BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1316

Length=790
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245645.1|  PREDICTED: scarecrow-like protein 28               407   1e-134   Solanum lycopersicum
ref|XP_006358871.1|  PREDICTED: scarecrow-like protein 28-like          407   2e-134   Solanum tuberosum [potatoes]
ref|XP_009609251.1|  PREDICTED: scarecrow-like protein 28               405   1e-133   Nicotiana tomentosiformis
gb|KJB52044.1|  hypothetical protein B456_008G243900                    400   1e-131   Gossypium raimondii
ref|XP_009782602.1|  PREDICTED: scarecrow-like protein 28               397   1e-130   Nicotiana sylvestris
ref|XP_011033794.1|  PREDICTED: scarecrow-like protein 28               396   3e-130   Populus euphratica
ref|XP_002303565.1|  scarecrow transcription factor family protein      396   3e-130   Populus trichocarpa [western balsam poplar]
gb|KEH31708.1|  GRAS family transcription factor                        391   4e-128   Medicago truncatula
ref|XP_004515801.1|  PREDICTED: scarecrow-like protein 28-like          388   7e-127   Cicer arietinum [garbanzo]
ref|XP_002276880.1|  PREDICTED: scarecrow-like protein 28               387   1e-126   Vitis vinifera
ref|XP_007040131.1|  GRAS family transcription factor                   384   8e-126   
ref|XP_012086993.1|  PREDICTED: scarecrow-like protein 28               384   9e-126   Jatropha curcas
ref|XP_003525725.1|  PREDICTED: scarecrow-like protein 28-like is...    382   5e-125   Glycine max [soybeans]
ref|XP_006440546.1|  hypothetical protein CICLE_v10019186mg             382   6e-125   Citrus clementina [clementine]
ref|XP_011072178.1|  PREDICTED: scarecrow-like protein 28               382   6e-125   Sesamum indicum [beniseed]
gb|KHN34430.1|  Scarecrow-like protein 28                               382   8e-125   Glycine soja [wild soybean]
gb|KDO63554.1|  hypothetical protein CISIN_1g005954mg                   382   1e-124   Citrus sinensis [apfelsine]
ref|XP_006477403.1|  PREDICTED: scarecrow-like protein 28-like          382   1e-124   Citrus sinensis [apfelsine]
ref|XP_002509714.1|  DELLA protein RGL1, putative                       381   2e-124   Ricinus communis
gb|KJB20743.1|  hypothetical protein B456_003G162400                    379   8e-124   Gossypium raimondii
emb|CDP09804.1|  unnamed protein product                                378   4e-123   Coffea canephora [robusta coffee]
gb|AHA85561.1|  scarecrow-like protein 28                               377   9e-123   Dimocarpus longan [longan]
ref|XP_008238774.1|  PREDICTED: scarecrow-like protein 28               374   2e-121   Prunus mume [ume]
ref|XP_009344268.1|  PREDICTED: scarecrow-like protein 28               373   4e-121   Pyrus x bretschneideri [bai li]
ref|XP_010278558.1|  PREDICTED: scarecrow-like protein 28               372   4e-121   Nelumbo nucifera [Indian lotus]
ref|XP_008369471.1|  PREDICTED: scarecrow-like protein 28               373   5e-121   
ref|XP_007155560.1|  hypothetical protein PHAVU_003G212200g             371   7e-121   Phaseolus vulgaris [French bean]
ref|XP_010053331.1|  PREDICTED: scarecrow-like protein 28               371   1e-120   Eucalyptus grandis [rose gum]
ref|XP_002299559.1|  hypothetical protein POPTR_0001s08850g             370   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_009339647.1|  PREDICTED: scarecrow-like protein 28               370   3e-120   Pyrus x bretschneideri [bai li]
ref|XP_007209056.1|  hypothetical protein PRUPE_ppa017030mg             371   3e-120   Prunus persica
ref|XP_011029197.1|  PREDICTED: scarecrow-like protein 28               369   8e-120   Populus euphratica
ref|XP_010112565.1|  hypothetical protein L484_010570                   367   6e-119   Morus notabilis
ref|XP_004298743.1|  PREDICTED: scarecrow-like protein 28               366   1e-118   Fragaria vesca subsp. vesca
ref|XP_003549861.1|  PREDICTED: scarecrow-like protein 28-like is...    366   1e-118   Glycine max [soybeans]
ref|XP_008373836.1|  PREDICTED: scarecrow-like protein 28               364   9e-118   
ref|XP_008346588.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    364   9e-118   Malus domestica [apple tree]
gb|KHN14118.1|  Scarecrow-like protein 28                               362   4e-117   Glycine soja [wild soybean]
ref|XP_010676544.1|  PREDICTED: scarecrow-like protein 28               352   4e-113   
ref|XP_006857885.1|  PREDICTED: scarecrow-like protein 28               349   6e-112   Amborella trichopoda
ref|XP_010940885.1|  PREDICTED: scarecrow-like protein 28               347   2e-111   
ref|XP_009407963.1|  PREDICTED: scarecrow-like protein 28 isoform X2    345   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407962.1|  PREDICTED: scarecrow-like protein 28 isoform X1    346   5e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934553.1|  PREDICTED: scarecrow-like protein 28               343   9e-111   Elaeis guineensis
ref|XP_008800814.1|  PREDICTED: scarecrow-like protein 28               345   9e-111   Phoenix dactylifera
ref|XP_008448980.1|  PREDICTED: scarecrow-like protein 28               344   3e-110   Cucumis melo [Oriental melon]
ref|XP_004148280.2|  PREDICTED: scarecrow-like protein 28               343   4e-110   Cucumis sativus [cucumbers]
ref|XP_010545969.1|  PREDICTED: scarecrow-like protein 28               342   3e-109   Tarenaya hassleriana [spider flower]
ref|XP_008779212.1|  PREDICTED: scarecrow-like protein 28               337   3e-109   
ref|XP_009398727.1|  PREDICTED: scarecrow-like protein 28               335   8e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406334.1|  PREDICTED: scarecrow-like protein 28               326   5e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006391781.1|  hypothetical protein EUTSA_v10023324mg             323   6e-102   Eutrema salsugineum [saltwater cress]
gb|EYU29837.1|  hypothetical protein MIMGU_mgv1a021768mg                321   4e-101   Erythranthe guttata [common monkey flower]
emb|CDY45974.1|  BnaA09g12920D                                          319   8e-101   Brassica napus [oilseed rape]
ref|NP_176498.1|  scarecrow-like protein 28                             318   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412565.1|  PREDICTED: scarecrow-like protein 28               317   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009113022.1|  PREDICTED: scarecrow-like protein 28               317   6e-100   Brassica rapa
emb|CDY70213.1|  BnaCnng67210D                                          317   6e-100   Brassica napus [oilseed rape]
ref|XP_006300849.1|  hypothetical protein CARUB_v10019945mg             317   8e-100   Capsella rubella
ref|XP_010533716.1|  PREDICTED: scarecrow-like protein 28               317   8e-100   Tarenaya hassleriana [spider flower]
emb|CDY47352.1|  BnaCnng14890D                                          315   3e-99    Brassica napus [oilseed rape]
emb|CDY49199.1|  BnaA09g10790D                                          315   4e-99    Brassica napus [oilseed rape]
ref|XP_009112977.1|  PREDICTED: scarecrow-like protein 28               313   1e-98    Brassica rapa
ref|XP_010418318.1|  PREDICTED: scarecrow-like protein 28 isoform X2    312   4e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010430392.1|  PREDICTED: scarecrow-like protein 28 isoform X2    312   5e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010418317.1|  PREDICTED: scarecrow-like protein 28 isoform X1    312   7e-98    
ref|XP_002886432.1|  scarecrow transcription factor family protein      313   7e-98    
ref|XP_010430391.1|  PREDICTED: scarecrow-like protein 28 isoform X1    311   1e-97    
ref|XP_010473538.1|  PREDICTED: scarecrow-like protein 28 isoform X2    310   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010473537.1|  PREDICTED: scarecrow-like protein 28 isoform X1    310   7e-97    
gb|EPS73834.1|  hypothetical protein M569_00923                         282   2e-89    Genlisea aurea
ref|XP_001763823.1|  predicted protein                                  260   5e-81    
ref|XP_001773672.1|  predicted protein                                  251   1e-77    
ref|XP_004964401.1|  PREDICTED: scarecrow-like protein 28-like          245   8e-73    Setaria italica
gb|AFW86077.1|  hypothetical protein ZEAMMB73_433354                    245   1e-72    
ref|XP_002436390.1|  hypothetical protein SORBIDRAFT_10g001690          245   2e-72    Sorghum bicolor [broomcorn]
emb|CBI34713.3|  unnamed protein product                                225   2e-70    Vitis vinifera
ref|XP_003557108.1|  PREDICTED: scarecrow-like protein 28               238   9e-70    Brachypodium distachyon [annual false brome]
ref|XP_002981812.1|  hypothetical protein SELMODRAFT_114956             233   2e-69    
ref|XP_002967802.1|  GRAS family protein                                233   1e-68    Selaginella moellendorffii
ref|NP_001056667.1|  Os06g0127800                                       228   4e-66    
gb|EAY99490.1|  hypothetical protein OsI_21459                          228   4e-66    Oryza sativa Indica Group [Indian rice]
gb|ADE76869.1|  unknown                                                 216   4e-66    Picea sitchensis
gb|EAZ35680.1|  hypothetical protein OsJ_19967                          223   2e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008676018.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    202   5e-57    
ref|XP_001773669.1|  predicted protein                                  196   6e-57    
ref|XP_001763820.1|  predicted protein                                  194   1e-55    
gb|KJB34025.1|  hypothetical protein B456_006G044300                    191   2e-52    Gossypium raimondii
ref|XP_008441631.1|  PREDICTED: DELLA protein RGL1-like                 190   5e-52    Cucumis melo [Oriental melon]
gb|KHG02698.1|  Protein SCARECROW                                       189   7e-52    Gossypium arboreum [tree cotton]
ref|XP_004138798.1|  PREDICTED: DELLA protein RGL1-like                 189   9e-52    Cucumis sativus [cucumbers]
ref|XP_011623444.1|  PREDICTED: DELLA protein RGL1                      184   1e-51    
gb|ERN06264.1|  hypothetical protein AMTR_s00016p00207780               179   2e-51    Amborella trichopoda
ref|XP_007161687.1|  hypothetical protein PHAVU_001G089900g             188   3e-51    Phaseolus vulgaris [French bean]
ref|XP_011045749.1|  PREDICTED: DELLA protein RGL1-like                 187   5e-51    Populus euphratica
gb|KDO63869.1|  hypothetical protein CISIN_1g045762mg                   182   5e-51    Citrus sinensis [apfelsine]
ref|XP_002298647.1|  hypothetical protein POPTR_0001s33360g             187   6e-51    Populus trichocarpa [western balsam poplar]
ref|XP_001778507.1|  predicted protein                                  181   4e-50    
ref|XP_003622095.1|  Protein SCARECROW                                  185   5e-50    Medicago truncatula
ref|XP_002512896.1|  DELLA protein GAI1, putative                       185   5e-50    Ricinus communis
emb|CDP16713.1|  unnamed protein product                                185   5e-50    Coffea canephora [robusta coffee]
ref|XP_001769597.1|  predicted protein                                  179   6e-50    
ref|XP_002992412.1|  hypothetical protein SELMODRAFT_135151             179   7e-50    
ref|XP_006447014.1|  hypothetical protein CICLE_v10018153mg             184   8e-50    Citrus clementina [clementine]
ref|XP_007031934.1|  GRAS family transcription factor                   183   1e-49    
ref|XP_006338809.1|  PREDICTED: protein SCARECROW-like                  183   2e-49    
ref|XP_002968015.1|  GRAS family protein                                180   4e-49    
ref|XP_009613034.1|  PREDICTED: DELLA protein RGL1-like                 182   6e-49    Nicotiana tomentosiformis
ref|XP_007217517.1|  hypothetical protein PRUPE_ppa024399mg             182   8e-49    
ref|XP_009346793.1|  PREDICTED: DELLA protein RGL1-like                 181   9e-49    
ref|XP_008231070.1|  PREDICTED: DELLA protein GAI-like                  181   1e-48    Prunus mume [ume]
ref|XP_003549053.1|  PREDICTED: protein SCARECROW-like                  181   1e-48    Glycine max [soybeans]
ref|XP_009803754.1|  PREDICTED: DELLA protein RGL2-like                 181   2e-48    Nicotiana sylvestris
ref|XP_010315907.1|  PREDICTED: DELLA protein RGL1-like                 181   2e-48    
gb|KDP41801.1|  hypothetical protein JCGZ_26819                         180   2e-48    Jatropha curcas
ref|XP_012067557.1|  PREDICTED: DELLA protein RGL1-like                 180   2e-48    Jatropha curcas
ref|XP_008379744.1|  PREDICTED: DELLA protein RGL1-like                 180   2e-48    
ref|XP_008791129.1|  PREDICTED: DELLA protein RGL3-like                 180   3e-48    
ref|XP_003553957.1|  PREDICTED: protein SCARECROW-like                  180   3e-48    Glycine max [soybeans]
ref|XP_009378007.1|  PREDICTED: DELLA protein RGL1-like                 179   6e-48    Pyrus x bretschneideri [bai li]
ref|XP_009405522.1|  PREDICTED: DELLA protein GAI-like                  179   6e-48    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010110925.1|  hypothetical protein L484_005656                   179   7e-48    Morus notabilis
ref|XP_008341667.1|  PREDICTED: DELLA protein RGL1-like                 178   1e-47    
ref|XP_002274834.2|  PREDICTED: scarecrow-like protein 21               178   1e-47    Vitis vinifera
ref|XP_011099005.1|  PREDICTED: DELLA protein RGL2-like                 178   1e-47    Sesamum indicum [beniseed]
gb|EYU31843.1|  hypothetical protein MIMGU_mgv1a021983mg                178   2e-47    Erythranthe guttata [common monkey flower]
ref|XP_009344215.1|  PREDICTED: DELLA protein RGL1-like                 178   2e-47    Pyrus x bretschneideri [bai li]
ref|XP_010917930.1|  PREDICTED: DELLA protein GAI1-like                 170   3e-46    
ref|XP_004304540.2|  PREDICTED: DELLA protein RGL1-like                 174   3e-46    Fragaria vesca subsp. vesca
dbj|BAQ20610.1|  GRAS-family protein 2                                  174   1e-45    Lygodium japonicum
ref|XP_002993034.1|  hypothetical protein SELMODRAFT_23095              168   3e-45    
ref|XP_010030721.1|  PREDICTED: scarecrow-like protein 21               169   1e-44    Eucalyptus grandis [rose gum]
gb|KCW55804.1|  hypothetical protein EUGRSUZ_I01625                     169   2e-44    Eucalyptus grandis [rose gum]
gb|EEC68221.1|  hypothetical protein OsI_36217                          164   2e-44    Oryza sativa Indica Group [Indian rice]
ref|XP_007203631.1|  hypothetical protein PRUPE_ppa003975mg             166   9e-44    Prunus persica
gb|AJC52501.1|  SCL18                                                   156   1e-43    Pinus radiata
ref|XP_004287380.1|  PREDICTED: DELLA protein GAI-like                  165   2e-43    Fragaria vesca subsp. vesca
ref|XP_002450783.1|  hypothetical protein SORBIDRAFT_05g018070          166   3e-43    Sorghum bicolor [broomcorn]
ref|XP_003524001.1|  PREDICTED: DELLA protein DWARF8-like               164   3e-43    Glycine max [soybeans]
ref|XP_010237707.1|  PREDICTED: DELLA protein GAI-like                  166   4e-43    
gb|ABA93922.1|  GRAS family transcription factor containing protein     166   4e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009765072.1|  PREDICTED: scarecrow-like protein 18               161   7e-43    Nicotiana sylvestris
ref|XP_002284952.1|  PREDICTED: DELLA protein SLR1-like                 163   8e-43    Vitis vinifera
ref|XP_009618056.1|  PREDICTED: scarecrow-like protein 18               161   9e-43    Nicotiana tomentosiformis
ref|XP_003556343.1|  PREDICTED: DELLA protein GAI1-like                 161   1e-42    Glycine max [soybeans]
ref|XP_008680172.1|  PREDICTED: DELLA protein GAI-like                  164   1e-42    Zea mays [maize]
gb|ACH47034.1|  lateral suppressor protein                              160   2e-42    Nicotiana tabacum [American tobacco]
emb|CAN64763.1|  hypothetical protein VITISV_015992                     160   2e-42    Vitis vinifera
ref|XP_002265645.1|  PREDICTED: scarecrow-like protein 18               160   3e-42    Vitis vinifera
ref|XP_010913242.1|  PREDICTED: scarecrow-like protein 18               160   3e-42    Elaeis guineensis
ref|XP_009346546.1|  PREDICTED: scarecrow-like protein 18               157   4e-42    
ref|XP_004980521.1|  PREDICTED: DELLA protein GAI-like                  162   5e-42    Setaria italica
ref|XP_001774314.1|  AtGAI1 GRAS E3 ubiquitin ligase protein            161   6e-42    
ref|XP_008463334.1|  PREDICTED: DELLA protein SLR1-like                 160   8e-42    Cucumis melo [Oriental melon]
ref|XP_009384383.1|  PREDICTED: scarecrow-like protein 3 isoform X2     159   8e-42    
ref|XP_009384382.1|  PREDICTED: scarecrow-like protein 3 isoform X1     159   1e-41    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010252869.1|  PREDICTED: scarecrow-like protein 18               160   1e-41    Nelumbo nucifera [Indian lotus]
ref|XP_010928164.1|  PREDICTED: scarecrow-like protein 18               158   1e-41    Elaeis guineensis
ref|XP_006589312.1|  PREDICTED: DELLA protein RGA-like                  159   2e-41    Glycine max [soybeans]
ref|XP_004146291.2|  PREDICTED: DELLA protein GAI                       159   2e-41    Cucumis sativus [cucumbers]
ref|XP_010049952.1|  PREDICTED: DELLA protein GAI-like                  160   2e-41    Eucalyptus grandis [rose gum]
gb|ACV52014.1|  GAI/RGA-like 3-b                                        159   2e-41    Gossypium hirsutum [American cotton]
emb|CCG14223.1|  gibberellin DELLA protein                              159   2e-41    Cucumis sativus [cucumbers]
gb|AHB17748.1|  GA repressor DELLA                                      159   2e-41    Actinidia deliciosa [Chinese gooseberry]
gb|AEX97112.1|  spur-type DELLA protein                                 159   3e-41    Malus domestica [apple tree]
ref|XP_006475101.1|  PREDICTED: scarecrow-like protein 18-like          158   3e-41    Citrus sinensis [apfelsine]
ref|XP_004507626.1|  PREDICTED: DELLA protein RHT-1-like                159   3e-41    
ref|XP_009379077.1|  PREDICTED: scarecrow-like protein 18               158   4e-41    Pyrus x bretschneideri [bai li]
ref|XP_009374432.1|  PREDICTED: scarecrow-like protein 18               158   4e-41    
ref|XP_003528281.1|  PREDICTED: DELLA protein SLR1-like                 158   4e-41    Glycine max [soybeans]
ref|XP_008343960.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    159   4e-41    
gb|AGH06216.1|  lateral suppressor protein                              157   4e-41    Malus domestica [apple tree]
ref|XP_008337344.1|  PREDICTED: DELLA protein GAI-like                  159   4e-41    
emb|CDY03601.1|  BnaC03g68600D                                          157   4e-41    
ref|XP_011000401.1|  PREDICTED: scarecrow-like protein 18               157   5e-41    Populus euphratica
ref|XP_007144131.1|  hypothetical protein PHAVU_007G131200g             158   5e-41    Phaseolus vulgaris [French bean]
gb|AAY56754.1|  DELLA protein                                           158   5e-41    Malus domestica [apple tree]
gb|KDO73932.1|  hypothetical protein CISIN_1g048299mg                   157   6e-41    Citrus sinensis [apfelsine]
gb|KJB54121.1|  hypothetical protein B456_009G021700                    158   6e-41    Gossypium raimondii
gb|ACV52013.1|  GAI/RGA-like 3-a                                        158   6e-41    Gossypium hirsutum [American cotton]
gb|AGV54403.1|  DELLA protein DWARF8-like protein                       157   7e-41    Phaseolus vulgaris [French bean]
ref|XP_006452790.1|  hypothetical protein CICLE_v10008226mg             157   7e-41    Citrus clementina [clementine]
gb|AAY56753.1|  DELLA protein                                           158   8e-41    Malus domestica [apple tree]
ref|XP_008384643.1|  PREDICTED: scarecrow-like protein 18               157   8e-41    
ref|XP_006475770.1|  PREDICTED: DELLA protein GAI-like                  157   9e-41    Citrus sinensis [apfelsine]
emb|CDY45059.1|  BnaA08g02160D                                          153   1e-40    Brassica napus [oilseed rape]
ref|XP_006451026.1|  hypothetical protein CICLE_v10010825mg             157   1e-40    Citrus clementina [clementine]
ref|XP_009371410.1|  PREDICTED: DELLA protein GAI-like                  157   2e-40    Pyrus x bretschneideri [bai li]
ref|XP_001754090.1|  GAI1-like E3 ubiquitin ligase protein              157   2e-40    
ref|XP_008390123.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    158   2e-40    
ref|XP_010249953.1|  PREDICTED: DELLA protein SLR1-like                 157   2e-40    Nelumbo nucifera [Indian lotus]
gb|AHW42470.1|  RGA                                                     157   2e-40    Pinus tabuliformis [southern Chinese pine]
gb|KJB22203.1|  hypothetical protein B456_004G034900                    155   3e-40    Gossypium raimondii
ref|XP_012078699.1|  PREDICTED: DELLA protein SLR1-like                 156   3e-40    Jatropha curcas
dbj|BAQ20609.1|  GRAS-family protein 1                                  157   4e-40    Lygodium japonicum
ref|NP_001234179.1|  lateral suppressor protein                         154   5e-40    Solanum lycopersicum
ref|XP_008354103.1|  PREDICTED: scarecrow-like protein 18               154   5e-40    
ref|XP_006346062.1|  PREDICTED: scarecrow-like protein 18-like          154   5e-40    Solanum tuberosum [potatoes]
ref|XP_002529354.1|  DELLA protein GAI1, putative                       155   6e-40    Ricinus communis
dbj|BAP05438.1|  GAI1-like E3 ubiquitin ligase protein                  155   7e-40    Marchantia polymorpha
ref|XP_007013315.1|  GAI/RGA-like protein                               155   7e-40    
ref|XP_009107220.1|  PREDICTED: scarecrow-like protein 3                154   8e-40    Brassica rapa
ref|XP_008811155.1|  PREDICTED: scarecrow-like protein 18               153   9e-40    Phoenix dactylifera
gb|AHB17747.1|  GA repressor DELLA                                      154   1e-39    Actinidia deliciosa [Chinese gooseberry]
ref|XP_007206810.1|  hypothetical protein PRUPE_ppa025834mg             152   2e-39    
gb|ACR58456.1|  GAI/RGA-like protein                                    154   2e-39    Gossypium hirsutum [American cotton]
ref|XP_002321384.1|  hypothetical protein POPTR_0015s01070g             152   2e-39    Populus trichocarpa [western balsam poplar]
ref|XP_007020290.1|  GRAS family transcription factor                   152   3e-39    
gb|ACV52015.1|  GAI/RGA-like 4-a                                        153   4e-39    Gossypium hirsutum [American cotton]
emb|CDP13626.1|  unnamed protein product                                152   4e-39    Coffea canephora [robusta coffee]
ref|XP_011095666.1|  PREDICTED: scarecrow-like protein 18               152   4e-39    Sesamum indicum [beniseed]
gb|KJB64828.1|  hypothetical protein B456_010G067000                    152   5e-39    Gossypium raimondii
ref|XP_008246525.1|  PREDICTED: scarecrow-like protein 18               152   5e-39    
ref|XP_010480099.1|  PREDICTED: scarecrow-like protein 18               151   9e-39    Camelina sativa [gold-of-pleasure]
ref|XP_008382900.1|  PREDICTED: protein SCARECROW 1-like                152   9e-39    
ref|XP_002975137.1|  GRAS family protein                                153   1e-38    Selaginella moellendorffii
ref|XP_002300599.1|  hypothetical protein POPTR_0001s47720g             150   1e-38    Populus trichocarpa [western balsam poplar]
ref|XP_008372571.1|  PREDICTED: protein SCARECROW-like                  152   1e-38    
ref|XP_002977541.1|  hypothetical protein SELMODRAFT_107274             150   1e-38    
emb|CBI17738.3|  unnamed protein product                                150   2e-38    Vitis vinifera
ref|XP_010921930.1|  PREDICTED: scarecrow-like protein 3                150   2e-38    Elaeis guineensis
gb|AAR31213.1|  GAI protein                                             151   2e-38    Oryza sativa [red rice]
ref|NP_001043705.1|  Os01g0646300                                       150   2e-38    
dbj|BAH01283.1|  unnamed protein product                                150   2e-38    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010254273.1|  PREDICTED: DELLA protein GAI-like                  151   2e-38    Nelumbo nucifera [Indian lotus]
ref|XP_010229736.1|  PREDICTED: DELLA protein GAI1-like                 149   2e-38    Brachypodium distachyon [annual false brome]
gb|AHA85560.1|  lateral                                                 150   2e-38    Dimocarpus longan [longan]
ref|XP_011044695.1|  PREDICTED: scarecrow-like protein 18 isoform X1    149   3e-38    Populus euphratica
ref|XP_002278039.1|  PREDICTED: scarecrow-like protein 3                149   4e-38    Vitis vinifera
ref|XP_002960248.1|  GRAS-family protein                                150   4e-38    Selaginella moellendorffii
ref|XP_008798776.1|  PREDICTED: scarecrow-like protein 18               149   5e-38    
ref|XP_006829673.2|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    149   6e-38    
ref|XP_007200779.1|  hypothetical protein PRUPE_ppa023981mg             149   6e-38    
ref|XP_009411905.1|  PREDICTED: protein MONOCULM 1-like                 149   7e-38    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644434.1|  PREDICTED: DELLA protein SLN1-like                 149   7e-38    Oryza brachyantha
ref|XP_012088061.1|  PREDICTED: scarecrow-like protein 3                148   7e-38    Jatropha curcas
emb|CDM83536.1|  unnamed protein product                                149   8e-38    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009369454.1|  PREDICTED: protein SCARECROW-like                  149   9e-38    Pyrus x bretschneideri [bai li]
ref|XP_004252879.1|  PREDICTED: scarecrow-like protein 3                149   9e-38    Solanum lycopersicum
ref|XP_008235644.1|  PREDICTED: protein SCARECROW-like                  149   1e-37    
ref|XP_011007026.1|  PREDICTED: scarecrow-like protein 18               148   1e-37    Populus euphratica
ref|XP_001785259.1|  PAL1B encoding AtPAT1-like protein                 146   1e-37    
gb|ABU63412.1|  DELLA protein                                           149   1e-37    Selaginella kraussiana
ref|XP_010925126.1|  PREDICTED: DELLA protein DWARF8-like               149   1e-37    Elaeis guineensis
ref|XP_010502027.1|  PREDICTED: scarecrow-like protein 18               146   2e-37    Camelina sativa [gold-of-pleasure]
gb|EPS64600.1|  lateral suppressor protein                              147   2e-37    Genlisea aurea
ref|XP_010929728.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    149   2e-37    
ref|XP_008242703.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    148   2e-37    Prunus mume [ume]
ref|XP_004292218.1|  PREDICTED: protein SCARECROW-like                  148   2e-37    Fragaria vesca subsp. vesca
ref|XP_002983047.1|  hypothetical protein SELMODRAFT_117648             145   3e-37    
emb|CDY37137.1|  BnaC06g03620D                                          150   3e-37    Brassica napus [oilseed rape]
ref|XP_007032856.1|  GRAS family transcription factor                   146   3e-37    
ref|XP_009336159.1|  PREDICTED: protein SCARECROW-like                  147   3e-37    Pyrus x bretschneideri [bai li]
ref|XP_010061376.1|  PREDICTED: scarecrow-like protein 18               147   4e-37    Eucalyptus grandis [rose gum]
ref|XP_009147840.1|  PREDICTED: scarecrow-like protein 3                146   5e-37    Brassica rapa
gb|KJB10562.1|  hypothetical protein B456_001G207600                    145   6e-37    Gossypium raimondii
ref|XP_002303907.2|  hypothetical protein POPTR_0003s20100g             146   7e-37    
ref|XP_002318447.1|  LATERAL SUPPRESSOR family protein                  145   7e-37    Populus trichocarpa [western balsam poplar]
emb|CDY22795.1|  BnaA06g02820D                                          145   8e-37    Brassica napus [oilseed rape]
ref|XP_008799986.1|  PREDICTED: scarecrow-like protein 21               146   8e-37    Phoenix dactylifera
ref|XP_006484335.1|  PREDICTED: DELLA protein GAI1-like                 145   1e-36    Citrus sinensis [apfelsine]
ref|XP_006438138.1|  hypothetical protein CICLE_v10031305mg             145   1e-36    
emb|CDY54362.1|  BnaC06g07300D                                          144   2e-36    Brassica napus [oilseed rape]
ref|NP_175954.1|  GRAS family transcription factor                      145   2e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001758085.1|  predicted protein                                  144   2e-36    
ref|XP_002971659.1|  hypothetical protein SELMODRAFT_95651              145   2e-36    
ref|XP_010928897.1|  PREDICTED: protein MONOCULM 1-like                 144   2e-36    
gb|KDO82051.1|  hypothetical protein CISIN_1g037028mg                   145   2e-36    Citrus sinensis [apfelsine]
ref|XP_008777332.1|  PREDICTED: DELLA protein GAI-like                  145   3e-36    Phoenix dactylifera
ref|XP_008783096.1|  PREDICTED: protein MONOCULM 1-like                 144   3e-36    
ref|XP_002982488.1|  hypothetical protein SELMODRAFT_116890             144   3e-36    
gb|AEE69131.1|  GRAS family transcription factor                        144   3e-36    Citrus medica var. sarcodactylis
ref|XP_002525912.1|  DELLA protein SLR1, putative                       144   3e-36    Ricinus communis
ref|XP_010916867.1|  PREDICTED: DELLA protein GAI-like                  145   3e-36    Elaeis guineensis
gb|ADZ96431.1|  transcription factor LAS                                144   3e-36    Brassica napus [oilseed rape]
ref|XP_008809331.1|  PREDICTED: DELLA protein RHT-1-like                145   3e-36    
emb|CDY50028.1|  BnaA06g00290D                                          143   4e-36    Brassica napus [oilseed rape]
gb|ADZ96432.1|  transcription factor LAS                                144   5e-36    Brassica oleracea
dbj|BAJ93346.1|  predicted protein                                      144   5e-36    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADZ96433.1|  transcription factor LAS                                143   6e-36    
ref|XP_009147499.1|  PREDICTED: scarecrow-like protein 18               143   7e-36    
emb|CDP03761.1|  unnamed protein product                                143   9e-36    
ref|XP_002267538.1|  PREDICTED: scarecrow-like protein 21               143   1e-35    
ref|XP_001782936.1|  PAL1A AtPAT1-like protein                          141   1e-35    
ref|XP_002965679.1|  GRAS family protein                                143   1e-35    
ref|XP_006392620.1|  hypothetical protein EUTSA_v10011480mg             142   1e-35    
emb|CBI28139.3|  unnamed protein product                                144   2e-35    
ref|XP_010690197.1|  PREDICTED: scarecrow-like protein 18               142   2e-35    
ref|XP_004969307.1|  PREDICTED: DELLA protein DWARF8-like               142   2e-35    
ref|XP_010415179.1|  PREDICTED: DELLA protein RGL1-like                 142   2e-35    
ref|XP_010511563.1|  PREDICTED: DELLA protein RGL1-like                 142   3e-35    
ref|XP_010935956.1|  PREDICTED: protein SCARECROW-like                  140   3e-35    
ref|XP_010688103.1|  PREDICTED: DELLA protein GAI1-like                 142   3e-35    
ref|XP_009412995.1|  PREDICTED: DELLA protein RGA2-like                 142   3e-35    
gb|EYU46215.1|  hypothetical protein MIMGU_mgv1a006491mg                141   4e-35    
ref|XP_002965561.1|  GRAS family protein                                142   4e-35    
ref|XP_009603019.1|  PREDICTED: scarecrow-like protein 3                141   5e-35    
ref|XP_002891845.1|  hypothetical protein ARALYDRAFT_892558             140   5e-35    
ref|XP_010932712.1|  PREDICTED: DELLA protein RGL1-like                 141   6e-35    
ref|XP_006304499.1|  hypothetical protein CARUB_v10011270mg             140   6e-35    
dbj|BAD42666.1|  lateral suppressor-like protein                        140   6e-35    
ref|XP_002977371.1|  hypothetical protein SELMODRAFT_106700             140   7e-35    
ref|XP_002981009.1|  GRAS family protein                                142   7e-35    
emb|CDP16466.1|  unnamed protein product                                137   7e-35    
gb|EAZ17249.1|  hypothetical protein OsJ_32770                          141   8e-35    
ref|XP_002982342.1|  hypothetical protein SELMODRAFT_116328             140   1e-34    
ref|XP_008810295.1|  PREDICTED: protein SCARECROW-like                  138   1e-34    
ref|XP_009603492.1|  PREDICTED: DELLA protein RGL1-like                 140   1e-34    
ref|NP_001065617.1|  Os11g0124300                                       141   1e-34    
ref|XP_006302161.1|  hypothetical protein CARUB_v10020171mg             140   1e-34    
gb|KHN27990.1|  Chitin-inducible gibberellin-responsive protein 1       139   1e-34    
ref|XP_010039137.1|  PREDICTED: scarecrow-like protein 21               140   1e-34    
ref|XP_004296106.2|  PREDICTED: scarecrow-like protein 18 isoform X1    139   1e-34    
dbj|BAD22576.1|  SCARECROW                                              141   1e-34    
ref|XP_003561023.1|  PREDICTED: DELLA protein GAI-like                  140   2e-34    
ref|XP_002887024.1|  hypothetical protein ARALYDRAFT_475738             140   2e-34    
ref|XP_004309796.2|  PREDICTED: DELLA protein RGA2-like                 140   2e-34    
ref|XP_002458232.1|  hypothetical protein SORBIDRAFT_03g029470          140   2e-34    
ref|XP_002306863.2|  hypothetical protein POPTR_0005s24850g             140   2e-34    
ref|XP_007021111.1|  GRAS family transcription factor isoform 2         139   2e-34    
ref|XP_011097798.1|  PREDICTED: scarecrow-like protein 18               139   2e-34    
ref|XP_006592888.1|  PREDICTED: chitin-inducible gibberellin-resp...    139   2e-34    
ref|XP_003540429.1|  PREDICTED: chitin-inducible gibberellin-resp...    140   2e-34    
ref|XP_007021113.1|  GRAS family transcription factor isoform 4         140   2e-34    
ref|XP_007021110.1|  GRAS family transcription factor isoform 1         140   2e-34    
ref|XP_010319111.1|  PREDICTED: DELLA protein RGL1-like                 139   2e-34    
ref|XP_008674050.1|  PREDICTED: DELLA protein SLN1-like                 139   2e-34    
gb|AJC52489.1|  SCR                                                     142   2e-34    
ref|XP_001770794.1|  predicted protein                                  139   3e-34    
ref|XP_003531153.1|  PREDICTED: DELLA protein GAI1-like                 139   3e-34    
ref|XP_007210018.1|  hypothetical protein PRUPE_ppa016418mg             139   3e-34    
dbj|BAJ91036.1|  predicted protein                                      140   3e-34    
ref|XP_008239620.1|  PREDICTED: DELLA protein RGL1-like                 139   3e-34    
ref|XP_009759684.1|  PREDICTED: scarecrow-like protein 3                138   3e-34    
gb|ABH85406.1|  SCARECROW                                               141   3e-34    
ref|XP_011080303.1|  PREDICTED: protein SCARECROW-like                  139   3e-34    
ref|XP_002974950.1|  GRAS family protein                                140   4e-34    
gb|ADA84480.1|  GRAS                                                    139   4e-34    
ref|NP_001147776.1|  GRAS family transcription factor containing ...    138   4e-34    
ref|XP_006351563.1|  PREDICTED: DELLA protein RGL1-like                 139   4e-34    
ref|XP_007050241.1|  GRAS family transcription factor                   139   5e-34    
ref|XP_003543283.1|  PREDICTED: chitin-inducible gibberellin-resp...    139   5e-34    
ref|XP_002966500.1|  GRAS family protein                                140   5e-34    
ref|XP_006443804.1|  hypothetical protein CICLE_v10019735mg             138   5e-34    
gb|ABU63411.1|  DELLA protein                                           138   7e-34    
emb|CAN65092.1|  hypothetical protein VITISV_040971                     136   7e-34    
ref|XP_011024077.1|  PREDICTED: DELLA protein RGL1-like                 138   8e-34    
gb|EYU25601.1|  hypothetical protein MIMGU_mgv1a003589mg                138   8e-34    
gb|AHB17744.1|  GA repressor DELLA                                      138   8e-34    
ref|XP_012079895.1|  PREDICTED: DELLA protein RGL1-like                 138   9e-34    
ref|XP_002282942.1|  PREDICTED: chitin-inducible gibberellin-resp...    138   9e-34    
gb|ACN28379.1|  unknown                                                 135   9e-34    
ref|XP_009387556.1|  PREDICTED: scarecrow-like transcription fact...    138   9e-34    
dbj|BAI94488.1|  GRAS family transcription factor                       138   1e-33    
ref|XP_006391387.1|  hypothetical protein EUTSA_v10018436mg             137   1e-33    
emb|CDP13289.1|  unnamed protein product                                137   1e-33    
gb|AJC52496.1|  SCL10                                                   139   1e-33    
ref|XP_007022629.1|  GRAS family transcription factor                   137   1e-33    
ref|XP_002456925.1|  hypothetical protein SORBIDRAFT_03g045660          137   1e-33    
ref|XP_010270381.1|  PREDICTED: scarecrow-like protein 1                137   1e-33    
gb|AHB17742.1|  GA repressor DELLA                                      137   1e-33    
ref|XP_001786265.1|  predicted protein                                  135   1e-33    
ref|XP_011048259.1|  PREDICTED: scarecrow-like protein 21               137   1e-33    
ref|XP_010552430.1|  PREDICTED: scarecrow-like protein 18               137   1e-33    
ref|XP_006826543.1|  PREDICTED: DELLA protein RGL1                      137   1e-33    
gb|EEE52158.1|  hypothetical protein OsJ_34005                          139   2e-33    
emb|CDP05816.1|  unnamed protein product                                137   2e-33    
ref|XP_009336573.1|  PREDICTED: DELLA protein RGL1-like                 137   2e-33    
emb|CAN73735.1|  hypothetical protein VITISV_032120                     135   2e-33    
ref|XP_001782213.1|  predicted protein                                  135   2e-33    
ref|XP_010027286.1|  PREDICTED: DELLA protein GAI-like                  137   2e-33    
ref|XP_012070709.1|  PREDICTED: chitin-inducible gibberellin-resp...    137   2e-33    
gb|KCW62009.1|  hypothetical protein EUGRSUZ_H04688                     136   2e-33    
ref|XP_002994174.1|  hypothetical protein SELMODRAFT_432115             139   2e-33    
ref|XP_008448967.1|  PREDICTED: scarecrow-like protein 18               135   2e-33    
ref|XP_002322227.1|  hypothetical protein POPTR_0015s10310g             137   2e-33    
ref|XP_012070710.1|  PREDICTED: chitin-inducible gibberellin-resp...    137   2e-33    
ref|XP_002266415.1|  PREDICTED: scarecrow-like protein 1                137   2e-33    
emb|CDY70426.1|  BnaCnng68300D                                          136   3e-33    
ref|XP_006452128.1|  hypothetical protein CICLE_v10007843mg             137   3e-33    
ref|XP_002515010.1|  DELLA protein GAI1, putative                       136   3e-33    
ref|XP_002993223.1|  hypothetical protein SELMODRAFT_136689             136   3e-33    
ref|XP_009127484.1|  PREDICTED: DELLA protein RGL1                      136   3e-33    
gb|KJB81853.1|  hypothetical protein B456_013G164700                    134   3e-33    
ref|XP_009346474.1|  PREDICTED: chitin-inducible gibberellin-resp...    136   3e-33    
ref|XP_002965807.1|  GRAS family protein                                136   3e-33    
emb|CDY55037.1|  BnaCnng28010D                                          136   4e-33    
ref|XP_009334053.1|  PREDICTED: chitin-inducible gibberellin-resp...    136   4e-33    
gb|EAY99130.1|  hypothetical protein OsI_21089                          136   4e-33    
gb|KDP24294.1|  hypothetical protein JCGZ_25590                         135   4e-33    
dbj|BAJ96029.1|  predicted protein                                      135   4e-33    
ref|XP_011084871.1|  PREDICTED: DELLA protein RGL1-like                 135   4e-33    
ref|XP_009620744.1|  PREDICTED: DELLA protein RGL1-like                 136   4e-33    
ref|XP_010037969.1|  PREDICTED: protein SCARECROW-like                  135   5e-33    
ref|XP_001770840.1|  predicted protein                                  134   5e-33    
ref|XP_003526176.1|  PREDICTED: chitin-inducible gibberellin-resp...    136   5e-33    
ref|XP_003608883.1|  GRAS family transcription factor                   135   5e-33    
ref|XP_004294325.1|  PREDICTED: scarecrow-like protein 21               136   5e-33    
ref|XP_008656875.1|  PREDICTED: scarecrow-like protein 3                135   5e-33    
ref|XP_002272465.2|  PREDICTED: protein SCARECROW-like                  135   5e-33    
ref|NP_001056394.1|  Os05g0574900                                       135   6e-33    
gb|KCW60632.1|  hypothetical protein EUGRSUZ_H03356                     136   6e-33    
ref|XP_009396052.1|  PREDICTED: chitin-inducible gibberellin-resp...    135   6e-33    
ref|XP_001758181.1|  predicted protein                                  135   6e-33    
gb|KHG18009.1|  Scarecrow-like protein 1                                136   6e-33    
gb|KJB81854.1|  hypothetical protein B456_013G164700                    135   6e-33    
gb|KCW47573.1|  hypothetical protein EUGRSUZ_K01320                     137   7e-33    
gb|KHF99028.1|  Scarecrow-like protein 1                                135   7e-33    
ref|XP_011043671.1|  PREDICTED: scarecrow-like protein 18               135   7e-33    
ref|XP_009769411.1|  PREDICTED: DELLA protein RGL1-like                 135   7e-33    
ref|XP_009359535.1|  PREDICTED: DELLA protein RGL1-like                 135   7e-33    
ref|XP_010036052.1|  PREDICTED: protein SCARECROW                       137   7e-33    
ref|XP_008365835.1|  PREDICTED: chitin-inducible gibberellin-resp...    135   8e-33    
ref|XP_009409866.1|  PREDICTED: protein MONOCULM 1-like                 134   8e-33    
ref|XP_011028840.1|  PREDICTED: protein SCARECROW-like                  135   8e-33    
ref|XP_011097451.1|  PREDICTED: DELLA protein GAI-like                  135   8e-33    
ref|XP_008386036.1|  PREDICTED: scarecrow-like protein 21               135   8e-33    
ref|XP_008366473.1|  PREDICTED: scarecrow-like protein 21               135   9e-33    
ref|XP_010649367.1|  PREDICTED: scarecrow-like protein 1                135   1e-32    
ref|XP_011099169.1|  PREDICTED: scarecrow-like protein 3                134   1e-32    
ref|NP_176809.1|  DELLA protein RGL1                                    135   1e-32    
emb|CBI20484.3|  unnamed protein product                                134   1e-32    
ref|XP_006476980.1|  PREDICTED: DELLA protein GAI1-like                 135   1e-32    
ref|XP_002448913.1|  hypothetical protein SORBIDRAFT_05g001500          135   1e-32    
ref|XP_009768414.1|  PREDICTED: DELLA protein RGL1-like                 134   1e-32    
gb|ACY40694.1|  GRAS family transcription factor                        134   1e-32    
emb|CAA12242.1|  RGA-like                                               135   1e-32    
ref|XP_011004025.1|  PREDICTED: protein SCARECROW-like                  134   1e-32    
gb|KJB14096.1|  hypothetical protein B456_002G110100                    134   1e-32    
ref|XP_009395599.1|  PREDICTED: scarecrow-like protein 21               134   1e-32    
ref|XP_002263040.1|  PREDICTED: DELLA protein GAI                       134   2e-32    
gb|KDO69327.1|  hypothetical protein CISIN_1g040125mg                   134   2e-32    
ref|XP_010470510.1|  PREDICTED: DELLA protein RGL1 isoform X1           134   2e-32    
ref|XP_007037896.1|  GRAS family transcription factor                   134   2e-32    
gb|EYU43074.1|  hypothetical protein MIMGU_mgv1a021462mg                134   2e-32    
ref|XP_006440048.1|  hypothetical protein CICLE_v10019777mg             134   2e-32    
ref|XP_009355562.1|  PREDICTED: scarecrow-like protein 21               134   2e-32    
emb|CAN60709.1|  hypothetical protein VITISV_027284                     134   2e-32    
ref|NP_001168484.1|  protein SCARECROW                                  135   2e-32    
ref|XP_009388384.1|  PREDICTED: protein MONOCULM 1                      133   2e-32    
ref|XP_004977413.1|  PREDICTED: protein SCARECROW-like                  135   2e-32    
ref|XP_009407441.1|  PREDICTED: DELLA protein GAI-like                  134   2e-32    
ref|XP_008806184.1|  PREDICTED: scarecrow-like protein 18               133   3e-32    
ref|XP_010267831.1|  PREDICTED: chitin-inducible gibberellin-resp...    134   3e-32    
ref|XP_003525665.1|  PREDICTED: DELLA protein RGL1-like                 133   3e-32    
ref|XP_007214671.1|  hypothetical protein PRUPE_ppa003323mg             134   3e-32    
gb|ABI34432.1|  CRY                                                     133   3e-32    
gb|KHN20452.1|  Chitin-inducible gibberellin-responsive protein 1       133   3e-32    
ref|XP_002520249.1|  Chitin-inducible gibberellin-responsive prot...    134   3e-32    
ref|XP_007144875.1|  hypothetical protein PHAVU_007G191300g             133   3e-32    
gb|AHB17743.1|  GA repressor DELLA                                      134   3e-32    
gb|EYU19196.1|  hypothetical protein MIMGU_mgv1a003912mg                134   3e-32    
ref|XP_008800637.1|  PREDICTED: LOW QUALITY PROTEIN: chitin-induc...    133   3e-32    
ref|XP_006370596.1|  hypothetical protein POPTR_0001s44090g             134   4e-32    
ref|XP_011027392.1|  PREDICTED: scarecrow-like protein 1                134   4e-32    
gb|KJB13547.1|  hypothetical protein B456_002G080600                    133   4e-32    
ref|XP_010105178.1|  hypothetical protein L484_006916                   133   4e-32    
ref|XP_010645115.1|  PREDICTED: DELLA protein RGL1-like                 133   4e-32    
ref|XP_011014635.1|  PREDICTED: scarecrow-like transcription fact...    133   4e-32    
gb|KDP26739.1|  hypothetical protein JCGZ_17897                         133   4e-32    
gb|KJB38085.1|  hypothetical protein B456_006G236200                    135   4e-32    
emb|CBI31126.3|  unnamed protein product                                134   4e-32    
gb|KJB13548.1|  hypothetical protein B456_002G080600                    133   5e-32    
ref|XP_012085888.1|  PREDICTED: DELLA protein RGL1-like                 133   5e-32    
gb|KGN55959.1|  hypothetical protein Csa_3G039300                       132   5e-32    
ref|XP_003566939.1|  PREDICTED: DELLA protein SLR1-like                 133   5e-32    
gb|AJZ72812.1|  LAS                                                     126   5e-32    
ref|XP_006592516.1|  PREDICTED: chitin-inducible gibberellin-resp...    133   5e-32    
gb|KHG10483.1|  Protein SCARECROW -like protein                         135   5e-32    
gb|KJB29092.1|  hypothetical protein B456_005G083700                    132   5e-32    
ref|XP_003617697.1|  Scarecrow-like transcription factor PAT1           132   6e-32    
ref|XP_006365320.1|  PREDICTED: protein SCARECROW-like                  135   6e-32    
ref|XP_010694285.1|  PREDICTED: scarecrow-like protein 21               133   6e-32    
ref|XP_004147990.2|  PREDICTED: scarecrow-like protein 18               131   6e-32    
ref|XP_011018909.1|  PREDICTED: protein SCARECROW-like                  135   6e-32    
gb|KHN43091.1|  Chitin-inducible gibberellin-responsive protein 1       131   6e-32    
gb|KJB29091.1|  hypothetical protein B456_005G083700                    132   6e-32    
ref|XP_008244327.1|  PREDICTED: scarecrow-like protein 21               133   7e-32    
gb|KJB29088.1|  hypothetical protein B456_005G083700                    132   7e-32    
gb|KJB29087.1|  hypothetical protein B456_005G083700                    133   7e-32    
ref|XP_004515897.1|  PREDICTED: DELLA protein RGL1-like                 132   7e-32    
ref|XP_008804655.1|  PREDICTED: protein SCARECROW 2-like                134   7e-32    
ref|XP_002318703.1|  hypothetical protein POPTR_0012s09550g             132   7e-32    
ref|XP_006381294.1|  hypothetical protein POPTR_0006s11500g             135   7e-32    
gb|EPS59520.1|  hypothetical protein M569_15285                         132   8e-32    
gb|EAY82094.1|  hypothetical protein OsI_37294                          133   8e-32    
ref|XP_007137518.1|  hypothetical protein PHAVU_009G133800g             133   8e-32    
ref|XP_004978490.1|  PREDICTED: protein SCARECROW-like                  134   8e-32    
ref|XP_001780523.1|  predicted protein                                  131   9e-32    
gb|AJC52490.1|  SCL2                                                    134   1e-31    
gb|EAY79759.1|  hypothetical protein OsI_34915                          132   1e-31    
gb|KGN63511.1|  hypothetical protein Csa_1G002800                       132   1e-31    
ref|XP_002264349.1|  PREDICTED: protein SCARECROW                       134   1e-31    
gb|AJC52494.1|  SCL7                                                    127   1e-31    
ref|XP_004138071.1|  PREDICTED: DELLA protein GAI-like                  132   1e-31    
gb|AEK06229.1|  GAI1                                                    132   1e-31    
ref|XP_002302035.2|  hypothetical protein POPTR_0002s03740g             132   1e-31    
ref|XP_010104285.1|  hypothetical protein L484_005388                   132   1e-31    
ref|XP_009615228.1|  PREDICTED: protein SCARECROW-like                  134   1e-31    
ref|XP_011040510.1|  PREDICTED: DELLA protein RGL1-like                 132   1e-31    



