPHGSSSQNLENLVNEVML  472



>ref|XP_008229473.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
 ref|XP_008229474.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=486

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 183/233 (79%), Gaps = 2/233 (1%)
 Frame = -3

Query  863  MLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITV  684
            MLP VY+IGPLQL     + +  +K    +LWKE+  CL+WLNT  PNSVVYVNFGSI V
Sbjct  253  MLPRVYSIGPLQL-HLNEIPEHPLKMVGYSLWKEETECLEWLNTNTPNSVVYVNFGSIAV  311

Query  683  MTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVL  504
            MT +QLVEF WGLANSK  F W+IRPD V GE A+ PPEF+ ETKER ++A WCPQE+VL
Sbjct  312  MTSEQLVEFGWGLANSKLPFFWVIRPDLVIGESAIFPPEFVAETKERSLIAGWCPQEQVL  371

Query  503  GHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRN  324
             HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+N+VKR+
Sbjct  372  NHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDVKRD  431

Query  323  EVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            EVE LVKELM+GEKGK+MK K MEWKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  432  EVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVLL  483



>ref|NP_173656.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 sp|Q9SK82.1|U85A1_ARATH RecName: Full=UDP-glycosyltransferase 85A1; AltName: Full=Cytokinin-O-glucosyltransferase 
2; AltName: Full=Zeatin O-glucosyltransferase 
2; Short=AtZOG2 [Arabidopsis thaliana]
 gb|AAF18537.1|AC006551_23 Putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAL91228.1| putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAP49527.1| At1g22400 [Arabidopsis thaliana]
 gb|AEE30237.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 gb|AHL38930.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=489

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQD-DDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS+LP VY++GPL LL    +++  ++    SNLWKE+  CLDWL+TK  NSV+Y+NFGS
Sbjct  248  QSILPPVYSVGPLHLLANREIEEGSEIGMMSSNLWKEEMECLDWLDTKTQNSVIYINFGS  307

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITV++  QLVEFAWGLA S K FLW+IRPD V+GEEA+VPP+FL ETK+R MLASWCPQE
Sbjct  308  ITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPDFLMETKDRSMLASWCPQE  367

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPA+GGFLTH GWNS LES+  GVPM+CWPFFA+QQ NC +C   W +G+EI  +V
Sbjct  368  KVLSHPAIGGFLTHCGWNSILESLSCGVPMVCWPFFADQQMNCKFCCDEWDVGIEIGGDV  427

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            KR EVE++V+ELMDGEKGK+M+ KA+EW++LA+ +     GSS +N E + +K LL  K
Sbjct  428  KREEVEAVVRELMDGEKGKKMREKAVEWQRLAEKATEHKLGSSVMNFETVVSKFLLGQK  486



>ref|XP_010060021.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Eucalyptus grandis]
Length=499

 Score =   323 bits (829),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 190/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M+P +YT+GPL +L + L  DDD K+  SN WKED  CL+WL++  P SVVYVNFGSI
Sbjct  262  KAMVPPIYTLGPLHILTEQL-PDDDTKSIGSNPWKEDLGCLEWLDSNPPVSVVYVNFGSI  320

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QL E AWGLANS + FLW+IRPD V G  A++PP+FL  T++R +L SWCPQE+
Sbjct  321  TVMSPAQLGELAWGLANSGQAFLWVIRPDLVLGNMAILPPDFLAATRQRSLLVSWCPQER  380

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTH GW ST+ESI AGVP++CWPFF EQQ NCWY    WGIG+EI+++VK
Sbjct  381  VLNHPAVGGFLTHGGWKSTIESIVAGVPVVCWPFFVEQQRNCWYSCEEWGIGLEIDDDVK  440

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GK MKRK MEW+++A+++A   SGSS  NL+++ +KVLLSP+
Sbjct  441  RDEVERQVRELMEGERGKAMKRKVMEWQEMAREAAR-PSGSSCSNLDEVIDKVLLSPR  497



>ref|XP_009377941.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   323 bits (828),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 186/235 (79%), Gaps = 3/235 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
             SMLP VYTIGPLQL    + +      +  +LWKE+  CL+WLNTK  NSVVYVNFGSI
Sbjct  251  SSMLPLVYTIGPLQLHLNQIPEHPLNIGY--SLWKEETVCLEWLNTKAQNSVVYVNFGSI  308