>ref|XP_004245645.1| PREDICTED: scarecrow-like protein 28 [Solanum lycopersicum]
Length=679

 Score =   407 bits (1047),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 217/248 (88%), Gaps = 2/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P +H+RITGIGESKQ+L+ETGDRLA FAE LNLAFEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  433  PPTHVRITGIGESKQDLVETGDRLAEFAEALNLAFEFHPVVDRLEDVRLWMLHVKEGESV  492

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQMH++LYD+SG  L DFLGLIRSTNP  ++MAEQEAEH+E SLE+RLVNSL+YY
Sbjct  493  AVNCVLQMHRLLYDSSGGILRDFLGLIRSTNPTIILMAEQEAEHNEPSLEARLVNSLRYY  552

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +AVFDS+   LPLDSP R KIEE+FAR+IRNIIACEGR+R ERH  FGKWRK LMEQG F
Sbjct  553  AAVFDSIAFGLPLDSPARIKIEELFARDIRNIIACEGRDRTERHECFGKWRK-LMEQGGF  611

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAGS  25
            RC GITERELLQSQMLLKM+S E Y+V KQG DD  LTLSW DQPL TVSAWTP D AGS
Sbjct  612  RCTGITERELLQSQMLLKMYSCEDYRVTKQGNDDAALTLSWLDQPLCTVSAWTPIDAAGS  671

Query  24   SSSYSQPT  1
            SSSY QP+
Sbjct  672  SSSYYQPS  679



>ref|XP_006358871.1| PREDICTED: scarecrow-like protein 28-like [Solanum tuberosum]
Length=679

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 217/248 (88%), Gaps = 2/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P +H+RITGIGESKQ+L+ETGDRLA FAE LNLAFEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  433  PPTHVRITGIGESKQDLVETGDRLAEFAEALNLAFEFHPVVDRLEDVRLWMLHVKEGESV  492

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQMH++LYD+SG  L DFLGLIRSTNP  ++MAEQEAEH+E SLE+RLVNSL+YY
Sbjct  493  AVNCVLQMHRLLYDSSGGILRDFLGLIRSTNPTIILMAEQEAEHNEPSLEARLVNSLRYY  552

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +AVFDS+  +LPLDSP R KIEE+FAR+IRNIIACEGR+R ERH  FGKWRK LMEQG F
Sbjct  553  AAVFDSIGFSLPLDSPARIKIEELFARDIRNIIACEGRDRTERHECFGKWRK-LMEQGGF  611

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAGS  25
            RC GITEREL QSQMLLKM+S E Y+V KQG DD  LTLSW DQPL TVSAWTP D AGS
Sbjct  612  RCTGITERELFQSQMLLKMYSCEDYRVTKQGNDDAALTLSWLDQPLCTVSAWTPIDAAGS  671

Query  24   SSSYSQPT  1
            SSSY QP+
Sbjct  672  SSSYYQPS  679



>ref|XP_009609251.1| PREDICTED: scarecrow-like protein 28 [Nicotiana tomentosiformis]
Length=674

 Score =   405 bits (1040),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 217/248 (88%), Gaps = 2/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P +H+RITGIGESKQ+L+ETGDRLA FAE LNLAFEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  428  PPTHVRITGIGESKQDLVETGDRLAEFAEALNLAFEFHPVVDRLEDVRLWMLHVKEGESV  487

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC LQMH++LYD+SG  L DFLGLIRSTNP  ++MAEQEAEH+E SLE+RLVNSL+YY
Sbjct  488  AVNCALQMHRLLYDSSGGILRDFLGLIRSTNPTIILMAEQEAEHNEPSLEARLVNSLRYY  547

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +AVFDS+  +LPLDSP R KIEE+FAR+IRNIIACEGR+R ERH  FGKWRK LMEQG F
Sbjct  548  AAVFDSIGFSLPLDSPSRIKIEELFARDIRNIIACEGRDRTERHECFGKWRK-LMEQGGF  606

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAGS  25
            RC GITERELLQSQMLLKM+S E Y+V KQG DD  LTLSW DQPL TVSAW+P D AGS
Sbjct  607  RCTGITERELLQSQMLLKMYSCEDYRVIKQGNDDAALTLSWLDQPLCTVSAWSPLDAAGS  666

Query  24   SSSYSQPT  1
            SSSY QP+
Sbjct  667  SSSYYQPS  674



>gb|KJB52044.1| hypothetical protein B456_008G243900 [Gossypium raimondii]
 gb|KJB52045.1| hypothetical protein B456_008G243900 [Gossypium raimondii]
 gb|KJB52046.1| hypothetical protein B456_008G243900 [Gossypium raimondii]
Length=670

 Score =   400 bits (1027),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 218/248 (88%), Gaps = 2/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+R+TGIGESKQEL +TGDRL+GFAE LNL FEFHPVVDRLEDVRLWMLHVKE E+V
Sbjct  424  PPSHVRVTGIGESKQELNDTGDRLSGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEKETV  483

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G AL D LGLIRSTNP  VVMAEQEAEH+  SLE+R+ NSL+YY
Sbjct  484  AVNCVFQLHKTLYDGNGGALRDLLGLIRSTNPAVVVMAEQEAEHNVLSLEARVTNSLRYY  543

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+DS+LP++SPVR K+EEMFAREIRNIIACEG +R ERH SF KWRK LMEQG+F
Sbjct  544  SAIFDSIDSSLPMESPVRMKVEEMFAREIRNIIACEGSDRFERHESFEKWRK-LMEQGRF  602

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAWTPFDIAGS  25
            RC+GI+ERELLQSQMLLKM++ E+Y V+KQGED G LTLSW DQPLY+VSAWTP D+AGS
Sbjct  603  RCIGISERELLQSQMLLKMYTCENYSVKKQGEDGGALTLSWLDQPLYSVSAWTPIDVAGS  662

Query  24   SSSYSQPT  1
            SSS+ QP 
Sbjct  663  SSSFPQPN  670



>ref|XP_009782602.1| PREDICTED: scarecrow-like protein 28 [Nicotiana sylvestris]
Length=675

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/246 (78%), Positives = 214/246 (87%), Gaps = 2/246 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P +H+RITGIGESKQ+L+ETGDRLA FAE LNLAFEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  429  PPTHVRITGIGESKQDLVETGDRLAEFAEALNLAFEFHPVVDRLEDVRLWMLHVKEGESV  488

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC LQMH++LYD+SG  L DFLGLIRSTNP  ++MAEQEAEH+E SLE+RLVNSL+YY
Sbjct  489  AVNCALQMHRLLYDSSGGILRDFLGLIRSTNPTIILMAEQEAEHNEPSLEARLVNSLRYY  548

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +AVFDS+  +LP DSP R KIEE+FAR+IRNIIACEGR+R ERH  FGKWRK LMEQG F
Sbjct  549  AAVFDSIGFSLPPDSPSRIKIEELFARDIRNIIACEGRDRTERHECFGKWRK-LMEQGGF  607

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAGS  25
            RC GITERELLQSQMLLKM+S E ++V KQG DD  LTLSW DQPL TVSAW+P D AGS
Sbjct  608  RCTGITERELLQSQMLLKMYSCEDFRVIKQGNDDAALTLSWLDQPLCTVSAWSPLDAAGS  667

Query  24   SSSYSQ  7
            SSSY Q
Sbjct  668  SSSYYQ  673



>ref|XP_011033794.1| PREDICTED: scarecrow-like protein 28 [Populus euphratica]
Length=665

 Score =   396 bits (1017),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 214/247 (87%), Gaps = 2/247 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRL GFAE LNL FEFHPVVDRLEDVRLWMLHVKE E V
Sbjct  419  PPSHVRITGIGESKQELNETGDRLTGFAEALNLPFEFHPVVDRLEDVRLWMLHVKESECV  478

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            A+NC+ QMHK LYD SG AL DFLGLIRSTNP  V+MAEQEAEH+  +LE+R+ NSLKYY
Sbjct  479  AINCIFQMHKTLYDGSGGALRDFLGLIRSTNPTIVLMAEQEAEHNAPNLETRVCNSLKYY  538

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FD++DS+LP +SPVR K+EEM+AREIRN+IACEG +R ERH SF KW+K LMEQG  
Sbjct  539  SAIFDAIDSSLPFNSPVRIKLEEMYAREIRNVIACEGSDRHERHESFDKWKK-LMEQGGL  597

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQG-EDDGLTLSWEDQPLYTVSAWTPFDIAGS  25
            RCVGI ERE+LQ+QMLLKM+S +SYKV+KQG E+  LTLSW DQPLYTVSAWTP DIAGS
Sbjct  598  RCVGIDEREMLQAQMLLKMYSCDSYKVKKQGHEEAALTLSWLDQPLYTVSAWTPLDIAGS  657

Query  24   SSSYSQP  4
            S+S+SQP
Sbjct  658  STSFSQP  664



>ref|XP_002303565.1| scarecrow transcription factor family protein [Populus trichocarpa]
 gb|EEE78544.1| scarecrow transcription factor family protein [Populus trichocarpa]
Length=665

 Score =   396 bits (1017),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 215/247 (87%), Gaps = 2/247 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE E V
Sbjct  419  PPSHVRITGIGESKQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKERECV  478

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            A+NC+ QMHK LYD SG AL DFLGLIRSTNP  V++AEQEAEH+  +LE+R+ NSLKYY
Sbjct  479  AINCIFQMHKTLYDGSGGALRDFLGLIRSTNPTIVLLAEQEAEHNAPNLETRVCNSLKYY  538

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+DS+LP +SPVR K+EEM+AREIRN++ACEG +R ERH SF KW+K LMEQG  
Sbjct  539  SAIFDSIDSSLPFNSPVRIKLEEMYAREIRNVVACEGSDRHERHESFDKWKK-LMEQGGL  597

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQG-EDDGLTLSWEDQPLYTVSAWTPFDIAGS  25
            RCVGI ERE+LQ+QMLLKM+S +SYKV+KQG E+  LTLSW DQPLYTVSAWTP DIAGS
Sbjct  598  RCVGIDEREMLQAQMLLKMYSCDSYKVKKQGHEEAALTLSWLDQPLYTVSAWTPLDIAGS  657

Query  24   SSSYSQP  4
            S+S+SQP
Sbjct  658  STSFSQP  664



>gb|KEH31708.1| GRAS family transcription factor [Medicago truncatula]
Length=677

 Score =   391 bits (1004),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/250 (74%), Positives = 217/250 (87%), Gaps = 3/250 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITG+GESKQEL ETGDRLAGFAE LNL F+FHPVVDRLEDVRLWMLHVKE E+V
Sbjct  428  PPSHVRITGVGESKQELNETGDRLAGFAEALNLPFDFHPVVDRLEDVRLWMLHVKEHETV  487

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQ+HK L+D SG AL DFLGLIRSTNP  VVMAEQEAEH+E+ L+SR+ NSLKYY
Sbjct  488  AVNCVLQLHKTLHDGSGGALRDFLGLIRSTNPTIVVMAEQEAEHNEARLDSRVCNSLKYY  547

Query  381  SAVFDSLD-STLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FDS+D S LPL+SP+R KIEEM AREIRNI+ACEGR+RLERH SFG WRK+++E G 
Sbjct  548  SALFDSIDHSGLPLESPMRIKIEEMLAREIRNIVACEGRDRLERHQSFGNWRKMIVEHGG  607

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQGEDD--GLTLSWEDQPLYTVSAWTPFDIA  31
            FRC+G+T+REL+QSQ LLKM+S ++Y V+KQ ++    LTL W DQPLYTVS+WTP D+A
Sbjct  608  FRCMGVTDRELIQSQFLLKMYSCDNYSVQKQEQEGATALTLGWLDQPLYTVSSWTPIDVA  667

Query  30   GSSSSYSQPT  1
            GSSSS+SQP 
Sbjct  668  GSSSSFSQPA  677



>ref|XP_004515801.1| PREDICTED: scarecrow-like protein 28-like [Cicer arietinum]
Length=683

 Score =   388 bits (996),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 216/250 (86%), Gaps = 5/250 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITG+GESKQEL ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE E+V
Sbjct  434  PPSHVRITGVGESKQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEHETV  493

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQ+HK LYD SG AL DFLGLIRSTNP  VVMAEQEAEH+ + L++R+ NSLKYY
Sbjct  494  AVNCVLQLHKTLYDGSGGALRDFLGLIRSTNPTVVVMAEQEAEHNAARLDTRVCNSLKYY  553

Query  381  SAVFDSLD-STLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++D S LPL+SP+R KIEEM+AREIRNI+ACEGR+RLERH SFG WRK+++E G 
Sbjct  554  SALFDAIDHSGLPLESPMRIKIEEMYAREIRNIVACEGRDRLERHQSFGNWRKMMVEHGG  613

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG---LTLSWEDQPLYTVSAWTPFDI  34
            FRC+G+TERE +QSQ L+KM+S ++Y ++KQ E +G   LTL W DQPLYTVS+W P D+
Sbjct  614  FRCMGVTERETIQSQFLMKMYSCDNYSIKKQ-EKEGATALTLGWLDQPLYTVSSWAPVDV  672

Query  33   AGSSSSYSQP  4
            AGSSSS+SQP
Sbjct  673  AGSSSSFSQP  682



>ref|XP_002276880.1| PREDICTED: scarecrow-like protein 28 [Vitis vinifera]
Length=676

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/238 (77%), Positives = 208/238 (87%), Gaps = 1/238 (0%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITG+GESKQEL ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVK+ ESV
Sbjct  431  PPSHVRITGVGESKQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKDKESV  490

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD SG AL DFLGLIRSTNP  V+MAEQEAEH+E SLE+R+ NSL+YY
Sbjct  491  AVNCIFQLHKTLYDGSGGALRDFLGLIRSTNPSIVLMAEQEAEHNELSLETRVSNSLRYY  550

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+D +LPLDSPVR K+EEMFAREIRNIIACEG +R+ERH SF KWR+  MEQG F
Sbjct  551  SAIFDSIDYSLPLDSPVRMKVEEMFAREIRNIIACEGSDRVERHESFEKWRR-RMEQGGF  609

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTPFDIAG  28
            RCVGI+ERE+LQSQMLLKM+S E+Y V K+G+D  LTLSW DQPLYTVSAWT  D+AG
Sbjct  610  RCVGISEREMLQSQMLLKMYSCENYSVSKRGQDAALTLSWLDQPLYTVSAWTQVDVAG  667



>ref|XP_007040131.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOY24632.1| GRAS family transcription factor [Theobroma cacao]
Length=671

 Score =   384 bits (987),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 210/239 (88%), Gaps = 2/239 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+R+TGIGESKQEL ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  425  PPSHVRVTGIGESKQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEKESV  484

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G AL DFLGL+RSTNP  V++AEQEAEH+  S+++R+ NSL+YY
Sbjct  485  AVNCVFQLHKTLYDGNGGALRDFLGLLRSTNPAVVIVAEQEAEHNVLSIDARVTNSLRYY  544

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+DS+LPL+SP+R KIEEMFAREIRNIIACEG +R ERH SF KWRK LMEQG F
Sbjct  545  SAIFDSMDSSLPLESPIRIKIEEMFAREIRNIIACEGSDRFERHESFEKWRK-LMEQGGF  603

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAG  28
            RC+G++ERELLQSQMLLKM+S E+Y V+KQG+D   LTLSW DQPLY+VSAWTP D+AG
Sbjct  604  RCMGVSERELLQSQMLLKMYSCENYSVKKQGQDGAALTLSWLDQPLYSVSAWTPVDVAG  662



>ref|XP_012086993.1| PREDICTED: scarecrow-like protein 28 [Jatropha curcas]
 gb|KDP25501.1| hypothetical protein JCGZ_20657 [Jatropha curcas]
Length=668

 Score =   384 bits (987),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 181/239 (76%), Positives = 207/239 (87%), Gaps = 2/239 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  422  PPSHVRITGIGESKQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEGESV  481

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            A+NC+ QMH+ LYD +G AL DFLGLIRST+P  V+MAEQEAEH+  +LE+R+ NSLKYY
Sbjct  482  AINCIFQMHRTLYDGNGGALRDFLGLIRSTSPTIVLMAEQEAEHNAPNLETRVCNSLKYY  541

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+DS+L LDSPVR K+EEMFAREIRNI+ACEG +RLERH SF KWR  LMEQG F
Sbjct  542  SAIFDSIDSSLALDSPVRIKVEEMFAREIRNIVACEGSDRLERHESFEKWRN-LMEQGGF  600

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAG  28
            RC+GI++RE+LQ QMLLKM+S E Y+V KQG+D   +TLSW DQPLYTVSAW P D+AG
Sbjct  601  RCMGISDREMLQCQMLLKMYSCEDYRVTKQGQDGAAVTLSWLDQPLYTVSAWAPVDVAG  659



>ref|XP_003525725.1| PREDICTED: scarecrow-like protein 28-like isoform X1 [Glycine 
max]
 ref|XP_006579605.1| PREDICTED: scarecrow-like protein 28-like isoform X2 [Glycine 
max]
 ref|XP_006579606.1| PREDICTED: scarecrow-like protein 28-like isoform X3 [Glycine 
max]
 ref|XP_006579607.1| PREDICTED: scarecrow-like protein 28-like isoform X4 [Glycine 
max]
Length=664

 Score =   382 bits (982),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/251 (73%), Positives = 217/251 (86%), Gaps = 4/251 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P +H+RITGIGESKQ+L ETG+RLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE E+V
Sbjct  414  PPTHVRITGIGESKQDLNETGERLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEHETV  473

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQ+HK LYD SG AL DFLGLIRSTNP  VV+AEQEAEH+E+ LE R+ NSLKYY
Sbjct  474  AVNCVLQLHKTLYDGSGGALRDFLGLIRSTNPSVVVVAEQEAEHNENRLEGRVCNSLKYY  533

Query  381  SAVFDSLD-STLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FDS+D S LP +S VR KIEEM+A+EIRNI+ACEGRER+ERH SFG WR++++EQG 
Sbjct  534  SALFDSIDESGLPQESAVRVKIEEMYAKEIRNIVACEGRERVERHESFGNWRRMMVEQGG  593

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQGED--DGLTLSWEDQPLYTVSAWTPFD-I  34
            FRC+G+TEREL QSQMLLKM+S ESY V+KQ ++   G+TLSW +QPLYTVSAW P D  
Sbjct  594  FRCMGVTERELSQSQMLLKMYSCESYSVKKQEKEGATGVTLSWLEQPLYTVSAWGPVDAA  653

Query  33   AGSSSSYSQPT  1
            AG+SSS+SQP+
Sbjct  654  AGTSSSFSQPS  664



>ref|XP_006440546.1| hypothetical protein CICLE_v10019186mg [Citrus clementina]
 gb|ESR53786.1| hypothetical protein CICLE_v10019186mg [Citrus clementina]
Length=667

 Score =   382 bits (982),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 211/248 (85%), Gaps = 2/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRL+GFAE LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  421  PPSHVRITGIGESKQELNETGDRLSGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEKESV  480

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LY  +G  L DFLGLIRSTNP  V+MAEQEAEH+   LE+R+ NSL+YY
Sbjct  481  AVNCIFQLHKTLYSGNGGVLRDFLGLIRSTNPTIVLMAEQEAEHNSPFLETRVSNSLRYY  540

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FD +D  LPLDSPVR KIEEMFARE+R+I+ACEG +RLERH SF  WR+ +MEQG F
Sbjct  541  SALFDLIDYCLPLDSPVRIKIEEMFAREVRSIVACEGSDRLERHESFENWRR-MMEQGGF  599

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAGS  25
            RC+GI+ERE+LQSQMLLKM+S E+Y V+KQG+D   +TLSW DQPLYTVSAW P D+AG 
Sbjct  600  RCMGISEREMLQSQMLLKMYSCENYGVKKQGQDGAAVTLSWIDQPLYTVSAWVPVDVAGG  659

Query  24   SSSYSQPT  1
            SSS+SQP+
Sbjct  660  SSSFSQPS  667



>ref|XP_011072178.1| PREDICTED: scarecrow-like protein 28 [Sesamum indicum]
Length=672

 Score =   382 bits (982),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 213/242 (88%), Gaps = 3/242 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL+ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE E+V
Sbjct  429  PPSHVRITGIGESKQELIETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEKETV  488

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
             VNC+ Q+HK+LYD++G  ++DFLGLIRSTN  A+VMAEQEA H+E S+++RL NSLKYY
Sbjct  489  VVNCVFQLHKMLYDSTGGTIMDFLGLIRSTNAEAIVMAEQEASHNEISVDARLSNSLKYY  548

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SAVFDS+DS+LPLDSPVR KIEEMFAREIRNIIACEGR+R ERH +F KW++ LMEQG F
Sbjct  549  SAVFDSVDSSLPLDSPVRIKIEEMFAREIRNIIACEGRDRYERHETFEKWQQ-LMEQGGF  607

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG--LTLSWEDQPLYTVSAWTPFDIAG  28
            RC+GI++RELLQ QM+LKM+S ESY+V+K+ ++    LTLSW DQPLYTVSAWTP DIAG
Sbjct  608  RCMGISDRELLQGQMMLKMYSCESYRVDKREQNGAASLTLSWLDQPLYTVSAWTPVDIAG  667

Query  27   SS  22
             S
Sbjct  668  GS  669



>gb|KHN34430.1| Scarecrow-like protein 28 [Glycine soja]
Length=664

 Score =   382 bits (980),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 183/251 (73%), Positives = 217/251 (86%), Gaps = 4/251 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P +H+RITGIGESKQ+L ETG+RLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE E+V
Sbjct  414  PPTHVRITGIGESKQDLNETGERLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEHETV  473

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQ+HK LYD SG AL DFLGLIRSTNP  +V+AEQEAEH+E+ LE R+ NSLKYY
Sbjct  474  AVNCVLQLHKTLYDGSGGALRDFLGLIRSTNPSVIVVAEQEAEHNENRLEGRVCNSLKYY  533

Query  381  SAVFDSLD-STLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FDS+D S LP +S VR KIEEM+A+EIRNI+ACEGRER+ERH SFG WR++++EQG 
Sbjct  534  SALFDSIDESGLPQESAVRVKIEEMYAKEIRNIVACEGRERVERHESFGNWRRMMVEQGG  593

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQGED--DGLTLSWEDQPLYTVSAWTPFD-I  34
            FRC+G+TEREL QSQMLLKM+S ESY V+KQ ++   G+TLSW +QPLYTVSAW P D  
Sbjct  594  FRCMGVTERELSQSQMLLKMYSCESYSVKKQEKEGATGVTLSWLEQPLYTVSAWGPVDAA  653

Query  33   AGSSSSYSQPT  1
            AG+SSS+SQP+
Sbjct  654  AGTSSSFSQPS  664



>gb|KDO63554.1| hypothetical protein CISIN_1g005954mg [Citrus sinensis]
Length=667

 Score =   382 bits (980),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 211/248 (85%), Gaps = 2/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRL+GFAE LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  421  PPSHVRITGIGESKQELNETGDRLSGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEKESV  480

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LY  +G  L DFLGLIRSTNP  V+MAEQEAEH+   LE+R+ NSL+YY
Sbjct  481  AVNCIFQLHKTLYSGNGGVLRDFLGLIRSTNPTIVLMAEQEAEHNSPFLETRVSNSLRYY  540

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FD +D +LPLDSPVR KIEEMFARE+R+I+ACEG +RLERH SF  WR+ +MEQG F
Sbjct  541  SALFDLIDYSLPLDSPVRIKIEEMFAREVRSIVACEGSDRLERHESFENWRR-MMEQGGF  599

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAGS  25
            RC+GI+ERE+LQSQMLLKM+S  +Y V+KQG+D   LTLSW DQPLYTVSAW P D+AG 
Sbjct  600  RCMGISEREMLQSQMLLKMYSCGNYGVKKQGQDGAALTLSWIDQPLYTVSAWAPVDVAGG  659

Query  24   SSSYSQPT  1
            SSS+SQP+
Sbjct  660  SSSFSQPS  667



>ref|XP_006477403.1| PREDICTED: scarecrow-like protein 28-like [Citrus sinensis]
Length=667

 Score =   382 bits (980),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 211/248 (85%), Gaps = 2/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRL+GFAE LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  421  PPSHVRITGIGESKQELNETGDRLSGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEKESV  480

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LY  +G  L DFLGLIRSTNP  V+MAEQEAEH+   LE+R+ NSL+YY
Sbjct  481  AVNCIFQLHKTLYSGNGGVLRDFLGLIRSTNPTIVLMAEQEAEHNSPFLETRVSNSLRYY  540

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FD +D +LPLDSPVR KIEEMFARE+R+I+ACEG +RLERH SF  WR+ +MEQG F
Sbjct  541  SALFDLIDYSLPLDSPVRIKIEEMFAREVRSIVACEGSDRLERHESFENWRR-MMEQGGF  599

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAGS  25
            RC+GI+ERE+LQSQMLLKM+S  +Y V+KQG+D   LTLSW DQPLYTVSAW P D+AG 
Sbjct  600  RCMGISEREMLQSQMLLKMYSCGNYGVKKQGQDGAALTLSWIDQPLYTVSAWAPVDVAGG  659

Query  24   SSSYSQPT  1
            SSS+SQP+
Sbjct  660  SSSFSQPS  667



>ref|XP_002509714.1| DELLA protein RGL1, putative [Ricinus communis]
 gb|EEF51101.1| DELLA protein RGL1, putative [Ricinus communis]
Length=662

 Score =   381 bits (978),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 208/238 (87%), Gaps = 1/238 (0%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  417  PPSHVRITGIGESKQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEGESV  476

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ QMHK LYD +G AL DFLGLIRST+P  V+MAEQEAEH+ ++LE+R+ NSLKYY
Sbjct  477  AVNCVFQMHKTLYDGNGGALRDFLGLIRSTSPTIVLMAEQEAEHNATNLEARVCNSLKYY  536

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS++++LPLDS VR KIEEMFAREIRNI+ACEG +RLERH SF KWRK LMEQG F
Sbjct  537  SAIFDSINTSLPLDSLVRIKIEEMFAREIRNIVACEGSDRLERHESFEKWRK-LMEQGGF  595

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTPFDIAG  28
            RC+GI+ERE+LQSQMLLKM+S E Y+V+++ +   LTLSW DQPLYT+SAW P D+ G
Sbjct  596  RCMGISEREVLQSQMLLKMYSCEDYRVKERQDRAALTLSWLDQPLYTISAWAPVDVVG  653



>gb|KJB20743.1| hypothetical protein B456_003G162400 [Gossypium raimondii]
Length=642

 Score =   379 bits (972),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 209/241 (87%), Gaps = 4/241 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+R+TGIGESKQEL ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLH KE ES+
Sbjct  394  PPSHVRVTGIGESKQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHAKENESI  453

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G  L DFLGLIRS NPIAV++AEQE E++  +LE+R+ NSL+YY
Sbjct  454  AVNCVFQLHKTLYDGNGGVLRDFLGLIRSINPIAVIIAEQETENNILNLEARVANSLRYY  513

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+DSTLPL+SPVR KIEEMFAREIRN+IACEG +R ERH SF KWRK LMEQG F
Sbjct  514  SAIFDSIDSTLPLESPVRIKIEEMFAREIRNLIACEGSDRFERHTSFEKWRK-LMEQGGF  572

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGE--DDG-LTLSWEDQPLYTVSAWTPFDIA  31
            +C+GIT+REL+QSQMLLKM++ E+Y V+KQG   DDG LTLSW D+PLYTVSAWTP D+A
Sbjct  573  KCMGITDRELVQSQMLLKMYTSENYSVKKQGPDGDDGALTLSWLDEPLYTVSAWTPIDVA  632

Query  30   G  28
            G
Sbjct  633  G  633



>emb|CDP09804.1| unnamed protein product [Coffea canephora]
Length=684

 Score =   378 bits (971),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/246 (74%), Positives = 207/246 (84%), Gaps = 2/246 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SHIRITGIGESKQEL+ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  437  PPSHIRITGIGESKQELIETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEKESV  496

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK+LYD++G  L DFLGLIRSTNP  V+M EQEAEH+    E+RL NSLKYY
Sbjct  497  AVNCIFQLHKMLYDSTGGVLRDFLGLIRSTNPTVVLMGEQEAEHNGPGFETRLTNSLKYY  556

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDSL+ ++  DSP+R KIEEMFAREIRNIIACEG+ER ERH  F KW+K +MEQG F
Sbjct  557  SAIFDSLEESIAADSPIRMKIEEMFAREIRNIIACEGQERFERHQGFVKWQK-MMEQGGF  615

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAGS  25
            R +   ERELLQS+MLLKM+  E+YKVEKQGED   LTLSW DQPLYT+SAW   D+AGS
Sbjct  616  RSLNTGERELLQSRMLLKMYGSENYKVEKQGEDGAALTLSWLDQPLYTISAWWSIDVAGS  675

Query  24   SSSYSQ  7
            SSS+SQ
Sbjct  676  SSSFSQ  681



>gb|AHA85561.1| scarecrow-like protein 28 [Dimocarpus longan]
Length=672

 Score =   377 bits (967),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 208/249 (84%), Gaps = 3/249 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRL+GFAE LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  425  PPSHVRITGIGESKQELNETGDRLSGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEKESV  484

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LY  +G AL D LGLIRSTNP  V+MAEQEAEH+ ++LE+R+ NSL+YY
Sbjct  485  AVNCVFQLHKTLYSGNGGALRDLLGLIRSTNPTLVLMAEQEAEHNSANLEARVSNSLRYY  544

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
             A+FD +DS+LPLDSPVR KIEEMFAREIRNI+ACEG +R ERH  FG WRK +MEQG F
Sbjct  545  GAIFDLIDSSLPLDSPVRIKIEEMFAREIRNIVACEGSDRSERHERFGNWRK-MMEQGGF  603

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD--GLTLSWEDQPLYTVSAWTPFDIAG  28
            R +GI+ERE LQSQMLLKM+S E+Y V KQ +D    LTLSW DQ LYTVS W P D+AG
Sbjct  604  RSMGISEREFLQSQMLLKMYSNENYSVRKQEQDGVAALTLSWLDQSLYTVSGWAPVDVAG  663

Query  27   SSSSYSQPT  1
            +SSS+SQP+
Sbjct  664  TSSSFSQPS  672



>ref|XP_008238774.1| PREDICTED: scarecrow-like protein 28 [Prunus mume]
Length=697

 Score =   374 bits (960),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/240 (75%), Positives = 204/240 (85%), Gaps = 3/240 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SHIRITGIGESKQEL ETGDRLAGFA  LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  450  PPSHIRITGIGESKQELNETGDRLAGFAGALNLPFEFHPVVDRLEDVRLWMLHVKEQESV  509

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G AL DFLGLIRSTNP  V+MAEQEAEH+E  LE+R+ NSLK+Y
Sbjct  510  AVNCVFQLHKTLYDGTGGALRDFLGLIRSTNPTIVLMAEQEAEHNEPRLETRVSNSLKHY  569

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FD + S+LPL+S  R K+EEMFAREIRN+IACEG +RLERH SF KWRK LMEQG F
Sbjct  570  SAIFDLISSSLPLESQARIKVEEMFAREIRNVIACEGSDRLERHESFEKWRK-LMEQGGF  628

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD--GLTLSWEDQPLYTVSAWTPFDIAG  28
            RC+GITERE+LQSQ LLKM++ E+Y V+KQG+D    LTL W DQPLYTVSAWTP D+AG
Sbjct  629  RCMGITEREMLQSQFLLKMYADENYNVKKQGQDGAAALTLGWLDQPLYTVSAWTPVDVAG  688



>ref|XP_009344268.1| PREDICTED: scarecrow-like protein 28 [Pyrus x bretschneideri]
Length=681

 Score =   373 bits (957),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/241 (76%), Positives = 205/241 (85%), Gaps = 4/241 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFA  LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  433  PPSHVRITGIGESKQELNETGDRLAGFAGALNLPFEFHPVVDRLEDVRLWMLHVKEHESV  492

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G AL DFLGLIRSTNP  V++AEQEAEH+ES LE+R+ NSLKYY
Sbjct  493  AVNCVFQLHKTLYDATGGALRDFLGLIRSTNPTIVLVAEQEAEHNESKLETRVSNSLKYY  552

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+ S+LPL+S  R K+EEMFA+EIRNIIACEG +RLERH SF KWRK LMEQ  F
Sbjct  553  SAIFDSIGSSLPLESQARIKVEEMFAQEIRNIIACEGSDRLERHESFEKWRK-LMEQEGF  611

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGED---DGLTLSWEDQPLYTVSAWTPFDIA  31
            RCVGITERE+LQSQ LLKM++ E+Y V+KQ +D   + LTLSW DQPLYTVSAWTP D A
Sbjct  612  RCVGITEREMLQSQFLLKMYASENYTVKKQEKDGAAEALTLSWMDQPLYTVSAWTPVDAA  671

Query  30   G  28
            G
Sbjct  672  G  672



>ref|XP_010278558.1| PREDICTED: scarecrow-like protein 28 [Nelumbo nucifera]
Length=676

 Score =   372 bits (956),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 209/248 (84%), Gaps = 2/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQELLETGDRLAGFA+ L+L FEFH VVDRLEDVRLWMLHVKE ESV
Sbjct  430  PPSHVRITGIGESKQELLETGDRLAGFADALSLPFEFHAVVDRLEDVRLWMLHVKEKESV  489

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQ+HK+LYD +G AL D LGLIRSTNP  VVM EQEA H+E+SLE+R+ NSL+YY
Sbjct  490  AVNCILQLHKMLYDENGGALRDLLGLIRSTNPTVVVMGEQEAMHNEASLEARVCNSLRYY  549

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+DS+LPLDS VR K+EEM+AREIRNI+ACEG +RLERH SF +WR   ME G F
Sbjct  550  SAIFDSIDSSLPLDSLVRIKVEEMYAREIRNIVACEGNDRLERHESFARWRG-FMEHGGF  608

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAGS  25
            R VGI ERELLQS+MLLKM++ E Y VEKQGE+  GLTL W +QPLYTVSAW P D+AGS
Sbjct  609  RYVGIGERELLQSRMLLKMYAGEKYSVEKQGEEGAGLTLRWLEQPLYTVSAWAPVDVAGS  668

Query  24   SSSYSQPT  1
            SS    P+
Sbjct  669  SSLPQVPS  676



>ref|XP_008369471.1| PREDICTED: scarecrow-like protein 28 [Malus domestica]
Length=683

 Score =   373 bits (957),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 203/238 (85%), Gaps = 4/238 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFA  LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  434  PPSHVRITGIGESKQELNETGDRLAGFAGALNLPFEFHPVVDRLEDVRLWMLHVKEHESV  493

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYDT+G AL DFLGLIRSTNP  V+MAEQEAEH+ES LE+R+ NSLKYY
Sbjct  494  AVNCVFQLHKTLYDTTGGALRDFLGLIRSTNPTLVLMAEQEAEHNESKLETRVSNSLKYY  553

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+ S+LPL+S  R K+EEMFA+EIRNIIACEG +RLERH SF KWRK LMEQ  F
Sbjct  554  SAIFDSIGSSLPLESQARIKVEEMFAQEIRNIIACEGSDRLERHESFEKWRK-LMEQEGF  612

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQ---GEDDGLTLSWEDQPLYTVSAWTPFD  37
            RCVGITERE+LQSQ LLKM++ E+Y V+KQ   G  + LTLSW DQPLYTVSAWTP D
Sbjct  613  RCVGITEREMLQSQFLLKMYASENYTVKKQEKNGAAEALTLSWMDQPLYTVSAWTPVD  670



>ref|XP_007155560.1| hypothetical protein PHAVU_003G212200g [Phaseolus vulgaris]
 gb|ESW27554.1| hypothetical protein PHAVU_003G212200g [Phaseolus vulgaris]
Length=647

 Score =   371 bits (953),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 212/251 (84%), Gaps = 5/251 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQ+L ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE E+V
Sbjct  398  PPSHVRITGIGESKQDLNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEQETV  457