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP  LVEF WGLANSK  F W+IRPD V GE  ++PPEF+ ETKER ++ASWCPQE+
Sbjct  309  TVMTPAHLVEFGWGLANSKLPFFWVIRPDLVIGESMILPPEFVAETKERSLVASWCPQEQ  368

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFFA+QQ +C Y    WG+GMEI N+VK
Sbjct  369  VLNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWGVGMEIGNDVK  428

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R+EVE LV+ELMDGEKGK+MK +AMEWKKLA++ AT+  GSS  NL+ + N+VLL
Sbjct  429  RDEVEKLVRELMDGEKGKKMKNRAMEWKKLAEE-ATSPYGSSSKNLDNLVNQVLL  482



>ref|XP_009349617.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=486

 Score =   323 bits (828),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 186/232 (80%), Gaps = 2/232 (1%)
 Frame = -3

Query  860  LPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVM  681
            +P VYTIGP++LL   + +D   K    +LWKE+  CL WL++K PNSVVYVNFGSITVM
Sbjct  254  IPPVYTIGPIELLLNQMPKDPS-KFGGYSLWKEETECLPWLDSKAPNSVVYVNFGSITVM  312

Query  680  TPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLG  501
            TP+QLVEF WGLANSK  F W+IRPD V GE  ++ P+F  ETKE+G++ASWCPQE+VL 
Sbjct  313  TPEQLVEFGWGLANSKLPFFWVIRPDLVIGESGILSPDFFAETKEKGLIASWCPQEQVLN  372

Query  500  HPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNE  321
            HP+VGGFLTHSGWNST+ES+ AGVPM+CWPFFA+QQTNC+Y    WGIGMEI+N+VKR+ 
Sbjct  373  HPSVGGFLTHSGWNSTMESLTAGVPMLCWPFFADQQTNCYYTCNKWGIGMEIDNDVKRDG  432

Query  320  VESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            V+ L+KELM+GEKGK+MK KAMEWKKLA++ AT   GSS  N + + N VLL
Sbjct  433  VQKLIKELMEGEKGKKMKNKAMEWKKLAEE-ATGPLGSSSTNFDNLVNNVLL  483



>emb|CDP01087.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 193/236 (82%), Gaps = 5/236 (2%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S LP +YTIGPL  LE   V D+ +   +SNLWKE+  CL+WL++KDPNSVVYVNFGSI 
Sbjct  249  SYLPPIYTIGPLHFLENH-VHDNSLTDVQSNLWKEEPKCLEWLDSKDPNSVVYVNFGSIA  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP+QLVEFAWGLANSK+ FLWI+RPD VSG  A++P EFLEETKER M A WC QEKV
Sbjct  308  VMTPEQLVEFAWGLANSKQNFLWILRPDLVSGSSAILPSEFLEETKERSMFAGWCAQEKV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+VGGFLTHSGWNST+ESI  GVPMICWP FA+QQTNCW+C T WGIGMEI+NNVKR
Sbjct  368  LSHPSVGGFLTHSGWNSTIESISYGVPMICWPCFADQQTNCWFCCTKWGIGMEIDNNVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            +EVE LV ELM GEKGKEMK+KAM+WKKLA+ + T     S +NLE + ++VLL+P
Sbjct  428  DEVERLVSELMAGEKGKEMKKKAMDWKKLAETAVT----DSKLNLENLIHQVLLNP  479



>emb|CDY38225.1| BnaC05g17420D [Brassica napus]
Length=482

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 187/235 (80%), Gaps = 2/235 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQL-LEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS++P VY+IGPL L +++ + +D ++    SNLWKE+  C+DWLN++ PNSVVYVNFGS
Sbjct  247  QSIVPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNSRAPNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITVMT  QLV+FAWGLA + K FLW+IRPD V+GE ++VPPEFL ET +R MLASWCPQE
Sbjct  307  ITVMTAKQLVDFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPAVGGFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC +C   W IG+EI  +V
Sbjct  367  EVLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEI-GDV  425

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            +R EVE++V+ELMDGEKGK+M+ KA EW+ LA+ +     GSS VN +++   VL
Sbjct  426  RREEVEAVVRELMDGEKGKKMREKAEEWRSLAEKATECKRGSSVVNFDKVVKVVL  480



>ref|XP_003635298.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Vitis vinifera]
Length=478

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 188/234 (80%), Gaps = 2/234 (1%)
 Frame = -3

Query  860  LPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSITVM  681
             P +YT GPL LLE+ ++ D  VK+ RS+LWKED TCL+WL+ ++PNSVVYVN+GS+TVM
Sbjct  247  FPRIYTAGPLPLLERHML-DGQVKSLRSSLWKEDSTCLEWLDQREPNSVVYVNYGSVTVM  305

Query  680  TPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKVLG  501
            T   L EFAWGLANSK +FLWIIRPD V G+ AV+P EFL+ETK+RG+L SWCPQE+VL 
Sbjct  306  TDRHLKEFAWGLANSKYSFLWIIRPDIVMGDSAVLPEEFLKETKDRGLLVSWCPQEQVLS  365

Query  500  HPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKRNE  321
            HP+VG FLTH GWNS LE+IC GVP+ICWPFFA+QQTNC Y  T WGIG+E++++VKR+E
Sbjct  366  HPSVGVFLTHCGWNSMLEAICGGVPVICWPFFADQQTNCRYACTTWGIGVEVDHDVKRDE  425

Query  320  VESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSP  159
            +E LVKE+M G+KGK+M++KA EWK  A++ AT   GSSY N ++   + L +P
Sbjct  426  IEELVKEMMGGDKGKQMRKKAQEWKMKAEE-ATDVGGSSYTNFDKFIKEALHTP  478



>ref|XP_011467653.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=462

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 187/234 (80%), Gaps = 2/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VY IGPLQLL    + +  +K+   +LWKE+  CL WL+ K PNSVVYVNFGS+ 
Sbjct  224  SMLPPVYAIGPLQLLLNQ-IPEHPLKSVGYSLWKEETECLQWLHGKAPNSVVYVNFGSVV  282

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP QL+EFAWGLANSK  FLW+IRPD ++GE A++PPEF+ ETKERG++ASWCPQE+V
Sbjct  283  VMTPQQLMEFAWGLANSKLPFLWVIRPDLIAGESAILPPEFVAETKERGLIASWCPQEQV  342

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP VGGFLTHSGWNST+ESI AGVPM+CWP   +Q+ NC Y    WGIGMEI+N+VKR
Sbjct  343  LNHPTVGGFLTHSGWNSTMESISAGVPMLCWPLLGDQRINCRYTCYEWGIGMEISNDVKR  402

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            ++V+ LV+ELM GEKGKE+K K M WKKLA+D A++  GSS++ L+ + N+VLL
Sbjct  403  DKVKKLVEELMKGEKGKELKNKVMIWKKLAED-ASSPLGSSHIALDNLVNQVLL  455



>ref|XP_010477495.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 186/236 (79%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLV-QDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS++P VY+IGPL LLEK  + +D ++    SNLW+E+  CLDWLNTK  NSVVYVNFGS
Sbjct  247  QSIIPPVYSIGPLHLLEKQEIGEDSEIGQMGSNLWREEAECLDWLNTKAQNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITV+   QL EFAWGLA + K FLW+IRPD V+G+EA+VP EFL ET++R MLASWCPQE
Sbjct  307  ITVLNAKQLAEFAWGLAATGKEFLWVIRPDLVAGDEAMVPHEFLTETEDRRMLASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPA+GGFLTH GWNS LES+C GVPM+CWPFFAEQQTNC +    W +G+EI  +V
Sbjct  367  QVLSHPAIGGFLTHCGWNSMLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGIEIGGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELMDGEKGK+M+ KA EW++LA+++     GSS VN +   +KVLL
Sbjct  427  KREEVEAVVRELMDGEKGKKMRVKAQEWRRLAKEATEHKQGSSVVNFQTFVSKVLL  482



>gb|ADV71371.1| glycosyltransferase GT14M03 [Pueraria montana var. lobata]
Length=485

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 197/235 (84%), Gaps = 2/235 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            S+LP VY+IGPL  L    V D D+ A  SNLWKE+  CL+WL+TK+ N+VVYVNFGS+T
Sbjct  246  SILPPVYSIGPLNFLLND-VTDKDLNAIGSNLWKEEPGCLEWLDTKEANTVVYVNFGSVT  304