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQ+HK LYD SG AL DFLGLIRSTNP  VV+AEQEAEH+E+ LE+R+ NSLKYY
Sbjct  458  AVNCVLQLHKTLYDGSGGALRDFLGLIRSTNPSVVVVAEQEAEHNETRLEARVCNSLKYY  517

Query  381  SAVFDSL-DSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD + +S +  +S VR KIEEM+ REIRN++ACEGRERLERH  FGKWR++L+E+G 
Sbjct  518  SALFDCIEESGVAQESAVRVKIEEMYGREIRNMVACEGRERLERHEGFGKWRRMLVEEGG  577

Query  204  FRCVGITERELLQSQMLLKMHSMESY---KVEKQGEDDGLTLSWEDQPLYTVSAWTPFDI  34
             RC+G++ERE+ QSQ+LLKM+  E+Y   KVEK+G    +TLSW DQPLYTVSAW P D+
Sbjct  578  LRCLGVSEREISQSQLLLKMYCCENYSVKKVEKEGA-TAVTLSWLDQPLYTVSAWVPVDV  636

Query  33   AGSSSSYSQPT  1
            AG+SSS+S PT
Sbjct  637  AGTSSSFSHPT  647



>ref|XP_010053331.1| PREDICTED: scarecrow-like protein 28 [Eucalyptus grandis]
 gb|KCW77603.1| hypothetical protein EUGRSUZ_D01917 [Eucalyptus grandis]
Length=672

 Score =   371 bits (953),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/249 (72%), Positives = 210/249 (84%), Gaps = 3/249 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL+ETGDRLA FA   NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  425  PPSHVRITGIGESKQELVETGDRLAVFAGSFNLPFEFHPVVDRLEDVRLWMLHVKEGESV  484

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD SG AL DFL LIRSTNP+ ++MAEQEA H+ SSLE R++NSL+YY
Sbjct  485  AVNCVCQLHKTLYDGSGGALRDFLRLIRSTNPVVLLMAEQEAHHNTSSLEVRVINSLRYY  544

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+ S+LPL+S  R KIEE+FAREIRNI+ACEG +RLERH SF +WRK LMEQG F
Sbjct  545  SALFDSIHSSLPLESAARVKIEELFAREIRNIVACEGSDRLERHQSFDEWRK-LMEQGAF  603

Query  201  RCVGITERELLQSQMLLKMHSM-ESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAG  28
            RC+  TERE +QSQMLLKM+ + E + V ++G+D   LTLSW+DQPLYTVSAW P D+AG
Sbjct  604  RCLETTERERIQSQMLLKMYDVDEDFIVSERGQDQAALTLSWQDQPLYTVSAWVPADVAG  663

Query  27   SSSSYSQPT  1
            SSSS+SQP 
Sbjct  664  SSSSFSQPN  672



>ref|XP_002299559.1| hypothetical protein POPTR_0001s08850g [Populus trichocarpa]
 gb|EEE84364.1| hypothetical protein POPTR_0001s08850g [Populus trichocarpa]
Length=666

 Score =   370 bits (950),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 202/239 (85%), Gaps = 2/239 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE E V
Sbjct  420  PPSHVRITGIGESKQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKERECV  479

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            A+NC+ QMHK LYD SG AL DFLGLIRSTNP  V++AEQEAEH+  +LE+R+ NSLKYY
Sbjct  480  AINCVFQMHKTLYDGSGGALRDFLGLIRSTNPAIVIVAEQEAEHNAPNLETRVCNSLKYY  539

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+DS+LP DSPVR KIEEM+AREIRNI+ACEG +R ERH     W+K LMEQG  
Sbjct  540  SALFDSIDSSLPFDSPVRIKIEEMYAREIRNIVACEGSDRHERHEMLDNWKK-LMEQGGL  598

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQG-EDDGLTLSWEDQPLYTVSAWTPFDIAG  28
            RC+ I+ERE+LQSQ+LLKM+S +SY+V+K G E   LTLSW DQPLYTVSAWTP DIAG
Sbjct  599  RCLVISEREMLQSQILLKMYSCDSYQVKKHGQEGAALTLSWLDQPLYTVSAWTPLDIAG  657



>ref|XP_009339647.1| PREDICTED: scarecrow-like protein 28 [Pyrus x bretschneideri]
Length=678

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 203/241 (84%), Gaps = 4/241 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFA  LNL FEFHPVVDRLEDVR+WMLHVKE ESV
Sbjct  430  PPSHVRITGIGESKQELNETGDRLAGFAGALNLPFEFHPVVDRLEDVRVWMLHVKEHESV  489

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G AL DFLGL+RSTNP  V+MAEQEAEH+E+ LE+R+ NSLKYY
Sbjct  490  AVNCVFQLHKTLYDMTGGALRDFLGLVRSTNPTIVLMAEQEAEHNEARLETRVSNSLKYY  549

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+ S+LPL S  R K+EEMFAREIRNI+ACEG +RLERH SF KWRK  MEQG F
Sbjct  550  SAIFDSIGSSLPLGSQARIKVEEMFAREIRNIVACEGSDRLERHESFEKWRK-WMEQGGF  608

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGED---DGLTLSWEDQPLYTVSAWTPFDIA  31
            RC GITERE+LQSQ LLKM++ ESY V+KQ +D   + LTLSW DQPLYTVSAWT  D+A
Sbjct  609  RCAGITEREMLQSQFLLKMYASESYAVKKQEQDGAAEALTLSWMDQPLYTVSAWTKVDVA  668

Query  30   G  28
            G
Sbjct  669  G  669



>ref|XP_007209056.1| hypothetical protein PRUPE_ppa017030mg [Prunus persica]
 gb|EMJ10255.1| hypothetical protein PRUPE_ppa017030mg [Prunus persica]
Length=697

 Score =   371 bits (952),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/240 (75%), Positives = 203/240 (85%), Gaps = 3/240 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SHIRITGIGESKQEL ETGDRLAGFA  LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  450  PPSHIRITGIGESKQELNETGDRLAGFAGALNLPFEFHPVVDRLEDVRLWMLHVKEQESV  509

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G AL DFLGLIRSTNP  V+MAEQEAEH+E  LE+R+ NSLK+Y
Sbjct  510  AVNCVFQLHKTLYDGTGGALRDFLGLIRSTNPTIVLMAEQEAEHNEPRLEARVSNSLKHY  569

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FD + S+LP +S  R K+EEMFAREIRN+IACEG +RLERH SF KWRK LMEQG F
Sbjct  570  SAIFDLISSSLPSESQARIKVEEMFAREIRNVIACEGSDRLERHESFEKWRK-LMEQGGF  628

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDD--GLTLSWEDQPLYTVSAWTPFDIAG  28
            RC+GITERE+LQSQ LLKM++ E+Y V+KQG+D    +TL W DQPLYTVSAWTP D+AG
Sbjct  629  RCMGITEREMLQSQFLLKMYAGENYNVKKQGQDGAAAVTLGWMDQPLYTVSAWTPVDVAG  688



>ref|XP_011029197.1| PREDICTED: scarecrow-like protein 28 [Populus euphratica]
Length=666

 Score =   369 bits (947),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 200/239 (84%), Gaps = 2/239 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRL GFAE LNL FEFHPVVDRLEDVRLWMLHVKE E V
Sbjct  420  PPSHVRITGIGESKQELNETGDRLTGFAEALNLPFEFHPVVDRLEDVRLWMLHVKERECV  479

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            A+NC+ QMHK LYD SG AL DFLGLIRSTNP  VV+AEQEAEH+  +LE+R+ NSLKYY
Sbjct  480  AINCVFQMHKTLYDGSGGALRDFLGLIRSTNPAIVVVAEQEAEHNAPNLETRVCNSLKYY  539

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +A+FDS+DS+LP DSPVR KIEEM+AREIRNI+ACEG +R ERH  F  W+K LMEQG  
Sbjct  540  AALFDSIDSSLPFDSPVRIKIEEMYAREIRNIVACEGSDRHERHEMFDNWKK-LMEQGGL  598

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQG-EDDGLTLSWEDQPLYTVSAWTPFDIAG  28
            RC  I+ERE+LQSQMLLKM+S +SY+V+K G E   L LSW DQPLYTVSAWTP DIAG
Sbjct  599  RCSVISEREMLQSQMLLKMYSCDSYQVKKHGQEGAALALSWLDQPLYTVSAWTPLDIAG  657



>ref|XP_010112565.1| hypothetical protein L484_010570 [Morus notabilis]
 gb|EXC34112.1| hypothetical protein L484_010570 [Morus notabilis]
Length=661

 Score =   367 bits (941),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 206/248 (83%), Gaps = 3/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  414  PPSHVRITGIGESKQELNETGDRLAGFAEALNLPFEFHPVVDRLEDVRLWMLHVKEQESV  473

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G    DFLGLIRSTNP  VVMAEQEAEH++  LE R+ NSLKYY
Sbjct  474  AVNCVFQLHKTLYDPNGGVFRDFLGLIRSTNPTVVVMAEQEAEHNDPRLEVRVCNSLKYY  533

Query  381  SAVFDSLD-STLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD +D S LPLDS VR K+EEMFAREIRNI+ACE  +R+ERH  F KWR+ +ME+G 
Sbjct  534  SAIFDCIDASQLPLDSGVRIKVEEMFAREIRNIVACERGDRVERHERFEKWRR-MMEEGG  592

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQGEDD-GLTLSWEDQPLYTVSAWTPFDIAG  28
            FR   I ERE++QS++LLKM+S E Y V++QG+D   +TL W+DQPL+TVSAWTP D+AG
Sbjct  593  FRSARIGEREVMQSRLLLKMYSCEDYNVKEQGQDGAAITLGWQDQPLFTVSAWTPVDLAG  652

Query  27   SSSSYSQP  4
            SSSS+SQP
Sbjct  653  SSSSFSQP  660



>ref|XP_004298743.1| PREDICTED: scarecrow-like protein 28 [Fragaria vesca subsp. vesca]
Length=654

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 198/242 (82%), Gaps = 5/242 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITG+GESKQEL ETGDRLAGFA  LNL FEFHPVVDRLEDVRLWMLHVKE ESV
Sbjct  404  PPSHVRITGVGESKQELNETGDRLAGFAGALNLPFEFHPVVDRLEDVRLWMLHVKEQESV  463

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC  Q+HK LYDT+G A  DFLGLIRSTNP  V+MAEQEAEH+E  LE+R+ NSL+YY
Sbjct  464  AVNCAFQLHKTLYDTTGGAFRDFLGLIRSTNPTIVLMAEQEAEHNEPRLEARVSNSLRYY  523

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FD + S+LPLDSP R K+E+  AREIRNI+ACEG +RLERH  F KWR +LMEQG F
Sbjct  524  SAIFDLIGSSLPLDSPARIKVEDTVAREIRNIVACEGSDRLERHEGFEKWR-MLMEQGGF  582

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGE----DDGLTLSWEDQPLYTVSAWTPFDI  34
            RC GIT+RE LQSQ LLKM+  E+Y V+KQG+       LTLSW DQPLYTVSAWTP D+
Sbjct  583  RCNGITDREFLQSQFLLKMYECENYSVKKQGQRHEGPAALTLSWMDQPLYTVSAWTPVDV  642

Query  33   AG  28
            AG
Sbjct  643  AG  644



>ref|XP_003549861.1| PREDICTED: scarecrow-like protein 28-like isoform X1 [Glycine 
max]
 ref|XP_006600806.1| PREDICTED: scarecrow-like protein 28-like isoform X2 [Glycine 
max]
 ref|XP_006600807.1| PREDICTED: scarecrow-like protein 28-like isoform X3 [Glycine 
max]
Length=669

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 212/251 (84%), Gaps = 4/251 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESKQ+L ETG+RLAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE E+V
Sbjct  419  PPIHVRITGIGESKQDLNETGERLAGFAEVLNLPFEFHPVVDRLEDVRLWMLHVKEHETV  478

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK L+D SG AL DFLGLIRST P  VV+AEQEAEH+ + LE+R+ NSLKYY
Sbjct  479  AVNCVSQLHKTLHDGSGGALRDFLGLIRSTKPSVVVVAEQEAEHNHTRLEARVCNSLKYY  538

Query  381  SAVFDSL-DSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FDS+ +S LP++S VR KIEEM+ +EIRNIIACEGRER+ERH SFG WR++++EQG 
Sbjct  539  SALFDSIEESGLPIESAVRVKIEEMYGKEIRNIIACEGRERVERHESFGNWRRMMVEQGG  598

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQGED--DGLTLSWEDQPLYTVSAWTPFD-I  34
            FRC+ +TEREL QSQMLLKM+S ESY V+KQ ++   G+TLSW +QPLYTVSAW P D  
Sbjct  599  FRCMSVTERELSQSQMLLKMYSCESYSVKKQEKEGATGVTLSWLEQPLYTVSAWGPVDAA  658

Query  33   AGSSSSYSQPT  1
            AG+SSS+S P+
Sbjct  659  AGTSSSFSHPS  669



>ref|XP_008373836.1| PREDICTED: scarecrow-like protein 28 [Malus domestica]
Length=684

 Score =   364 bits (935),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 201/241 (83%), Gaps = 4/241 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ET DRLAGFA  LNL FEFHPVVDRLEDVR+WMLHVKE ESV
Sbjct  436  PPSHVRITGIGESKQELNETRDRLAGFAGALNLPFEFHPVVDRLEDVRVWMLHVKEHESV  495

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G AL DFLGLIRSTNP  V+MAEQEAEH+E+ LE+R+ NSLKYY
Sbjct  496  AVNCVFQLHKTLYDMTGGALRDFLGLIRSTNPTIVLMAEQEAEHNEARLETRVSNSLKYY  555

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+ S+LPL S  R K+EEMFAREIRNI+ACEG +RLERH SF KWRK  MEQG F
Sbjct  556  SAIFDSIGSSLPLGSQARIKVEEMFAREIRNIVACEGSDRLERHESFEKWRK-WMEQGGF  614

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGED---DGLTLSWEDQPLYTVSAWTPFDIA  31
            RC GITERE+LQSQ LLKM++ ESY V+KQ +D     LTLSW D+PLYTVSAWT  D+A
Sbjct  615  RCAGITEREMLQSQFLLKMYANESYAVKKQEQDGAAGALTLSWMDRPLYTVSAWTTVDVA  674

Query  30   G  28
            G
Sbjct  675  G  675



>ref|XP_008346588.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 28 [Malus 
domestica]
Length=684

 Score =   364 bits (934),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 201/241 (83%), Gaps = 4/241 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ET DRLAGFA  LNL FEFHPVVDRLEDVR+WMLHVKE ESV
Sbjct  436  PPSHVRITGIGESKQELNETRDRLAGFAGALNLPFEFHPVVDRLEDVRVWMLHVKEHESV  495

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYD +G AL DFLGLIRSTNP  V+MAEQEAEH+E+ LE+R+ NSLKYY
Sbjct  496  AVNCVFQLHKTLYDMTGGALRDFLGLIRSTNPTIVLMAEQEAEHNEARLETRVSNSLKYY  555

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+ S+LPL S  R K+EEMFAREIRNI+ACEG +RLERH SF KWRK  MEQG F
Sbjct  556  SAIFDSIGSSLPLGSQARIKVEEMFAREIRNIVACEGSDRLERHESFEKWRK-WMEQGGF  614

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGED---DGLTLSWEDQPLYTVSAWTPFDIA  31
            RC GITERE+LQSQ LLKM++ ESY V+KQ +D     LTLSW D+PLYTVSAWT  D+A
Sbjct  615  RCAGITEREMLQSQFLLKMYANESYAVKKQEQDGAAGALTLSWMDRPLYTVSAWTTVDVA  674

Query  30   G  28
            G
Sbjct  675  G  675



>gb|KHN14118.1| Scarecrow-like protein 28 [Glycine soja]
Length=671

 Score =   362 bits (930),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/253 (70%), Positives = 213/253 (84%), Gaps = 6/253 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDR--LAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGE  568
            P +H+RITGIGESKQ+L ETG+R  LAGFAE LNL FEFHPVVDRLEDVRLWMLHVKE E
Sbjct  419  PPTHVRITGIGESKQDLNETGERQRLAGFAEVLNLPFEFHPVVDRLEDVRLWMLHVKEHE  478

Query  567  SVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLK  388
            +VAVNC+ Q+HK L+D SG AL DFLGLIRST P  VV+AEQEAEH+ + LE+R+ NSLK
Sbjct  479  TVAVNCVSQLHKTLHDGSGGALRDFLGLIRSTKPSVVVVAEQEAEHNHTRLEARVCNSLK  538

Query  387  YYSAVFDSL-DSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQ  211
            YYSA+FDS+ +S LP++S VR KIEEM+ +EIRNIIACEGRER+ERH SFG WR++++EQ
Sbjct  539  YYSALFDSIEESGLPIESAVRVKIEEMYGKEIRNIIACEGRERVERHESFGNWRRMMVEQ  598

Query  210  GKFRCVGITERELLQSQMLLKMHSMESYKVEKQGED--DGLTLSWEDQPLYTVSAWTPFD  37
            G FRC+ +TEREL QSQMLLKM+S ESY V+KQ ++   G+TLSW +QPLYTVSAW P D
Sbjct  599  GGFRCMSVTERELSQSQMLLKMYSCESYSVKKQEKEGATGVTLSWLEQPLYTVSAWGPVD  658

Query  36   -IAGSSSSYSQPT  1
              AG+SSS+S P+
Sbjct  659  AAAGTSSSFSHPS  671



>ref|XP_010676544.1| PREDICTED: scarecrow-like protein 28 [Beta vulgaris subsp. vulgaris]
Length=679

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 193/232 (83%), Gaps = 2/232 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL+ETG+RLA FAE  NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  434  PPSHVRITGIGESKQELIETGERLASFAEAFNLPFEFHPVVDRLEDVRLWMLHVKEGESV  493

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQ+HK LYDT+  +  DF+GLIRSTNPIA VMAEQEA+H+E ++E R+ +SL+YY
Sbjct  494  AVNCILQLHKTLYDTTNASFRDFMGLIRSTNPIAFVMAEQEADHNEPNMEMRVCSSLRYY  553

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+DS+LP D P R KIEEMF REIRNI+ACEG +R+ERH  FG W++  MEQ  F
Sbjct  554  SAIFDSIDSSLPYDIPARVKIEEMFGREIRNIVACEGSDRIERHEKFGNWKR-RMEQVGF  612

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
             CV   ERE+ QSQMLLKM+S ESY VE+QG DD +TL W DQPLYTVS WT
Sbjct  613  WCVKRNEREVFQSQMLLKMYSNESYNVEQQG-DDAITLRWMDQPLYTVSLWT  663



>ref|XP_006857885.1| PREDICTED: scarecrow-like protein 28 [Amborella trichopoda]
 gb|ERN19352.1| hypothetical protein AMTR_s00069p00112440 [Amborella trichopoda]
Length=676

 Score =   349 bits (895),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 201/246 (82%), Gaps = 2/246 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESK EL ETG+RLAGFAE +NL FEFH VVD+LEDVRLWMLHVKEGESV
Sbjct  427  PPSHVRITGIGESKHELQETGERLAGFAEAMNLKFEFHAVVDKLEDVRLWMLHVKEGESV  486

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
             VNC+LQ+H VLYD +  AL D LGL++ST P+ VV+AEQEA H++ + E R + +LKYY
Sbjct  487  VVNCILQLHTVLYDDNVGALRDLLGLMQSTRPVMVVIAEQEASHNDPNWELRFLRTLKYY  546

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDS+D++ P DSP R K+EEMFAREIRNI+ACEGRER ERH SF  W++L+ E G F
Sbjct  547  SAIFDSIDASFPRDSPARIKVEEMFAREIRNIVACEGRERTERHESFETWKRLMEEVG-F  605

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTPFDIAGSS  22
            R + + ERE LQSQM+LKM+  +SY V KQGE +GLTL W DQPL+TVS+W P D+AGSS
Sbjct  606  RSLRVEERERLQSQMILKMYDCDSYNVVKQGE-EGLTLCWLDQPLFTVSSWAPIDVAGSS  664

Query  21   SSYSQP  4
            SS+SQP
Sbjct  665  SSFSQP  670



>ref|XP_010940885.1| PREDICTED: scarecrow-like protein 28 [Elaeis guineensis]
Length=652

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 204/248 (82%), Gaps = 3/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGES+Q+L +TG RLA FAE  NL FEFH VVDRLEDVRLWMLHVK  + V
Sbjct  407  PPSHVRITGIGESRQDLHDTGARLARFAEAFNLPFEFHAVVDRLEDVRLWMLHVKREDCV  466

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+L MHK LYD +G AL+D LGLIRSTNP  V+MAEQEA+H+E   E+RL NSL+YY
Sbjct  467  AVNCVLMMHKTLYDENGGALMDLLGLIRSTNPAIVLMAEQEAQHNEPRWETRLANSLQYY  526

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDSLD +LP DS  R KIEEMFAREIRN++ACEG ER++RH  F +WRK LME G F
Sbjct  527  SAIFDSLDCSLPEDSLARIKIEEMFAREIRNLVACEGSERVDRHEKFERWRK-LMEDGGF  585

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGED-DGLTLSWEDQPLYTVSAWTPFDIAGS  25
            RC+GI ERE+LQS+++L+M++ E+Y ++KQGE+ DGLTL W +Q LYTVSAW P D+AGS
Sbjct  586  RCMGIGEREMLQSRLILRMYNGENYSIDKQGEESDGLTLKWLNQSLYTVSAWAPNDVAGS  645

Query  24   SSSYSQPT  1
            S++ SQP+
Sbjct  646  SAT-SQPS  652



>ref|XP_009407963.1| PREDICTED: scarecrow-like protein 28 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=616

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/247 (68%), Positives = 197/247 (80%), Gaps = 2/247 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITG+GES+Q+L +TG RLA  AE  NLAFEFH VVDRLEDVRLWMLHVK  E +
Sbjct  372  PPSHVRITGVGESRQDLQDTGIRLARLAESFNLAFEFHAVVDRLEDVRLWMLHVKREECL  431

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+L MHK LYD SG+A +D L LIRST+P  VVMAEQEA+H+E + E+RL  SL YY
Sbjct  432  AVNCVLTMHKALYDESGKAFMDLLDLIRSTHPEIVVMAEQEAKHNEPNWETRLARSLSYY  491

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +A+FDS+D  LP DS  R K+EE+FA+EIRNI+ACEG ER ERH SF  W K LME G F
Sbjct  492  AAIFDSMDDALPKDSQARIKVEEVFAKEIRNIVACEGDERTERHESFDGWSK-LMEDGGF  550

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTPFDIAGSS  22
            RC+GI ERE+LQS+M+L+M+S E Y +EKQGE DGLTL W DQPLYTVSAW P D+AG S
Sbjct  551  RCLGIGEREMLQSRMILRMYSCEKYSIEKQGEGDGLTLMWLDQPLYTVSAWAPRDVAG-S  609

Query  21   SSYSQPT  1
            SS SQP+
Sbjct  610  SSMSQPS  616



>ref|XP_009407962.1| PREDICTED: scarecrow-like protein 28 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   346 bits (887),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/247 (68%), Positives = 197/247 (80%), Gaps = 2/247 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITG+GES+Q+L +TG RLA  AE  NLAFEFH VVDRLEDVRLWMLHVK  E +
Sbjct  406  PPSHVRITGVGESRQDLQDTGIRLARLAESFNLAFEFHAVVDRLEDVRLWMLHVKREECL  465

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+L MHK LYD SG+A +D L LIRST+P  VVMAEQEA+H+E + E+RL  SL YY
Sbjct  466  AVNCVLTMHKALYDESGKAFMDLLDLIRSTHPEIVVMAEQEAKHNEPNWETRLARSLSYY  525

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +A+FDS+D  LP DS  R K+EE+FA+EIRNI+ACEG ER ERH SF  W K LME G F
Sbjct  526  AAIFDSMDDALPKDSQARIKVEEVFAKEIRNIVACEGDERTERHESFDGWSK-LMEDGGF  584

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTPFDIAGSS  22
            RC+GI ERE+LQS+M+L+M+S E Y +EKQGE DGLTL W DQPLYTVSAW P D+AG S
Sbjct  585  RCLGIGEREMLQSRMILRMYSCEKYSIEKQGEGDGLTLMWLDQPLYTVSAWAPRDVAG-S  643

Query  21   SSYSQPT  1
            SS SQP+
Sbjct  644  SSMSQPS  650



>ref|XP_010934553.1| PREDICTED: scarecrow-like protein 28 [Elaeis guineensis]
Length=571

 Score =   343 bits (879),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 200/244 (82%), Gaps = 2/244 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGES+Q+L ETG RLA FAE  NL FE+H VVDRLEDVRLWMLHVK  E V
Sbjct  326  PPSHVRITGIGESRQDLQETGARLARFAEAFNLPFEYHAVVDRLEDVRLWMLHVKREECV  385

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+L MHK LYD SG AL++ LGLIRSTNP  V++AEQEA+H++   E+RL NSL++Y
Sbjct  386  AVNCILVMHKALYDESGGALMNLLGLIRSTNPAIVLLAEQEAQHNDPRWETRLANSLQHY  445

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDSLD +LP+DSP R KIEEMFAREIRN++ACEG ER++RH  F +W+  LME G F
Sbjct  446  SAIFDSLDYSLPVDSPARIKIEEMFAREIRNLVACEGSERIDRHEKFERWKN-LMEDGGF  504

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGE-DDGLTLSWEDQPLYTVSAWTPFDIAGS  25
            R  GI ERE+LQS+++L+M++ E+Y +++QG+ D GLTL W +QPLYTVSAW P DIAGS
Sbjct  505  RSTGIGEREMLQSRLILRMYNGENYSIDRQGDGDGGLTLKWLNQPLYTVSAWAPIDIAGS  564

Query  24   SSSY  13
            SS++
Sbjct  565  SSTH  568



>ref|XP_008800814.1| PREDICTED: scarecrow-like protein 28 [Phoenix dactylifera]
Length=649

 Score =   345 bits (885),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 205/248 (83%), Gaps = 3/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGES+Q+L ETG RLA FAE  NL FEFH VVDRLEDVRLWMLHVK  E V
Sbjct  404  PPSHVRITGIGESRQDLQETGARLARFAEAFNLPFEFHAVVDRLEDVRLWMLHVKREECV  463

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+L MHK LYD +G AL++ LGLIRSTNP  V++AEQEA+H++   E+RL NSL+YY
Sbjct  464  AVNCILVMHKALYDETGGALMNLLGLIRSTNPAIVLIAEQEAQHNDPRWETRLANSLQYY  523

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDSLD +LP DSP R KIEEMFAREIRN++ACEG ER++RH  F +WR L++++G F
Sbjct  524  SAIFDSLDYSLPEDSPARIKIEEMFAREIRNLVACEGSERVDRHEKFERWRNLMVDRG-F  582

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGE-DDGLTLSWEDQPLYTVSAWTPFDIAGS  25
            RC+GI ERE+LQS++LL+++  E+Y + KQGE +DGLTL+W ++PL+TVSAW P DIAGS
Sbjct  583  RCMGIGEREMLQSRLLLRVYDGENYSIVKQGEGNDGLTLNWLNRPLFTVSAWAPIDIAGS  642

Query  24   SSSYSQPT  1
            SS+  QP+
Sbjct  643  SSA-PQPS  649



>ref|XP_008448980.1| PREDICTED: scarecrow-like protein 28 [Cucumis melo]
Length=661

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 201/260 (77%), Gaps = 13/260 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFAE L L FEFH VVDRLEDVRLWMLHVKE ESV
Sbjct  401  PPSHVRITGIGESKQELNETGDRLAGFAEALRLPFEFHAVVDRLEDVRLWMLHVKEQESV  460

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
             VNC+LQ+HK LYD +G AL DFLGLIRSTNP  VVMAEQEAEH+E  LE+R+  +LKYY
Sbjct  461  GVNCILQLHKTLYDGNGGALRDFLGLIRSTNPSIVVMAEQEAEHNEPRLETRVAATLKYY  520

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +A+FDSLD++LP +S  R KIEEMF REIRN+IACEGRER ERH  F KW+K + +QG  
Sbjct  521  AAIFDSLDTSLPPESSARLKIEEMFGREIRNMIACEGRERYERHVGFKKWKKDMEQQGGL  580

Query  201  RCVGI-TERELLQSQMLLKMHS--MESYKVEK----------QGEDDGLTLSWEDQPLYT  61
            +C+ I  +RELLQ+Q LLKM+S     + V K          +G    + L+WEDQPLYT
Sbjct  581  QCIRIHDDRELLQTQFLLKMYSSAAHGFNVTKIEEEEEEEEEEGTAQAICLTWEDQPLYT  640

Query  60   VSAWTPFDIAGSSSSYSQPT  1
            VSAW+P +++GSSSS++ PT
Sbjct  641  VSAWSPAEVSGSSSSFNHPT  660



>ref|XP_004148280.2| PREDICTED: scarecrow-like protein 28 [Cucumis sativus]
 gb|KGN55975.1| GRAS family transcription factor [Cucumis sativus]
Length=658

 Score =   343 bits (881),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/258 (66%), Positives = 200/258 (78%), Gaps = 11/258 (4%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGESKQEL ETGDRLAGFAE L L FEFH VVDRLEDVRLWMLHVKE ESV
Sbjct  400  PPSHVRITGIGESKQELNETGDRLAGFAEALRLPFEFHAVVDRLEDVRLWMLHVKEQESV  459

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
             VNC+LQ+HK LYD +G AL DFLGLIRSTNP  VVMAEQEAEH+E  LE+R+  +LKYY
Sbjct  460  GVNCILQLHKTLYDGNGGALRDFLGLIRSTNPSIVVMAEQEAEHNEPRLETRVAATLKYY  519

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +AVFDSLD++LP +S  R K+EEMF REIRN IACEGRER ERH  F KW+K + +QG  
Sbjct  520  AAVFDSLDTSLPPESSARLKVEEMFGREIRNTIACEGRERYERHVGFKKWKKDMEQQGGM  579

Query  201  RCVGI-TERELLQSQMLLKMHS--MESYKVEK--------QGEDDGLTLSWEDQPLYTVS  55
            +C+ I  +RELLQ+Q LLKM+S     + V K        +G    + L+WEDQPLYTVS
Sbjct  580  QCIRIHDDRELLQTQFLLKMYSSAAHGFNVTKIEEEEEEEEGTAQAICLTWEDQPLYTVS  639

Query  54   AWTPFDIAGSSSSYSQPT  1
            AW+P +++GSSSS++ PT
Sbjct  640  AWSPAEVSGSSSSFNHPT  657



>ref|XP_010545969.1| PREDICTED: scarecrow-like protein 28 [Tarenaya hassleriana]
Length=668

 Score =   342 bits (877),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 199/249 (80%), Gaps = 5/249 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESKQEL ETGDRL GFAE LNL FEFH VVDRLEDVRLWMLHVKEGESV
Sbjct  419  PPLHVRITGIGESKQELNETGDRLYGFAEALNLPFEFHSVVDRLEDVRLWMLHVKEGESV  478

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+HK LYDT+G A+ DF+GLIRSTNPIA+V+AEQEAEH+   LE+R+ NSL+YY
Sbjct  479  AVNCVFQLHKTLYDTTGAAIRDFMGLIRSTNPIALVIAEQEAEHNTDHLETRICNSLRYY  538

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDSL   LP DS +R KIEEMF REIRNI+ACEG  R ERH  F +WR+LL EQ  F
Sbjct  539  SAIFDSLHFNLPTDSLIRVKIEEMFGREIRNIVACEGNHRQERHTGFRRWRRLL-EQLGF  597

Query  201  RCVGITERELLQSQMLLKMH--SMESYKVEKQGED--DGLTLSWEDQPLYTVSAWTPFDI  34
            R +G++ERE+LQS+MLL+M+      + VE++ ED   G+TL W DQ LYTVSAWTP +I
Sbjct  598  RSLGVSEREVLQSKMLLRMYGGGGGGFNVERRDEDGSGGVTLRWSDQELYTVSAWTPAEI  657

Query  33   AGSSSSYSQ  7
             GSS S ++
Sbjct  658  GGSSLSLAR  666



>ref|XP_008779212.1| PREDICTED: scarecrow-like protein 28 [Phoenix dactylifera]
Length=511

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 200/252 (79%), Gaps = 6/252 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITGIGE +QEL +TG RLA FAE  NL FEFH VVDRLEDVRLWMLHVK  + V
Sbjct  261  PPSHVRITGIGECRQELQDTGARLARFAEACNLPFEFHAVVDRLEDVRLWMLHVKREDCV  320

Query  561  AVNCMLQMHKVLY-DTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKY  385
            AVNC+L +HK LY D +G AL+D LGLIRSTNP  V+MAEQEA+H+E+  E+RL NSLKY
Sbjct  321  AVNCVLMLHKTLYNDENGGALMDLLGLIRSTNPAIVLMAEQEAQHNETRWEARLANSLKY  380

Query  384  YSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            YSA+FDSLD  LP DS  R KIEEMFAREIRN++ACEG ER++RH  F +WRK LME G 
Sbjct  381  YSAIFDSLDCGLPEDSLARIKIEEMFAREIRNLVACEGSERVDRHEKFERWRK-LMEDGG  439

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQG-EDDGLTLSWEDQPLYTVSAWTPFDIA-  31
            FRC+GI ERE+LQS+++L+M+  E++ ++KQG E+DGLTL W +Q LYTVSAW P DIA 
Sbjct  440  FRCMGIGEREMLQSRLILRMYDGENFSIDKQGEENDGLTLKWLNQSLYTVSAWAPTDIAT  499

Query  30   --GSSSSYSQPT  1
                SS+ SQP+
Sbjct  500  DIAGSSATSQPS  511



>ref|XP_009398727.1| PREDICTED: scarecrow-like protein 28 [Musa acuminata subsp. malaccensis]
Length=646

 Score =   335 bits (858),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 194/248 (78%), Gaps = 3/248 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITG+GES+Q+L +TG  LA  AE LNL FEFH V DRLEDVRLWMLHVK  E V
Sbjct  401  PPSHLRITGVGESRQDLQDTGAALARLAESLNLPFEFHAVADRLEDVRLWMLHVKREECV  460

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+L MHK L D SG+A +D LGLIRST P  VVMAEQEA+H+E + E+R   SL YY
Sbjct  461  AVNCVLTMHKALSDESGKAFMDLLGLIRSTRPEIVVMAEQEAKHNEPNWETRFSRSLSYY  520

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +A+FDS+D  LP DSP R K+E++FAREIRN +ACEG ER ERH +F +WRK LME G F
Sbjct  521  AAIFDSMDYALPRDSPARIKVEQVFAREIRNAVACEGGERTERHENFDRWRK-LMEDGGF  579

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGED-DGLTLSWEDQPLYTVSAWTPFDIAGS  25
            +C+GI ERE+LQS+M+L+M+S + Y ++ QGE+ DGLTL W DQPLYTVSAW P D+AG 
Sbjct  580  KCLGIGEREMLQSRMILRMYSCDKYAIDNQGEEGDGLTLRWSDQPLYTVSAWAPTDVAGG  639

Query  24   SSSYSQPT  1
            SS+ SQP 
Sbjct  640  SST-SQPN  646



>ref|XP_009406334.1| PREDICTED: scarecrow-like protein 28 [Musa acuminata subsp. malaccensis]
Length=510

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 188/243 (77%), Gaps = 0/243 (0%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SH+RITG+GES+ +L  TG RLA  AE L+L FEFHPVVDR ED+RLWMLHVK  E V
Sbjct  264  PPSHVRITGVGESRPDLHATGVRLARIAESLHLPFEFHPVVDRFEDLRLWMLHVKREECV  323

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AV+C L MH+ L+D SG+A +D LGLIRSTNP  VVMAEQEAEH+E     RL  SL +Y
Sbjct  324  AVSCSLMMHRALHDESGKAFMDLLGLIRSTNPATVVMAEQEAEHNEPDWGRRLARSLNHY  383

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            +A+FDSLD  LP DS  R K+EE+FA+EIRNI+ACEG ER+ERH SF  WR+ + ++G F
Sbjct  384  AAIFDSLDDVLPQDSHARIKVEELFAKEIRNIVACEGDERIERHESFQGWRRRMTQEGGF  443

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTPFDIAGSS  22
             C+GI ERE+LQS+M+L+M+S + Y ++ +GE  GLTL W  QPLYTVSAW P D+AGSS
Sbjct  444  TCLGIGEREMLQSRMILRMYSCDKYSIDVEGEGHGLTLKWLHQPLYTVSAWVPVDVAGSS  503

Query  21   SSY  13
            S++
Sbjct  504  SAH  506



>ref|XP_006391781.1| hypothetical protein EUTSA_v10023324mg [Eutrema salsugineum]
 gb|ESQ29067.1| hypothetical protein EUTSA_v10023324mg [Eutrema salsugineum]
Length=670

 Score =   323 bits (827),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 194/250 (78%), Gaps = 10/250 (4%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  421  PPQHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  480

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+LQMHK LYD +G A+ DF+GLIRSTNP+A+V+AEQEAEH+   LE+R+ NSLKYY
Sbjct  481  AVNCVLQMHKTLYDGTGGAIRDFVGLIRSTNPVALVIAEQEAEHNSMQLETRVCNSLKYY  540

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R KIEEM F REIRNI+ACEG  R ERH  F  WR+ +MEQ  
Sbjct  541  SAIFDAIHTNLGTDSLIRVKIEEMLFGREIRNIVACEGSHRQERHVGFRHWRR-MMEQLG  599

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEKQGED-----DGLTLSWEDQPLYTVSAW  49
            FR +G++ERE+LQS+MLL+M+   +   + VE+  ED      G+TL W DQPLYT+SAW
Sbjct  600  FRSLGVSEREVLQSKMLLRMYGSGNEGFFNVEQSDEDGVGGGGGVTLRWSDQPLYTISAW  659

Query  48   TPFDIAGSSS  19
                I GSSS
Sbjct  660  AIAGIGGSSS  669



>gb|EYU29837.1| hypothetical protein MIMGU_mgv1a021768mg [Erythranthe guttata]
Length=668

 Score =   321 bits (822),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/258 (64%), Positives = 200/258 (78%), Gaps = 14/258 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEG-ES  565
            P SH+RITG+GESKQEL+ETGDRL+GFA+ LN+ FEFHPVVDRLEDVRLWMLHVKE  E+
Sbjct  410  PPSHVRITGVGESKQELIETGDRLSGFADALNIPFEFHPVVDRLEDVRLWMLHVKEKKET  469

Query  564  VAVNCMLQMHKVLYDTSGRA--------LVDFLGLIRSTNPIAVVMAEQEAEHDESSLES  409
            VAVNC+ Q+HK+LYDT+  A        L DFL LIRSTN  AVV+AEQE  H+   LES
Sbjct  470  VAVNCLFQLHKMLYDTTTTAAGGGGGAALRDFLSLIRSTNAEAVVIAEQEGAHNGVDLES  529

Query  408  RLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWR  229
            R+ NSLKYYSA+FDS+D +LPL+S  R KIEEMF +EIRNI+ACEGRER+ERH  F +WR
Sbjct  530  RVSNSLKYYSAIFDSVDPSLPLESKARIKIEEMFGKEIRNIVACEGRERVERHEGFDRWR  589

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKM-HSMESYKVEKQGEDDG--LTLSWEDQPLYTV  58
            +++  +G FRC GI ERE+LQ QM+LKM +  ++Y V  + E+    ++LSW DQPLYTV
Sbjct  590  EMIGREG-FRCTGIEEREVLQGQMMLKMTYGGDNYSVATRDENGAASVSLSWLDQPLYTV  648

Query  57   SAWTPFDI-AGSSSSYSQ  7
            SAW   D   GSSSSYS+
Sbjct  649  SAWKAVDFEGGSSSSYSR  666



>emb|CDY45974.1| BnaA09g12920D [Brassica napus]
Length=645

 Score =   319 bits (818),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/245 (65%), Positives = 193/245 (79%), Gaps = 9/245 (4%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITG+GESK EL ETGDRL GFAE ++L FEFHPVVDRLEDVRLWMLHVKEGE+V
Sbjct  405  PPRHVRITGVGESKHELNETGDRLHGFAEAMHLQFEFHPVVDRLEDVRLWMLHVKEGEAV  464

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ QMHK LYD +G A+ DF GL+RSTNP+AVV+AEQEAEH+ + LE+R+ NSLKYY
Sbjct  465  AVNCVSQMHKTLYDGTGAAVRDFAGLVRSTNPVAVVIAEQEAEHNSTQLETRVFNSLKYY  524

Query  381  SAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SAVFD +   L  DS +R KIEE +F REIRNI+ACEG  R ERH  FG+WR+ +MEQ  
Sbjct  525  SAVFDVMHKRLGADSLMRVKIEEVLFGREIRNIVACEGSHRQERHVGFGQWRR-MMEQLG  583

Query  204  FRCVGITERELLQSQMLLKMHS---MESYKVEKQGED-DGLTLSWEDQPLYTVSAWTPFD  37
            FR +G++ERE+LQS+MLL+M+     E + VE+  ED  G+TL W DQPLYTVSAW+   
Sbjct  584  FRSLGVSEREVLQSKMLLRMYGDGDEEFFNVERSDEDGGGVTLRWLDQPLYTVSAWS---  640

Query  36   IAGSS  22
            + GSS
Sbjct  641  VGGSS  645



>ref|NP_176498.1| scarecrow-like protein 28 [Arabidopsis thaliana]
 sp|Q9CAN3.1|SCL28_ARATH RecName: Full=Scarecrow-like protein 28; Short=AtSCL28; AltName: 
Full=GRAS family protein 8; Short=AtGRAS-8 [Arabidopsis 
thaliana]
 gb|AAG51600.1|AC010795_4 transcription factor SCARECROW, putative; 52594-50618 [Arabidopsis 
thaliana]
 gb|AEE34053.1| scarecrow-like protein 28 [Arabidopsis thaliana]
Length=658

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 192/244 (79%), Gaps = 13/244 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  412  PPHHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  471

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++QMHK LYD +G A+ DFLGLIRSTNPIA+V+AEQEAEH+   LE+R+ NSLKYY
Sbjct  472  AVNCVMQMHKTLYDGTGAAIRDFLGLIRSTNPIALVLAEQEAEHNSEQLETRVCNSLKYY  531

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R K+EEM F REIRNI+ACEG  R ERH  F  WR++L EQ  
Sbjct  532  SAMFDAIHTNLATDSLMRVKVEEMLFGREIRNIVACEGSHRQERHVGFRHWRRML-EQLG  590

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEKQGEDD--------GLTLSWEDQPLYTV  58
            FR +G++ERE+LQS+MLL+M+  ++   + VE+  ED+        G+TL W +QPLYT+
Sbjct  591  FRSLGVSEREVLQSKMLLRMYGSDNEGFFNVERSDEDNGGEGGRGGGVTLRWSEQPLYTI  650

Query  57   SAWT  46
            SAWT
Sbjct  651  SAWT  654



>ref|XP_009412565.1| PREDICTED: scarecrow-like protein 28 [Musa acuminata subsp. malaccensis]
Length=614

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 184/247 (74%), Gaps = 4/247 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGE    L + G RLAG AE L+L FEFHPVVDRLED+RLWMLHVK  E V
Sbjct  372  PPGHVRITGIGECGPHLQQAGVRLAGIAESLDLPFEFHPVVDRLEDIRLWMLHVKREECV  431

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC L MHK LYD SG+AL D LGLIRST P  VVMAEQEA+H+E + E+RL  SL YY
Sbjct  432  AVNCALTMHKTLYDESGKALTDLLGLIRSTRPEIVVMAEQEAKHNEPTWETRLAGSLNYY  491