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT DQL+EFAWGLANS KTF+W+IRPD V GE AV+PPEF+ ETK RG+L+SWCPQE+V
Sbjct  305  VMTNDQLIEFAWGLANSNKTFVWVIRPDLVVGENAVLPPEFVTETKNRGLLSSWCPQEQV  364

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTH+GWNSTLES+C GVPMICWPFFAEQ TNC +C   WGIG+EI  +V+R
Sbjct  365  LAHPAIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQHTNCRFCCKEWGIGLEI-GDVER  423

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            +++ESLV+ELMDGEKGKEMK+KA+EWK LAQ +A+  +GSS+V+ E++  +VL+S
Sbjct  424  DKIESLVRELMDGEKGKEMKKKALEWKTLAQKAASGPNGSSFVHFEKMIREVLMS  478



>ref|XP_009349618.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 186/235 (79%), Gaps = 3/235 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
             SMLP VYTIGPLQL    + +      +  +LWKE+  CL+WLNTK  NSVVYVNFGSI
Sbjct  251  SSMLPLVYTIGPLQLHLNQIPEHPLNIGY--SLWKEETVCLEWLNTKAQNSVVYVNFGSI  308

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVMTP  LVEF WGLANSK  F W+IRPD V GE A++PPEF+ ETKER ++ASWCPQE+
Sbjct  309  TVMTPAHLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKERSLVASWCPQEQ  368

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFFA+QQ +C Y    W +GMEI N+VK
Sbjct  369  VLNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWDVGMEIGNDVK  428

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            R+EVE LV+ELMDGEKGK+MK +AMEWKKLA++ AT+  GSS  NL+ + N+VLL
Sbjct  429  RDEVEKLVRELMDGEKGKKMKNRAMEWKKLAEE-ATSPYGSSSKNLDNLVNQVLL  482



>ref|XP_002323974.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
 gb|EEF04107.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
Length=482

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 184/233 (79%), Gaps = 2/233 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM P +Y++GPL LL     Q D + +  SNLWKE+  CL WL++KDPNSVVYVNFGSIT
Sbjct  247  SMFPPIYSVGPLNLLLDH-TQKDYLASIGSNLWKEETECLQWLDSKDPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VM P QLVEF+WGLANSKK FLWIIRPD V GE AV+PPEFLEET+ERG++ASWC QEKV
Sbjct  306  VMNPQQLVEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMASWCAQEKV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H ++GGFL+H GWNST+ES+  GV M+CWPFF+EQQTNC +    WG+GMEI ++  R
Sbjct  366  LKHSSIGGFLSHMGWNSTIESLSNGVAMLCWPFFSEQQTNCKFACVDWGVGMEIESDANR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            ++VE LV EL+DGEKGKEMKRKAMEWK  A+ + T  +GSS +N +++ N VL
Sbjct  426  DDVEKLVIELIDGEKGKEMKRKAMEWKSKAE-ATTGINGSSSMNFDKLVNDVL  477



>ref|XP_010060022.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Eucalyptus grandis]
Length=500

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 190/238 (80%), Gaps = 2/238 (1%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSI  690
            ++M+P +YT+GPL +L + L  DDD K+  SN WKED  CL+WL++  P SVVYVNFGSI
Sbjct  263  KAMVPPIYTLGPLHILTEQL-PDDDTKSIGSNPWKEDLGCLEWLDSNPPVSVVYVNFGSI  321

Query  689  TVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEK  510
            TVM+P QL E AWGLANS + FLW+IRPD V G  A++PP+FL  T++R +L SWCPQE+
Sbjct  322  TVMSPAQLGELAWGLANSGQAFLWVIRPDLVLGNMAILPPDFLAATRQRSLLVSWCPQER  381

Query  509  VLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVK  330
            VL HPAVGGFLTH GW ST+ESI AGVP++CWPFF EQQ NCWY    WGIG+EI+++VK
Sbjct  382  VLNHPAVGGFLTHGGWKSTIESIVAGVPVVCWPFFVEQQRNCWYSCEEWGIGLEIDDDVK  441

Query  329  RNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            R+EVE  V+ELM+GE+GK MKRK MEW+++A+++A   SGSS  NL+++ +KVLLSP+
Sbjct  442  RDEVERQVRELMEGERGKAMKRKVMEWQEMAREAAR-PSGSSCSNLDEVIDKVLLSPR  498



>emb|CDY62992.1| BnaC07g48400D [Brassica napus]
Length=488

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 184/239 (77%), Gaps = 1/239 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLVQDD-DVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            Q +   VY+IGPL LL   +++D  +V    SNLWKE+  CL WL+TK P+SVVYVNFGS
Sbjct  247  QPIFSPVYSIGPLHLLANRVIEDSGEVGRMGSNLWKEEIECLAWLDTKAPDSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITV +  QL EFA GLA S + FLW+IRPD V+GE AVVPPEFL ET++RGM+ASWCPQE
Sbjct  307  ITVTSGKQLAEFALGLAGSGEEFLWVIRPDLVAGEAAVVPPEFLVETRDRGMMASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            KVL HPAVGGFLTH GWNS LES+C GVPMICWPFFAEQ TNC +C   WG+GMEI+ NV
Sbjct  367  KVLSHPAVGGFLTHCGWNSMLESLCGGVPMICWPFFAEQPTNCKFCCDEWGVGMEISENV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLSPK  156
            KR E+E++VKELMDGE G++M+ KA EW++LA+ +     GSS +N E + +KV+L  +
Sbjct  427  KREEIETVVKELMDGENGRKMREKAREWRRLAEKATENTYGSSVINFETVVSKVVLRQR  485



>ref|XP_010041627.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 190/240 (79%), Gaps = 6/240 (3%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEK-----TLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVN  702
            S+ P +YTIGPLQLL       +   D+ +++   NLW+E+  CL WL++K+P SVVYVN
Sbjct  249  SVFPHIYTIGPLQLLADWGAGGSPEIDEALRSVGGNLWREEPGCLPWLDSKEPGSVVYVN  308

Query  701  FGSITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWC  522
            FGSITVMT  QL EFAWGLANS+K FLWIIRPD V+ E AV+PPEF+EE   RGML SWC
Sbjct  309  FGSITVMTTGQLTEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVSWC  368

Query  521  PQEKVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEIN  342
             QE+VL H A+GGFLTHSGWNSTLES+C GVP+ICWPFFAEQQTNC Y  T WGIGMEI+
Sbjct  369  QQEEVLKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEID  428

Query  341  NNVKRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLLS  162
            N+VKR+EVE LV+ELM+GEKGKEM++KAMEWK  A++ A    G+SY N++++ ++VL S
Sbjct  429  NDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMLGGTSYNNVDKLISEVLSS  487



>ref|XP_010498706.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 187/236 (79%), Gaps = 1/236 (0%)
 Frame = -3

Query  869  QSMLPSVYTIGPLQLLEKTLV-QDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGS  693
            QS++P VY+IGPL LLEK  + +D ++    SNLW+E+  CLDWL+TK  NSVVYVNFGS
Sbjct  247  QSIIPPVYSIGPLHLLEKQEIGEDSELGRMGSNLWREEAECLDWLDTKARNSVVYVNFGS  306

Query  692  ITVMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQE  513
            ITV+   QL EFAWGLA + K FLW+IRPD V+G+EA+VP EFL ET++R MLASWCPQE
Sbjct  307  ITVLNAKQLAEFAWGLAATGKEFLWVIRPDLVAGDEAMVPHEFLTETEDRRMLASWCPQE  366

Query  512  KVLGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNV  333
            +VL HPA+GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +    W +G+EI  +V
Sbjct  367  QVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGIEIGGDV  426

Query  332  KRNEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            KR EVE++V+ELMDGEKGK+M+ KA +W++LA+++     GSS VN +   +KVLL
Sbjct  427  KREEVEAVVRELMDGEKGKKMREKAQQWRRLAKEATEHKHGSSVVNFDTFVSKVLL  482



>ref|XP_009350672.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 184/234 (79%), Gaps = 3/234 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SMLP VY IGPLQL     +QD  +    S LWKE+  CLDWLNTK PNSVVYVNFGSIT
Sbjct  252  SMLPLVYPIGPLQL-HLNQIQDQPLNIGYS-LWKEETECLDWLNTKAPNSVVYVNFGSIT  309