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            ++VFDS++  LP+DS  R KIEE FA+EIRNI+A EG ER ERH SF +WRK LM+ G F
Sbjct  492  ASVFDSMEHALPVDSQARIKIEEAFAKEIRNIVAREGSERTERHESFDRWRK-LMQDGGF  550

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTPFDIAGSS  22
            RC+GI E E  QS+M+ +M+S E+Y + +QGE DGLTL W  QPLYTVSAW P D+    
Sbjct  551  RCLGIGEGE--QSRMIPRMYSCENYSIHEQGEGDGLTLKWLHQPLYTVSAWAPADVTDGP  608

Query  21   SSYSQPT  1
            S+ SQP 
Sbjct  609  ST-SQPN  614



>ref|XP_009113022.1| PREDICTED: scarecrow-like protein 28 [Brassica rapa]
Length=640

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 189/238 (79%), Gaps = 6/238 (3%)
 Frame = -2

Query  744  IPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGES  565
            IP  H+RITG+GESK EL ETGDRL GFAE ++L FEFHPVVDRLEDVRLWMLHVKEGE+
Sbjct  399  IPPRHVRITGVGESKHELNETGDRLHGFAEAMHLQFEFHPVVDRLEDVRLWMLHVKEGEA  458

Query  564  VAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKY  385
            VAVNC+ QMHK LYD +G A+ DF GL+RSTNP+AVV+AEQEAEH+ + LE+R+ NSLKY
Sbjct  459  VAVNCVSQMHKTLYDGTGAAVRDFAGLVRSTNPVAVVIAEQEAEHNSTQLETRVFNSLKY  518

Query  384  YSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQG  208
            YSA FD +   L  DS +R KIEE +F REIRNI+ACEG  R ERH  FG+WR+ +MEQ 
Sbjct  519  YSAGFDVMHKRLGADSLMRVKIEEVLFGREIRNIVACEGSHRQERHVGFGEWRR-MMEQL  577

Query  207  KFRCVGITERELLQSQMLLKMHS---MESYKVEKQGED-DGLTLSWEDQPLYTVSAWT  46
             FR +G++ERE+LQS+MLL+M+     E + VE+  ED  G+TL W DQPLYTVSAW+
Sbjct  578  GFRSLGVSEREVLQSKMLLRMYGDGDEEFFNVERSDEDGGGVTLRWLDQPLYTVSAWS  635



>emb|CDY70213.1| BnaCnng67210D [Brassica napus]
Length=643

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 193/245 (79%), Gaps = 9/245 (4%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITG+GESK EL ETGDRL GFAE ++L F+FHPVVDRLEDVRLWMLHVKEGE+V
Sbjct  403  PPRHVRITGVGESKHELNETGDRLHGFAEAMHLQFQFHPVVDRLEDVRLWMLHVKEGEAV  462

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ QMHK LYD +G A+ DF+GL+RSTNP+AVV+AEQEAEH+   LE+R+ NSLKYY
Sbjct  463  AVNCVSQMHKTLYDGTGAAVRDFVGLVRSTNPVAVVIAEQEAEHNSVQLETRVFNSLKYY  522

Query  381  SAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SAVFD +   L  DS +R KIEE +F REIRNI+ACEG  R ERH  FG+WR++L EQ  
Sbjct  523  SAVFDVMHKRLGADSLMRVKIEEVLFGREIRNIVACEGSHRQERHVGFGQWRRML-EQLG  581

Query  204  FRCVGITERELLQSQMLLKMHS---MESYKVEKQGED-DGLTLSWEDQPLYTVSAWTPFD  37
            FR +G++ERE+LQS+MLL+M+     E + VE+  ED  G+TL W DQPLYTVSAW+   
Sbjct  582  FRSLGVSEREVLQSKMLLRMYGDGDEEFFNVERSDEDGGGVTLRWLDQPLYTVSAWS---  638

Query  36   IAGSS  22
            + GSS
Sbjct  639  VGGSS  643



>ref|XP_006300849.1| hypothetical protein CARUB_v10019945mg [Capsella rubella]
 gb|EOA33747.1| hypothetical protein CARUB_v10019945mg [Capsella rubella]
Length=640

 Score =   317 bits (811),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 191/244 (78%), Gaps = 13/244 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  394  PPHHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  453

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++QMHK LYD +G A+ DFLGLIRSTNP+A+V+AEQEAEH+   LE+R+ NSLKYY
Sbjct  454  AVNCVMQMHKTLYDGTGAAIRDFLGLIRSTNPVALVLAEQEAEHNSEQLETRVCNSLKYY  513

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R KIEEM F REIRNI+ACEG  R ERH  F  WR++L EQ  
Sbjct  514  SAMFDAIHTNLATDSLIRVKIEEMLFGREIRNIVACEGSHRQERHVGFRHWRRML-EQLG  572

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEKQGED--------DGLTLSWEDQPLYTV  58
            FR +G++ERE+LQS+MLL+M+   +   + VE++ ED         G+TL W +QPLYT+
Sbjct  573  FRSLGVSEREVLQSKMLLRMYGSGNEGFFNVERRDEDGGAEGGRGGGVTLRWSEQPLYTI  632

Query  57   SAWT  46
            SAWT
Sbjct  633  SAWT  636



>ref|XP_010533716.1| PREDICTED: scarecrow-like protein 28 [Tarenaya hassleriana]
Length=659

 Score =   317 bits (812),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 189/243 (78%), Gaps = 6/243 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESKQEL ETGDRL  FAE LNL FEFHPVVDRLEDVRLWMLHVKEGE V
Sbjct  409  PPLHVRITGIGESKQELNETGDRLYRFAEALNLPFEFHPVVDRLEDVRLWMLHVKEGEYV  468

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+H  LYDT+G A+  FLGLIRS NPIAVV+AEQEA+HD   LE+R+ +SLKYY
Sbjct  469  AVNCVFQLHTALYDTTGAAIRAFLGLIRSINPIAVVIAEQEADHDTGHLEARVCHSLKYY  528

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDSL  +LP DS +R K+E+MF REIRNI+ACEG  R ERH  FG+WR+LL EQ  F
Sbjct  529  SAIFDSLHFSLPTDSLIRVKVEDMFGREIRNIVACEGSHRQERHMRFGRWRRLL-EQSGF  587

Query  201  RCVGITERELLQSQMLLKMHSMESYKV-----EKQGEDDGLTLSWEDQPLYTVSAWTPFD  37
            R +G++ERE+LQS++LL+M+            E++ E  G+TL W DQ LYTVSAWTP +
Sbjct  588  RNLGVSEREVLQSKVLLRMYGGGGGGFTVERREEEEEGGGVTLRWSDQELYTVSAWTPGE  647

Query  36   IAG  28
            I G
Sbjct  648  IGG  650



>emb|CDY47352.1| BnaCnng14890D [Brassica napus]
Length=637

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/250 (64%), Positives = 193/250 (77%), Gaps = 13/250 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITG+GESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGE+V
Sbjct  391  PPRHVRITGVGESKLELNETGDRLHGFAEAMNLPFEFHPVVDRLEDVRLWMLHVKEGEAV  450

Query  561  AVNCMLQMHKVLYD--TSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLK  388
            AVNC++QMHK LYD  T G A  +F+GL+RSTNP+AVV+AEQEAEHD + LE+R+ NSLK
Sbjct  451  AVNCLMQMHKTLYDDGTGGAAFRNFVGLVRSTNPVAVVIAEQEAEHDSAQLETRVCNSLK  510

Query  387  YYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQ  211
            YYSAVFD + + L  DS +R KIEE +F REIRNI+ACEG  R  RH  FG+WR+ +MEQ
Sbjct  511  YYSAVFDVMHTHLRADSLMRVKIEEVLFGREIRNIVACEGSHRQGRHVGFGQWRR-MMEQ  569

Query  210  GKFRCVGITERELLQSQMLLKMHSMES---YKVEKQGED---DGLTLSWEDQPLYTVSAW  49
              FR +G++ERE+LQS+MLL+M+       + VE+  ED    G+TL W +QPLYT+SAW
Sbjct  570  LGFRSLGVSEREVLQSKMLLRMYGDGDEGFFNVERSAEDGDGGGVTLRWLEQPLYTISAW  629

Query  48   TPFDIAGSSS  19
                I GSSS
Sbjct  630  ---GIGGSSS  636



>emb|CDY49199.1| BnaA09g10790D [Brassica napus]
Length=632

 Score =   315 bits (806),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 194/248 (78%), Gaps = 13/248 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITG+GESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGE+V
Sbjct  390  PPRHVRITGVGESKHELNETGDRLRGFAEAMNLPFEFHPVVDRLEDVRLWMLHVKEGEAV  449

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++Q+HK LYD  G A  +F+GL+RSTNP+AVV+AEQEAEHD + LE+R+ NSLKYY
Sbjct  450  AVNCVMQIHKTLYD--GAAFRNFVGLVRSTNPVAVVIAEQEAEHDSAQLETRVCNSLKYY  507

Query  381  SAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SAVFD + + L  DS +R KIEE +F REIRNI+ACEG  R ERH  FG+WR+ +MEQ  
Sbjct  508  SAVFDVMHTHLGADSLMRVKIEEVLFGREIRNIVACEGSHRQERHVGFGQWRR-MMEQLG  566

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEK---QGEDDGLTLSWEDQPLYTVSAWTP  43
            FR +G++ERE+LQS+MLL+M+       + VE+   +G+  G+TL W +QPLYT+SAW  
Sbjct  567  FRSLGVSEREVLQSRMLLRMYGDGDEGFFNVERSAEEGDGGGVTLRWLEQPLYTISAW--  624

Query  42   FDIAGSSS  19
              I GSSS
Sbjct  625  -GIGGSSS  631



>ref|XP_009112977.1| PREDICTED: scarecrow-like protein 28 [Brassica rapa]
Length=632

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 193/248 (78%), Gaps = 13/248 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITG+GESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGE+V
Sbjct  390  PPRHVRITGVGESKHELNETGDRLRGFAEAMNLPFEFHPVVDRLEDVRLWMLHVKEGEAV  449

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++Q+HK LYD  G A  +F+GL+RSTNP+AVV+AEQEAEHD + LE+R+ NSLKYY
Sbjct  450  AVNCVMQIHKTLYD--GAAFRNFVGLVRSTNPVAVVIAEQEAEHDSAQLETRVCNSLKYY  507

Query  381  SAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SAVFD + + L  DS +R KIEE +F REIRNI+A EG  R ERH  FG+WR+ +MEQ  
Sbjct  508  SAVFDVMHTHLGADSLMRVKIEEVLFGREIRNIVAWEGSHRQERHVGFGQWRR-MMEQLG  566

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEK---QGEDDGLTLSWEDQPLYTVSAWTP  43
            FR +G++ERE+LQS+MLL+M+       + VE+   +G+  GLTL W DQPLYT+SAW  
Sbjct  567  FRSLGVSEREVLQSKMLLRMYGDGDEGFFNVERSAEEGDGGGLTLGWLDQPLYTISAW--  624

Query  42   FDIAGSSS  19
              I GSSS
Sbjct  625  -GIGGSSS  631



>ref|XP_010418318.1| PREDICTED: scarecrow-like protein 28 isoform X2 [Camelina sativa]
Length=638

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 189/245 (77%), Gaps = 14/245 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  392  PPHHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  451

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++QMHK LYD +G A+ DFLGLIRSTNPIA+V+AEQEAEH+   LE+R+ NSLKYY
Sbjct  452  AVNCVMQMHKTLYDGTGGAIRDFLGLIRSTNPIALVLAEQEAEHNSEQLETRVCNSLKYY  511

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R KIEEM F REIRNI+ACEG  R ERH  F  WR++L EQ  
Sbjct  512  SAMFDAIHTNLATDSLIRVKIEEMLFGREIRNIVACEGSHRQERHVGFRHWRRML-EQLG  570

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEK---------QGEDDGLTLSWEDQPLYT  61
            FR +G++ERE+LQS+MLL+M+   +   + VE+          G   G+TL W +QPLYT
Sbjct  571  FRSLGVSEREVLQSKMLLRMYGSGNEGFFNVERSDEDGDGGEGGSSGGVTLRWSEQPLYT  630

Query  60   VSAWT  46
            +SAWT
Sbjct  631  ISAWT  635



>ref|XP_010430392.1| PREDICTED: scarecrow-like protein 28 isoform X2 [Camelina sativa]
Length=639

 Score =   312 bits (799),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 189/245 (77%), Gaps = 14/245 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  393  PPHHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  452

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++QMHK LYD +G A+ DFLGLIRSTNPIA+V+AEQEAEH+   LE+R+ NSLKYY
Sbjct  453  AVNCVMQMHKTLYDGTGGAIRDFLGLIRSTNPIALVLAEQEAEHNSEQLETRVCNSLKYY  512

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R KIEEM F REIRNI+ACEG  R ERH  F  WR++L EQ  
Sbjct  513  SAMFDAIHTNLATDSLIRVKIEEMLFGREIRNIVACEGSHRQERHVGFRHWRRML-EQLG  571

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEK---------QGEDDGLTLSWEDQPLYT  61
            FR +G++ERE+LQS+MLL+M+   +   + VE+          G   G+TL W +QPLYT
Sbjct  572  FRSLGVSEREVLQSKMLLRMYGSGNEGFFNVERSDEDGDGGEGGSSGGVTLRWSEQPLYT  631

Query  60   VSAWT  46
            +SAWT
Sbjct  632  ISAWT  636



>ref|XP_010418317.1| PREDICTED: scarecrow-like protein 28 isoform X1 [Camelina sativa]
Length=663

 Score =   312 bits (799),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 189/245 (77%), Gaps = 14/245 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  417  PPHHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  476

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++QMHK LYD +G A+ DFLGLIRSTNPIA+V+AEQEAEH+   LE+R+ NSLKYY
Sbjct  477  AVNCVMQMHKTLYDGTGGAIRDFLGLIRSTNPIALVLAEQEAEHNSEQLETRVCNSLKYY  536

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R KIEEM F REIRNI+ACEG  R ERH  F  WR++L EQ  
Sbjct  537  SAMFDAIHTNLATDSLIRVKIEEMLFGREIRNIVACEGSHRQERHVGFRHWRRML-EQLG  595

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEK---------QGEDDGLTLSWEDQPLYT  61
            FR +G++ERE+LQS+MLL+M+   +   + VE+          G   G+TL W +QPLYT
Sbjct  596  FRSLGVSEREVLQSKMLLRMYGSGNEGFFNVERSDEDGDGGEGGSSGGVTLRWSEQPLYT  655

Query  60   VSAWT  46
            +SAWT
Sbjct  656  ISAWT  660



>ref|XP_002886432.1| scarecrow transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH62691.1| scarecrow transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=691

 Score =   313 bits (801),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 156/251 (62%), Positives = 193/251 (77%), Gaps = 13/251 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  442  PPHHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  501

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++QMHK LYD +G A+ DFLGLIRSTNPIA+V+AEQEAEH+   LE+R+ NSL+YY
Sbjct  502  AVNCVMQMHKTLYDGTGAAIRDFLGLIRSTNPIALVLAEQEAEHNSEQLETRVCNSLRYY  561

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R KIEEM F REIRNI+ACEG  R ERH  F  W+++L EQ  
Sbjct  562  SAMFDAIHTNLATDSLIRVKIEEMLFGREIRNIVACEGNHRQERHVGFRHWKRML-EQLG  620

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEKQ--------GEDDGLTLSWEDQPLYTV  58
            FR +G++ERE++QS+MLL+M+  ++   + VE+         G   G+TL W +QPLYT+
Sbjct  621  FRSLGVSEREVMQSKMLLRMYGSDNEGFFNVERSGEDGGGEGGRGGGVTLRWSEQPLYTI  680

Query  57   SAWTPFDIAGS  25
            SAWT   I G+
Sbjct  681  SAWTIGGIGGN  691



>ref|XP_010430391.1| PREDICTED: scarecrow-like protein 28 isoform X1 [Camelina sativa]
Length=664

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 189/245 (77%), Gaps = 14/245 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  418  PPHHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  477

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++QMHK LYD +G A+ DFLGLIRSTNPIA+V+AEQEAEH+   LE+R+ NSLKYY
Sbjct  478  AVNCVMQMHKTLYDGTGGAIRDFLGLIRSTNPIALVLAEQEAEHNSEQLETRVCNSLKYY  537

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R KIEEM F REIRNI+ACEG  R ERH  F  WR++L EQ  
Sbjct  538  SAMFDAIHTNLATDSLIRVKIEEMLFGREIRNIVACEGSHRQERHVGFRHWRRML-EQLG  596

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEK---------QGEDDGLTLSWEDQPLYT  61
            FR +G++ERE+LQS+MLL+M+   +   + VE+          G   G+TL W +QPLYT
Sbjct  597  FRSLGVSEREVLQSKMLLRMYGSGNEGFFNVERSDEDGDGGEGGSSGGVTLRWSEQPLYT  656

Query  60   VSAWT  46
            +SAWT
Sbjct  657  ISAWT  661



>ref|XP_010473538.1| PREDICTED: scarecrow-like protein 28 isoform X2 [Camelina sativa]
Length=647

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 189/245 (77%), Gaps = 14/245 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  401  PPHHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  460

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++QMHK LYD +G A+ DFLGLIRSTNPIA+V+AEQEAEH+   LE+R+ NSLKYY
Sbjct  461  AVNCVMQMHKTLYDGTGGAIRDFLGLIRSTNPIALVLAEQEAEHNSEQLETRVCNSLKYY  520

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R KIEEM F REIRNI+ACEG  R ERH  F  WR++L EQ  
Sbjct  521  SAMFDAIHTNLATDSLIRVKIEEMLFGREIRNIVACEGSHRQERHVGFRHWRRML-EQLG  579

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEK---------QGEDDGLTLSWEDQPLYT  61
            FR +G++ERE+LQS+MLL+M+   +   + V++          G   G+TL W +QPLYT
Sbjct  580  FRSLGVSEREVLQSKMLLRMYGPGNEGFFNVDRSDEDGDGGEGGSSGGVTLRWSEQPLYT  639

Query  60   VSAWT  46
            +SAWT
Sbjct  640  ISAWT  644



>ref|XP_010473537.1| PREDICTED: scarecrow-like protein 28 isoform X1 [Camelina sativa]
Length=672

 Score =   310 bits (793),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 189/245 (77%), Gaps = 14/245 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P  H+RITGIGESK EL ETGDRL GFAE +NL FEFHPVVDRLEDVRLWMLHVKEGESV
Sbjct  426  PPHHVRITGIGESKLELNETGDRLHGFAEAMNLQFEFHPVVDRLEDVRLWMLHVKEGESV  485

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC++QMHK LYD +G A+ DFLGLIRSTNPIA+V+AEQEAEH+   LE+R+ NSLKYY
Sbjct  486  AVNCVMQMHKTLYDGTGGAIRDFLGLIRSTNPIALVLAEQEAEHNSEQLETRVCNSLKYY  545

Query  381  SAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            SA+FD++ + L  DS +R KIEEM F REIRNI+ACEG  R ERH  F  WR++L EQ  
Sbjct  546  SAMFDAIHTNLATDSLIRVKIEEMLFGREIRNIVACEGSHRQERHVGFRHWRRML-EQLG  604

Query  204  FRCVGITERELLQSQMLLKMHSMES---YKVEK---------QGEDDGLTLSWEDQPLYT  61
            FR +G++ERE+LQS+MLL+M+   +   + V++          G   G+TL W +QPLYT
Sbjct  605  FRSLGVSEREVLQSKMLLRMYGPGNEGFFNVDRSDEDGDGGEGGSSGGVTLRWSEQPLYT  664

Query  60   VSAWT  46
            +SAWT
Sbjct  665  ISAWT  669



>gb|EPS73834.1| hypothetical protein M569_00923, partial [Genlisea aurea]
Length=385

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -2

Query  744  IPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGES  565
            IP SH+RITGIGESKQEL+ETGD L+GFAE LNL F+FHPVVDRLEDVRLWMLHVKE ES
Sbjct  152  IPPSHVRITGIGESKQELIETGDHLSGFAEALNLPFKFHPVVDRLEDVRLWMLHVKENES  211

Query  564  VAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKY  385
            VAVNC  Q+HK+ YD +G  L DFLGLI STN  AVV+AEQEA H+E+S +SR+ +SL+Y
Sbjct  212  VAVNCTFQLHKLTYDETGEKLQDFLGLIHSTNAEAVVIAEQEASHNEASFDSRVASSLRY  271

Query  384  YSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            YS VFD+LDS+LPL S +R KIEEM+  EIR++++ EGRER ERH  F +W + +  +G 
Sbjct  272  YSTVFDALDSSLPLGSKMRRKIEEMYGYEIRDMVSNEGRERRERHERFDRWEETMAGKGG  331

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVE-KQGEDDGLTLSWEDQPLYTVSAW  49
            F  +GI ERE+   +M+LKM+  + Y+VE KQ +   +TLS+ DQPLY+VS W
Sbjct  332  FVSMGIEEREVQLCKMILKMYESKDYRVERKQDKKKAITLSYADQPLYSVSGW  384



>ref|XP_001763823.1| predicted protein [Physcomitrella patens]
 gb|EDQ71465.1| predicted protein [Physcomitrella patens]
Length=390

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 167/243 (69%), Gaps = 7/243 (3%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SHIRITGIGE K +LLETGDRLA FAE+ N+ F FH V+DRLEDVRLWMLHVKE E+V
Sbjct  142  PPSHIRITGIGECKDDLLETGDRLAEFAEEFNIPFSFHAVIDRLEDVRLWMLHVKENEAV  201

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q H++LYD SG  + DFL LI ST P  V + EQE  H+    E R + SLKYY
Sbjct  202  AVNCISQFHRLLYD-SGETIKDFLNLIGSTKPRVVAIVEQEGSHNSPHFEGRFLESLKYY  260

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SA+FDSL++ L  +S VR ++E++FA EIRNI++CEG ER+ERH    +W  +L+ Q  F
Sbjct  261  SAIFDSLEANLSRESCVRVQVEQLFALEIRNILSCEGAERVERHEDTARW-SVLLSQSDF  319

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTP---FDIA  31
              V + +    Q+Q+LL+M   + Y +    E+  LTL W +QPL TVSAW P   F + 
Sbjct  320  VNVPLEDSANTQAQILLRMFDSDGYTL--TAENGSLTLGWVEQPLLTVSAWKPDKDFVLT  377

Query  30   GSS  22
            G S
Sbjct  378  GKS  380



>ref|XP_001773672.1| predicted protein [Physcomitrella patens]
 gb|EDQ61560.1| predicted protein, partial [Physcomitrella patens]
Length=367

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 163/231 (71%), Gaps = 4/231 (2%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P SHIRITGIGE K++LLETGDRLA FAE+ N+ F FH V+DRLEDVRLWMLHVKE E+V
Sbjct  140  PPSHIRITGIGECKEDLLETGDRLAEFAEEFNIPFTFHAVIDRLEDVRLWMLHVKENEAV  199

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+H++LYD SG  +  FL LI ST P  V + EQE  H+    E R + SL+YY
Sbjct  200  AVNCISQLHRLLYD-SGETIEGFLNLIGSTKPKVVAVVEQEGSHNSPQFEGRFLESLQYY  258

Query  381  SAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            SAVFDSL++ +  +S  R ++E++FAREIRNI++CEG +R+ERH +  +WR ++   G F
Sbjct  259  SAVFDSLEANISRESSARVQVEQLFAREIRNILSCEGTDRMERHENISRWRSIMSRSG-F  317

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
              V + +    Q+ +LL+M   + Y + +  E+  +TL W +QPL T SAW
Sbjct  318  VKVPLEDSAYTQALILLRMFDSDGYTLAE--ENGAVTLGWMEQPLLTASAW  366



>ref|XP_004964401.1| PREDICTED: scarecrow-like protein 28-like [Setaria italica]
Length=611

 Score =   245 bits (626),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 166/235 (71%), Gaps = 2/235 (1%)
 Frame = -2

Query  744  IPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGES  565
            +P +H+RITG+GES+QEL ETG RL   A  L LAFEFH VVDRLEDVRLWMLHVK GE 
Sbjct  353  VPPAHVRITGVGESRQELQETGARLGRVAATLGLAFEFHAVVDRLEDVRLWMLHVKRGEC  412

Query  564  VAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKY  385
            VAVNC+L  H++L D +G AL DFLGL RST    +++ E E   +    E+R   +L+Y
Sbjct  413  VAVNCVLAAHRLLRDDTGAALADFLGLARSTGAAILLLGEHEDALNSGRWEARFARALRY  472

Query  384  YSAVFDSLDST-LPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQG  208
            Y+A FD++D+  L   SP R K EEMFAREIRN +A E  +R ERH SF  W++  ME+G
Sbjct  473  YAAAFDAVDAAGLSDASPARLKAEEMFAREIRNAVAFEAADRFERHESFAGWQQ-RMEEG  531

Query  207  KFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTP  43
             F+  GI +RE +Q +M+ +M +  +Y V+ QG+ +GLTL W DQP+YTVSAWTP
Sbjct  532  GFQNAGIGDREAMQGRMIARMFAPGNYSVQAQGDGEGLTLRWLDQPMYTVSAWTP  586



>gb|AFW86077.1| hypothetical protein ZEAMMB73_433354 [Zea mays]
Length=630

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 171/250 (68%), Gaps = 2/250 (1%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGE  568
            + P +H+RITG+GES+QEL ETG RL   A  L LAFEFH VVDRLEDVRLWMLHVK GE
Sbjct  374  VAPPAHVRITGVGESRQELQETGARLGRVAAALGLAFEFHAVVDRLEDVRLWMLHVKRGE  433

Query  567  SVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLK  388
             VAVNC+L  H++L D +G A+ DFLGL RST    +++ E E   +    E+R   +L+
Sbjct  434  CVAVNCVLAAHRLLRDETGAAVADFLGLTRSTGAAILLLGEHEDALNSGRWEARFARALR  493

Query  387  YYSAVFDSLDSTLPLD-SPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQ  211
            YY+A FD++++    D SP R K EEMFAREIRN +A E  +R ERH +F  WR+  M++
Sbjct  494  YYAAAFDAVEAAGLADASPARAKAEEMFAREIRNAVAFEAADRFERHETFTGWRQ-RMQE  552

Query  210  GKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTPFDIA  31
            G F+  GI +RE LQ +M+ +M +  +Y V+ QG+ +GLTL W DQ +YTVSAWTP    
Sbjct  553  GGFQNAGIGDREALQGRMIARMFAPGNYSVQVQGDGEGLTLRWMDQAMYTVSAWTPVSDG  612

Query  30   GSSSSYSQPT  1
            GS+ S S  T
Sbjct  613  GSTVSASVST  622



>ref|XP_002436390.1| hypothetical protein SORBIDRAFT_10g001690 [Sorghum bicolor]
 gb|EER87757.1| hypothetical protein SORBIDRAFT_10g001690 [Sorghum bicolor]
Length=624

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 166/243 (68%), Gaps = 2/243 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P +H+RITG+GES+QEL ETG RL   A  L LAFEFH VVDRLEDVRLWMLHVK GE V
Sbjct  367  PPAHVRITGVGESRQELQETGARLGRVAAALGLAFEFHAVVDRLEDVRLWMLHVKRGECV  426

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+L  H++L D +G A+ DFLGL RST    +++ E E   +    E+R   +L+YY
Sbjct  427  AVNCVLAAHRLLRDETGAAIADFLGLARSTGAAILLLGEHEDALNSGRWEARFARALRYY  486

Query  381  SAVFDSLDSTLPLD-SPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            +A FD++D+    D SP R K EEMFAREIRN +A E  +R ERH +F  WR+  M++G 
Sbjct  487  AAAFDAVDAAGLADTSPARAKAEEMFAREIRNAVAFEAGDRFERHETFAGWRR-RMQEGG  545

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTPFDIAGS  25
            F+  GI ERE +Q +M+ +M +  +Y V+ QG+ +GLTL W DQ +YTVSAWTP    G 
Sbjct  546  FQNAGIGEREAMQGRMIARMFAPGNYSVQAQGDGEGLTLRWMDQAMYTVSAWTPISDGGG  605

Query  24   SSS  16
              S
Sbjct  606  GGS  608



>emb|CBI34713.3| unnamed protein product [Vitis vinifera]
Length=150

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = -2

Query  453  MAEQEAEHDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACE  274
            MAEQEAEH+E SLE+R+ NSL+YYSA+FDS+D +LPLDSPVR K+EEMFAREIRNIIACE
Sbjct  1    MAEQEAEHNELSLETRVSNSLRYYSAIFDSIDYSLPLDSPVRMKVEEMFAREIRNIIACE  60

Query  273  GRERLERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGL  94
            G +R+ERH SF KWR+  MEQG FRCVGI+ERE+LQSQMLLKM+S E+Y V K+G+D  L
Sbjct  61   GSDRVERHESFEKWRR-RMEQGGFRCVGISEREMLQSQMLLKMYSCENYSVSKRGQDAAL  119

Query  93   TLSWEDQPLYTVSAWTPFDIAG  28
            TLSW DQPLYTVSAWT  D+AG
Sbjct  120  TLSWLDQPLYTVSAWTQVDVAG  141



>ref|XP_003557108.1| PREDICTED: scarecrow-like protein 28 [Brachypodium distachyon]
Length=631

 Score =   238 bits (606),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 166/250 (66%), Gaps = 9/250 (4%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWMLHVKEGES  565
            P +H+RITG+G SK EL ETG RL+  A  L LAFEFH VV+ RLEDVRLWMLHVK GE 
Sbjct  376  PPAHVRITGVGPSKLELQETGARLSAVAASLGLAFEFHAVVELRLEDVRLWMLHVKRGER  435

Query  564  VAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEH-DESSLESRLVNSLK  388
            VAVNC+L  H++L D  G A+  FL L RST    +++ E EAE  +    E R   +L+
Sbjct  436  VAVNCVLAAHRLLRD--GGAMAAFLSLARSTGADLLLLGEHEAEGLNGGRWEPRFARALR  493

Query  387  YYSAVFDSLDST-LPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQ  211
            +Y+A+FD++ +  L   SP R   EEMFAREIRN +A EG +R ERH  F +WR+  ME 
Sbjct  494  HYAALFDAVGAAGLDAASPARINAEEMFAREIRNAVAFEGADRCERHEGFPQWRR-RMED  552

Query  210  GKFRCVGITERELLQSQMLLKMHSME-SYKVEKQGED-DGLTLSWEDQPLYTVSAWTPF-  40
            G FR  G  +RE +Q +M+ +M +   +Y V  QG+D +GLTL W D PLYTVSAWTP  
Sbjct  553  GGFRNAGFGDREAMQGRMIARMVAPPGNYGVRAQGDDGEGLTLQWLDNPLYTVSAWTPAG  612

Query  39   DIAGSSSSYS  10
            D AGS+ S S
Sbjct  613  DGAGSTVSAS  622



>ref|XP_002981812.1| hypothetical protein SELMODRAFT_114956 [Selaginella moellendorffii]
 gb|EFJ17294.1| hypothetical protein SELMODRAFT_114956 [Selaginella moellendorffii]
Length=489

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 172/247 (70%), Gaps = 18/247 (7%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P S +RI+GIG  K  + ETGDRLA FA+ L L FEFH VV+RLE++RLWMLHVK+GE+V
Sbjct  243  PPSLVRISGIGPFKDSVQETGDRLAEFAQALGLCFEFHAVVERLEEIRLWMLHVKDGEAV  302

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+H+ L D   + +   + LIRST P  V + E EAEH+    E+R   SL+YY
Sbjct  303  AVNCIGQLHRSLLDR--QQIQGVMELIRSTKPEVVAIVEHEAEHNVECFEARFAGSLRYY  360

Query  381  SAVFDSLDSTLPL-----DSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +A+FD+LDS++ +         RT++E+ +FAREIRNI+ CEG +R+ERH  F  W+++L
Sbjct  361  AAMFDALDSSVVVVDGESSLSARTRVEKTIFAREIRNIVGCEGEDRIERHERFEGWKRML  420

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSMESYKVEK-QGED--------DGLTLSWEDQPL  67
             E+G FR  G+++R ++Q+++LL+M     Y+++K +G+D        +G+TL W DQPL
Sbjct  421  EEEG-FRNRGMSQRAIVQAKLLLEMFLCPEYRIDKLEGKDENGSRECCEGITLGWLDQPL  479

Query  66   YTVSAWT  46
             TVSAW+
Sbjct  480  VTVSAWS  486



>ref|XP_002967802.1| GRAS family protein [Selaginella moellendorffii]
 gb|EFJ31149.1| GRAS family protein [Selaginella moellendorffii]
Length=564

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 172/247 (70%), Gaps = 18/247 (7%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P S +RI+GIG  K  + ETGDRLA FA+ L L FEFH VV+RLE++RLWMLHVK+GE+V
Sbjct  318  PPSLVRISGIGPFKDSVQETGDRLAEFAQALGLCFEFHAVVERLEEIRLWMLHVKDGEAV  377

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVNC+ Q+H+ L D   + +   + LIRST P  V + E EAEH+    E+R   SL+YY
Sbjct  378  AVNCIGQLHRSLLDR--QQIQGVMELIRSTKPEVVAIVEHEAEHNVECFEARFAGSLRYY  435

Query  381  SAVFDSLDSTLPL-----DSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +A+FD+LDS++ +         RT++E+ +FAREIRNI+ CEG +R+ERH  F  W+++L
Sbjct  436  AAMFDALDSSVVVVDGESSLSARTRVEKTIFAREIRNIVGCEGEDRIERHERFEGWKRML  495

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSMESYKVEK-QGED--------DGLTLSWEDQPL  67
             E+G FR  G+++R ++Q+++LL+M     Y+++K +G+D        +G+TL W DQPL
Sbjct  496  EEEG-FRNRGMSQRAIVQAKLLLEMFLCPEYRIDKLEGKDENGSRECCEGITLGWLDQPL  554

Query  66   YTVSAWT  46
             TVSAW+
Sbjct  555  VTVSAWS  561



>ref|NP_001056667.1| Os06g0127800 [Oryza sativa Japonica Group]
 dbj|BAA90816.1| putative gibberellin response modulator [Oryza sativa Japonica 
Group]
 dbj|BAC24836.1| putative gibberellin response modulator [Oryza sativa Japonica 
Group]
 dbj|BAF18581.1| Os06g0127800 [Oryza sativa Japonica Group]
Length=617

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 168/255 (66%), Gaps = 9/255 (4%)
 Frame = -2

Query  744  IPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGES  565
            +P +H+RITG+GES+QEL ETG RLA  A  L LAFEFH VVDRLEDVRLWMLHVK GE 
Sbjct  357  VPPAHVRITGVGESRQELQETGARLARVAAALGLAFEFHAVVDRLEDVRLWMLHVKRGEC  416

Query  564  VAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEH-DESSLESRLVNSLK  388
            VAVNC+L MH++L D +  AL DFLGL RST    +++ E E    +    E+R   +L+
Sbjct  417  VAVNCVLAMHRLLRDDA--ALTDFLGLARSTGATILLLGEHEGGGLNSGRWEARFARALR  474

Query  387  YYSAVFDSLDST-LPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQ  211
            YY+A FD++D+  LP  SP R K EEMFAREIRN +A EG ER ERH SF  WR+ + + 
Sbjct  475  YYAAAFDAVDAAGLPEASPARAKAEEMFAREIRNAVAFEGPERFERHESFAGWRRRMEDG  534

Query  210  GKFRCVGITERELLQSQMLLKMHSMESYKVEKQ-----GEDDGLTLSWEDQPLYTVSAWT  46
            G F+  GI ERE +Q +M+ +M   + Y V+       G  + LTL W DQPLYTV+AWT
Sbjct  535  GGFKNAGIGEREAMQGRMIARMFGPDKYTVQAHGGGGSGGGEALTLRWLDQPLYTVTAWT  594

Query  45   PFDIAGSSSSYSQPT  1
            P       S+ S  T
Sbjct  595  PAGDGAGGSTVSAST  609



>gb|EAY99490.1| hypothetical protein OsI_21459 [Oryza sativa Indica Group]
Length=618

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 168/255 (66%), Gaps = 9/255 (4%)
 Frame = -2

Query  744  IPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGES  565
            +P +H+RITG+GES+QEL ETG RLA  A  L LAFEFH VVDRLEDVRLWMLHVK GE 
Sbjct  358  VPPAHVRITGVGESRQELQETGARLARVAAALGLAFEFHAVVDRLEDVRLWMLHVKRGEC  417

Query  564  VAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEH-DESSLESRLVNSLK  388
            VAVNC+L MH++L D +  AL DFLGL RST    +++ E E    +    E+R   +L+
Sbjct  418  VAVNCVLAMHRLLRDDA--ALTDFLGLARSTGATILLLGEHEGGGLNSGRWEARFARALR  475

Query  387  YYSAVFDSLDST-LPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQ  211
            YY+A FD++D+  LP  SP R K EEMFAREIRN +A EG ER ERH SF  WR+ + + 
Sbjct  476  YYAAAFDAVDAAGLPEASPARAKAEEMFAREIRNAVAFEGPERFERHESFAGWRRRMEDG  535

Query  210  GKFRCVGITERELLQSQMLLKMHSMESYKVEKQ-----GEDDGLTLSWEDQPLYTVSAWT  46
            G F+  GI ERE +Q +M+ +M   + Y V+       G  + LTL W DQPLYTV+AWT
Sbjct  536  GGFKNAGIGEREAMQGRMIARMFGPDKYTVQAHGGGGSGGGEALTLRWLDQPLYTVTAWT  595

Query  45   PFDIAGSSSSYSQPT  1
            P       S+ S  T
Sbjct  596  PAGDGAGGSTVSAST  610



>gb|ADE76869.1| unknown [Picea sitchensis]
Length=193

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 139/197 (71%), Gaps = 4/197 (2%)
 Frame = -2

Query  591  MLHVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            MLHVKE E+VAVNCMLQ+HK LYD +G AL   LGLI+ST P  VV+ EQEA H++   E
Sbjct  1    MLHVKEKETVAVNCMLQLHKTLYD-NGAALRGILGLIQSTKPAVVVVVEQEANHNDQIFE  59

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
             R + +L+YYSA+FDS+D+ LP DSP R K+E+ FAREIRNIIACEG ER+ERH  F  W
Sbjct  60   GRFLQALQYYSAIFDSIDANLPSDSPARLKMEQFFAREIRNIIACEGPERIERHEKFEHW  119

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            ++ +ME+G F  V + ERE  Q+++LL M   ++Y+V+   ED  LTL W DQPLYT SA
Sbjct  120  KQ-MMEEGGFTAVPLGEREHCQARILLDMFPCKNYRVKL--EDGRLTLGWLDQPLYTASA  176

Query  51   WTPFDIAGSSSSYSQPT  1
            W P +     +S S P 
Sbjct  177  WAPQEGGNGGASTSSPA  193



>gb|EAZ35680.1| hypothetical protein OsJ_19967 [Oryza sativa Japonica Group]
Length=617

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 167/255 (65%), Gaps = 9/255 (4%)
 Frame = -2

Query  744  IPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGES  565
            +P +H+RITG+GES+QEL ETG RLA  A  L LAFEFH VVDRLEDVRLWMLHVK GE 
Sbjct  357  VPPAHVRITGVGESRQELQETGARLARVAAALGLAFEFHAVVDRLEDVRLWMLHVKRGEC  416

Query  564  VAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEH-DESSLESRLVNSLK  388
            VAVNC+L MH++L D +  AL DFLGL RST    +++ E E    +    E+R   +L+
Sbjct  417  VAVNCVLAMHRLLRDDA--ALTDFLGLARSTGATILLLGEHEGGGLNSGRWEARFARALR  474

Query  387  YYSAVFDSLDST-LPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQ  211
            YY+A FD++D+  LP  S  R K EEMFAREIRN +A EG ER ERH SF  WR+ + + 
Sbjct  475  YYAAAFDAVDAAGLPEASHARAKAEEMFAREIRNAVAFEGPERFERHESFAGWRRRMEDG  534

Query  210  GKFRCVGITERELLQSQMLLKMHSMESYKVEKQ-----GEDDGLTLSWEDQPLYTVSAWT  46
            G F+  GI ERE +Q +M+ +M   + Y V+       G  + LTL W DQPLYTV+AWT
Sbjct  535  GGFKNAGIGEREAMQGRMIARMFGPDKYTVQAHGGGGSGGGEALTLRWLDQPLYTVTAWT  594

Query  45   PFDIAGSSSSYSQPT  1
            P       S+ S  T
Sbjct  595  PAGDGAGGSTVSAST  609



>ref|XP_008676018.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 28 [Zea 
mays]
Length=557

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESV  562
            P +H+RITG+GES+QEL ETG RL   A  L LAFEFH VVDRLEDVRLWMLH+K  E V
Sbjct  325  PXAHVRITGVGESRQELQETGVRLGRMAIALGLAFEFHVVVDRLEDVRLWMLHMKRIEXV  384

Query  561  AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYY  382
            AVN +L  H +  D  G A+ DFL L+RST    +++ E E   +   LE+R   +L+YY
Sbjct  385  AVNYVLAAHHLHRDEIGAAVADFLELMRSTGATILLLGEHEDALNSGRLEARFXRALRYY  444

Query  381  SAVFDSLDSTLPLD-SPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
             A FD +++    D SP R K EEMFAREIRN +A E  +R ERH +F  WR   M++G+
Sbjct  445  VAAFDVVEAAGLADASPARAKAEEMFAREIRNAVAFEAADRFERHETFAGWR-WRMQEGR  503

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG  97
            F+  GI +RE LQ  M+ +M +  +Y ++  G   G
Sbjct  504  FQNTGIGDREALQGCMIARMFAPGNYSMQGVGRRRG  539



>ref|XP_001773669.1| predicted protein [Physcomitrella patens]
 gb|EDQ61557.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 152/229 (66%), Gaps = 5/229 (2%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            ++ITGIG S   L +TG RLA FAE   + FEFH VV  LED+    L  K GE+VAVNC
Sbjct  101  LKITGIGTSCNSLQDTGRRLASFAETYGVPFEFHAVVGELEDLTPMELGAKPGEAVAVNC  160

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            ++Q+H++L   +G  L +F+  +RS +P+ + + EQEA H+ SS   R V ++ YY+AVF
Sbjct  161  VMQLHRLL--NNGDKLHNFIAGLRSLHPVMLTLVEQEANHNTSSFLGRFVEAVHYYAAVF  218

Query  369  DSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLDS+LPL S  R KIE++ FA++I+NI+ACEG +R+ERH +   W+K ++  G FR +
Sbjct  219  DSLDSSLPLASEERAKIEQLYFAQQIKNIVACEGVDRIERHETLDLWQKRMVTAG-FRQL  277

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
             ++   + Q+++LL +     Y++ +Q     ++L+W+DQ L + S+W 
Sbjct  278  PLSSHAVTQAKLLLSLSPCGGYRLSQQ-PGGSISLNWQDQCLLSASSWV  325



>ref|XP_001763820.1| predicted protein [Physcomitrella patens]
 gb|EDQ71462.1| predicted protein, partial [Physcomitrella patens]
Length=368

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 149/228 (65%), Gaps = 5/228 (2%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            ++ITG+G S   L +TG RLA FAE   + FEFH VV  LED+    L  K GE+VAVNC
Sbjct  145  LKITGVGTSCTSLQDTGRRLAAFAETYGVPFEFHAVVGELEDLSPMELGAKPGEAVAVNC  204