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMTP+ LVEF WGLA SK  F W+IRPD V G+ A++P EF++ETKER ++ASWCPQE+V
Sbjct  310  VMTPEHLVEFGWGLAKSKVPFFWVIRPDLVIGQSALLPLEFVDETKERSLIASWCPQEQV  369

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HP+V GFLTHSGWNSTLES+ AGVPM+CWPFF +QQ +C Y    WGIGMEI+N+VKR
Sbjct  370  LNHPSVAGFLTHSGWNSTLESLTAGVPMLCWPFFGDQQMDCRYSCNEWGIGMEISNDVKR  429

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVLL  165
            +EVE LV+ELMDGEKGK+MK K M WKKLA++ AT   GSS  NL+ + N+VLL
Sbjct  430  DEVERLVRELMDGEKGKKMKNKVMAWKKLAEE-ATGPHGSSSKNLDMLVNQVLL  482



>ref|XP_002323976.2| hypothetical protein POPTR_0017s07920g [Populus trichocarpa]
 gb|EEF04109.2| hypothetical protein POPTR_0017s07920g [Populus trichocarpa]
Length=482

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 185/233 (79%), Gaps = 2/233 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            SM P +Y++GPL LL     Q+D + +  S+LWKE+  CL WL++KDPNSVVYVNFGSIT
Sbjct  247  SMFPPIYSVGPLNLLLDQ-TQNDYLASIVSSLWKEETECLHWLDSKDPNSVVYVNFGSIT  305

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VM P QLVEF+ GLANSKK FLWIIRPD V G+ AV+PPEFLEET++RG++ASWC QEKV
Sbjct  306  VMNPQQLVEFSLGLANSKKNFLWIIRPDLVRGDSAVLPPEFLEETRDRGLMASWCAQEKV  365

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L H ++GGFL+H GWNST+ES+  GVPM+CWPFF+EQQTNC +    WG+GMEI ++  R
Sbjct  366  LKHSSIGGFLSHMGWNSTIESLSNGVPMLCWPFFSEQQTNCKFACVDWGVGMEIESDANR  425

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
            +EVE LV ELMDGEKGKEMKRKAMEWK  A+ + T  +GSS +N +++ N VL
Sbjct  426  DEVEKLVIELMDGEKGKEMKRKAMEWKSKAE-ATTGINGSSSMNFDKLVNDVL  477



>ref|NP_001277168.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51843.1| UDP-glycosyltransferase 85A33 [Vitis vinifera]
Length=482

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 189/233 (81%), Gaps = 2/233 (1%)
 Frame = -3

Query  866  SMLPSVYTIGPLQLLEKTLVQDDDVKAFRSNLWKEDQTCLDWLNTKDPNSVVYVNFGSIT  687
            + LP VY+IGPLQ L    + DD +K+  SNLWKE   CL WL++K+PNSVVYVNFGSIT
Sbjct  249  ATLPPVYSIGPLQHLVDQ-ISDDRLKSMGSNLWKEQTDCLQWLDSKEPNSVVYVNFGSIT  307

Query  686  VMTPDQLVEFAWGLANSKKTFLWIIRPDAVSGEEAVVPPEFLEETKERGMLASWCPQEKV  507
            VMT  QL EFAWGLANS K FLWIIRPD V G+ A++PPEF+ ETK+RGMLASWCPQE+V
Sbjct  308  VMTSQQLTEFAWGLANSNKPFLWIIRPDLVVGDSALLPPEFVTETKDRGMLASWCPQEQV  367

Query  506  LGHPAVGGFLTHSGWNSTLESICAGVPMICWPFFAEQQTNCWYCGTHWGIGMEINNNVKR  327
            L HPA+GGFLTHSGWNST ESIC GVP+ICWPFFAEQQTNC Y  + WGIGMEI+NNVKR
Sbjct  368  LKHPAIGGFLTHSGWNSTSESICGGVPLICWPFFAEQQTNCRYSCSEWGIGMEIDNNVKR  427

Query  326  NEVESLVKELMDGEKGKEMKRKAMEWKKLAQDSATAASGSSYVNLEQIFNKVL  168
             EVE LV+ELMDGEKGKEMK+K MEWKKLA++ AT   GSSY N  ++   VL
Sbjct  428  VEVEKLVRELMDGEKGKEMKKKVMEWKKLAEE-ATRPGGSSYDNFNKLLRNVL  479



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1949878542686