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            ++Q+H++L   +G  L +F+  +RS +P+ + + EQEA H+ SS   R V +L YY+AVF
Sbjct  205  VMQLHRLL--NNGDKLQNFISGLRSIHPVMLTLVEQEANHNTSSFMGRFVEALHYYAAVF  262

Query  369  DSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLDS+LPL S  R KIE++ FA++I+NI+ACEG +R+ERH +   W+K  M+   FR  
Sbjct  263  DSLDSSLPLASEERAKIEQLYFAQQIKNIVACEGADRIERHETLELWQK-RMKLAGFRQW  321

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
             ++   + Q+++LL +   + Y + +Q     ++L+W+D+ L T S W
Sbjct  322  PLSSHSVTQAKLLLSLSPCDGYCLSQQ-PGGSISLNWQDRSLLTASTW  368



>gb|KJB34025.1| hypothetical protein B456_006G044300 [Gossypium raimondii]
Length=653

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 145/229 (63%), Gaps = 10/229 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G S + + ETG  L   A  L++ FEFHP+ ++LED++  M + + GE++AVN 
Sbjct  431  LRITGVGPSMEAIKETGRSLTELAHSLHIPFEFHPIGEKLEDIKPHMFNRRVGEALAVNA  490

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            +  +H+V     G  L + L +IR+  P  V + EQEA H+      R + +L YYSA+F
Sbjct  491  VNTLHRV----PGNFLGNLLAMIRNQAPNIVTLVEQEASHNGPYFLGRFLEALHYYSAIF  546

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER+ERH    KWRK LME   F+ V
Sbjct  547  DSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGSERIERHERLEKWRK-LMEGKGFKGV  605

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  606  PLSANAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRAILAASAW  651



>ref|XP_008441631.1| PREDICTED: DELLA protein RGL1-like [Cucumis melo]
Length=685

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 148/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S   + ETG  L   A  LN+ FEFH + ++LE ++  M + + 
Sbjct  457  PGGSP--FLRITGVGPSIDAVRETGRCLTELAHSLNVPFEFHAIGEQLESLKPNMFNRRV  514

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G++L + LG+IR   P  V + EQEA H+      R + +
Sbjct  515  GEALAVNAVNRLHRV----PGKSLGNLLGMIRDQAPNIVTLVEQEASHNGPYFLGRFLEA  570

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER+ERH    KWRK LM
Sbjct  571  LHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGPERIERHERLEKWRK-LM  629

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ L   SAW
Sbjct  630  EAKGFKGVALSSNAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRALIAASAW  683



>gb|KHG02698.1| Protein SCARECROW [Gossypium arboreum]
Length=643

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 145/229 (63%), Gaps = 10/229 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G S + + ETG  L   A  L++ FEFHP+ ++LE+++  M + + GE++AVN 
Sbjct  421  LRITGVGPSIEAIKETGRCLTELAHSLHIPFEFHPIGEKLENIKAHMFNRRVGEALAVNA  480

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            +  +H+V     G  L + L +IR+  P  V + EQEA H+      R + +L YYSA+F
Sbjct  481  VNTLHRV----PGNCLGNLLAMIRNQAPNIVTLVEQEASHNGPYFLGRFLEALHYYSAIF  536

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER+ERH    KWRK LME   F+ V
Sbjct  537  DSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGSERIERHERLEKWRK-LMEGKGFKGV  595

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  596  PLSANAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRAILAASAW  641



>ref|XP_004138798.1| PREDICTED: DELLA protein RGL1-like [Cucumis sativus]
 gb|KGN63151.1| hypothetical protein Csa_2G405020 [Cucumis sativus]
Length=685

 Score =   189 bits (481),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 148/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S   + ETG  L   A  LN+ FEFH + ++LE ++  M + + 
Sbjct  457  PGGSP--FLRITGVGPSIDAVRETGRCLTELAHSLNVPFEFHAIGEQLESLKPNMFNRRV  514

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G++L + LG+IR   P  V + EQEA H+      R + +
Sbjct  515  GEALAVNAVNRLHRV----PGKSLGNLLGMIRDQAPNIVTLVEQEASHNGPYFLGRFLEA  570

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER+ERH    KWRK LM
Sbjct  571  LHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGPERIERHERLEKWRK-LM  629

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ L   SAW
Sbjct  630  EAKGFKGVALSSNAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRALIAASAW  683



>ref|XP_011623444.1| PREDICTED: DELLA protein RGL1 [Amborella trichopoda]
Length=374

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 145/239 (61%), Gaps = 12/239 (5%)
 Frame = -2

Query  759  GXPGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHV  580
            G PG  P   +R+TG+G   + + ETG RLA  A  L + FEFH V D LE++R   L  
Sbjct  144  GRPGGPPA--LRLTGLGSQLELVRETGRRLADLAHSLRVPFEFHAVADPLEELRPRALGR  201

Query  579  KEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLV  400
            + GE++A+N + ++H V    +  AL   L L R   P  V + EQEA H+     SR +
Sbjct  202  RIGEALAINAVNRLHHV----APHALGPLLALFRDQAPKIVTLVEQEASHNSPYFLSRFL  257

Query  399  NSLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKL  223
             +L YYSA FDSLD+T P DSP R ++E+ +FA EI NI+ACEG  R+ERH    +WR+ 
Sbjct  258  EALHYYSATFDSLDATFPTDSPQRARVEKFIFAAEINNIVACEGAARVERHERLERWRR-  316

Query  222  LMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            +ME   FR V ++   + QS+MLL +++ + Y++    ED G L L W+D+PL  VSAW
Sbjct  317  VMEGKGFRGVPLSANAVNQSRMLLSIYTCDGYRL---NEDAGCLLLGWQDRPLIAVSAW  372



>gb|ERN06264.1| hypothetical protein AMTR_s00016p00207780 [Amborella trichopoda]
Length=221

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 139/227 (61%), Gaps = 10/227 (4%)
 Frame = -2

Query  723  ITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNCML  544
            +TG+G   + + ETG RLA  A  L + FEFH V D LE++R   L  + GE++A+N + 
Sbjct  1    MTGLGSQLELVRETGRRLADLAHSLRVPFEFHAVADPLEELRPRALGRRIGEALAINAVN  60

Query  543  QMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVFDS  364
            ++H V    +  AL   L L R   P  V + EQEA H+     SR + +L YYSA FDS
Sbjct  61   RLHHV----APHALGPLLALFRDQAPKIVTLVEQEASHNSPYFLSRFLEALHYYSATFDS  116

Query  363  LDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCVGI  187
            LD+T P DSP R ++E+ +FA EI NI+ACEG  R+ERH    +WR+ +ME   FR V +
Sbjct  117  LDATFPTDSPQRARVEKFIFAAEINNIVACEGAARVERHERLERWRR-VMEGKGFRGVPL  175

Query  186  TERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            +   + QS+MLL +++ + Y++    ED G L L W+D+PL  VSAW
Sbjct  176  SANAVNQSRMLLSIYTCDGYRLN---EDAGCLLLGWQDRPLIAVSAW  219



>ref|XP_007161687.1| hypothetical protein PHAVU_001G089900g [Phaseolus vulgaris]
 gb|ESW33681.1| hypothetical protein PHAVU_001G089900g [Phaseolus vulgaris]
Length=663

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 142/229 (62%), Gaps = 10/229 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G S   + ETG  L   A  L + FEFH V ++LED+R  MLH + GE++AVN 
Sbjct  441  LRITGVGPSLDAVRETGRCLTELAHSLRIPFEFHAVGEQLEDLRPHMLHRRVGEALAVNA  500

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            + ++H+V     G  L + L +IR   P  V + EQEA H+      R + +L YYSA+F
Sbjct  501  VNRLHRV----PGNHLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEALHYYSAIF  556

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK +ME   F+ V
Sbjct  557  DSLDATFPADSAQRAKVEQYIFAPEIRNIVACEGAERFERHERLEKWRK-IMEGKGFKGV  615

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S + Y++    +D G L L W+D+ +   SAW
Sbjct  616  ALSPNAVTQSKILLGLYSCDGYRLT---DDKGCLLLGWQDRAIVAASAW  661



>ref|XP_011045749.1| PREDICTED: DELLA protein RGL1-like [Populus euphratica]
Length=679

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 145/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L   A  L++ FE+HPV + LED++  M + + 
Sbjct  451  PGGAP--FLRITGVGSSMENVRETGRCLTELAHSLHVPFEYHPVAEELEDLKPHMFNRRV  508

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G  L +   +IR   P  V + EQEA H+      R + +
Sbjct  509  GEALAVNSVNRLHRV----PGNCLGNLFAMIRDQAPNIVTVVEQEASHNGPYFLGRFLEA  564

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK LM
Sbjct  565  LHYYSAIFDSLDATFPPDSSQRAKVEQYIFAPEIRNIVACEGAERFERHERLEKWRK-LM  623

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  624  EGKGFKGVPLSANAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRAILAASAW  677



>gb|KDO63869.1| hypothetical protein CISIN_1g045762mg, partial [Citrus sinensis]
Length=373

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 146/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G + +   ETG  L   A  L++ FEFHPV ++LED++  M + + 
Sbjct  145  PGGAP--FLRITGVGATIESAKETGRCLTELAHSLHVPFEFHPVGEQLEDLKPHMFNRRV  202

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V  +  G    + L +IR   P  V + EQEA H+      R + +
Sbjct  203  GEALAVNAVNRLHRVPSNCLG----NLLAMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  258

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER  RH    KWRK +M
Sbjct  259  LHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGGERTARHERLEKWRK-IM  317

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   FR V ++   + QS++LL ++S + Y++    ED+G L L W+D+ L   SAW
Sbjct  318  EGKGFRGVPLSANAVTQSKILLGLYSCDGYRLT---EDNGCLLLGWQDRALLAASAW  371



>ref|XP_002298647.1| hypothetical protein POPTR_0001s33360g [Populus trichocarpa]
 gb|EEE83452.1| hypothetical protein POPTR_0001s33360g [Populus trichocarpa]
Length=679

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 145/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L   A  L++ FE+HPV + L D++  M + + 
Sbjct  451  PGGAP--FLRITGVGSSMENVRETGRCLTELAHSLHVPFEYHPVAEELVDLKPHMFNRRV  508

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G  L + L +IR   P  V + EQEA H+      R + +
Sbjct  509  GEALAVNSVNRLHRV----PGNCLGNLLAMIRDQAPNIVTVVEQEASHNGPYFLGRFLEA  564

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLDST P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK LM
Sbjct  565  LHYYSAIFDSLDSTFPPDSSQRAKVEQYIFAPEIRNIVACEGAERFERHERLEKWRK-LM  623

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  624  EGKGFKGVPLSANAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRAILAASAW  677



>ref|XP_001778507.1| predicted protein [Physcomitrella patens]
 gb|EDQ56680.1| predicted protein [Physcomitrella patens]
Length=404

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 145/232 (63%), Gaps = 4/232 (2%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RITG+G+ ++ L  TG RLA FA+ + L FEF P+V   E++   M  ++ GE+VA N
Sbjct  172  HLRITGVGKDREMLDRTGTRLAEFAQSIQLPFEFTPLVQAPENLIPSMFGLRIGEAVAFN  231

Query  552  CMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAV  373
            CMLQ+H++L   S + L  FL ++ S  P  V +AE EA H++     R   +L +YS +
Sbjct  232  CMLQLHQLLAKGSEK-LTSFLYMLESLTPRVVTLAELEASHNQPHFLDRFAEALNHYSTL  290

Query  372  FDSLDSTLPLDSPVRTKIEEMFAR-EIRNIIACEGRERLERHASFGKWRKLLMEQGKFRC  196
            FDSLD+TLP  SP R ++E+ + + EI NI+AC+G ER  RH    +WR+   E+  F+ 
Sbjct  291  FDSLDATLPPTSPERIRVEQTWYKMEIINIVACDGTERTVRHQRCEQWRRFF-ERAGFQL  349

Query  195  VGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAWTP  43
            +  +     Q+++LL++H   + Y++ +  ED  L L W+D+PL+ VS+W P
Sbjct  350  LPTSRFATSQARLLLRLHYPCDGYRLVEDVEDGCLLLGWQDRPLFCVSSWHP  401



>ref|XP_003622095.1| Protein SCARECROW [Medicago truncatula]
 ref|XP_003622098.1| Protein SCARECROW [Medicago truncatula]
 gb|AES78313.1| GRAS family transcription factor [Medicago truncatula]
 gb|AFK81971.2| required for arbuscular mycorrhization 1 [Medicago truncatula]
Length=674

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 147/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  L   A  L + FEFHPV ++LED++  M + + 
Sbjct  446  PGGAP--FLRITGVGPCIESVRETGRCLTELAHSLRIPFEFHPVGEQLEDLKPHMFNRRV  503

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G  L + L +IR   P  V + EQEA H+      R + +
Sbjct  504  GEALAVNTVNRLHRV----PGNHLGNLLSMIRDQAPNIVTLVEQEASHNGPYFLGRFLEA  559

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P++S  R K+E+ +FA EIRNI+ACEG ER+ERH    KWRK +M
Sbjct  560  LHYYSAIFDSLDATFPVESAPRAKVEQYIFAPEIRNIVACEGEERIERHERLEKWRK-IM  618

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  619  EGKGFKGVPLSPNAVTQSRILLGLYSCDGYRLT---EDKGCLLLGWQDRAIIAASAW  672



>ref|XP_002512896.1| DELLA protein GAI1, putative [Ricinus communis]
 gb|EEF49399.1| DELLA protein GAI1, putative [Ricinus communis]
Length=686

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 144/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  L   A  L++ FEFHPV + LED++  M + + 
Sbjct  458  PGGAP--FLRITGVGSCIESVRETGRCLTELAHSLHVPFEFHPVAEELEDLKPHMFNRRV  515

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H V     G  L + L +IR   P  V + E+EA H+      R + +
Sbjct  516  GEALAVNSVNRLHHV----PGNCLPNLLAMIRDQAPNIVTIVEKEASHNGPYFLGRFLEA  571

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK LM
Sbjct  572  LHYYSAIFDSLDATFPPDSTQRAKVEQYIFAPEIRNIVACEGPERTERHERLEKWRK-LM  630

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  631  EGKGFKGVPLSANAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRAILAASAW  684



>emb|CDP16713.1| unnamed protein product [Coffea canephora]
Length=707

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 149/237 (63%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  L   A  L++ FEFHPV ++LED++  ML+ + 
Sbjct  479  PGGAP--FLRITGVGPYPEAVRETGRCLTELAHSLHIPFEFHPVGEQLEDLKPHMLNRRV  536

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H V     G +L + LG+IR   P  V + EQEA H+      R + +
Sbjct  537  GEALAVNSVNRLHWV----PGNSLGNLLGMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  592

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P +S  R K+E+ +FA EIRNI+A EGRER+ RH    KWRK +M
Sbjct  593  LHYYSAIFDSLDATFPAESAQRAKVEQYIFAPEIRNIVAEEGRERVRRHERLEKWRK-IM  651

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   ++ VG++   + QS++LL ++S E Y++    ED G L L W+D+ +   SAW
Sbjct  652  EGKGYKGVGLSTNAVTQSKILLGLYSCEGYRLT---EDKGCLLLGWQDRAIVAASAW  705



>ref|XP_001769597.1| predicted protein [Physcomitrella patens]
 gb|EDQ65590.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/231 (40%), Positives = 143/231 (62%), Gaps = 4/231 (2%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RITG+G+ +  L  TG RLA FA+ +NL FEF P+V   E +   ML ++ GE+VA+N
Sbjct  147  HLRITGVGQDRDVLNRTGIRLAEFAQSINLPFEFSPLVQISEHLVPRMLGLRVGEAVAIN  206

Query  552  CMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAV  373
            CMLQ+H++L     + L+ FL ++ S  P  V +AE EA H++     R   +L +YS +
Sbjct  207  CMLQLHRLLAKGPEK-LISFLCMLESLTPKVVTLAELEASHNQPHFLDRFAEALNHYSTL  265

Query  372  FDSLDSTLPLDSPVRTKIEEMFAR-EIRNIIACEGRERLERHASFGKWRKLLMEQGKFRC  196
            FDSLD+TLP  S  R ++E+ + + EI NI+AC+G ER+ RH  F  WR+     G F+ 
Sbjct  266  FDSLDATLPPTSADRIRVEQTWCKMEIVNIVACDGAERIVRHQRFELWRRYFHRAG-FQL  324

Query  195  VGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
            +  +     Q+++LL++H   + Y++ +  +D  L L W+D PL+ VS+W 
Sbjct  325  LSTSRFATSQARLLLRLHYPCDDYQLLENVDDGCLLLGWQDHPLFCVSSWN  375



>ref|XP_002992412.1| hypothetical protein SELMODRAFT_135151, partial [Selaginella 
moellendorffii]
 gb|EFJ06562.1| hypothetical protein SELMODRAFT_135151, partial [Selaginella 
moellendorffii]
Length=371

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 144/232 (62%), Gaps = 8/232 (3%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RITG+G   + + ETG RLA  A  L + FE+H V +RLED++  MLH + GE++AVN
Sbjct  142  HLRITGVGMPLEAVQETGKRLADLAATLRVPFEYHAVGERLEDLQSHMLHRRHGEALAVN  201

Query  552  CMLQMHKVLYDTS--GRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYS  379
            C+ + H++  D       +V  L +IR   P  V + EQEA H+ +S   R + ++ YYS
Sbjct  202  CIDRFHRLFTDDHLVVNPVVRILSMIREQAPRIVTLVEQEASHNTNSFLKRFLEAMHYYS  261

Query  378  AVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            A+FDSL++TLP  SP R K+E+ +F+ EI NI+ACEG +R+ RH    KW K +ME   F
Sbjct  262  AIFDSLEATLPQVSPERAKVEQVVFSSEIMNIVACEGSQRIVRHEKVDKWCK-IMESIGF  320

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
              V ++   + QS++LL+++  + Y +    ED G L L W+D+ +   SAW
Sbjct  321  YNVALSPSAVHQSKLLLRLYQTDGYTLV---EDKGCLLLGWQDRAIIGASAW  369



>ref|XP_006447014.1| hypothetical protein CICLE_v10018153mg [Citrus clementina]
 ref|XP_006470106.1| PREDICTED: protein SCARECROW-like [Citrus sinensis]
 gb|ESR60254.1| hypothetical protein CICLE_v10018153mg [Citrus clementina]
Length=680

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 146/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G + +   ETG  L   A  L++ FEFHPV ++LED++  M + + 
Sbjct  452  PGGAP--FLRITGVGATIESAKETGRCLTELAHSLHVPFEFHPVGEQLEDLKPHMFNRRV  509

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V  +  G    + L +IR   P  V + EQEA H+      R + +
Sbjct  510  GEALAVNAVNRLHRVPSNCLG----NLLAMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  565

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER  RH    KWRK +M
Sbjct  566  LHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGGERTARHERLEKWRK-IM  624

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   FR V ++   + QS++LL ++S + Y++    ED+G L L W+D+ L   SAW
Sbjct  625  EGKGFRGVPLSANAVTQSKILLGLYSCDGYRLT---EDNGCLLLGWQDRALLAASAW  678



>ref|XP_007031934.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOY02860.1| GRAS family transcription factor [Theobroma cacao]
Length=654

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 142/229 (62%), Gaps = 10/229 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G S + + ETG  L   A  L++ FEFHP+ ++LED++  M + + GE++AVN 
Sbjct  432  LRITGVGPSLEYIKETGRCLTELAHSLHIPFEFHPIGEQLEDIKPHMFNRRVGEALAVNA  491

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            + ++H+V     G  L + L +IR   P  V + EQEA H+      R + +L YYSA+F
Sbjct  492  VNRLHRV----PGNCLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEALHYYSAIF  547

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T   DS  R K+E+ +FA EIRNI+ACEG ER  RH    KWRK LME   F+ V
Sbjct  548  DSLDATFSPDSAQRAKVEQYIFAPEIRNIVACEGSERTARHERLEKWRK-LMEGKGFKGV  606

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  607  PLSANAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRAILAASAW  652



>ref|XP_006338809.1| PREDICTED: protein SCARECROW-like [Solanum tuberosum]
Length=689

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 148/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L   A+ L++ FEFHPV ++LED++  M + + 
Sbjct  461  PGGAP--FLRITGVGSSPEAVRETGRCLTELAQSLHVPFEFHPVGEQLEDLKAHMFNRRI  518

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G  + + LG+IR   P  V + EQEA H+      R + +
Sbjct  519  GEALAVNSVNRLHRV----PGNCIGNLLGMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  574

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +F  EI NI++CEG ER+ RH    KWR+ +M
Sbjct  575  LHYYSAIFDSLDATFPGDSSQRAKLEQYIFGPEIMNIVSCEGMERMVRHERLEKWRR-VM  633

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + YK+    ED+G L L W+D+ +   SAW
Sbjct  634  EGKGFKGVALSANAVTQSKILLGLYSCDGYKLT---EDNGCLLLGWQDRAILAASAW  687



>ref|XP_002968015.1| GRAS family protein, partial [Selaginella moellendorffii]
 gb|EFJ31362.1| GRAS family protein, partial [Selaginella moellendorffii]
Length=504

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 144/232 (62%), Gaps = 8/232 (3%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RITG+G   + + ETG RLA  A  L + FE+H V +RLED++  MLH + GE++AVN
Sbjct  275  HLRITGVGMPLEAVQETGKRLADLAATLRVPFEYHAVGERLEDLQSHMLHRRHGEALAVN  334

Query  552  CMLQMHKVLYDTS--GRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYS  379
            C+ + H++  D       +V  L +IR   P  V + EQEA H+ +S   R + ++ YYS
Sbjct  335  CIDRFHRLFTDDHLVVNPVVRILSMIREQAPRIVTLVEQEANHNTNSFLKRFLEAMHYYS  394

Query  378  AVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKF  202
            A+FDSL++TLP  SP R K+E+ +F+ EI NI+ACEG +R+ RH    KW K +ME   F
Sbjct  395  AIFDSLEATLPQVSPERAKVEQVVFSSEIMNIVACEGSQRIVRHEKVDKWCK-IMESIGF  453

Query  201  RCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
              V ++   + QS++LL+++  + Y +    ED G L L W+D+ +   SAW
Sbjct  454  YNVALSPSAVHQSKLLLRLYQTDGYTLV---EDKGCLLLGWQDRAIIGASAW  502



>ref|XP_009613034.1| PREDICTED: DELLA protein RGL1-like [Nicotiana tomentosiformis]
Length=707

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 147/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L   A  L++ FEFHPV ++LED++  M + + 
Sbjct  479  PGGAP--FLRITGVGPSPEAVKETGRCLTELAHSLHVPFEFHPVGEQLEDLKPHMFNRRI  536

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V  +  G    + L +IR   P  V + EQEA H+      R + +
Sbjct  537  GEALAVNSVNRLHRVPVNCIG----NLLAMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  592

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EI NI++CEG ER+ RH    KWR+ LM
Sbjct  593  LHYYSAIFDSLDATFPADSSQRAKLEQYIFAPEIMNIVSCEGAERVVRHERLEKWRR-LM  651

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + YK+    ED+G L L W+D+ +   SAW
Sbjct  652  EGKGFKGVALSANAVTQSKILLGLYSCDGYKLT---EDNGCLLLGWQDRAILAASAW  705



>ref|XP_007217517.1| hypothetical protein PRUPE_ppa024399mg [Prunus persica]
 gb|EMJ18716.1| hypothetical protein PRUPE_ppa024399mg [Prunus persica]
Length=708

 Score =   182 bits (461),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 143/229 (62%), Gaps = 10/229 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G   + + ETG  L   A  L++ FEFH V ++LED++  M + + GE++AVN 
Sbjct  486  LRITGVGPCIEAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFNRRIGEALAVNT  545

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            + ++H+V     G  L + L +IR   P  V + EQEA H+      R + +L YYSA+F
Sbjct  546  VNRLHRV----PGNYLGNVLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEALHYYSAIF  601

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T P DS  R K+E+ +FA+EIRNI+ACEG ER ERH    KWRK +ME   F+ V
Sbjct  602  DSLDATFPPDSAQRAKVEQYIFAQEIRNIVACEGAERTERHERLEKWRK-VMESKGFKSV  660

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  661  ALSANAVTQSKILLGLYSCDGYRMT---EDKGCLLLGWQDRSIMAASAW  706



>ref|XP_009346793.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
Length=704

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 146/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  L   A  L++ FEFH V ++LED++  M + + 
Sbjct  476  PGGAP--FLRITGVGPCIEAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFNRRI  533

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V  +  G    + L +IR   P  V + EQEA H+      R + +
Sbjct  534  GEALAVNTVNRLHRVPVNCLG----NLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEA  589

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK +M
Sbjct  590  LHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLDKWRK-VM  648

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED+G L L W+D+ +   SAW
Sbjct  649  ESKGFKSVALSANAVTQSKILLGLYSCDGYRMT---EDNGCLLLGWQDRSIMAASAW  702



>ref|XP_008231070.1| PREDICTED: DELLA protein GAI-like [Prunus mume]
Length=712

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 145/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  L   A  L++ FEFH V ++LED++  M + + 
Sbjct  484  PGGAP--FLRITGVGPCIEAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFNRRI  541

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G  L + L +IR   P  V + EQEA H+      R + +
Sbjct  542  GEALAVNTVNRLHRV----PGNYLGNVLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEA  597

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK +M
Sbjct  598  LHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLEKWRK-VM  656

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  657  ESKGFKSVALSANAVTQSKILLGLYSCDGYRMT---EDKGCLLLGWQDRSIMAASAW  710



>ref|XP_003549053.1| PREDICTED: protein SCARECROW-like [Glycine max]
Length=687

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 142/229 (62%), Gaps = 10/229 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G S   + ETG  L   A  L + FEFH V ++LED++  ML+ + GE++AVN 
Sbjct  465  LRITGVGPSIDTVRETGRCLTELAHSLRIPFEFHAVGEQLEDLKPHMLNRRVGEALAVNA  524

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            + ++H+V     G  L + L ++R   P  V + EQEA H+      R + +L YYSA+F
Sbjct  525  VNRLHRV----PGNHLGNLLTMLRDQAPSIVTLVEQEASHNGPYFLGRFLEALHYYSAIF  580

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T P +S  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK +ME   F+ V
Sbjct  581  DSLDATFPAESAQRAKVEQYIFAPEIRNIVACEGPERFERHERLEKWRK-MMEGKGFKGV  639

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S E Y++    ED G L L W+D+ +   SAW
Sbjct  640  VLSPNAVTQSKILLGLYSCEGYRLT---EDKGCLLLGWQDRAIVAASAW  685



>ref|XP_009803754.1| PREDICTED: DELLA protein RGL2-like [Nicotiana sylvestris]
Length=713

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 147/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L   A  L++ FEFHPV ++LED++  M + + 
Sbjct  485  PGGAP--FLRITGVGPSPEAVRETGRCLTELAHSLHVPFEFHPVGEQLEDLKPHMFNRRI  542

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V  +  G    + L +IR   P  V + EQEA H+      R + +
Sbjct  543  GEALAVNSVNRLHRVPVNCIG----NLLAMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  598

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EI NI++CEG ER+ RH    KWR+ LM
Sbjct  599  LHYYSAIFDSLDATFPADSSQRAKLEQYIFAPEIMNIVSCEGAERVVRHERLEKWRR-LM  657

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + YK+    ED+G L L W+D+ +   SAW
Sbjct  658  EGKGFKGVPLSANAVTQSKILLGLYSCDGYKLT---EDNGCLLLGWQDRAILAASAW  711



>ref|XP_010315907.1| PREDICTED: DELLA protein RGL1-like [Solanum lycopersicum]
Length=680

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 147/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  L   A+ L++ FEFHPV ++LED++  M + + 
Sbjct  452  PGGAP--FLRITGVGSYPEAVRETGRCLTELAQSLHVPFEFHPVGEQLEDLKPHMFNRRI  509

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G  + + LG+IR   P  V + EQEA H+      R + +
Sbjct  510  GEALAVNSVNRLHRV----PGNCIGNLLGMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  565

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +F  EI NI++CEG ER+ RH    KWR+ +M
Sbjct  566  LHYYSAIFDSLDATFPGDSSQRAKLEQYIFGPEIMNIVSCEGMERMVRHERLEKWRR-VM  624

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + YK+    ED+G L L W+D+ +   SAW
Sbjct  625  EGKGFKGVALSANAVTQSKILLGLYSCDGYKLT---EDNGCLLLGWQDRAILAASAW  678



>gb|KDP41801.1| hypothetical protein JCGZ_26819 [Jatropha curcas]
Length=674

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 145/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L   A  L++ FE+HPV + L++++  M + + 
Sbjct  446  PGGAP--FLRITGVGSSIESVRETGRCLTELAHSLHVPFEYHPVAEELDNLKPHMFNRRV  503

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V        L + L +IR   P  V + E+EA H+      R + +
Sbjct  504  GEALAVNSVNRLHRV----PANCLGNLLAMIRDQAPNIVTLVEREASHNGPYFLGRFLEA  559

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK LM
Sbjct  560  LHYYSAIFDSLDATFPPDSAQRAKLEQYIFAPEIRNIVACEGAERTERHERLEKWRK-LM  618

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ L   SAW
Sbjct  619  EGKGFKGVPLSANAVTQSRILLGLYSCDGYRLT---EDKGCLLLGWQDRALVAASAW  672



>ref|XP_012067557.1| PREDICTED: DELLA protein RGL1-like [Jatropha curcas]
Length=682

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 145/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L   A  L++ FE+HPV + L++++  M + + 
Sbjct  454  PGGAP--FLRITGVGSSIESVRETGRCLTELAHSLHVPFEYHPVAEELDNLKPHMFNRRV  511

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V        L + L +IR   P  V + E+EA H+      R + +
Sbjct  512  GEALAVNSVNRLHRV----PANCLGNLLAMIRDQAPNIVTLVEREASHNGPYFLGRFLEA  567

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK LM
Sbjct  568  LHYYSAIFDSLDATFPPDSAQRAKLEQYIFAPEIRNIVACEGAERTERHERLEKWRK-LM  626

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ L   SAW
Sbjct  627  EGKGFKGVPLSANAVTQSRILLGLYSCDGYRLT---EDKGCLLLGWQDRALVAASAW  680



>ref|XP_008379744.1| PREDICTED: DELLA protein RGL1-like [Malus domestica]
Length=704

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 143/229 (62%), Gaps = 10/229 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G   + + ETG  L   A  L++ FEFH V ++LED++  M + + GE++AVN 
Sbjct  482  LRITGVGPCIEAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFNRRIGEALAVNT  541

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            + ++H+V  +  G    + L +IR   P  V + EQEA H+      R + +L YYSA+F
Sbjct  542  VNRLHRVPVNXLG----NLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEALHYYSAIF  597

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK +ME   F+ V
Sbjct  598  DSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLEKWRK-VMESKGFKSV  656

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S + Y++    ED+G L L W+D+ +   SAW
Sbjct  657  ALSANAVTQSKILLGLYSCDGYRMT---EDNGCLLLGWQDRSIMAASAW  702



>ref|XP_008791129.1| PREDICTED: DELLA protein RGL3-like [Phoenix dactylifera]
Length=717

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/238 (42%), Positives = 144/238 (61%), Gaps = 13/238 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVK  577
            PG  P   +RITG+G   + + +TG  LA  A  L + FEFH  V DRLED+   MLH +
Sbjct  488  PGGPPA--LRITGVGHPAESVRQTGRHLAELAHSLRVPFEFHAAVADRLEDLLPGMLHRR  545

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
             GE++AVN + ++H+V     G  L   L +IR   P  V + E EA H+      R + 
Sbjct  546  IGEALAVNAVCRLHRV----PGAHLGQLLSMIRDQAPKIVTLVEHEASHNGPYFLGRFLE  601

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L YYSA+FDSLD+T P DS  R K+E+ +FA EI+NI+A EG ER+ RH   G+WRK +
Sbjct  602  ALHYYSAIFDSLDATFPADSAARAKVEQYIFAPEIKNIVASEGAERVARHERLGRWRK-V  660

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            ME   F+ V ++   + QS++LL +++ + Y++    ED+G L L W+D+ +   SAW
Sbjct  661  MEGRGFKGVALSANSVNQSRILLGLYACDGYRLT---EDNGCLLLGWQDRAIIAASAW  715



>ref|XP_003553957.1| PREDICTED: protein SCARECROW-like [Glycine max]
Length=681

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 140/229 (61%), Gaps = 10/229 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G     + ETG  L   A  L + FEFH V ++LED++  ML+ + GE++AVN 
Sbjct  459  LRITGVGPLLDAVRETGRCLTELAHSLRIPFEFHAVGEQLEDLKPHMLNRRVGEALAVNA  518

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            +  +H+V     G  L + L ++R   P  V + EQEA H+      R + +L YYSA+F
Sbjct  519  VNHLHRV----PGNHLGNLLTMLRDQAPSIVTLVEQEASHNGPYFLGRFLEALHYYSAIF  574

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T P +S  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK +ME   F+ V
Sbjct  575  DSLDATFPAESAQRAKVEQYIFAPEIRNIVACEGAERFERHERLEKWRK-IMEGKGFKGV  633

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S E Y++    ED G L L W+D+ +   SAW
Sbjct  634  ALSPNAVTQSKILLGLYSCEGYRLT---EDKGCLLLGWQDRAIIAASAW  679



>ref|XP_009378007.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
 ref|XP_009350709.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
Length=701

 Score =   179 bits (454),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 145/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  L   A  L++ FEFH V ++LED++  M + + 
Sbjct  473  PGGAP--FLRITGVGPCIEAVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFNRRI  530

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V  +  G    + L +IR   P  V + EQEA H+      R + +
Sbjct  531  GEALAVNTVNRLHRVPVNCLG----NLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEA  586

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK +M
Sbjct  587  LHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLEKWRK-VM  645

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  646  ESKGFKSVPLSANAVTQSKILLGLYSCDGYRMT---EDKGCLLLGWQDRSIMAASAW  699



>ref|XP_009405522.1| PREDICTED: DELLA protein GAI-like [Musa acuminata subsp. malaccensis]
Length=726

 Score =   179 bits (454),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 141/238 (59%), Gaps = 13/238 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPV-VDRLEDVRLWMLHVK  577
            PG  P   +RITG+G     + ETG  LA  A  L + FEFH   V+RLED+R  MLH +
Sbjct  497  PGGAPA--LRITGVGHPADSVRETGRHLAELAHSLRVPFEFHAATVERLEDLRPSMLHRR  554

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
             GE++AVN + ++H+V     G  L   L +IR   P    + EQEA H+      R + 
Sbjct  555  VGEALAVNSVNRLHRV----PGAHLGPLLAMIRDQAPKIFTLVEQEASHNGPYFLGRFLE  610

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L YYSA+FDSLD+T P DS  R K+E+ + A EIRNI+ACEG ER+ RH    +WR+ +
Sbjct  611  ALHYYSAIFDSLDATFPSDSAARAKVEQFLLAPEIRNIVACEGSERVARHERLERWRR-V  669

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            ME   F  V ++   + QS++LL ++  + Y++    ED G L L W+D+P+   SAW
Sbjct  670  MEGRGFEGVALSANAVNQSKILLGLYPCDGYRLT---EDKGCLLLGWQDRPIIAASAW  724



>ref|XP_010110925.1| hypothetical protein L484_005656 [Morus notabilis]
 gb|EXC29148.1| hypothetical protein L484_005656 [Morus notabilis]
Length=687

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 141/228 (62%), Gaps = 8/228 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G S   + ETG  LA  A  L++ FEFH V ++LED++  M + + GE++AVN 
Sbjct  465  LRITGVGPSIDSVEETGRCLAELAHSLHVPFEFHAVGEQLEDLKPHMFNRRVGEALAVNS  524

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            + ++H+V        L + L +IR   P  + + EQEA H+      R + +L YYSA+F
Sbjct  525  VNRLHRV----PANCLGNILSMIRDQAPNILTLVEQEASHNGPYFLGRFLEALHYYSAIF  580

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T P+DS  R K+E+ +FA EIRNI+ACEG ER  RH    KWRK +ME   FR V
Sbjct  581  DSLDATFPVDSVQRAKVEQYIFAPEIRNIVACEGPERTARHERLEKWRK-VMEGKGFRGV  639

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S + Y++ +  E   L L W+D+ +   SAW
Sbjct  640  PLSANAVTQSKILLGLYSCDGYRLTE--EKGCLLLGWQDRAIIAASAW  685



>ref|XP_008341667.1| PREDICTED: DELLA protein RGL1-like [Malus domestica]
Length=705

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 145/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  L   A  L++ FEFH V ++LED++  M + + 
Sbjct  477  PGGAP--FLRITGVGPCIEGVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFNRRI  534

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V    S   L + L +IR   P  V + EQEA H+      R + +
Sbjct  535  GEALAVNTVNRLHRV----SVNCLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEA  590

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK +M
Sbjct  591  LHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGVERTERHERLEKWRK-VM  649

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  650  ESKGFKSVPLSANAVTQSKILLGLYSCDGYRMT---EDKGCLLLGWQDRSIMAASAW  703



>ref|XP_002274834.2| PREDICTED: scarecrow-like protein 21 [Vitis vinifera]
 emb|CBI21318.3| unnamed protein product [Vitis vinifera]
Length=668

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 144/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L   A  L++ FEFHPV + LED++  M + + 
Sbjct  440  PGGAP--FLRITGVGCSPESVRETGRCLTELAHSLHVPFEFHPVGEELEDLKPHMFNRRV  497

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN   ++H+V  +  G    + L +IR   P  V + EQEA H+      R + +
Sbjct  498  GEALAVNSANRLHRVPTNFLG----NLLAMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  553

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA  IRNI+ACEG ER+ RH    KWRK LM
Sbjct  554  LHYYSAIFDSLDATFPPDSAQRAKLEQYIFAPVIRNIVACEGAERVMRHERLEKWRK-LM  612

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  613  EGKGFQGVPLSANAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRAILAASAW  666



>ref|XP_011099005.1| PREDICTED: DELLA protein RGL2-like [Sesamum indicum]
Length=708

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 144/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L   A  L++ FEFHPV + LED++  M + + 
Sbjct  480  PGGAP--FLRITGVGPSPESVRETGRCLTELAHSLHVPFEFHPVGEELEDLKPHMFNRRV  537

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G  L + L +IR   P  V + EQEA H+      R + +
Sbjct  538  GEALAVNSVNRLHRV----PGNCLGNLLAMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  593

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+A EG ER  RH    KWRK +M
Sbjct  594  LHYYSAIFDSLDATFPPDSAQRAKVEQHIFAPEIRNIVAQEGPERTMRHERLEKWRK-VM  652

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  653  EGKGFQGVPLSSNAVTQSKILLGLYSCDGYRLT---EDKGCLLLGWQDRSILAASAW  706



>gb|EYU31843.1| hypothetical protein MIMGU_mgv1a021983mg [Erythranthe guttata]
Length=694

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 148/237 (62%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G S + + ETG  L+  A  L++ FEFHPV + LED++  M + + 
Sbjct  466  PGGAP--FLRITGVGPSPESVRETGRCLSELAHSLHVPFEFHPVGEELEDLKPHMFNRRV  523

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V     G AL + L +IR   P  V + EQEA H+      R + +
Sbjct  524  GEALAVNSVNRLHRV----PGNALGNLLTMIRDQAPNIVTIVEQEASHNGPYFLGRFLEA  579

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P +S  RTK+E+ +FA EI+NI+A EG ER+ RH    KWRK +M
Sbjct  580  LHYYSAIFDSLDATFPSESEQRTKVEQNIFAPEIKNIVAHEGPERVMRHERLEKWRK-IM  638

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  639  EGKGFQGVPLSSNAVTQSKILLGLYSCDGYRLT---EDRGCLLLGWQDRSILAASAW  692



>ref|XP_009344215.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
Length=699

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 145/237 (61%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  L   A  L++ FEFH V ++LED++  M + + 
Sbjct  471  PGGAP--FLRITGVGPFIEGVKETGRCLTELALSLHVPFEFHAVGEQLEDLKPHMFNRRI  528

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN + ++H+V  +  G    + L +IR   P  V + EQEA H+      R + +
Sbjct  529  GEALAVNTVNRLHRVPVNCLG----NLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEA  584

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSLD+T P DS  R K+E+ +FA EIRNI+ACEG ER ERH    KWRK +M
Sbjct  585  LHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLEKWRK-VM  643

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F+ V ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  644  ESKGFKSVPLSANAVTQSKILLGLYSCDGYRMT---EDKGCLLLGWQDRSIMAASAW  697



>ref|XP_010917930.1| PREDICTED: DELLA protein GAI1-like [Elaeis guineensis]
Length=409

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 143/237 (60%), Gaps = 11/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVK  577
            PG  P   +RITG+G   + + +TG  LA  A  L++ FEFHP + DRLED+R  MLH +
Sbjct  180  PGGPPA--LRITGVGHPAESVHQTGRHLAELAHSLHVPFEFHPAIADRLEDLRPSMLHRR  237

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
             GE++AVN + ++H+V        L   L  IR   P  V + E EA H++     R + 
Sbjct  238  VGEALAVNAVCRLHRV----PDIHLDWLLSTIRDQAPKIVTLVEIEASHNDPHFLGRFLE  293

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L Y++A+FDSLD+T P DS  R K+E+ +FA EI+NI+A EG ER+ RH    +WRK +
Sbjct  294  ALPYFAALFDSLDATFPADSAARAKVEQYIFAPEIKNIVAREGAERVARHEKLDRWRK-V  352

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            ME   F+ V ++   + QS++LL +++ + Y++ +  E+  + L W DQ +   SAW
Sbjct  353  MEGRGFKGVALSANSVDQSRILLGLYACDGYRLTE--ENGCMFLGWRDQRMIAASAW  407



>ref|XP_004304540.2| PREDICTED: DELLA protein RGL1-like [Fragaria vesca subsp. vesca]
Length=710

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 141/229 (62%), Gaps = 10/229 (4%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +RITG+G   + + ETG  L   A  L++ FEFH V ++LED++  M + + GE++AVN 
Sbjct  488  LRITGVGPCIEAVKETGRCLMELAISLHVPFEFHAVGEQLEDLKPHMFNRRIGEALAVNT  547

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
            + ++H+V     G  L + L +IR   P  V + EQEA H+      R + +L YYSA+F
Sbjct  548  VNRLHRV----PGNCLGNLLAMIRDQAPNIVTLVEQEASHNGPYFLGRFLEALHYYSAIF  603

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSLD+T P DS  R K+E+ +FA EIRNI+A EG ER ERH    KWRK +ME   F+ V
Sbjct  604  DSLDATFPPDSAQRAKVEQYIFAPEIRNIVAFEGAERTERHERLEKWRK-VMEGKGFKSV  662

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             ++   + QS++LL ++S + Y++    ED G L L W+D+ +   SAW
Sbjct  663  PLSANAVTQSKILLGLYSCDGYRMM---EDKGCLLLGWQDRSIMAASAW  708



>dbj|BAQ20610.1| GRAS-family protein 2 [Lygodium japonicum]
Length=918

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/246 (43%), Positives = 144/246 (59%), Gaps = 17/246 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P  H+++TGIG    ++K  L ETG  LA FAE LN+ F+F  VV  +L DV+ WM
Sbjct  676  PGGPP--HVKLTGIGPPQPDNKDVLRETGTSLAEFAEALNVKFKFRGVVATKLNDVKPWM  733

Query  588  LHVKEGESVAVNCMLQMHKVLY---DTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDES  421
            L V+ GE++AVN + Q+H++LY   + S  A +D  L  I+S NP  V + EQEAEH+  
Sbjct  734  LQVQPGEAIAVNSIFQLHRLLYVDPNASVPAPIDVILDSIKSLNPKVVAIVEQEAEHNSP  793

Query  420  SLESRLVNSLKYYSAVFDSLDST-LPLDSPVRTKIEEMFAREIRNIIACEGRERLERHAS  244
                R   +L YY  +FDSL++  LP   P R+  E    REI NI+A EG  R+ERH +
Sbjct  794  VFIERFSQALHYYCTMFDSLEAAKLPPQCPERSCAEAYLGREIVNIVASEGASRIERHET  853

Query  243  FGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPL  67
              +WR L M +  FR + I      Q+  LL  ++ +SY +E   E+ G LTL W  +PL
Sbjct  854  LPQWR-LRMSRAGFRPLHIGSHAFNQAGCLLDYYAGKSYTLE---ENYGCLTLGWHSRPL  909

Query  66   YTVSAW  49
              VSAW
Sbjct  910  IAVSAW  915



>ref|XP_002993034.1| hypothetical protein SELMODRAFT_23095, partial [Selaginella moellendorffii]
 gb|EFJ05873.1| hypothetical protein SELMODRAFT_23095, partial [Selaginella moellendorffii]
Length=404

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/248 (38%), Positives = 140/248 (56%), Gaps = 24/248 (10%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RIT + E ++ L   G +LA  AE+L++ F+FHPV      +   ML VK GE+VAV 
Sbjct  160  HLRITAVNEKREVLALMGQKLAESAERLDIPFQFHPVAVTPAALERDMLGVKSGEAVAVT  219

Query  552  CMLQMHKVLYD-------------------TSGRALVDFLGLIRSTNPIAVVMAEQEAEH  430
             ++Q+H +L D                    +   +   L L+ S +P  +V+ EQE+ H
Sbjct  220  SLMQLHSLLADEKEDGKVRGGDVAPKEAKAGTSSTISRVLQLLHSLSPKIMVVVEQESNH  279

Query  429  DESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLER  253
            +  +L  R   +L YYSA+FDSLDSTLP  S  R  +E + F +EIRNI+ACEG ER+ER
Sbjct  280  N-GALHERFAPALHYYSAIFDSLDSTLPQHSSERITVERLIFGQEIRNIVACEGLERMER  338

Query  252  HASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQ  73
            H +   W++   EQ  F    ++    +Q++ LL +HS + YK+ +  E   L L W+D 
Sbjct  339  HETLSSWKRRF-EQAHFSSSHLSPTTAVQAERLLTIHSPDGYKLHR--EKGSLILCWQDT  395

Query  72   PLYTVSAW  49
            P+ +VSAW
Sbjct  396  PMLSVSAW  403



>ref|XP_010030721.1| PREDICTED: scarecrow-like protein 21 [Eucalyptus grandis]
Length=615

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 139/237 (59%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  LA  A  L L FEFHPV ++LE ++  +LH + 
Sbjct  386  PGGAP--FLRITGVGSCIEMVSETGRCLAELARSLRLPFEFHPVSEQLEALKPHLLHWRV  443

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN +  +H+V        L   L +IR   P  V + EQEA H+      R + +
Sbjct  444  GEALAVNSVNCLHRV----PSICLGSLLTMIRDQAPSIVTLVEQEASHNGPYFLGRFLEA  499

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSL+ T P +S  R K+E++ FA EIRNI+ACEG ER ERH    KWRK +M
Sbjct  500  LHYYSAIFDSLNVTFPSNSVHRAKVEQLVFAPEIRNIVACEGPERTERHERLEKWRK-VM  558

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F  V ++E  + QS+ L+ ++S   Y +    ED G L L W+D+ +   SAW
Sbjct  559  EGRGFAGVPLSENAMTQSKTLVGLYSRGGYTLR---EDMGCLLLGWQDRAIVASSAW  612



>gb|KCW55804.1| hypothetical protein EUGRSUZ_I01625 [Eucalyptus grandis]
Length=692

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 139/237 (59%), Gaps = 12/237 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +RITG+G   + + ETG  LA  A  L L FEFHPV ++LE ++  +LH + 
Sbjct  463  PGGAP--FLRITGVGSCIEMVSETGRCLAELARSLRLPFEFHPVSEQLEALKPHLLHWRV  520

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE++AVN +  +H+V        L   L +IR   P  V + EQEA H+      R + +
Sbjct  521  GEALAVNSVNCLHRV----PSICLGSLLTMIRDQAPSIVTLVEQEASHNGPYFLGRFLEA  576

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYSA+FDSL+ T P +S  R K+E++ FA EIRNI+ACEG ER ERH    KWRK +M
Sbjct  577  LHYYSAIFDSLNVTFPSNSVHRAKVEQLVFAPEIRNIVACEGPERTERHERLEKWRK-VM  635

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            E   F  V ++E  + QS+ L+ ++S   Y +    ED G L L W+D+ +   SAW
Sbjct  636  EGRGFAGVPLSENAMTQSKTLVGLYSRGGYTLR---EDMGCLLLGWQDRAIVASSAW  689



>gb|EEC68221.1| hypothetical protein OsI_36217 [Oryza sativa Indica Group]
Length=318

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 137/239 (57%), Gaps = 14/239 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVK  577
            PG  P   +R+TG+G     + ETG  LA  A  L + FEFH    DRLE +R   LH +
Sbjct  88   PGGPPT--LRLTGVGHPPAAVRETGRHLASLAASLRVPFEFHAAAADRLERLRPAALHRR  145

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
             GE++AVN + ++H+V        L   L +IR   P  + + EQEA H+      R + 
Sbjct  146  VGEALAVNAVNRLHRV----PSSHLPPLLSMIRDQAPKIITLVEQEAAHNGPYFLGRFLE  201

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L YYSA+FDSLD+T P +S  R K+E+ + A EIRN++ACEG ER+ RH    +WR+ L
Sbjct  202  ALHYYSAIFDSLDATFPAESTARMKVEQCLLAPEIRNVVACEGAERVARHERLERWRR-L  260

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSM-ESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            ME   F  V ++   + QSQ+LL ++   + Y++    ED G L L W+D+ +   SAW
Sbjct  261  MEGRGFEAVPLSAAAVGQSQVLLGLYGAGDGYRLT---EDSGCLLLGWQDRAIIAASAW  316



>ref|XP_007203631.1| hypothetical protein PRUPE_ppa003975mg [Prunus persica]
 gb|EMJ04830.1| hypothetical protein PRUPE_ppa003975mg [Prunus persica]
Length=537

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 141/254 (56%), Gaps = 16/254 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  276  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  333

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L     R   +   LG IR+ NP  V + EQEA+H+++  
Sbjct  334  LQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLGWIRNLNPKIVTVVEQEADHNKTGF  393

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N++ CEG  R+ERH   GK
Sbjct  394  LDRFTEALYYYSTMFDSLEAC--AMQPEKALAEMYIQREICNVVCCEGAARVERHEPLGK  451

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L + G FR + +      Q+ MLL + S E Y+VE   E+DG LTL W  +PL   
Sbjct  452  WRARLGQAG-FRALHLGSNAFKQASMLLTLFSAEGYRVE---ENDGCLTLGWHSRPLIAA  507

Query  57   SAWTPFDIAGSSSS  16
            SAW     A ++++
Sbjct  508  SAWQVMPTAEATTA  521



>gb|AJC52501.1| SCL18, partial [Pinus radiata]
Length=154

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  468  PIAVVMAEQEAEHDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRN  289
            P  VV+ EQEA H++   E R + +L+YYSA+FDS+D++LP DSP R K+E+ FAREIRN
Sbjct  2    PAVVVVVEQEANHNDPIFEGRFLQALQYYSAIFDSIDASLPSDSPARLKMEQYFAREIRN  61

Query  288  IIACEGRERLERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQG  109
            IIACEG ER+ERH  F  W++ LME+G F  V + ERE  Q+++LL M   ++Y V+   
Sbjct  62   IIACEGPERIERHEKFEHWKQ-LMEEGGFTAVPLGEREHCQARILLDMFPCKNYIVKL--  118

Query  108  EDDGLTLSWEDQPLYTVSAWTPFDIAGSSSSYSQPT  1
            ED  LTL W  QPLYT SAW P +     +S S P 
Sbjct  119  EDGRLTLDWLHQPLYTASAWAPQEGGNGGASTSSPA  154



>ref|XP_004287380.1| PREDICTED: DELLA protein GAI-like [Fragaria vesca subsp. vesca]
Length=544

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/255 (39%), Positives = 142/255 (56%), Gaps = 12/255 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  286  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  343

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLES  409
            L V   E+VAVN ++Q+H++L   S R  +  LG IR+ NP  V + EQEA+H++     
Sbjct  344  LQVSPKEAVAVNSIMQLHRLLGSDSTRIEM-MLGWIRNLNPKIVTVVEQEADHNKPGFLE  402

Query  408  RLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWR  229
            R   +L YYS +FDSL++   +  P +T  E    REI N++ CEG  R+ERH    KWR
Sbjct  403  RFTEALYYYSNMFDSLEACGAMQ-PDKTLAEMYIQREICNVVCCEGVARVERHEPLAKWR  461

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
              L EQ  FR + +      Q+ MLL + S E Y+VE++  +  LT+ W  +PL   SAW
Sbjct  462  TRL-EQAGFRPLHLGSNAYKQASMLLTLFSAEGYRVEEK--EGCLTIGWHSRPLIAASAW  518

Query  48   TPFDIAGSSSSYSQP  4
                +   +++ + P
Sbjct  519  QVMPLPEPTATATNP  533



>ref|XP_002450783.1| hypothetical protein SORBIDRAFT_05g018070 [Sorghum bicolor]
 gb|EES09771.1| hypothetical protein SORBIDRAFT_05g018070 [Sorghum bicolor]
Length=781

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/239 (41%), Positives = 138/239 (58%), Gaps = 14/239 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVK  577
            PG  P   +R+TG+G     + ETG  LA  A  L + FEFH  V DRLE +R   L  +
Sbjct  551  PGGPPT--LRLTGVGHPSAAVRETGRHLASLAASLRVPFEFHAAVADRLERLRPGALQRR  608

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
             GE++AVN + ++H+V     G  L   L +IR   P  + + EQEA H+      R + 
Sbjct  609  VGEALAVNAVNRLHRV----PGVHLGPLLSMIRDQAPKIMTLVEQEAGHNGPYFLGRFLE  664

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L YYSA+FDSLD+T P DS  R K+E+ + A EIRN++ACEG ER+ RH    +WR+ L
Sbjct  665  ALHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACEGAERVARHERLDRWRR-L  723

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSM-ESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            ME   F  V ++   + QSQ+LL ++   + Y++    ED G L L W+D+ +   SAW
Sbjct  724  MEGRGFEPVPLSPAAVGQSQVLLGLYGAGDGYRLT---EDKGCLLLGWQDRAIIAASAW  779



>ref|XP_003524001.1| PREDICTED: DELLA protein DWARF8-like [Glycine max]
Length=503

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 138/244 (57%), Gaps = 17/244 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TGIG    +++  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  253  PGGPPL--LRLTGIGLPSSDNRDTLREIGLRLAELARSVNVRFAFRGVAAWRLEDVKPWM  310

Query  588  LHVKEGESVAVNCMLQMHKVLY---DTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESS  418
            L V   E+VAVN ++Q+H++L    D +G  +   LG IRS NP  + + EQEA H+E  
Sbjct  311  LQVNPNEAVAVNSIMQLHRLLASDSDPAGSGIETVLGWIRSLNPKIISVVEQEANHNEDM  370

Query  417  LESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFG  238
               R   +L YYS VFDSL++  P++ P +   E    REI N++ CEG  R+ERH    
Sbjct  371  FLERFTEALHYYSTVFDSLEAC-PVE-PDKALAEMYLQREICNVVCCEGPARVERHEPLD  428

Query  237  KWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYT  61
            KWRK L + G F+ + +      Q+ MLL + S E Y VE   E+ G LTL W  +PL  
Sbjct  429  KWRKRLGKAG-FKPLHLGSNAYKQASMLLTLFSAEGYCVE---ENQGCLTLGWHSRPLIA  484

Query  60   VSAW  49
             SAW
Sbjct  485  ASAW  488



>ref|XP_010237707.1| PREDICTED: DELLA protein GAI-like [Brachypodium distachyon]
Length=738

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 138/239 (58%), Gaps = 14/239 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVK  577
            PG  P   +R+TG+G     + ETG  LA  A  L + FEFH  V D+LE +R   L  +
Sbjct  508  PGGPPT--LRLTGVGHPAAAVRETGRHLASLAASLRVPFEFHAAVADKLERLRPAALQRR  565

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
             GE++AVN + ++H+V     G  L   L +IR   P  + + EQEA H+      R + 
Sbjct  566  VGEALAVNAVNRLHRV----PGAHLAPLLSMIRDQAPKIMTLVEQEAGHNGPYFLGRFLE  621

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L YYSA+FDSLD+T P DS  R K+E+ + A EIRN++ACEG ER+ RH    +WR+ +
Sbjct  622  ALHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACEGAERVARHERLDRWRR-I  680

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSM-ESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            ME   F  V ++   + QSQ+LL ++   + Y++    ED G L L W+D+ +   SAW
Sbjct  681  MEGRGFEAVPLSPAAVGQSQVLLGLYGAGDGYRLN---EDKGCLLLGWQDRAIIGASAW  736



>gb|ABA93922.1| GRAS family transcription factor containing protein [Oryza sativa 
Japonica Group]
Length=772

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 137/239 (57%), Gaps = 14/239 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVK  577
            PG  P   +R+TG+G     + ETG  LA  A  L + FEFH    DRLE +R   LH +
Sbjct  542  PGGPPT--LRLTGVGHPPAAVRETGRHLASLAASLRVPFEFHAAAADRLERLRPAALHRR  599

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
             GE++AVN + ++H+V        L   L +IR   P  + + EQEA H+      R + 
Sbjct  600  VGEALAVNAVNRLHRV----PSSHLPPLLSMIRDQAPKIITLVEQEAAHNGPYFLGRFLE  655

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L YYSA+FDSLD+T P +S  R K+E+ + A EIRN++ACEG ER+ RH    +WR+ L
Sbjct  656  ALHYYSAIFDSLDATFPAESTARMKVEQCLLAPEIRNVVACEGAERVARHERLERWRR-L  714

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSM-ESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            ME   F  V ++   + QSQ+LL ++   + Y++    ED G L L W+D+ +   SAW
Sbjct  715  MEGRGFEAVPLSAAAVGQSQVLLGLYGAGDGYRLT---EDSGCLLLGWQDRAIIAASAW  770



>ref|XP_009765072.1| PREDICTED: scarecrow-like protein 18 [Nicotiana sylvestris]
Length=407

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 137/239 (57%), Gaps = 11/239 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-----DRLEDVRLWM-LHV  580
            P   +RITG G     L  TGDRLA FA  L L F+FHP++     D   D  +   + +
Sbjct  171  PPPTLRITGTGNDLDTLRRTGDRLAKFAHSLGLRFQFHPLLITNNNDNDHDPSIISSIVL  230

Query  579  KEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLV  400
               E++A+NC+  +H++L D     L  FL  I+S NP  V +AE+EA H+      R V
Sbjct  231  LPDETLAINCVFYLHRLLKDR--EKLRIFLHRIKSMNPKVVTLAEREANHNHPLFLQRFV  288

Query  399  NSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKL  223
             +L YY+AVFDSL++TLP  S  R  +E++ F REI +I+A EG +R ERH  F  W  +
Sbjct  289  EALDYYAAVFDSLEATLPPSSRERMTVEQVWFGREIIDIVAAEGDKRRERHERFRSWEVM  348

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            L   G F  V ++   L Q+++LL++H   E Y++      +   L W++QPL+++S+W
Sbjct  349  LRSCG-FSNVALSPFALSQAKLLLRLHYPSEGYQLSVSSTSNSFFLGWQNQPLFSISSW  406



>ref|XP_002284952.1| PREDICTED: DELLA protein SLR1-like [Vitis vinifera]
Length=532

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 132/245 (54%), Gaps = 14/245 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  284  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  341

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VA+N ++Q+H++L     R  A+   LG IRS NP  V + EQEA H++S  
Sbjct  342  LQVSPKEAVAINSIMQLHRLLGSGPTRVSAIETVLGWIRSLNPKIVTVVEQEANHNQSEF  401

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    +EI N++ CEG  R+ERH    K
Sbjct  402  LDRFTEALYYYSTMFDSLEAC--SLQPEKAVAEIYIQKEICNVLCCEGSARVERHEPLAK  459

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVS  55
            WR  L   G FR + +      Q+ MLL + S E Y VE+   D  LTL W  +PL   S
Sbjct  460  WRNRLGAAG-FRPLNLGSNAFKQASMLLTLFSAEGYCVEEH--DGCLTLGWHSRPLIAAS  516

Query  54   AWTPF  40
            AW P 
Sbjct  517  AWQPL  521



>ref|XP_009618056.1| PREDICTED: scarecrow-like protein 18 [Nicotiana tomentosiformis]
Length=410

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 137/239 (57%), Gaps = 11/239 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-----DRLEDVRLWM-LHV  580
            P   +RITG G     L  TGDRLA FA  L L F+FHP++     D   D  +   + +
Sbjct  174  PPPTLRITGTGNDLDTLRRTGDRLAKFAHSLGLRFQFHPLLITNNNDNDHDPSIISSIVL  233

Query  579  KEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLV  400
               E++A+NC+  +H++L D     L  FL  I+S NP  V +AE+EA H+      R V
Sbjct  234  LPDETLAINCVFYLHRLLKDR--EMLRIFLHRIKSMNPKVVTLAEREANHNHPLFLQRFV  291

Query  399  NSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKL  223
             +L YY+AVFDSL++TLP  S  R  +E++ F REI +I+A EG +R ERH  F  W  +
Sbjct  292  EALDYYAAVFDSLEATLPPSSRERMTVEQVWFGREIIDIVAAEGDKRRERHERFRSWEVM  351

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            L   G F  V ++   L Q+++LL++H   E Y++      +   L W++QPL+++S+W
Sbjct  352  LRSCG-FSNVALSPFALSQAKLLLRLHYPSEGYQLSVSSTSNSFFLGWQNQPLFSISSW  409



>ref|XP_003556343.1| PREDICTED: DELLA protein GAI1-like [Glycine max]
Length=434

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 137/242 (57%), Gaps = 17/242 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TGIG    E++  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  188  PGGPPL--LRLTGIGPPSAENRDNLREIGLRLAELARSVNVRFAFRGVAAWRLEDVKPWM  245

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLES  409
            L V   E+VAVN ++Q+H++    S  A+ + LG IR  NP  V + EQEA H+      
Sbjct  246  LQVSPNEAVAVNSIMQLHRLTAVKS--AVEEVLGWIRILNPKIVTVVEQEANHNGEGFLE  303

Query  408  RLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGKW  232
            R   +L YYS+VFDSLD+  P++ P +  + EM+  REI N++ CEG  RLERH    KW
Sbjct  304  RFTEALHYYSSVFDSLDAC-PVE-PDKAALAEMYLQREICNVVCCEGPARLERHEPLAKW  361

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKV-EKQGEDDGLTLSWEDQPLYTVS  55
            R  L + G FR + +      Q+ MLL + S E + V E QG    LTL W  +PL   S
Sbjct  362  RDRLGKAG-FRALHLGFNAYKQASMLLTLFSAEGFCVQENQGS---LTLGWHSRPLIAAS  417

Query  54   AW  49
            AW
Sbjct  418  AW  419



>ref|XP_008680172.1| PREDICTED: DELLA protein GAI-like [Zea mays]
 gb|AFW60842.1| hypothetical protein ZEAMMB73_473687 [Zea mays]
 gb|AIB04575.1| GRAS transcription factor, partial [Zea mays]
Length=771

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 137/239 (57%), Gaps = 14/239 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVK  577
            PG  P   +R+TG+G     + ETG  LA  A  L + FEFH  V DRLE +R   LH +
Sbjct  541  PGGPPT--LRLTGVGHPAAAVRETGRHLASLAASLRVPFEFHAAVADRLERLRPAALHRR  598

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
             GE++AVN + ++H+V        L   L +IR   P  + + EQEA H+      R + 
Sbjct  599  VGEALAVNAVNRLHRV----PAVHLGPLLSMIRDQAPKIMTLVEQEAGHNGPYFLGRFLE  654

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L YYSA+FDSLD+T P DS  R K+E+ + A EIRN++ACEG ER+ RH    +WR+ +
Sbjct  655  ALHYYSAIFDSLDATFPADSAQRMKVEQCLLAPEIRNVVACEGAERVARHERLDRWRR-I  713

Query  219  MEQGKFRCVGITERELLQSQMLLKMHSM-ESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            ME   F  V ++   + QSQ+LL ++   + Y++    ED G L L W+D+     SAW
Sbjct  714  MEGRGFEPVPLSPAAVAQSQVLLGLYGAGDGYRLT---EDRGCLLLGWQDRATIAASAW  769



>gb|ACH47034.1| lateral suppressor protein [Nicotiana tabacum]
Length=407

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 137/239 (57%), Gaps = 11/239 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-----DRLEDVRLWM-LHV  580
            P   +RITG G     L  TGDRLA FA  L L F+FHP++     D   D  +   + +
Sbjct  171  PPLTLRITGTGNDLDTLRRTGDRLAKFAHSLGLRFQFHPLLITNNNDNDHDPSIISSIVL  230

Query  579  KEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLV  400
               E++A+NC+  +H++L D     L  FL  I+S NP  V +AE+EA H+      R V
Sbjct  231  LPDETLAINCVFYLHRLLKDR--EKLRIFLHRIKSMNPKVVTLAEREANHNHPLFLQRFV  288

Query  399  NSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKL  223
             +L YY+AVFDSL++TLP  S  R  +E++ F REI +I+A EG +R ERH  F  W  +
Sbjct  289  EALDYYAAVFDSLEATLPPSSRERMTVEQVWFGREIIDIVAAEGDKRRERHERFRSWEVM  348

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            L   G F  V ++   L Q+++LL++H   E Y++      +   L W++QPL+++S+W
Sbjct  349  LRSCG-FSNVALSPFALSQAKLLLRLHYPSEGYQLSVSSTSNSFFLGWQNQPLFSISSW  406



>emb|CAN64763.1| hypothetical protein VITISV_015992 [Vitis vinifera]
Length=377

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 143/241 (59%), Gaps = 11/241 (5%)
 Frame = -2

Query  750  GLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLE--DVRLWM---L  586
             L P   IRITG GE    L  TGDRL  FA+ L L F+FHP++ R +   V L++   L
Sbjct  140  NLHPPPMIRITGTGEDLGILQRTGDRLLKFAQSLGLKFQFHPLLLRNDPTSVPLYLPSAL  199

Query  585  HVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
             +   E++AVNC+L +H++L D S R L  FL  I++  P  V +AE+EA H+      R
Sbjct  200  QLLPDETLAVNCVLYLHRLLKDDS-RDLRLFLHKIKAMEPKVVTIAEREANHNHPLFLQR  258

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             V +L +Y+AVFDSL++TLP  S  R  +E + F REI +I++ EG  R ERH  F  W 
Sbjct  259  FVEALDHYTAVFDSLEATLPPTSRERLAVERIWFGREIVDIVSAEGDNRRERHERFESWE  318

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
             +L   G F  V ++   L Q+++LL++H   E Y++  Q  +D   L W++Q L++VS+
Sbjct  319  VMLRSSG-FSNVPLSPFALSQAKLLLRLHYPSEGYRL--QIINDSFFLGWQNQALFSVSS  375

Query  51   W  49
            W
Sbjct  376  W  376



>ref|XP_002265645.1| PREDICTED: scarecrow-like protein 18 [Vitis vinifera]
 emb|CBI39870.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 143/241 (59%), Gaps = 11/241 (5%)
 Frame = -2

Query  750  GLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLE--DVRLWM---L  586
             L P   IRITG GE    L  TGDRL  FA+ L L F+FHP++ R +   V L++   L
Sbjct  176  NLHPPPMIRITGTGEDLGILQRTGDRLLKFAQSLGLKFQFHPLLLRNDPTSVPLYLPSAL  235

Query  585  HVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
             +   E++AVNC+L +H++L D S R L  FL  I++  P  V +AE+EA H+      R
Sbjct  236  QLLPDETLAVNCVLYLHRLLKDDS-RDLRLFLHKIKAMEPKVVTIAEREANHNHPLFLQR  294

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             V +L +Y+AVFDSL++TLP  S  R  +E + F REI +I++ EG  R ERH  F  W 
Sbjct  295  FVEALDHYTAVFDSLEATLPPTSRERLAVERIWFGREIVDIVSAEGDNRRERHERFESWE  354

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
             +L   G F  V ++   L Q+++LL++H   E Y++  Q  +D   L W++Q L++VS+
Sbjct  355  VMLRSSG-FSNVPLSPFALSQAKLLLRLHYPSEGYRL--QIINDSFFLGWQNQALFSVSS  411

Query  51   W  49
            W
Sbjct  412  W  412



>ref|XP_010913242.1| PREDICTED: scarecrow-like protein 18 [Elaeis guineensis]
Length=409

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 144/244 (59%), Gaps = 18/244 (7%)
 Frame = -2

Query  738  RSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPV------VDRLEDVRLWMLHVK  577
            R  IRITG G     L  TGDRL  FA  L L F+FHP+      VD    +R + LH  
Sbjct  171  RPSIRITGTGADLDVLHRTGDRLEAFANSLGLRFQFHPLYLSTTNVDTGAGLRSFQLH--  228

Query  576  EGESVAVNCMLQMHKVLYDTSGR-----ALVDFLGLIRSTNPIAVVMAEQEAEHDESSLE  412
             GE++AVNC+L +HK+L D S        L+ FL  +++  P+ V +AE+EA H+     
Sbjct  229  PGETLAVNCVLFLHKLLKDGSSTDDPPCELMAFLRAVKAMKPVVVTVAEREANHNSPVFL  288

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGK  235
             R + +L +Y+AVF+SL++TLP  S  R ++EE++  REI +I++ EG  R ERHA F  
Sbjct  289  QRFMEALDHYTAVFESLEATLPPKSQERREVEELWLGREIEDIVSREGEGRRERHARFEW  348

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTV  58
            W  L+ ++G F  V ++     Q+++LL++H   E Y++  Q   + L L W+ +PL++V
Sbjct  349  WEGLMRDRG-FSSVQLSPFAFSQAKLLLRLHYPSEGYQL--QMSKNCLFLGWQHKPLFSV  405

Query  57   SAWT  46
            S+W 
Sbjct  406  SSWN  409



>ref|XP_009346546.1| PREDICTED: scarecrow-like protein 18 [Pyrus x bretschneideri]
Length=295

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 143/239 (60%), Gaps = 9/239 (4%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-----DRLEDVRLWMLH  583
            L P   +RIT  G     LL TG+RL  FA+ L LAF+FHP+V        + +    L 
Sbjct  59   LHPPPTLRITATGRDLTLLLRTGERLLRFAQSLGLAFQFHPLVLNNTSQPSDLISPSTLG  118

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
            + + E +AVNC+L +H ++ D S R L  FL  I+S NP    +A +EA H+     +R 
Sbjct  119  LHQNEVLAVNCVLYLHTLVTDDS-RDLFLFLQKIKSLNPKVFTIANKEANHNNHLFFNRF  177

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKL  223
            V +L +Y AVFDSL++TLP +S  R  +EE F REI++++  EG +R +RH S+  + ++
Sbjct  178  VEALDHYGAVFDSLEATLPPNSRERLVVEEWFGREIKDVVGIEGEKRKQRHESYETFWEV  237

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            ++ +  F  V ++   L Q+++LL++H   E Y++  +  +D   L W+++PL++VS+W
Sbjct  238  VLRRAGFENVPLSPFALSQAKLLLRLHYPSEGYQL--RIFNDSFFLGWQNRPLFSVSSW  294



>ref|XP_004980521.1| PREDICTED: DELLA protein GAI-like [Setaria italica]
Length=753

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 137/239 (57%), Gaps = 14/239 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVK  577
            PG  P   +R+TG+G     + ETG  LA  A  L + FEFH    DRLE +R   L  +
Sbjct  523  PGGPPT--LRLTGVGHPAAAVRETGRHLASLAASLRVPFEFHAAAADRLERLRPAALQRR  580

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
             GE++AVN + ++H+V        L   L +IR   P  + + EQEA H+      R + 
Sbjct  581  VGEALAVNAVNRLHRV----PSAHLGPLLSMIRDQAPKIMTLVEQEAGHNGPYFLGRFLE  636

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L YYSA+FDSLD+T P DS  R K+E+ + A EIRN++ACEG ER+ RH    +WR+ L
Sbjct  637  ALHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACEGAERVARHERLDRWRR-L  695

Query  219  MEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            ME   F  V ++   + QSQ+LL ++ + + Y++    ED G L L W+D+ +   SAW
Sbjct  696  MEGRGFEPVPLSPAAIGQSQVLLGLYGASDGYRLT---EDKGCLLLGWQDRAIIAASAW  751



>ref|XP_001774314.1| AtGAI1 GRAS E3 ubiquitin ligase protein [Physcomitrella patens]
 gb|ABU63413.1| DELLA protein [Physcomitrella patens]
 gb|ABX10764.1| DELLA-like protein [Physcomitrella patens]
 gb|EDQ60816.1| AtGAI1 GRAS E3 ubiquitin ligase protein [Physcomitrella patens]
Length=553

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 139/241 (58%), Gaps = 12/241 (5%)
 Frame = -2

Query  750  GLIPRSHIRITGIGESKQE----LLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWML  586
            G  PR  +R+TGIG  +      L E G +LA  A+ + + FEF  V+  +L+D++ WML
Sbjct  315  GGPPR--LRLTGIGPPQPSGSDTLQEIGTKLAELAKTVRVDFEFRGVIAVKLDDIKPWML  372

Query  585  HVKEGESVAVNCMLQMHKVLYDTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDESSLES  409
             ++ GE+VAVN +LQ+HK+LY     A +D  L L+R   P    + E EA H++ S   
Sbjct  373  QIRHGEAVAVNSVLQLHKLLYSAGPEAPIDAVLLLVRELKPKIFTIVEHEANHNQPSFLG  432

Query  408  RLVNSLKYYSAVFDSLDS-TLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
            R + +L YYS +FD+L++  LP ++  +  IE    REI NI+ACE   R ERH +  +W
Sbjct  433  RFIEALHYYSTMFDALEACNLPSENNEQVLIEMYLGREIYNIVACEDGARTERHENLFQW  492

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            R  L++ G +R + +      Q+ MLL M S E Y+VE++     LTL W  +PL   SA
Sbjct  493  RLRLLKAG-YRPIQLGLNAFKQASMLLTMFSGEGYRVEEK--LGCLTLGWHSRPLIAASA  549

Query  51   W  49
            W
Sbjct  550  W  550



>ref|XP_008463334.1| PREDICTED: DELLA protein SLR1-like [Cucumis melo]
Length=535

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 138/242 (57%), Gaps = 15/242 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  283  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAAARLEDVKPWM  340

Query  588  LHVKEGESVAVNCMLQMHKVLYDT-SGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            L V   E+VAVN ++Q+H++L +  S  A+   LG IRS NP  + + EQEA+H++S   
Sbjct  341  LQVSPKETVAVNSVMQLHRLLGNNQSSSAMEMVLGWIRSLNPKIMTVVEQEADHNQSGFL  400

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
             R   +L YYS +FDSL++   +  P +   E    REI N+++CEG  R+ERH    KW
Sbjct  401  ERFTEALFYYSTMFDSLEACCMM--PEKGLAEMYLQREICNVVSCEGSARVERHEPLVKW  458

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVS  55
            R  L + G FR + +      Q+ MLL + S E + +E   E++G LTL W  +PL   S
Sbjct  459  RSRLRQAG-FRALHLGSNAFKQASMLLTLFSAEGFSIE---ENEGCLTLGWHSRPLIAAS  514

Query  54   AW  49
            AW
Sbjct  515  AW  516



>ref|XP_009384383.1| PREDICTED: scarecrow-like protein 3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 98/272 (36%), Positives = 151/272 (56%), Gaps = 46/272 (17%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H++ITGI E K+ L  T  RL+  AE+L++ F+F P+V RL+++ +  L VK GE++A++
Sbjct  192  HLKITGIHEHKEVLHYTAIRLSEAAERLDVPFQFIPLVSRLDNLDIERLRVKTGEALAIS  251

Query  552  CMLQMHKVL-----------------------------------YDTSGRA-------LV  499
             +LQ+H +L                                   + TS  +       + 
Sbjct  252  SVLQLHSLLATEDVGGHLRKAQRIAPISKLTLGEFLEKDHLANTHSTSAESAARPPTRIQ  311

Query  498  DFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKI  319
             FL  +   +P  VV+ EQEA H+  +L+ RLV +L YY+AVFD LD T+P  S  R ++
Sbjct  312  SFLASLWGLSPKIVVVTEQEANHNGKTLKERLVEALFYYAAVFDGLDLTVPRQSVERLRV  371

Query  318  EEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMH  142
            E+M F  EIRNIIACEG ER ERH    +W +  M    FR + ++   LLQ++ LL+  
Sbjct  372  EKMLFGEEIRNIIACEGLERKERHEKLERWSQ-RMSMAGFRLLPLSYYGLLQARRLLQSF  430

Query  141  SMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
              + YKV++  E+    + W+D+PL++VSAW+
Sbjct  431  GWQGYKVKE--ENGCFMMCWQDRPLFSVSAWS  460



>ref|XP_009384382.1| PREDICTED: scarecrow-like protein 3 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/272 (36%), Positives = 151/272 (56%), Gaps = 46/272 (17%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H++ITGI E K+ L  T  RL+  AE+L++ F+F P+V RL+++ +  L VK GE++A++
Sbjct  192  HLKITGIHEHKEVLHYTAIRLSEAAERLDVPFQFIPLVSRLDNLDIERLRVKTGEALAIS  251

Query  552  CMLQMHKVL-----------------------------------YDTSGRA-------LV  499
             +LQ+H +L                                   + TS  +       + 
Sbjct  252  SVLQLHSLLATEDVGGHLRKAQRIAPISKLTLGEFLEKDHLANTHSTSAESAARPPTRIQ  311

Query  498  DFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKI  319
             FL  +   +P  VV+ EQEA H+  +L+ RLV +L YY+AVFD LD T+P  S  R ++
Sbjct  312  SFLASLWGLSPKIVVVTEQEANHNGKTLKERLVEALFYYAAVFDGLDLTVPRQSVERLRV  371

Query  318  EEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMH  142
            E+M F  EIRNIIACEG ER ERH    +W +  M    FR + ++   LLQ++ LL+  
Sbjct  372  EKMLFGEEIRNIIACEGLERKERHEKLERWSQ-RMSMAGFRLLPLSYYGLLQARRLLQSF  430

Query  141  SMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
              + YKV++  E+    + W+D+PL++VSAW+
Sbjct  431  GWQGYKVKE--ENGCFMMCWQDRPLFSVSAWS  460



>ref|XP_010252869.1| PREDICTED: scarecrow-like protein 18 [Nelumbo nucifera]
Length=531

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/240 (39%), Positives = 145/240 (60%), Gaps = 14/240 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEG---  571
            P   IRITG G+    L  TGDRL  FA  L L F+F+P++  L D     LH+      
Sbjct  298  PPPTIRITGTGQDLDALRRTGDRLQRFAHSLGLKFQFNPLL--LNDPSSIALHLPPAIVL  355

Query  570  ---ESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLV  400
               E +AVNC+L +H++L D S  A + FL  I++ NP  V +AE+EA H+      R V
Sbjct  356  LPDEILAVNCVLFLHRLLRDDSRDARL-FLRTIKAMNPKVVTVAEREANHNHPFFLQRFV  414

Query  399  NSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKL  223
            ++L +Y+A+FDSL++TLP +S  R  +E++ F +EI +I++ +G +R +RH  F  W ++
Sbjct  415  DALDHYTALFDSLEATLPPNSRERLAVEQVWFGKEILDIVSADGDDRRQRHERFETWVEM  474

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
            L   G F  V ++   L Q+++LL++H   E Y++  Q  +D L L W++QPL++VS+W 
Sbjct  475  LRSSG-FSNVPLSPFALSQAKLLLRLHYPSEGYQL--QILNDSLFLGWQNQPLFSVSSWN  531



>ref|XP_010928164.1| PREDICTED: scarecrow-like protein 18 [Elaeis guineensis]
Length=412

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 140/239 (59%), Gaps = 15/239 (6%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV------DRLEDVRLWMLHVKEGE  568
            IRITG G     L  TGDRL  FA  L L F+FHP+       D           +  GE
Sbjct  176  IRITGTGTDLDVLHRTGDRLQAFANSLGLRFQFHPLYLPTTNPDATTTSLNSSFQLHPGE  235

Query  567  SVAVNCMLQMHKVLYDTSGR----ALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLV  400
            ++AVNC+L +HK+L D +G      LV FL  +++ NP+ V +AE+EA H+      R +
Sbjct  236  TLAVNCILFLHKLLRDRTGDDPACKLVAFLHAVKAMNPVVVTVAEREATHNSPVFLRRFM  295

Query  399  NSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGKWRKL  223
             +L +Y+AVF+SL++TLP  SP R ++E+++  REI +I+  EG  R ERH  F  W  L
Sbjct  296  EALDHYTAVFESLEATLPPKSPERLEVEQVWLGREIEDIVGREGEGRKERHERFEWWEGL  355

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            + ++G F  + ++   L Q+++LL++H   E Y++  Q   + L L W+ +PL++VS+W
Sbjct  356  MRDRG-FSSLPLSPFALSQAKLLLRLHYPSEGYQL--QMSKNSLFLGWQHKPLFSVSSW  411



>ref|XP_006589312.1| PREDICTED: DELLA protein RGA-like [Glycine max]
Length=488

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 135/242 (56%), Gaps = 17/242 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TG+G    E++  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  242  PGGPPL--LRLTGVGPPSAENRDNLREIGLRLAELARSVNVRFAFRGVAAWRLEDVKPWM  299

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLES  409
            L V   E+VAVN ++Q+H+V       A+ + L  IRS NP  V + EQEA H+      
Sbjct  300  LQVSLNEAVAVNSIMQLHRV--TAVDAAVEEVLSWIRSLNPKIVTVVEQEANHNGEGFLE  357

Query  408  RLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGKW  232
            R   +L YYS VFDSLD+  P++ P +  + EM+  REI N++ CEG  RLERH    KW
Sbjct  358  RFTEALHYYSTVFDSLDAC-PVE-PDKAALAEMYLQREICNVVCCEGPARLERHEPLAKW  415

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKV-EKQGEDDGLTLSWEDQPLYTVS  55
            R  L + G FR + +      Q+ MLL + S E + V E QG    LTL W  +PL   S
Sbjct  416  RDRLGKAG-FRPLHLGFNAYKQASMLLTLFSAEGFCVQENQGS---LTLGWHSRPLIAAS  471

Query  54   AW  49
            AW
Sbjct  472  AW  473



>ref|XP_004146291.2| PREDICTED: DELLA protein GAI [Cucumis sativus]
 gb|KGN65400.1| hypothetical protein Csa_1G408720 [Cucumis sativus]
Length=535

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 138/242 (57%), Gaps = 15/242 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  283  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAAARLEDVKPWM  340

Query  588  LHVKEGESVAVNCMLQMHKVLYDT-SGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            L V   E+VAVN ++Q+H++L +  S  A+   LG IRS NP  + + EQEA+H+++   
Sbjct  341  LQVSPKETVAVNSVMQLHRLLGNNQSSSAMEMVLGWIRSLNPKIMTVVEQEADHNQTGFL  400

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
             R   +L YYS +FDSL++   +  P +   E    REI N+++CEG  R+ERH    KW
Sbjct  401  ERFTEALFYYSTMFDSLEACCMM--PEKGLAEMYLQREICNVVSCEGSARVERHEPLVKW  458

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVS  55
            R  L + G FR + +      Q+ MLL + S E + +E   E++G LTL W  +PL   S
Sbjct  459  RSRLRQAG-FRALHLGSNAFKQASMLLTLFSAEGFSIE---ENEGCLTLGWHSRPLIAAS  514

Query  54   AW  49
            AW
Sbjct  515  AW  516



>ref|XP_010049952.1| PREDICTED: DELLA protein GAI-like [Eucalyptus grandis]
 gb|KCW82780.1| hypothetical protein EUGRSUZ_C04156 [Eucalyptus grandis]
Length=567

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/235 (41%), Positives = 129/235 (55%), Gaps = 13/235 (6%)
 Frame = -2

Query  729  IRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVKEGES  565
            +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WML V   E+
Sbjct  315  LRLTGIGPPSPDGRDVLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWMLQVSPKEA  374

Query  564  VAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSL  391
            VAVN ++Q+H++L     R   +   L  IRS NP  + +AEQEA H+      R   +L
Sbjct  375  VAVNSIMQLHRLLGSDPPRDPPIGSVLPWIRSLNPKIMTVAEQEANHNRPGFLDRFTEAL  434

Query  390  KYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQ  211
             YYS +FDSL++  P+  P +   E    REI NI+ CEG  R+ERH    +WR  L   
Sbjct  435  YYYSTLFDSLEAACPVQ-PDKALAEMYLQREICNIVGCEGAARVERHEPLDRWRARLGRA  493

Query  210  GKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            G FR + +      Q+ MLL + S E Y VE   E++G LTL W  +PL   SAW
Sbjct  494  G-FRPLHLGSNAFKQASMLLTLFSTEGYSVE---ENEGCLTLCWHSRPLIAASAW  544



>gb|ACV52014.1| GAI/RGA-like 3-b [Gossypium hirsutum]
 gb|ADH10267.1| GAI3b [Gossypium hirsutum]
Length=541

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 131/243 (54%), Gaps = 16/243 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  295  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  352

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   ESVAVN ++Q+H++L     R   +   L  IRS NP  + + EQEA H++   
Sbjct  353  LQVNPKESVAVNSIMQLHRLLGSDPNRNSPIETVLSWIRSLNPKIMTVVEQEANHNQPGF  412

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N+++CEG  R+ERH    K
Sbjct  413  LDRFTEALHYYSTMFDSLEAC--TVQPNKALAEIYIQREIANVVSCEGSARVERHEPLSK  470

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L   G FR + +      Q+ MLL + S E Y VE   E+DG LTL W  +PL   
Sbjct  471  WRTRLSGAG-FRPLHLGSNAYKQASMLLTLFSAEGYSVE---ENDGCLTLGWHSRPLIAA  526

Query  57   SAW  49
            SAW
Sbjct  527  SAW  529



>emb|CCG14223.1| gibberellin DELLA protein [Cucumis sativus]
Length=535

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 138/242 (57%), Gaps = 15/242 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  283  PGGPPL--LRLTGIGPPFPDGRDSLREIGLRLAELARSVNVRFAFRGVAAARLEDVKPWM  340

Query  588  LHVKEGESVAVNCMLQMHKVLYDT-SGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            L V   E+VAVN ++Q+H++L +  S  A+   LG IRS NP  + + EQEA+H+++   
Sbjct  341  LQVSPKETVAVNSVMQLHRLLGNNQSSSAMEMVLGWIRSLNPKIMTVVEQEADHNQTGFL  400

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
             R   +L YYS +FDSL++   +  P +   E    REI N+++CEG  R+ERH    KW
Sbjct  401  ERFTEALFYYSTMFDSLEACCMM--PEKGLAEMYLQREICNVVSCEGSARVERHEPLVKW  458

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVS  55
            R  L + G FR + +      Q+ MLL + S E + +E   E++G LTL W  +PL   S
Sbjct  459  RSRLRQAG-FRALHLGSNAFKQASMLLTLFSAEGFSIE---ENEGCLTLGWHSRPLIAAS  514

Query  54   AW  49
            AW
Sbjct  515  AW  516



>gb|AHB17748.1| GA repressor DELLA [Actinidia deliciosa]
Length=524

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 137/243 (56%), Gaps = 16/243 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TG+G    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  270  PGGPPL--LRLTGMGPPSSDGRDSLREIGLRLAELAHSVNVQFAFRGVAASRLEDVKPWM  327

Query  588  LHVKEGESVAVNCMLQMHKVLY-DTSGRALV-DFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VA+N ++Q+H++L  D + R+ + D LG IR+ NP  + + EQEA H++   
Sbjct  328  LQVGPKEAVAINSIMQLHRLLVSDPTRRSPIEDVLGWIRNLNPKVMTVVEQEANHNQPEF  387

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N++ CEG  R+ERH S  K
Sbjct  388  LDRFTEALHYYSTMFDSLETC--STQPDKALAEIYIQREICNVVCCEGLARVERHESLAK  445

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L   G F+ + +      Q+ MLL + S E Y VE   E++G LTL W  +PL  V
Sbjct  446  WRARLSGAG-FKPLHLGSNAFKQASMLLTLFSAEGYCVE---ENEGCLTLGWHSRPLIAV  501

Query  57   SAW  49
            SAW
Sbjct  502  SAW  504



>gb|AEX97112.1| spur-type DELLA protein [Malus domestica]
Length=547

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/259 (39%), Positives = 142/259 (55%), Gaps = 17/259 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  286  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  343

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L     R   +   L  IR+ NP  V + EQEA+H++   
Sbjct  344  LQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLSWIRNLNPKIVAVVEQEADHNKPGF  403

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N++ CEG  R+ERH    K
Sbjct  404  LDRFTEALYYYSNMFDSLEAC--AMQPEKALAEIYIQREICNVVCCEGAARVERHEPLDK  461

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR + +EQ  FR + +      Q+ MLL + S E Y+VE   E+ G LTL W ++PL   
Sbjct  462  WR-IRLEQAGFRPLHLGSNAFKQASMLLTLFSAEGYRVE---ENQGCLTLGWHNRPLIAA  517

Query  57   SAWTPFDIAGSSSSYSQPT  1
            SAW    +A ++++  QP 
Sbjct  518  SAWQVMPMAEATAN-QQPV  535



>ref|XP_006475101.1| PREDICTED: scarecrow-like protein 18-like [Citrus sinensis]
Length=457

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 142/241 (59%), Gaps = 11/241 (5%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV---DRLEDVRLWM---L  586
            L P   +RITG G   + L  TG+RL  FA+ L L F+FHP++   D    V   +   L
Sbjct  219  LQPPPMLRITGTGHDIEILQRTGERLLKFAQSLGLRFQFHPLLLMNDDPTSVAFCLPSAL  278

Query  585  HVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
             +  GE++A+NCML +HK+L D   R L  FL  I++ NP  V +AE+EA H+      R
Sbjct  279  TILPGETLAINCMLFLHKLLKDHDTRDLRLFLHKIKALNPRVVTIAEREASHNHPVFLQR  338

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             V ++ +Y A+FDSL++TLP +S  R  +E++ F REI  I+A EG  R ERH  F  W 
Sbjct  339  FVEAVDHYGAIFDSLEATLPPNSRERLAVEQVWFGREIVEIVATEGENRKERHERFDSWE  398

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
             +L   G +  V ++   L Q+++LL++H   E Y++  Q  ++ L L W+++ L++VS+
Sbjct  399  MILRSCG-YSNVPLSGYALSQAKLLLRLHYPSEGYQL--QILNNSLFLGWQNRALFSVSS  455

Query  51   W  49
            W
Sbjct  456  W  456



>ref|XP_004507626.1| PREDICTED: DELLA protein RHT-1-like [Cicer arietinum]
Length=498

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/244 (41%), Positives = 135/244 (55%), Gaps = 17/244 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  248  PGGPP--FLRLTGIGPPSPDDRDNLREIGLRLAELARSVNVRFAFRGVAAWRLEDVKPWM  305

Query  588  LHVKEGESVAVNCMLQMHKVL---YDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESS  418
            L V   E+VAVN ++Q+H++L    D     +   LG IRS NP  + + EQEA H++  
Sbjct  306  LQVSSKEAVAVNSIMQLHRLLGSQSDPISSGIETVLGWIRSLNPKIMTVVEQEANHNKDG  365

Query  417  LESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFG  238
               R   +L YYS VFDSL++  P++ P +   E    REI N++ CEG  R+ERH    
Sbjct  366  FLERFTEALHYYSTVFDSLEAC-PVE-PDKAMAEIYLQREICNVVCCEGPARIERHEPLV  423

Query  237  KWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYT  61
            KWR+ L + G FR + +      Q+ MLL + S E Y VE   E+ G LTL W  +PL  
Sbjct  424  KWRERLGKAG-FRPLHLGSNAFKQASMLLTLFSAEGYCVE---ENQGSLTLGWHSRPLIA  479

Query  60   VSAW  49
             SAW
Sbjct  480  ASAW  483



>ref|XP_009379077.1| PREDICTED: scarecrow-like protein 18 [Pyrus x bretschneideri]
Length=457

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 144/239 (60%), Gaps = 9/239 (4%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV----DRLED-VRLWMLH  583
            L P   +RIT  G     LL TG+RL  FA+ L LAF+FHP+V     R  D +    L 
Sbjct  221  LHPPPTLRITATGRDLTLLLRTGERLFRFAQSLGLAFQFHPLVLNNAARPSDLISPSTLG  280

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
            + + E++AVNC+L +H ++ D S R L+ FL  I+S NP    +A +EA H+     +R 
Sbjct  281  LHQNEALAVNCVLYLHTLVTDDS-RDLLLFLQKIKSLNPKVFTVANKEANHNNPLFFNRF  339

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKL  223
            V +L +Y AVF+SL++TLP +S  R  +EE F RE+++++  EG +R +RH  +  + ++
Sbjct  340  VEALDHYGAVFESLEATLPPNSRERLAVEEWFGREVKDVVGVEGEKRKQRHERYETFWEV  399

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            ++ +  F  V ++   L Q+++LL++H   E Y++     +D   L W+++PL++VS+W
Sbjct  400  VLRRAGFENVALSPFALSQAKLLLRLHYPSEGYQLRIL--NDSFFLGWQNRPLFSVSSW  456



>ref|XP_009374432.1| PREDICTED: scarecrow-like protein 18 [Pyrus x bretschneideri]
Length=461

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 144/239 (60%), Gaps = 9/239 (4%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV----DRLED-VRLWMLH  583
            L P   +RIT  G     LL TG+RL  FA+ L LAF+FHP+V     +  D +    L 
Sbjct  225  LHPPPTLRITATGRDLTLLLRTGERLLRFAQSLGLAFQFHPLVLNNTSQPSDLISPSTLG  284

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
            + + E +AVNC+L +H ++ D S R L  FL  I+S NP    +A +EA H+     +R 
Sbjct  285  LHQNEVLAVNCVLYLHTLVTDDS-RDLFLFLQKIKSLNPKVFTIANKEANHNNHLFFNRF  343

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKL  223
            V +L +Y AVFDSL++TLP +S  R  +EE F REI++++  EG +R +RH S+  + ++
Sbjct  344  VEALDHYGAVFDSLEATLPPNSRERLVVEEWFGREIKDVVGIEGEKRKQRHESYETFWEV  403

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            ++ +  F  V ++   L Q+++LL++H   E Y++  +  +D   L W+++PL++VS+W
Sbjct  404  VLRRAGFENVPLSPFALSQAKLLLRLHYPSEGYQL--RIFNDSFFLGWQNRPLFSVSSW  460



>ref|XP_003528281.1| PREDICTED: DELLA protein SLR1-like [Glycine max]
Length=505

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 137/244 (56%), Gaps = 17/244 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TGIG    +++  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  255  PGGPPL--LRLTGIGPPSSDNRDTLREIGLRLAELARSVNVRFAFRGVAAWRLEDVKPWM  312

Query  588  LHVKEGESVAVNCMLQMHKVLY---DTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESS  418
            L V   E+VAVN ++Q+H++L    D  G  +   LG IRS NP  + + EQEA H++  
Sbjct  313  LQVNPNEAVAVNSIMQLHRLLASDSDPIGSGIETVLGWIRSLNPKIISVVEQEANHNQDR  372

Query  417  LESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFG  238
               R   +L YYS VFDSL++  P++ P +   E    REI N+++ EG  R+ERH    
Sbjct  373  FLERFTEALHYYSTVFDSLEAC-PVE-PDKALAEMYLQREICNVVSSEGPARVERHEPLA  430

Query  237  KWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYT  61
            KWR+ L E+  F+ + +      Q+ MLL + S E Y VE   E+ G LTL W  +PL  
Sbjct  431  KWRERL-EKAGFKPLHLGSNAYKQASMLLTLFSAEGYSVE---ENQGCLTLGWHSRPLIA  486

Query  60   VSAW  49
             SAW
Sbjct  487  ASAW  490



>ref|XP_008343960.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI-like [Malus 
domestica]
Length=546

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 136/249 (55%), Gaps = 16/249 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  285  PGGPPX--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  342

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L     R   +   L  IR+ NP  V + EQEA+H++   
Sbjct  343  LQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLSWIRNLNPKIVTVVEQEADHNKPGF  402

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++  P+  P +T  E    REI N++ CEG  R+ERH    K
Sbjct  403  LDRFTEALYYYSTMFDSLEAC-PMQ-PEKTLAEMYIQREICNVVCCEGAARVERHEPLSK  460

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L + G F  + +      Q+ MLL + S E Y+VE   E+ G LTL W  +PL   
Sbjct  461  WRTRLGQAG-FSPLHLGSNAFKQASMLLTLFSAEGYRVE---ENQGCLTLGWHSRPLIAA  516

Query  57   SAWTPFDIA  31
            SAW    +A
Sbjct  517  SAWQVMXVA  525



>gb|AGH06216.1| lateral suppressor protein [Malus domestica]
Length=458

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 144/239 (60%), Gaps = 9/239 (4%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV----DRLED-VRLWMLH  583
            L P   +RIT  G     LL TG+RL  FA+ L LAF+FHP+V     R  D +    L 
Sbjct  222  LHPPPTLRITATGRDLTLLLRTGERLLRFAQSLGLAFQFHPLVLNNAARPSDLISPSTLG  281

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
            + + E++AVNC+L +H ++ D S R L+ FL  I+S NP    +A +EA H+     +R 
Sbjct  282  LHQNEALAVNCVLYLHTLVTDDS-RDLLLFLQKIKSLNPKVFTVANKEANHNNPLFFNRF  340

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKL  223
            V +L +Y AVF+SL++TLP +S  R  +EE F RE+++++  EG +R +RH  +  + ++
Sbjct  341  VEALDHYGAVFESLEATLPPNSRERLAVEEWFGREVKDVVGVEGEKRKQRHERYETFWEV  400

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            ++ +  F  V ++   L Q+++LL++H   E Y++     +D   L W+++PL++VS+W
Sbjct  401  VLRRAGFENVALSPFALSQAKLLLRLHYPSEGYQLRIL--NDSFFLGWQNRPLFSVSSW  457



>ref|XP_008337344.1| PREDICTED: DELLA protein GAI-like [Malus domestica]
Length=547

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/254 (39%), Positives = 140/254 (55%), Gaps = 16/254 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  286  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFXFRGVAASRLEDVKPWM  343

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L     R   +   L  IR+ NP  V + EQEA+H++   
Sbjct  344  LQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLSWIRNLNPKIVAVVEQEADHNKPGF  403

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N++ CEG  R+ERH    K
Sbjct  404  LDRFTEALYYYSNMFDSLEAC--AMQPEKALAEIYIQREICNVVCCEGAARVERHEPLDK  461

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR + +EQ  FR + +      Q+ MLL + S E Y+VE   E+ G LTL W ++PL   
Sbjct  462  WR-IRLEQAGFRPLHLGSNAFKQASMLLTLFSAEGYRVE---ENQGCLTLGWHNRPLIAA  517

Query  57   SAWTPFDIAGSSSS  16
            SAW    +A ++++
Sbjct  518  SAWQVMPMAEATAN  531



>emb|CDY03601.1| BnaC03g68600D [Brassica napus]
Length=449

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 145/249 (58%), Gaps = 24/249 (10%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RITG+   K+ L +   RL   AE+L++ F+F+PVV  LE + +  L VK GE++AV+
Sbjct  200  HLRITGVHHQKEVLDQMAHRLIEEAEKLDIPFQFNPVVSSLECLNVEQLRVKTGEALAVS  259

Query  552  CMLQMHKVLYD--------------------TSGRALVDFLGLIRSTNPIAVVMAEQEAE  433
             +LQ+H  L                      ++ R +  FL  I   +P  +V+ EQ+++
Sbjct  260  SVLQLHNFLASDVTNNNGHSLSGDSASSLPLSNSRKIDSFLNAIWGLSPKIIVVTEQDSD  319

Query  432  HDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLE  256
            H+ S++  RL+ SL  Y+A+FD L++ +P  S  R K+E+M F  EI+NIIACEG ER E
Sbjct  320  HNGSTVMERLLESLYTYAALFDCLETKVPRTSQDRMKVEKMLFGEEIKNIIACEGSERRE  379

Query  255  RHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWED  76
            RH    KW + +   G F  V ++   +LQ++ LL+ +  + Y++++  E     + W+D
Sbjct  380  RHEKLEKWSQRIDLAG-FGNVPLSYYAMLQARRLLQGYGFDGYRIKE--ESGCAVICWQD  436

Query  75   QPLYTVSAW  49
            +PLY+VSAW
Sbjct  437  RPLYSVSAW  445



>ref|XP_011000401.1| PREDICTED: scarecrow-like protein 18 [Populus euphratica]
Length=420

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 138/241 (57%), Gaps = 12/241 (5%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEG-  571
            L P   +RITG G     L  TGDRL  FA  L L F+FHP++    D     LH+    
Sbjct  183  LHPPPMLRITGTGHDLNILQRTGDRLLKFAHSLGLGFQFHPLLLLNNDPTFLALHLPSAI  242

Query  570  -----ESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
                 E++AVNC+L +H+ L D S R L+ FL  I++ NP  V +AE+EA H+      R
Sbjct  243  TLLPDEALAVNCVLYLHRFLKDDS-RELLLFLHKIKALNPKVVTVAEREASHNNPLFLQR  301

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             + +L +Y+A+FDSL++TLP ++  R  +E++ F REI +I+A EG  R ERH  F  W 
Sbjct  302  FLEALDHYTALFDSLEATLPPNNRERLAVEQIWFGREIMDIVAAEGEVRRERHQRFETWE  361

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
             LL   G F  V ++   L Q+++LL++H   E Y++     ++   L W++  L++VS+
Sbjct  362  MLLKSVG-FSSVPLSPFALSQAKLLLRLHYPSEGYQLRIL--NNSFFLGWQNHSLFSVSS  418

Query  51   W  49
            W
Sbjct  419  W  419



>ref|XP_007144131.1| hypothetical protein PHAVU_007G131200g [Phaseolus vulgaris]
 gb|ESW16125.1| hypothetical protein PHAVU_007G131200g [Phaseolus vulgaris]
Length=490

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 130/241 (54%), Gaps = 18/241 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TG+G    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  247  PGGPPS--LRLTGVGPPSPDERDTLREIGARLAELAHSVNVRFTFRGVAAWRLEDVKPWM  304

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLES  409
            L V   E+VAVN ++Q+H+VL    G  +   LG IRS NP  V + EQEA H+      
Sbjct  305  LQVSPKEAVAVNSIMQLHRVL----GSGIDAVLGWIRSLNPKIVTVVEQEANHNGEGFLE  360

Query  408  RLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWR  229
            R   +L YYS VFDSL++      P +   E    REI N++ CEG  R+ERH    KWR
Sbjct  361  RFTEALHYYSTVFDSLEACSV--EPDKGLAEMYLQREICNVVCCEGPARVERHEPLAKWR  418

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSA  52
            + L + G  R + +      Q+ MLL + S E Y VE   E+ G LTL W  +PL   SA
Sbjct  419  ERLAKAG-LRPLHLGSNAYKQASMLLTLFSAEGYCVE---ENQGCLTLGWHSRPLIAASA  474

Query  51   W  49
            W
Sbjct  475  W  475



>gb|AAY56754.1| DELLA protein [Malus domestica]
Length=546

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 136/249 (55%), Gaps = 16/249 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  285  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  342

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L     R   +   L  IR+ NP  V + EQEA+H++   
Sbjct  343  LQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLSWIRNLNPKIVTVVEQEADHNKPGF  402

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++  P+  P +T  E    REI N++ CEG  R+ERH    K
Sbjct  403  LDRFTEALYYYSTMFDSLEAC-PMQ-PEKTLAEMYIQREICNVVCCEGAARVERHEPLSK  460

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L + G F  + +      Q+ MLL + S E Y+VE   E+ G LTL W  +PL   
Sbjct  461  WRTRLGQAG-FSPLHLGSNAFKQASMLLTLFSAEGYRVE---ENQGCLTLGWHSRPLIAA  516

Query  57   SAWTPFDIA  31
            SAW    +A
Sbjct  517  SAWQVMHVA  525



>gb|KDO73932.1| hypothetical protein CISIN_1g048299mg [Citrus sinensis]
Length=459

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 142/241 (59%), Gaps = 11/241 (5%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV---DRLEDVRLWM---L  586
            L P   +RITG G   + L  TG+RL  FA+ L L F+FHP++   D    V  ++   L
Sbjct  221  LQPPPMLRITGTGNDIEILQRTGERLLKFAQSLGLRFQFHPLLLMNDDPTSVAFYLPSAL  280

Query  585  HVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
             +   E++AVNCML +HK+L D   R L  FL  I++ NP  V +AE+EA H+      R
Sbjct  281  TILPDETLAVNCMLFLHKLLKDHDTRDLRLFLHKIKALNPRVVTIAEREASHNHPLFLQR  340

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             V ++ +Y A+FDSL++TLP +S  R  +E++ F REI  I+A EG  R ERH  F  W 
Sbjct  341  FVEAVDHYGAIFDSLEATLPPNSRERLAVEQVWFGREIVEIVATEGENRKERHERFDSWE  400

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
             +L   G +  V ++   L Q+++LL++H   E Y++  Q  ++ L L W+++ L++VS+
Sbjct  401  MILRSCG-YSNVPLSGYALSQAKLLLRLHYPSEGYQL--QVLNNSLFLGWQNRALFSVSS  457

Query  51   W  49
            W
Sbjct  458  W  458



>gb|KJB54121.1| hypothetical protein B456_009G021700 [Gossypium raimondii]
Length=541

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 131/243 (54%), Gaps = 16/243 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  295  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  352

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   ESVAVN ++Q+H++L     R   +   L  IRS NP  + + EQEA H++   
Sbjct  353  LQVNPKESVAVNSIMQLHRLLGSDLNRNSPIETVLSWIRSLNPKIMTVVEQEANHNQPGF  412

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N+++CEG  R+ERH    K
Sbjct  413  LDRFTEALHYYSTMFDSLEAC--TVQPHKALAEIYIQREIANVVSCEGSARVERHEPLSK  470

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L   G FR + +      Q+ MLL + S E Y VE   E+DG LTL W  +PL   
Sbjct  471  WRTRLSGAG-FRPLHLGSNAYKQASMLLTLFSAEGYSVE---ENDGCLTLGWHSRPLIAA  526

Query  57   SAW  49
            SAW
Sbjct  527  SAW  529



>gb|ACV52013.1| GAI/RGA-like 3-a [Gossypium hirsutum]
 gb|ADH10264.1| GAI3a [Gossypium hirsutum]
Length=547

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 131/243 (54%), Gaps = 16/243 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  301  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  358

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   ESVAVN ++Q+H++L     R   +   L  IRS NP  + + EQEA H++   
Sbjct  359  LQVNPKESVAVNSIMQLHRLLGSDLNRNSPIETVLSWIRSLNPKIMTVVEQEANHNQPGF  418

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N+++CEG  R+ERH    K
Sbjct  419  LDRFTEALHYYSTMFDSLEAC--TVQPNKALAEIYIQREIANVVSCEGSARVERHEPLSK  476

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L   G FR + +      Q+ MLL + S E Y VE   E+DG LTL W  +PL   
Sbjct  477  WRTRLSGAG-FRPLHLGSNAYKQASMLLTLFSAEGYSVE---ENDGCLTLGWHSRPLIAA  532

Query  57   SAW  49
            SAW
Sbjct  533  SAW  535



>gb|AGV54403.1| DELLA protein DWARF8-like protein [Phaseolus vulgaris]
Length=493

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 130/241 (54%), Gaps = 18/241 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TG+G    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  250  PGGPPS--LRLTGVGPPSPDERDTLREIGARLAELAHSVNVRFTFRGVAAWRLEDVKPWM  307

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLES  409
            L V   E+VAVN ++Q+H+VL    G  +   LG IRS NP  V + EQEA H+      
Sbjct  308  LQVSPKEAVAVNSIMQLHRVL----GSGIDAVLGWIRSLNPKIVTVVEQEANHNGEGFLE  363

Query  408  RLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWR  229
            R   +L YYS VFDSL++      P +   E    REI N++ CEG  R+ERH    KWR
Sbjct  364  RFTEALHYYSTVFDSLEACSV--EPDKGLAEMYLQREICNVVCCEGPARVERHEPLAKWR  421

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSA  52
            + L + G  R + +      Q+ MLL + S E Y VE   E+ G LTL W  +PL   SA
Sbjct  422  ERLAKAG-LRPLHLGSNAYKQASMLLTLFSAEGYCVE---ENQGCLTLGWHSRPLIAASA  477

Query  51   W  49
            W
Sbjct  478  W  478



>ref|XP_006452790.1| hypothetical protein CICLE_v10008226mg [Citrus clementina]
 gb|ESR66030.1| hypothetical protein CICLE_v10008226mg [Citrus clementina]
Length=459

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 142/241 (59%), Gaps = 11/241 (5%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV---DRLEDVRLWM---L  586
            L P   +RITG G   + L  TG+RL  FA+ L L F+FHP++   D    V  ++   L
Sbjct  221  LQPPPMLRITGTGNDIEILQRTGERLLKFAQSLGLRFQFHPLLLMNDDPTSVAFYLPSAL  280

Query  585  HVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
             +   E++AVNCML +HK+L D   R L  FL  I++ NP  V +AE+EA H+      R
Sbjct  281  TILPDETLAVNCMLFLHKLLKDHDTRDLRLFLHKIKALNPRVVTIAEREASHNHPLFLQR  340

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             V ++ +Y A+FDSL++TLP +S  R  +E++ F REI  I+A EG  R ERH  F  W 
Sbjct  341  FVEAVDHYGAIFDSLEATLPPNSRERLAVEQVWFGREIVEIVATEGENRKERHERFDSWE  400

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
             +L   G +  V ++   L Q+++LL++H   E Y++  Q  ++ L L W+++ L++VS+
Sbjct  401  MILRSCG-YSNVPLSGYALSQAKLLLRLHYPSEGYQL--QVLNNSLFLGWQNRALFSVSS  457

Query  51   W  49
            W
Sbjct  458  W  458



>gb|AAY56753.1| DELLA protein [Malus domestica]
Length=546

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 142/259 (55%), Gaps = 17/259 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  286  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  343

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L     R   +   L  IR+ NP  V + EQEA+H++   
Sbjct  344  LQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLSWIRNLNPKIVAVVEQEADHNKPGF  403

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N++ CEG  R+ERH    K
Sbjct  404  LDRFTEALYYYSNMFDSLEAC--AMQPEKALAEIYIQREICNVVCCEGAARVERHEPLDK  461

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR + +EQ  F+ + +      Q+ MLL + S E Y+VE   E+ G LTL W ++PL   
Sbjct  462  WR-IRLEQAGFKPLHLGSNAFKQASMLLTLFSAEGYRVE---ENQGCLTLGWHNRPLIAA  517

Query  57   SAWTPFDIAGSSSSYSQPT  1
            SAW    +A ++++  QP 
Sbjct  518  SAWQVMPMAEATAN-QQPV  535



>ref|XP_008384643.1| PREDICTED: scarecrow-like protein 18 [Malus domestica]
Length=464

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 142/239 (59%), Gaps = 9/239 (4%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-----DRLEDVRLWMLH  583
            L P   +RIT  G     LL TG+RL  FA+ L LAF+FHP+V        + +    L 
Sbjct  228  LHPPPTLRITATGRDLSLLLRTGERLLRFAQSLGLAFQFHPLVLNNTSPPSDLISPSTLG  287

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
            + + E +AVNC+L +H ++ D S R L  FL  I+S NP    +A +EA H+     +R 
Sbjct  288  LHQNEVLAVNCVLYLHTLVTDDS-RDLFLFLQKIKSLNPKVFTIANKEANHNNHLFFNRF  346

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKL  223
            V +L +Y AVFDSL++TLP +S  R  +EE F REI++++  EG +R +RH S+  + ++
Sbjct  347  VEALDHYGAVFDSLEATLPPNSRERLVVEEWFGREIKDVVGVEGEKRKQRHESYETFWEV  406

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            ++ +  F  V ++   L Q+++LL++H   E Y++     +D   L W+++PL++VS+W
Sbjct  407  VLRRVGFENVPLSPFALSQAKLLLRLHYPSEGYQLRM--FNDSFFLGWQNRPLFSVSSW  463



>ref|XP_006475770.1| PREDICTED: DELLA protein GAI-like [Citrus sinensis]
 gb|KDO80378.1| hypothetical protein CISIN_1g009607mg [Citrus sinensis]
Length=531

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 131/242 (54%), Gaps = 14/242 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  283  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNIRFTFRGVAASRLEDVKPWM  340

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E++AVN +LQ+HK+L     R   +   LG IR+ NP  + + EQE+ H++   
Sbjct  341  LQVSPKEALAVNSILQLHKLLGSDPARNSPMEMVLGWIRNLNPKIMTVVEQESNHNQPEF  400

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++  PL  P +   E    REI N++ CEG  R+ERH    K
Sbjct  401  LDRFTTALYYYSTMFDSLEAC-PLQ-PEKALAEIYLQREICNVVCCEGSARVERHEPLAK  458

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVS  55
            WR  L   G FR + +      Q+ MLL + S E Y VE+   +  LTL W  +PL   S
Sbjct  459  WRNRLAGAG-FRPLHLGSNAFRQASMLLTLFSAEGYSVEET--EGCLTLGWHSRPLIAAS  515

Query  54   AW  49
            AW
Sbjct  516  AW  517



>emb|CDY45059.1| BnaA08g02160D [Brassica napus]
Length=304

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 148/249 (59%), Gaps = 24/249 (10%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RITG+   K+ L +   RL   AE+L++ F+F+PVV  L+ + +  L VK GE++AV+
Sbjct  55   HLRITGVHHQKEVLDQMAHRLIEEAEKLDIPFQFNPVVSSLQCLNVEQLRVKTGEALAVS  114

Query  552  CMLQMHKVL----YDTSGRAL---------------VD-FLGLIRSTNPIAVVMAEQEAE  433
             +LQ+H +L       +G +L               +D FL  I   +P  +V+ EQ+++
Sbjct  115  SVLQLHNLLASDVTSNNGHSLSGDSASSLPLSNSGKIDSFLNAIWGLSPKIMVVTEQDSD  174

Query  432  HDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLE  256
            H+ S++  RL+ SL  Y+A+FD L++ +P  S  R K+E+M F  EI+NIIACEG ER E
Sbjct  175  HNGSTVMERLLESLYTYAALFDCLETKVPRTSQDRMKVEKMLFGEEIKNIIACEGSERRE  234

Query  255  RHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWED  76
            RH    KW + +   G F  V ++   +LQ++ LL+ +  + Y++++  E     + W+D
Sbjct  235  RHEKLEKWSQRIDLAG-FGNVPLSYYAMLQARRLLQGYGFDGYRIKE--ESGCAVICWQD  291

Query  75   QPLYTVSAW  49
            +PLY+VSAW
Sbjct  292  RPLYSVSAW  300



>ref|XP_006451026.1| hypothetical protein CICLE_v10010825mg [Citrus clementina]
 gb|ESR64266.1| hypothetical protein CICLE_v10010825mg [Citrus clementina]
Length=531

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 131/242 (54%), Gaps = 14/242 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  283  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNIRFTFRGVAASRLEDVKPWM  340

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E++AVN +LQ+HK+L     R   +   LG IR+ NP  + + EQE+ H++   
Sbjct  341  LQVSPKEALAVNSILQLHKLLGADPARNSPMEMVLGWIRNLNPKIMTVVEQESNHNQPEF  400

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++  PL  P +   E    REI N++ CEG  R+ERH    K
Sbjct  401  LDRFTTALYYYSTMFDSLEAC-PLQ-PEKALAEIYLQREICNVVCCEGSARVERHEPLAK  458

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVS  55
            WR  L   G FR + +      Q+ MLL + S E Y VE+   +  LTL W  +PL   S
Sbjct  459  WRNRLAGAG-FRPLHLGSNAFRQASMLLTLFSAEGYSVEET--EGCLTLGWHSRPLIAAS  515

Query  54   AW  49
            AW
Sbjct  516  AW  517



>ref|XP_009371410.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=543

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/258 (39%), Positives = 140/258 (54%), Gaps = 17/258 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  282  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  339

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L     R   +   L  IR+ NP  V + EQEA+H++   
Sbjct  340  LQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLSWIRNLNPKIVTVVEQEADHNKPGF  399

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +T  E    REI N++ CEG  R+ERH    K
Sbjct  400  LDRFTEALYYYSTMFDSLEAC--AMQPEKTLAEMYIQREICNVVCCEGAARVERHEPLSK  457

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L + G F  + +      Q+ MLL + S E Y+VE   E+ G LTL W   PL   
Sbjct  458  WRTRLGQAG-FSPLHLGSNAFKQASMLLTLFSAEGYRVE---ENQGCLTLGWHSCPLIAA  513

Query  57   SAWTPFDIAGSSSSYSQP  4
            SAW    +A +++++ QP
Sbjct  514  SAWQVMSMAEATTNH-QP  530



>ref|XP_001754090.1| GAI1-like E3 ubiquitin ligase protein [Physcomitrella patens]
 gb|ABU63414.1| DELLA protein [Physcomitrella patens]
 gb|ABX10765.1| DELLA-like protein [Physcomitrella patens]
 gb|EDQ80991.1| GAI1-like E3 ubiquitin ligase protein [Physcomitrella patens]
Length=552

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/242 (38%), Positives = 137/242 (57%), Gaps = 12/242 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQE----LLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  PR  +R+TGIG  +      L E G +LA  AE + + FEF  VV  +L+D++ WM
Sbjct  313  PGGPPR--LRLTGIGPPQSGGSDVLQEIGMKLAQLAETVKVEFEFRGVVAVKLDDIKPWM  370

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            L +  GE+VAVN + Q+HK+LY       +D  L   R+  P    + E EA H++ S  
Sbjct  371  LQICHGEAVAVNSVFQLHKLLYSAGSVIPIDEVLRSARALKPKIFTIVEHEANHNQPSFL  430

Query  411  SRLVNSLKYYSAVFDSLDS-TLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
             R   +L YYS +FDSL++ +LP DS  +   E    REI NI+ACE   R+ERH +  +
Sbjct  431  GRFTEALHYYSTMFDSLEACSLPSDSSEQVLAEMYLGREINNIVACEDAARVERHENLVQ  490

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVS  55
            W+  +++ G +R + +      Q+ MLL M S + Y+VE++     LTL W  +PL + S
Sbjct  491  WQMRMLKAG-YRPIQLGLNAFKQASMLLTMFSGDGYRVEEK--LGCLTLGWHTRPLISAS  547

Query  54   AW  49
            AW
Sbjct  548  AW  549



>ref|XP_008390123.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI-like [Malus 
domestica]
Length=727

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 136/249 (55%), Gaps = 16/249 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  466  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  523

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L     R   +   L  IR+ NP  V + EQEA+H++   
Sbjct  524  LQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLSWIRNLNPKIVTVVEQEADHNKPGF  583

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++  P+  P +T  E    REI N++ CEG  R+ERH    K
Sbjct  584  LDRFTEALYYYSTMFDSLEAC-PMQ-PEKTLAEMYIQREICNVVCCEGAARVERHEPLSK  641

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L + G F  + +      Q+ MLL + S E Y+VE   E+ G LTL W  +PL   
Sbjct  642  WRTRLGQAG-FSPLHLGSNAFKQASMLLTLFSAEGYRVE---ENQGCLTLGWHSRPLIAA  697

Query  57   SAWTPFDIA  31
            SAW    +A
Sbjct  698  SAWQVMXVA  706



>ref|XP_010249953.1| PREDICTED: DELLA protein SLR1-like [Nelumbo nucifera]
Length=541

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/254 (39%), Positives = 137/254 (54%), Gaps = 18/254 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G +LA  A  +N+ F F  V   RL+DV+ WM
Sbjct  288  PGGPPL--LRLTGIGPPSPDGRDSLREIGLKLAELARSVNVRFAFRGVAASRLDDVKPWM  345

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRA--LVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VA+N ++Q+HK+L     R   +   LG +RS NP  + + EQEA H++   
Sbjct  346  LQVGPREAVAINSIMQLHKLLGPDPNRGSPIDSVLGWVRSLNPKIITVVEQEANHNQPEF  405

Query  414  ESRLVNSLKYYSAVFDSLDS-TLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFG  238
              R   +L YYS +FDSL+S TL    P +   E    REI N+++CEG  R+ERH    
Sbjct  406  LDRFTEALYYYSTMFDSLESCTL---QPEKAVAEMYIQREICNVVSCEGSARVERHEPLA  462

Query  237  KWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYT  61
            KWR  L   G FR + +      Q+ MLL + S E Y VE   E+ G LTL W  +PL  
Sbjct  463  KWRARLGGAG-FRPLHLGSNAFKQASMLLTLFSAEGYCVE---ENQGCLTLGWHSRPLIA  518

Query  60   VSAWTPFDIAGSSS  19
             SAW    +  ++S
Sbjct  519  ASAWQAVPLPDTNS  532



>gb|AHW42470.1| RGA [Pinus tabuliformis]
Length=594

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 140/245 (57%), Gaps = 16/245 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+T IG    + +  L E G +LA FAE +N+ F+F  V+ D+LED++ WM
Sbjct  353  PGGPPL--LRLTAIGPRQPDGRDVLQEIGMKLAQFAESVNVEFDFRGVMADKLEDIKPWM  410

Query  588  LHVKEGESVAVNCMLQMHKVLY--DTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDESS  418
              VK  E VAVN +LQ+H++LY    +G + +D  L  I S  P  V + E EA H+   
Sbjct  411  FQVKPDEVVAVNSVLQLHRLLYIDAPTGSSPIDVVLRSIGSLRPKIVTVVEHEANHNGPV  470

Query  417  LESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASF  241
               R V +L YYS +FDSL++   L + +   + E++  +EI NI+ACEGR R+ERH + 
Sbjct  471  FLDRFVEALHYYSTMFDSLEACNVLPNSMEKLLAELYIQKEICNIVACEGRYRIERHETL  530

Query  240  GKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLY  64
              WR  L   G FR   +      Q++MLL + S E Y VE   E++G LTL W  +PL 
Sbjct  531  SHWRVRLGRAG-FRPSHLGSNAFKQARMLLTLFSGEGYTVE---ENNGSLTLGWHSRPLI  586

Query  63   TVSAW  49
              SAW
Sbjct  587  AASAW  591



>gb|KJB22203.1| hypothetical protein B456_004G034900 [Gossypium raimondii]
Length=437

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/240 (39%), Positives = 140/240 (58%), Gaps = 14/240 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLW-------MLH  583
            P   +RITG G     L  TGDRL  FA+ L L FEFHP++   ED   W       M+ 
Sbjct  202  PPPMLRITGTGHDLNILHRTGDRLFKFAQSLGLRFEFHPLLVLNEDPT-WIATNFTSMVT  260

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
            +   E++AVNCML + ++L D S R +  FL  +++ NP  V +AE+EA H+      R 
Sbjct  261  ILPDEALAVNCMLYLQRLLKDDS-RDIRLFLHHMKALNPTVVTVAEREANHNHPLFLQRF  319

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRK  226
            V +L YY+A+FDSL++TLP +S  R  +E++ F REI +I+A EG  R ERH     W  
Sbjct  320  VEALDYYTAIFDSLEATLPPNSRERLAVEQIWFGREIVDIVAAEGENRRERHERLETWEV  379

Query  225  LLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            +L   G F  V ++     Q+++LL++H   E Y++  Q  ++   L W+++PL++VS+W
Sbjct  380  ILRSSG-FINVPLSPFAHSQAKLLLRLHYPSEGYQL--QIVNNCFFLGWQNRPLFSVSSW  436



>ref|XP_012078699.1| PREDICTED: DELLA protein SLR1-like [Jatropha curcas]
 gb|KDP32341.1| hypothetical protein JCGZ_13266 [Jatropha curcas]
Length=546

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 136/254 (54%), Gaps = 16/254 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +++ F F  V   RLEDV+ WM
Sbjct  289  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVHVRFAFRGVAASRLEDVKPWM  346

Query  588  LHVKEGESVAVNCMLQMHKVL-YDTSGRALVDF-LGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+HK+L  D    + +D  L  IR+ NP  + + EQEA H++   
Sbjct  347  LQVNPKEAVAVNSIMQLHKLLGSDPPRNSAIDMVLNWIRNLNPKIMTVVEQEAYHNQPGF  406

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N+++CEG  RLERH    K
Sbjct  407  LDRFTEALYYYSTMFDSLEACA--LQPEKILAEMYIQREICNVVSCEGSARLERHEPLAK  464

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L   G FR + +      Q+ MLL + S E Y VE   E++G LTL W  +PL   
Sbjct  465  WRSRLTAAG-FRPLHLGSNAFKQASMLLTLFSSEGYCVE---ENEGCLTLGWHSRPLIAA  520

Query  57   SAWTPFDIAGSSSS  16
            SAW      G S S
Sbjct  521  SAWEAVADGGGSGS  534



>dbj|BAQ20609.1| GRAS-family protein 1 [Lygodium japonicum]
Length=743

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 144/254 (57%), Gaps = 25/254 (10%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P  H+R+TGIG    ++K  L + G RLA  A  +N+ F F  VV  +L+DV+  M
Sbjct  493  PGGPP--HLRLTGIGPPQPDNKDVLQDIGMRLAEIAASVNVTFSFQGVVATKLDDVKPRM  550

Query  588  LHVKEGESVAVNCMLQMHKVLY--DTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDESS  418
            L  + GE+VAVN + Q+H +LY  ++S  A ++  L  I+S +P  V + EQEA H+  +
Sbjct  551  LQARPGEAVAVNSVFQLHPLLYSDNSSAEAPINQVLQSIKSLSPKIVTVVEQEANHNSPN  610

Query  417  LESRLVNSLKYYSAVFDSLDST-LPLDSPVRTKIE--------EMF-AREIRNIIACEGR  268
               R + +L YYS +FDSL++  LP D       E        EM+  +EI NI+ACEG 
Sbjct  611  FLDRFIQALHYYSTMFDSLEACGLPPDCEPELYSEMCQALHFTEMYLGKEIINIVACEGA  670

Query  267  ERLERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LT  91
             R ERH S  +WR  + + G FR + +      Q+ MLL++ S E Y VE   E++G LT
Sbjct  671  ARTERHESLSQWRMRMFKAG-FRPLHLGSNAFNQASMLLRIFSAEGYTVE---ENNGCLT  726

Query  90   LSWEDQPLYTVSAW  49
            L W  +PL   SAW
Sbjct  727  LGWHSRPLIASSAW  740



>ref|NP_001234179.1| lateral suppressor protein [Solanum lycopersicum]
 ref|XP_010324190.1| PREDICTED: lateral suppressor protein isoform X1 [Solanum lycopersicum]
 gb|AAD05242.1| lateral suppressor protein [Solanum lycopersicum]
 emb|CAC36399.1| lateral suppressor [Solanum lycopersicum]
Length=428

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/240 (38%), Positives = 137/240 (57%), Gaps = 14/240 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV------DRLEDVRLWM-LH  583
            P   +RITG G     L  TGDRLA FA  L L F+FHP+       D  ED  +   + 
Sbjct  193  PAPTLRITGTGNDLDTLRRTGDRLAKFAHSLGLRFQFHPLYIANNNHDHDEDPSIISSIV  252

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
            +   E++A+NC+  +H++L D     L  FL  ++S NP  V +AE+EA H+      R 
Sbjct  253  LLPDETLAINCVFYLHRLLKDRE--KLRIFLHRVKSMNPKIVTIAEKEANHNHPLFLQRF  310

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRK  226
            + +L YY+AVFDSL++TLP  S  R  +E++ F REI +I+A EG +R ERH  F  W  
Sbjct  311  IEALDYYTAVFDSLEATLPPGSRERMTVEQVWFGREIVDIVAMEGDKRKERHERFRSWEV  370

Query  225  LLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            +L   G F  V ++   L Q+++LL++H   E Y++      +   L W++QPL+++S+W
Sbjct  371  MLRSCG-FSNVALSPFALSQAKLLLRLHYPSEGYQLGVSS--NSFFLGWQNQPLFSISSW  427



>ref|XP_008354103.1| PREDICTED: scarecrow-like protein 18 [Malus domestica]
Length=458

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/239 (36%), Positives = 143/239 (60%), Gaps = 9/239 (4%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV----DRLED-VRLWMLH  583
            L P   +RIT  G     LL TG+RL  FA+ L LAF+FHP+V     R  D +    L 
Sbjct  222  LHPPPTLRITATGRDLTLLLRTGERLLRFAQSLGLAFQFHPLVLNNAARPSDLISPSTLG  281

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
            + + E++AVNC+L +H ++ D S R L+ FL  I+S NP    +A +EA H+     +R 
Sbjct  282  LHQNEALAVNCVLYLHTLVTDDS-RDLLLFLQKIKSLNPKVFTVANKEANHNNPLFFNRF  340

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKL  223
            V +L +Y AVF+SL++TLP +S  R  +EE   RE+++++  EG +R +RH  +  + ++
Sbjct  341  VEALDHYGAVFESLEATLPPNSRERLAVEEWXGREVKDVVGVEGEKRKQRHERYETFWEV  400

Query  222  LMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            ++ +  F  V ++   L Q+++LL++H   E Y++     +D   L W+++PL++VS+W
Sbjct  401  VLRRAGFENVALSPFALSQAKLLLRLHYPSEGYQLRIL--NDSFFLGWQNRPLFSVSSW  457



>ref|XP_006346062.1| PREDICTED: scarecrow-like protein 18-like [Solanum tuberosum]
Length=431

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/240 (38%), Positives = 137/240 (57%), Gaps = 14/240 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV------DRLEDVRLWM-LH  583
            P   +RITG G     L  TGDRLA FA  L L F+FHP+       D  ED  +   + 
Sbjct  196  PAPTLRITGTGNDLDTLRRTGDRLAKFAHSLGLRFQFHPLYIANNNRDHDEDPSIISSIV  255

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
            +   E++A+NC+  +H++L D     L  FL  ++S NP  V +AE+EA H+      R 
Sbjct  256  LLPDETLAINCVFYLHRLLKDRE--KLRIFLHRVKSMNPKIVTIAEKEANHNHPLFLQRF  313

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRK  226
            + +L YY+AVFDSL++TLP  S  R  +E++ F REI +I+A EG +R ERH  F  W  
Sbjct  314  IEALDYYTAVFDSLEATLPPGSRERMTVEQVWFGREIVDIVAMEGDKRKERHERFRSWEV  373

Query  225  LLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            +L   G F  V ++   L Q+++LL++H   E Y++      +   L W++QPL+++S+W
Sbjct  374  MLRSCG-FSNVALSPFALSQAKLLLRLHYPSEGYQLGVSS--NSFFLGWQNQPLFSISSW  430



>ref|XP_002529354.1| DELLA protein GAI1, putative [Ricinus communis]
 gb|EEF33021.1| DELLA protein GAI1, putative [Ricinus communis]
Length=536

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 133/251 (53%), Gaps = 16/251 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G +LA  A  +N+ F F  V   RLEDV+ WM
Sbjct  279  PGGPPL--LRLTGIGPPSPDGRDSLREIGVKLAELARSVNVRFAFRGVAASRLEDVKPWM  336

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRAL-VDF-LGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E++AVN ++Q+HK+L     R L +D  L  IR+ NP  + + EQEA H++   
Sbjct  337  LQVNPKEAIAVNSIMQLHKLLGSDPNRNLSIDMVLNWIRNLNPKIMTVVEQEANHNQPGF  396

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL +      P +   E    REI N+++CEG  RLERH    K
Sbjct  397  LDRFTEALYYYSTMFDSLGAC--ALQPEKVVAEMYIQREICNVVSCEGSARLERHEPLAK  454

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            W+  L   G F  + +      Q+ MLL + S E Y VE   E+DG LTL W  +PL   
Sbjct  455  WKSRLTAAG-FMPLHLGSNAFKQASMLLTLFSSEGYCVE---ENDGCLTLGWHSRPLIAA  510

Query  57   SAWTPFDIAGS  25
            SAW      GS
Sbjct  511  SAWQAVPDIGS  521



>dbj|BAP05438.1| GAI1-like E3 ubiquitin ligase protein [Marchantia polymorpha]
Length=560

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/244 (38%), Positives = 143/244 (59%), Gaps = 15/244 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQE----LLETGDRLAGFAEQLNLAFEFHPV-VDRLEDVRLWM  589
            PG  P   +R+TGIG   Q     L E G +LA  A+ +++ FEF  V   +L+DV+ +M
Sbjct  320  PGGPPI--LRLTGIGPPHQSGNDVLQEIGMKLAQLADLVSVQFEFRGVYAQKLDDVKPYM  377

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSG--RALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            LHV++GE+VAVN ++Q+H++L++ +    A+ + L  +RS NP  V + E EA H+    
Sbjct  378  LHVRQGEAVAVNAVMQLHRLLHNDNNCVPAVHEVLQSMRSLNPKIVTLVEHEANHNSPVF  437

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFG  238
              R + +L YYS +FDSL++           + EM+  REI NI+ACEG +R+ERH +  
Sbjct  438  LDRFMEALHYYSTMFDSLEACSSSSQSSEQLLAEMYVGREICNIVACEGFDRVERHENLV  497

Query  237  KWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYT  61
            +WR+ + + G F+   +      Q+ MLL +   + Y+VE   E++G LTL W  +PL  
Sbjct  498  QWRRRMTDAG-FQLRHLGSNAFKQASMLLTLFPGDGYRVE---ENNGCLTLGWHSRPLIA  553

Query  60   VSAW  49
             SAW
Sbjct  554  ASAW  557



>ref|XP_007013315.1| GAI/RGA-like protein [Theobroma cacao]
 gb|EOY30934.1| GAI/RGA-like protein [Theobroma cacao]
Length=548

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 132/243 (54%), Gaps = 16/243 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  289  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFTFRGVAASRLEDVKPWM  346

Query  588  LHVKEGESVAVNCMLQMHKVLY--DTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L    T    +   L  IRS NP  + + EQEA H++   
Sbjct  347  LQVNPKEAVAVNSIMQLHRLLGADPTRNSPIQTVLSWIRSLNPKIMTVVEQEANHNQPGF  406

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N+++CEG  R+ERH    K
Sbjct  407  LDRFTEALYYYSTMFDSLEAC--TVQPEKALAEIYIQREIANVVSCEGSARVERHEPLAK  464

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L   G FR + +      Q+ MLL + S E Y VE   E++G LTL W  +PL + 
Sbjct  465  WRTRLNGAG-FRPLHLGSNAFKQASMLLTLFSAEGYLVE---ENEGCLTLGWHSRPLISA  520

Query  57   SAW  49
            SAW
Sbjct  521  SAW  523



>ref|XP_009107220.1| PREDICTED: scarecrow-like protein 3 [Brassica rapa]
Length=445

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 148/249 (59%), Gaps = 24/249 (10%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RITG+   K+ L +   RL   AE+L++ F+F+PVV  L+ + +  L VK GE++AV+
Sbjct  196  HLRITGVHHQKEVLDQMAHRLIEEAEKLDIPFQFNPVVSSLQCLNVEQLRVKTGEALAVS  255

Query  552  CMLQMHKVL----YDTSGRAL---------------VD-FLGLIRSTNPIAVVMAEQEAE  433
             +LQ+H +L       +G +L               +D FL  I   +P  +V+ EQ+++
Sbjct  256  SVLQLHNLLASDVTSNNGHSLSGDSASSLPLSNSGKIDSFLNAIWGLSPKIMVVTEQDSD  315

Query  432  HDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLE  256
            H+ S++  RL+ SL  Y+A+FD L++ +P  S  R K+E+M F  EI+NIIACEG ER E
Sbjct  316  HNGSTVMERLLESLYTYAALFDCLETKVPRTSQDRMKVEKMLFGEEIKNIIACEGSERRE  375

Query  255  RHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWED  76
            RH    KW + +   G F  V ++   +LQ++ LL+ +  + Y++++  E     + W+D
Sbjct  376  RHEKLEKWSQRIDLAG-FGNVPLSYYAMLQARRLLQGYGFDGYRIKE--ESGCAVICWQD  432

Query  75   QPLYTVSAW  49
            +PLY+VSAW
Sbjct  433  RPLYSVSAW  441



>ref|XP_008811155.1| PREDICTED: scarecrow-like protein 18 [Phoenix dactylifera]
Length=410

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 94/257 (37%), Positives = 143/257 (56%), Gaps = 16/257 (6%)
 Frame = -2

Query  786  PMA*PVPEFGXPGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLE  607
            P    + E   P  +P   IRITG G     L  TG+RL  FA  L L F+FHP+     
Sbjct  158  PFLQAIAERSDPSSLPS--IRITGTGTGLDVLRRTGERLQAFANSLGLRFQFHPLYLPTA  215

Query  606  DVRLWM-----LHVKEGESVAVNCMLQMHKVLYDTSGR----ALVDFLGLIRSTNPIAVV  454
            D            +  GE++AVNCML +HK+L D S       LV FL  +++ NP+ V 
Sbjct  216  DPDASASLNSSFQLHPGETLAVNCMLFLHKLLKDGSSDDPACKLVAFLHAVKAMNPVVVT  275

Query  453  MAEQEAEHDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIAC  277
            +AE+EA H+      R + +L +Y+AVF+SL++TLP  SP R ++E+++  REI +I+  
Sbjct  276  VAEREANHNSPIFLRRFMEALDHYTAVFESLEATLPPKSPERLEVEQVWLGREIEDIVGR  335

Query  276  EGRERLERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDD  100
            EG  R ERH  F  W  L+  +G F  + ++   L Q+++LL++H   E Y++      +
Sbjct  336  EGEGRKERHERFEWWEGLMRGRG-FSSLPLSPFALSQAKLLLRLHYPSEGYQLPMS--KN  392

Query  99   GLTLSWEDQPLYTVSAW  49
             L L W+ +PL++VS+W
Sbjct  393  SLFLGWQHKPLFSVSSW  409



>gb|AHB17747.1| GA repressor DELLA [Actinidia deliciosa]
Length=519

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 128/242 (53%), Gaps = 14/242 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  265  PGGPPL--LRLTGIGPPSSDGRDSLREIGLRLAELAHSVNVQFAFRGVAASRLEDVKPWM  322

Query  588  LHVKEGESVAVNCMLQMHKVLYD--TSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VA+N ++Q+H++L    T G  +   LG IR+ NP  + + EQEA H++   
Sbjct  323  LQVGPKEAVAINSIMQLHRLLVSDTTRGSPIEAVLGWIRNMNPKVMTVVEQEANHNQPEF  382

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS  FDSL++      P +   E    REI NI+  EG  R+ERH    K
Sbjct  383  LDRFTEALHYYSTTFDSLETC--STQPDKALAEIYIQREICNIVCSEGLARVERHEPLAK  440

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVS  55
            WR  L   G F+ + +      Q+ MLL + S E Y VE+ G    LTL W  +PL   S
Sbjct  441  WRSRLRGAG-FKPLHLGSNAFKQASMLLTLFSAEGYCVEEDG--GCLTLGWHSRPLIAAS  497

Query  54   AW  49
            AW
Sbjct  498  AW  499



>ref|XP_007206810.1| hypothetical protein PRUPE_ppa025834mg [Prunus persica]
 gb|EMJ08009.1| hypothetical protein PRUPE_ppa025834mg [Prunus persica]
Length=398

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/241 (37%), Positives = 143/241 (59%), Gaps = 16/241 (7%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV--------DRLEDVRLWML  586
            P   +RIT  G S   LL+TGDRL  FA  L LAF FHP+V        D +    L +L
Sbjct  163  PPPMLRITATGHSLALLLKTGDRLLKFANSLGLAFHFHPLVLNDAVQPSDIISPSTLGLL  222

Query  585  HVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
                 E++AVNC+L +H ++ D S R L  FL  I+S NP  + +A +EA H+     +R
Sbjct  223  ---PNEALAVNCVLYLHTLVTDDS-RELSLFLRKIKSLNPKVLTIANKEANHNHPLFFNR  278

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGKWR  229
             V +L++Y AVFDSL++TLP +S  R  +E+++  REIR+++  E   R +RH  +  + 
Sbjct  279  FVEALEHYGAVFDSLEATLPPNSRERQAVEDVWMGREIRDVVGAEEGRRRQRHEKYETYW  338

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            ++++ +  F  V ++   L Q+++LL++H   E Y++  +  +D   L W+++PL++VS+
Sbjct  339  EVMLRRAGFENVALSPFALSQAKLLLRLHYPSEGYQL--RIINDSFFLGWQNRPLFSVSS  396

Query  51   W  49
            W
Sbjct  397  W  397



>gb|ACR58456.1| GAI/RGA-like protein [Gossypium hirsutum]
 gb|ACV52016.1| GAI/RGA-like 4-b [Gossypium hirsutum]
 gb|ADH10266.1| GAI4b [Gossypium hirsutum]
Length=538

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 131/243 (54%), Gaps = 16/243 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  291  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  348

Query  588  LHVKEGESVAVNCMLQMHKVLYD--TSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L    T    +   L  IR  NP  + + EQEA H++   
Sbjct  349  LQVNPKEAVAVNSIMQLHRLLGSEQTRNSPIDTVLSWIRGLNPKIMTVVEQEANHNQPGF  408

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N+++CEG  R+ERH    K
Sbjct  409  LDRFTEALYYYSTMFDSLEAC--RVQPEKALAEIYIQREIGNVVSCEGSARVERHEPLAK  466

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR+ L   G FR + +      Q+ MLL + S E Y VE   E++G L+L W  +PL   
Sbjct  467  WRRRLSGAG-FRALHLGSNAFKQASMLLTLFSAEGYSVE---ENEGCLSLGWHSRPLIAA  522

Query  57   SAW  49
            SAW
Sbjct  523  SAW  525



>ref|XP_002321384.1| hypothetical protein POPTR_0015s01070g [Populus trichocarpa]
 gb|EEF05511.1| hypothetical protein POPTR_0015s01070g [Populus trichocarpa]
Length=434

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 139/241 (58%), Gaps = 12/241 (5%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEG-  571
            L P   +RITG G     L  TGDRL  FA+ L L F+FHP++    D     L++    
Sbjct  197  LHPPPMLRITGTGHDLNILHRTGDRLLKFAQSLGLRFQFHPLLLLNNDPTTLALYLPSAI  256

Query  570  -----ESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
                 E++AVNC+L +H+ L D S R L+ FL  I++ NP  V +AE+EA H++     R
Sbjct  257  TLLPDEALAVNCVLYLHRFLKDDS-RELLLFLHKIKALNPKVVTVAEREANHNQPLFLQR  315

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             + +L +Y A+FDSL++TLP ++  R  +E++ F REI +I+A EG  R ERH  F  W 
Sbjct  316  FLEALDHYKALFDSLEATLPPNNRERLAVEQIWFGREILDIVAAEGEGRRERHQKFETWE  375

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
             +L   G F  V ++   L Q+++LL++H   E Y++  Q   +   L W++  L+++S+
Sbjct  376  MMLKSVG-FNKVPLSPFALSQAKLLLRLHYPSEGYQL--QILKNSFFLGWQNHSLFSISS  432

Query  51   W  49
            W
Sbjct  433  W  433



>ref|XP_007020290.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOY11815.1| GRAS family transcription factor [Theobroma cacao]
Length=438

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 140/241 (58%), Gaps = 12/241 (5%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLED---VRLWM---L  586
            L P   +RITG G     L  TGDRL  FA+ L L F+FHP++    D   V L +   L
Sbjct  201  LHPPPMLRITGTGHDLNILQRTGDRLFKFAQSLGLRFQFHPLLVLNNDPTSVALNLPSTL  260

Query  585  HVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
             +   E++AVNCM  +H++L D S R L  FL  I++ NP  V +AE+EA H+      R
Sbjct  261  TILPDEALAVNCMFYLHRLLKDDS-RDLRLFLHNIKAMNPAVVTIAEREANHNHPLFLQR  319

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             + +L YY+A+FDSL++TLP +S  R  +E++ F REI +I+A EG  R ERH     W 
Sbjct  320  FIEALDYYTAIFDSLEATLPPNSRERLAVEQIWFGREIVDIVAAEGENRRERHERLETWE  379

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
             +L   G F  V ++     Q+++LL++H   + Y++  Q  ++   L W+++ L++VS+
Sbjct  380  VILRSTG-FSNVPLSPFAHSQAKLLLRLHYPSDGYRL--QILNNSFFLGWQNRALFSVSS  436

Query  51   W  49
            W
Sbjct  437  W  437



>gb|ACV52015.1| GAI/RGA-like 4-a [Gossypium hirsutum]
 gb|ADH10265.1| GAI4a [Gossypium hirsutum]
Length=535

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 130/243 (53%), Gaps = 16/243 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  288  PGGPPL--LRLTGIGPPPPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  345

Query  588  LHVKEGESVAVNCMLQMHKVL--YDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L    T    +   L  IR  NP  + + EQEA H++   
Sbjct  346  LQVNPKEAVAVNSIMQLHRLLGCEQTRNSPIDTVLSWIRGLNPKIMTVVEQEANHNQPGF  405

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N+++CEG  R+ERH    K
Sbjct  406  LDRFTEALYYYSTMFDSLEAC--RIQPEKALAEIYIQREIGNVVSCEGSARVERHEPLAK  463

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR+ L   G FR + +      Q+ MLL + S E Y VE   E++G L+L W   PL   
Sbjct  464  WRRRLSGAG-FRALRLGSNAFKQASMLLTLFSAEGYSVE---ENEGCLSLGWHSSPLIAA  519

Query  57   SAW  49
            SAW
Sbjct  520  SAW  522



>emb|CDP13626.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 140/237 (59%), Gaps = 11/237 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLH----VKE  574
            PR  +RITG G   + L  TGDRLA FA  L L F+FHP+    ED  + +L     +  
Sbjct  208  PRPSLRITGTGNDLETLRRTGDRLAKFAHSLGLRFQFHPLHLHNEDDPIAVLSSAVVLLP  267

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GES+AVNC+  +H++L D  G  L  FL  I+  NP  V MAE+EA H+      R V +
Sbjct  268  GESLAVNCVHYLHRLLKDRDGLRL--FLHRIKVMNPRVVTMAEREANHNHPLFLQRFVEA  325

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L +Y+AVFDSL++TLP +S  R  +E++ F REI +I+A +G  R ERH  F  W +L+ 
Sbjct  326  LDHYAAVFDSLEATLPPNSRERLNVEQVWFGREIVDIVAADGDHRRERHERFRSW-ELMF  384

Query  216  EQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
                F  V ++   L Q+++LL++H   E Y++     +D   L W++Q LY+VS+W
Sbjct  385  RSCGFNNVPLSPFALSQAKLLLRLHYPSEGYQLHIL--NDSFFLGWQNQLLYSVSSW  439



>ref|XP_011095666.1| PREDICTED: scarecrow-like protein 18 [Sesamum indicum]
Length=435

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/239 (38%), Positives = 137/239 (57%), Gaps = 14/239 (6%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV-----DRLEDVRLWMLHVK  577
            P   +RITG G   + L  TGDRLA FA  L L F+FHP++     D +      +L   
Sbjct  204  PPPTLRITGTGHDLEILRRTGDRLAKFAHSLGLRFQFHPLILLTNEDPISVASSVLL--L  261

Query  576  EGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVN  397
              E++ VNC+  +H++L D     L  FL  I++  P  + +AE+EA H+    + R V 
Sbjct  262  PDETLVVNCVHYLHRLLKDRDRLHL--FLHRIKAMGPRVLTVAEREANHNHPIFQQRFVE  319

Query  396  SLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLL  220
            +L +Y+AVFDSL++TLP +S  R  +E++ F REI +I+A EG  R ERH  F  W  +L
Sbjct  320  ALDHYAAVFDSLEATLPPNSRERLAVEQIWFGREIADIVAGEGENRRERHERFRSWEVML  379

Query  219  MEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
               G F  V ++   L Q+++LL++H   E Y++     +D   L W++QPL++VS+W 
Sbjct  380  RSSG-FSNVRLSPFALSQAKLLLRLHYPSEGYQLHIL--NDSFFLGWQNQPLFSVSSWN  435



>gb|KJB64828.1| hypothetical protein B456_010G067000 [Gossypium raimondii]
 gb|KJB64829.1| hypothetical protein B456_010G067000 [Gossypium raimondii]
 gb|KJB64830.1| hypothetical protein B456_010G067000 [Gossypium raimondii]
Length=477

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 130/243 (53%), Gaps = 16/243 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  230  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  287

Query  588  LHVKEGESVAVNCMLQMHKVL--YDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L    T    +   L  IR  NP  + + EQEA H++   
Sbjct  288  LQVNPKEAVAVNSIMQLHRLLGCEQTRDSPIDTVLSWIRGLNPKIMTVVEQEANHNQPGF  347

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    REI N+++CEG  R+ERH    K
Sbjct  348  LDRFTEALYYYSTMFDSLEAC--RIQPEKALAEIYIQREIGNVVSCEGSARVERHEPLAK  405

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR+ L   G FR + +      Q+ MLL + S E Y VE   E++G L+L W   PL   
Sbjct  406  WRRRLSGAG-FRALRLGSNAFKQASMLLTLFSAEGYSVE---ENEGCLSLGWHSSPLIAA  461

Query  57   SAW  49
            SAW
Sbjct  462  SAW  464



>ref|XP_008246525.1| PREDICTED: scarecrow-like protein 18 [Prunus mume]
Length=471

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/241 (36%), Positives = 143/241 (59%), Gaps = 16/241 (7%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV--------DRLEDVRLWML  586
            P   +RIT  G S   LL+TGDRL  FA  L LAF FHP+V        D +    L +L
Sbjct  236  PPPMLRITATGHSLALLLKTGDRLLKFANSLGLAFHFHPLVLNDAVRPSDIISPSTLGLL  295

Query  585  HVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
                 E++A+NC+L +H ++ D SG  L  FL  I+S NP  + +A +EA H+     +R
Sbjct  296  ---PNEALAINCVLYLHTLVTDDSGE-LSLFLRKIKSLNPKVLTIANKEANHNHPLFFNR  351

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGKWR  229
             V +L++Y A+FDSL++TLP +S  R  +E+++  REIR+++  E   R +RH  +  + 
Sbjct  352  FVEALEHYGAIFDSLEATLPPNSRERQAVEDVWMGREIRDVVGAEEGRRRQRHEKYETYW  411

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            ++++ +  F  V ++   L Q+++LL++H   E Y++  +  +D   L W+++PL++VS+
Sbjct  412  EVMLRRAGFENVALSPFALSQAKLLLRLHYPSEGYQL--RIINDSFFLGWQNRPLFSVSS  469

Query  51   W  49
            W
Sbjct  470  W  470



>ref|XP_010480099.1| PREDICTED: scarecrow-like protein 18 [Camelina sativa]
Length=453

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 139/240 (58%), Gaps = 13/240 (5%)
 Frame = -2

Query  741  PRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDV-------RLWMLH  583
            PR  +RITG G     L  TGDRL  FA  L L F+FH +V   ED+       RL  L 
Sbjct  217  PRPSLRITGCGRDVAGLNRTGDRLTRFANSLGLQFQFHTLVIVEEDIAGLLLQIRLLALS  276

Query  582  VKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
               GE++AVNC+  +HK   D  G  +  FL +I+S NP  V MAE+EA H + S  +R 
Sbjct  277  FVHGETIAVNCVHFLHKFFND-DGDMIGHFLSVIKSLNPRIVTMAEREANHGDHSFLNRF  335

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRK  226
              ++ +Y A+FDSL++TLP +S  R  +E+  F +EI +++A E RER +RH  F  W +
Sbjct  336  SEAVDHYVAIFDSLEATLPPNSRERLTLEQRWFGKEIFDVVAAEARERKQRHRRFEIWEE  395

Query  225  LLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            ++   G F  V I    L Q+++LL++H   E Y +  Q  ++ L L W+++ L++VS+W
Sbjct  396  MMKRFG-FVNVPIGSFALSQAKLLLRLHYPSEGYNL--QFLNNSLFLGWQNRLLFSVSSW  452



>ref|XP_008382900.1| PREDICTED: protein SCARECROW 1-like [Malus domestica]
Length=501

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 132/230 (57%), Gaps = 8/230 (3%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+R+TG+G S + LLETG +L+ FA++L L+FEFHP+V  + +V   M+ V+ GE++AV+
Sbjct  273  HLRMTGVGTSSEILLETGKQLSNFAKRLGLSFEFHPIVRTVGEVDASMVQVQRGETLAVH  332

Query  552  CMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAV  373
                +   LYD +G      L LI    P  V + EQ+  H  S L+ R V SL YYS +
Sbjct  333  W---LQHSLYDATGSDW-KTLRLIEELAPRLVTLVEQDMSHSGSFLD-RFVGSLHYYSTM  387

Query  372  FDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRC  196
            FDSL+S LP D+P R K+E  MF REI NI+A  G  R      F +WR  L  + +F  
Sbjct  388  FDSLESYLPSDNPSRHKVEHSMFYREINNILAIGGPAR-SGEDKFRQWRSELGARSEFMQ  446

Query  195  VGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
            V ++   + Q+Q++L M          QG D  + L W+D  LY  SAWT
Sbjct  447  VEMSGNSMAQAQLILNMFPPTHGYSLVQG-DGTIRLGWKDTSLYVASAWT  495



>ref|XP_002975137.1| GRAS family protein [Selaginella moellendorffii]
 gb|EFJ23922.1| GRAS family protein [Selaginella moellendorffii]
Length=713

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 134/238 (56%), Gaps = 12/238 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +R+T +G S ++L E G +L   A  L + FE+  +   LED    M+ +++
Sbjct  484  PGGPPV--VRMTAVGSSLRDLQEAGSKLLDCARSLGVPFEYCILRVELEDFHAGMVELRD  541

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE+V VN + Q H+ L     R L  FL  +RS  P  VVMAE +A+H+      R +  
Sbjct  542  GEAVLVNSLCQFHRFLK----RDLDQFLQGLRSLRPRLVVMAENDADHNSPDFMHRFMAC  597

Query  393  LKYYSAVFDSLDSTL--PLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGKWRKL  223
            L YYSAVFD+ D++L  P   P R K+EE+  A+++RN+IACEG ER+ERH S   W   
Sbjct  598  LHYYSAVFDAFDASLHMPGTLPGRKKLEELIAAQKLRNMIACEGSERVERHESMRAWNA-  656

Query  222  LMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
             ME   FR V ++ + + Q+ +LLK++  + Y +  Q  +  L L W   PL  V AW
Sbjct  657  RMEGVGFRAVSMSHKAINQASLLLKLYYSDGYTLTNQ--EGFLILGWRGMPLNGVGAW  712



>ref|XP_002300599.1| hypothetical protein POPTR_0001s47720g [Populus trichocarpa]
 gb|EEE85404.1| hypothetical protein POPTR_0001s47720g [Populus trichocarpa]
Length=438

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/240 (38%), Positives = 136/240 (57%), Gaps = 10/240 (4%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEG-  571
            L P   +RITG G     L  TGDRL  FA  L L F+FHP++    D     L++    
Sbjct  201  LHPPPMLRITGTGHDLSILHRTGDRLLKFAHSLGLRFQFHPLLLLNNDPASLALYLSSAI  260

Query  570  -----ESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
                 E++AVNC+L +H+ L D S R L+  L  I++ NP  V +AE+EA H+      R
Sbjct  261  TLLPDEALAVNCVLCLHRFLMDDS-RELLLLLHKIKALNPNVVTVAEREANHNHLLFLQR  319

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             + +L +Y+A+FDSL++TLP +S  R  +E++ F REI +I+A EG  R ERH  F  W 
Sbjct  320  FLEALDHYTALFDSLEATLPPNSKERLSVEQIWFGREIMDIVAAEGEGRRERHQRFETWE  379

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
             +L   G F  V ++   L Q+++LL++H   S   + Q  ++   L W++  L++VS+W
Sbjct  380  MMLKSSG-FSNVPLSPFALSQAKLLLRLH-YPSKGYQLQIVNNSFFLGWQNHSLFSVSSW  437



>ref|XP_008372571.1| PREDICTED: protein SCARECROW-like [Malus domestica]
Length=510

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 132/230 (57%), Gaps = 8/230 (3%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+R+TG+G S + LLETG +L+ FA +L L+FEFHP+V ++ +V   M+ V+ GE++AV+
Sbjct  281  HVRMTGMGTSSEILLETGKQLSSFARRLGLSFEFHPIVRKVGEVDASMVQVRRGETLAVH  340

Query  552  CMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAV  373
                +   LYD +G      +  I    P  + + EQ+  H  S L+ R V SL YYS +
Sbjct  341  W---LQHSLYDATGPDW-KAMRFIEELAPRIITLVEQDMSHSGSFLD-RFVGSLHYYSTM  395

Query  372  FDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRC  196
            FDSL+S LP D+P R K+E  +F REI NI+A  G  R      F +WR  L  + +F  
Sbjct  396  FDSLESYLPSDNPNRHKVEHCLFYREINNILAIGGPAR-SGEDKFRQWRSELGARSEFMQ  454

Query  195  VGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
            VG++   + Q+Q++L M          QG D  + L W+D  LY  SAWT
Sbjct  455  VGMSGNSMAQAQLILNMFPPTHGYSLVQG-DGTIRLGWKDTSLYVASAWT  503



>ref|XP_002977541.1| hypothetical protein SELMODRAFT_107274 [Selaginella moellendorffii]
 gb|EFJ21545.1| hypothetical protein SELMODRAFT_107274 [Selaginella moellendorffii]
Length=423

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 134/238 (56%), Gaps = 12/238 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P   +R+T +G S ++L E G +L   A  L + FE+  +   LE+    M+ +++
Sbjct  194  PGGPPV--VRMTAVGSSLRDLQEAGSKLLDCARSLGVPFEYCILRVELEEFHAGMVELRD  251

Query  573  GESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            GE+V VN + Q H+ L     R L  FL  +RS  P  VVMAE +A+H+      R +  
Sbjct  252  GEAVLVNSLCQFHRFL----KRDLDQFLQGLRSLRPRLVVMAENDADHNSPDFMHRFMAC  307

Query  393  LKYYSAVFDSLDSTL--PLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGKWRKL  223
            L YYSAVFD+ D++L  P   P R K+EE+  A+++RN+IACEG ER+ERH S   W   
Sbjct  308  LHYYSAVFDAFDASLHMPGTLPGRKKLEELIAAQKLRNMIACEGSERVERHESMRAWNA-  366

Query  222  LMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
             ME   FR V ++ + + Q+ +LLK++  + Y +  Q  +  L L W   PL  V AW
Sbjct  367  RMEGVGFRAVSMSHKAINQASLLLKLYYSDGYTLTNQ--EGFLILGWRGMPLNGVGAW  422



>emb|CBI17738.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 148/246 (60%), Gaps = 21/246 (9%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RITGI E K+ L     +L   AE+L++ F+F+P+V +LE++    L VK GE++A++
Sbjct  187  HLRITGIHEQKEVLDLMALQLTKEAEKLDIPFQFNPIVSKLENLDFESLRVKTGEALAIS  246

Query  552  CMLQMHKVLY--------------DTSG---RALVDFLGLIRSTNPIAVVMAEQEAEHDE  424
             +LQ+H +L               +TS    + +  FL  +   +P  +V+ EQE+ ++ 
Sbjct  247  SVLQLHTLLAIDDEMVGKSPSASKNTSAVHLQRMGSFLAALWGLSPKLMVVTEQESNNNC  306

Query  423  SSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHA  247
             +L  R++ +L +Y+A+FD L+STL   S  R K+E+M F  EI+NIIACEG ER ERH 
Sbjct  307  PTLMERVMEALNFYAALFDCLESTLSRASIERQKVEKMLFGEEIKNIIACEGPERKERHE  366

Query  246  SFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPL  67
               KW  + +E   F  V ++ + +LQ+  LL  +  + Y++++  E+  L + W+D+PL
Sbjct  367  KLEKW-VMRLELAGFGRVPLSYQGMLQASRLLVSYGYDGYRMKE--ENGCLVICWQDRPL  423

Query  66   YTVSAW  49
            ++VSAW
Sbjct  424  FSVSAW  429



>ref|XP_010921930.1| PREDICTED: scarecrow-like protein 3 [Elaeis guineensis]
Length=472

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 154/293 (53%), Gaps = 63/293 (22%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKE  574
            PG  P  H+RITG+ E K+ L  T   L   AE+L++ F+F+PVV RL+++ +  L VK 
Sbjct  181  PGGPP--HLRITGVHEHKELLGHTATCLNKEAERLDIPFQFNPVVSRLDNLDIESLRVKT  238

Query  573  GESVAVN------CML-----------------------QMHKV----LYDTSGRALVD-  496
            GE++A+N      C+L                       Q+H V    L +   R +++ 
Sbjct  239  GEALAINSVLQLHCLLATNDEGRSSRIMPMPAIQNPNTTQLHGVNQATLRELLEREVING  298

Query  495  -----------------------FLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKY  385
                                   FL ++   +P  +V+ EQE+ H+   +  R   +L +
Sbjct  299  YTPSPDSALSPPFALVPAPRMESFLAVLWGLSPKVMVITEQESNHNSPMMNERFTKALYF  358

Query  384  YSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKWRKLLMEQGK  205
            Y+A+FD L+ST+P +S  R ++E++   EI+NIIACEG ER ERH    +W + L E   
Sbjct  359  YAALFDCLESTMPRNSVERMRVEKLLGEEIKNIIACEGLERTERHEKLERWAQRL-ELAG  417

Query  204  FRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
            F  V ++ + LLQ+ MLL+  + ESYK+     D+G + + W+DQPL++VSAW
Sbjct  418  FSRVSLSYQGLLQAGMLLRNFNCESYKL--LNSDNGCIMMYWQDQPLFSVSAW  468



>gb|AAR31213.1| GAI protein [Oryza sativa]
Length=493

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 129/241 (54%), Gaps = 11/241 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGE----SKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +RITGIG      + EL + G RLA  A  + + F F  V  + L++VR WM
Sbjct  211  PGGPP--FLRITGIGPPSPTGRDELRDVGLRLADLARSVRVRFSFRGVAANSLDEVRPWM  268

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            L +  GE+VA N +LQ+H++L D + +A +D  L  + S  P    + EQEA+H+++   
Sbjct  269  LQIAPGEAVAFNSVLQLHRLLGDPADQAPIDAVLDCVASVRPKIFTVIEQEADHNKTGFL  328

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
             R   +L YYSAVFDSLD+            E    REI +I+  EG  R ERH    +W
Sbjct  329  DRFTEALFYYSAVFDSLDAASASGGAGNAMAEAYLQREICDIVCGEGAARRERHEPLSRW  388

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            R  L   G    V +    L Q++ML+ + S E + VE+   D  LTL W  +PL++ SA
Sbjct  389  RDRLTRAG-LSAVPLGSNALRQARMLVGLFSGEGHSVEEA--DGCLTLGWHGRPLFSASA  445

Query  51   W  49
            W
Sbjct  446  W  446



>ref|NP_001043705.1| Os01g0646300 [Oryza sativa Japonica Group]
 dbj|BAB40172.1| gibberellin response modulator-like [Oryza sativa Japonica Group]
 dbj|BAC05533.1| gibberellin response modulator-like [Oryza sativa Japonica Group]
 dbj|BAF05619.1| Os01g0646300 [Oryza sativa Japonica Group]
Length=493

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 129/241 (54%), Gaps = 11/241 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGE----SKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +RITGIG      + EL + G RLA  A  + + F F  V  + L++VR WM
Sbjct  211  PGGPP--FLRITGIGPPSPTGRDELRDVGLRLADLARSVRVRFSFRGVAANSLDEVRPWM  268

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            L +  GE+VA N +LQ+H++L D + +A +D  L  + S  P    + EQEA+H+++   
Sbjct  269  LQIAPGEAVAFNSVLQLHRLLGDPADQAPIDAVLDCVASVRPKIFTVIEQEADHNKTGFL  328

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
             R   +L YYSAVFDSLD+            E    REI +I+  EG  R ERH    +W
Sbjct  329  DRFTEALFYYSAVFDSLDAASASGGAGNAMAEAYLQREICDIVCGEGAARRERHEPLSRW  388

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            R  L   G    V +    L Q++ML+ + S E + VE+   D  LTL W  +PL++ SA
Sbjct  389  RDRLTRAG-LSAVPLGSNALRQARMLVGLFSGEGHSVEEA--DGCLTLGWHGRPLFSASA  445

Query  51   W  49
            W
Sbjct  446  W  446



>dbj|BAH01283.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71178.1| hypothetical protein OsI_03058 [Oryza sativa Indica Group]
 gb|EEE55078.1| hypothetical protein OsJ_02811 [Oryza sativa Japonica Group]
Length=495

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 129/241 (54%), Gaps = 11/241 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGE----SKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +RITGIG      + EL + G RLA  A  + + F F  V  + L++VR WM
Sbjct  213  PGGPP--FLRITGIGPPSPTGRDELRDVGLRLADLARSVRVRFSFRGVAANSLDEVRPWM  270

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            L +  GE+VA N +LQ+H++L D + +A +D  L  + S  P    + EQEA+H+++   
Sbjct  271  LQIAPGEAVAFNSVLQLHRLLGDPADQAPIDAVLDCVASVRPKIFTVIEQEADHNKTGFL  330

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
             R   +L YYSAVFDSLD+            E    REI +I+  EG  R ERH    +W
Sbjct  331  DRFTEALFYYSAVFDSLDAASASGGAGNAMAEAYLQREICDIVCGEGAARRERHEPLSRW  390

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            R  L   G    V +    L Q++ML+ + S E + VE+   D  LTL W  +PL++ SA
Sbjct  391  RDRLTRAG-LSAVPLGSNALRQARMLVGLFSGEGHSVEEA--DGCLTLGWHGRPLFSASA  447

Query  51   W  49
            W
Sbjct  448  W  448



>ref|XP_010254273.1| PREDICTED: DELLA protein GAI-like [Nelumbo nucifera]
Length=535

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 128/242 (53%), Gaps = 16/242 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +RITGIG    + +  L E G +LA  A  +N+ F F  V   RL+DV+ WM
Sbjct  284  PGGPP--FLRITGIGPPSPDGRDSLREIGLKLAELARSVNVRFAFRGVAASRLDDVKPWM  341

Query  588  LHVKEGESVAVNCMLQMHKVLYD--TSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VA+N ++Q+H++L    + G  +   LG +R  NP  V + EQEA H++   
Sbjct  342  LQVGPREAVAINSIMQLHRLLAPDPSRGSPIDSVLGWVRGLNPKIVTVVEQEANHNQPEF  401

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL+S      P +   E    REI NI+ CEG  R ERH    K
Sbjct  402  LDRFTEALYYYSTMFDSLESC--ALQPEKALAEMYIQREICNIVCCEGSAREERHEPLAK  459

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L   G FR + +      Q+ MLL + S E Y VE   E+ G LTL W  +PL   
Sbjct  460  WRARLDGAG-FRAMHLGSNAFKQASMLLTLFSAEGYSVE---ENQGCLTLGWHSRPLIVA  515

Query  57   SA  52
            SA
Sbjct  516  SA  517



>ref|XP_010229736.1| PREDICTED: DELLA protein GAI1-like [Brachypodium distachyon]
Length=421

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/248 (39%), Positives = 133/248 (54%), Gaps = 18/248 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGE----SKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   IRITG+G     S+ EL E G  L   A  LN+ F FH V  D LE ++ WM
Sbjct  147  PGGPPS--IRITGVGPTHTGSRDELREVGLMLTEHARVLNVPFSFHIVTGDNLEGLKPWM  204

Query  588  LHVKEGESVAVNCMLQMHKVLYD-----TSGRALVD-FLGLIRSTNPIAVVMAEQEAEHD  427
             H+ +GE++AVN + Q+H++L D     TS    +D  LG I S  P    + EQEA+H+
Sbjct  205  FHLVQGEAIAVNSICQLHRLLVDPDAASTSLPPPIDTVLGWITSMRPKVFTVVEQEADHN  264

Query  426  ESSLESRLVNSLKYYSAVFDSLD--STLPLDSPVRTKIEEMFAREIRNIIACEGRERLER  253
            + +L  R  N+L YY A+FDS++  +T           E    REI NI+  EG  R+ER
Sbjct  265  KPTLVERFTNALFYYGAMFDSMEAVATRSRTGAAERGAEVHLKREIFNIVCNEGSSRVER  324

Query  252  HASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQ  73
            H +  +WR  L   G    V +    L  + MLL   S + Y V ++G  DGL L+W + 
Sbjct  325  HETLPRWRARLRRAG-LAQVPLRPNNLRHASMLLHDLSGDGYHVMERG--DGLMLAWHNN  381

Query  72   PLYTVSAW  49
            PL++VS W
Sbjct  382  PLFSVSVW  389



>gb|AHA85560.1| lateral [Dimocarpus longan]
Length=453

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 146/254 (57%), Gaps = 12/254 (5%)
 Frame = -2

Query  786  PMA*PVPEFGXPGLIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV---D  616
            P+   + E     L P   +RITG G     L  TGDRL  FA+ L L F+FHP++   D
Sbjct  203  PLMQALAERSNNTLHPPPMLRITGTGHDLDILHRTGDRLFMFAQSLGLRFQFHPLLLLND  262

Query  615  RLEDVRLWM---LHVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAE  445
                V +++   L +   E++AVNC+L +H+++ + S R L  FL  I+S NP  V +AE
Sbjct  263  DPTSVAVYLSSALSLLPDEALAVNCVLYLHRLVKEDS-RDLRLFLHKIKSLNPAVVTIAE  321

Query  444  QEAEHDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGR  268
            +EA H+      R V +L +YSA+++SL++TLP +S  R  +E++ F REI +I+  EG 
Sbjct  322  REANHNHPVFMRRFVEALDHYSAIYESLEATLPPNSKERLAVEQIWFGREIMDIVGAEGE  381

Query  267  ERLERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLT  91
             R ERH     W  +L   G F  V ++   L Q+++LL++H   E Y++  Q  ++   
Sbjct  382  NRRERHERLESWEVMLRSSG-FANVPLSPFALSQAKLLLRLHYPSEGYQI--QILNNSFF  438

Query  90   LSWEDQPLYTVSAW  49
            L W+++ L++VS+W
Sbjct  439  LGWQNRALFSVSSW  452



>ref|XP_011044695.1| PREDICTED: scarecrow-like protein 18 isoform X1 [Populus euphratica]
Length=434

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/241 (37%), Positives = 138/241 (57%), Gaps = 12/241 (5%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEG-  571
            L P   +RITG G     L  TGDRL  FA+ L L F+FHP++    D     L++    
Sbjct  197  LYPPPRLRITGTGHDLNMLHRTGDRLLKFAQSLGLRFQFHPLLLLNNDPTSLALYLPSAI  256

Query  570  -----ESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
                 E++AVNC+  +H+ L D S R L+ FL  I++ NP  V +AE+EA H++     R
Sbjct  257  TLLPDEALAVNCVSYLHRFLKDDS-RELLLFLHKIKALNPKVVTVAEREANHNQPLFLQR  315

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             + +L +Y A+FDSL++TLP  +  R  +E++ F REI +I+A EG  R ERH  F  W 
Sbjct  316  FLEALDHYKALFDSLEATLPPKNRERLAVEQIWFGREIMDIVAAEGEGRRERHKKFETW-  374

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            +++M+   F  V ++   L Q+++LL++H   E Y++  Q   +   L W +  L+++S+
Sbjct  375  EMMMKSVGFNKVPLSPFALSQAKLLLRLHYPSEGYQL--QILKNAFFLGWRNHSLFSISS  432

Query  51   W  49
            W
Sbjct  433  W  433



>ref|XP_002278039.1| PREDICTED: scarecrow-like protein 3 [Vitis vinifera]
Length=417

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 138/245 (56%), Gaps = 20/245 (8%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H++IT I  +K  L + G RL   AE L + F+F+P+   L D+ + ML V+ GE++A+ 
Sbjct  173  HLKITCISSNKLALEKLGIRLVKEAEALAMPFQFNPLNVTLRDLTIDMLRVRSGEALAIT  232

Query  552  CMLQMHKVLYD----------------TSGRALVDFLGLIRSTNPIAVVMAEQEAEHDES  421
             +L +H +L +                   + +  FL  +RS +P  +++ EQE++H+ +
Sbjct  233  SVLNLHTLLAEDDRVDAHFGLNKGNIVKECKQMSRFLATVRSMSPKILLLVEQESDHNLN  292

Query  420  SLESRLVNSLKYYSAVFDSLDSTL-PLDSPVRTKIEEMFAREIRNIIACEGRERLERHAS  244
             L  R V  L YYSA+FDS+++TL    S  R  +EEM+ REI NI+ACEG ER+ERH S
Sbjct  293  RLTDRFVQGLYYYSAIFDSMNATLGSSSSEERLAVEEMYGREIENIVACEGLERVERHES  352

Query  243  FGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLY  64
            +G+W  + + +G F+ V +    +   + L+     + YKV  + E   L + W  +PLY
Sbjct  353  YGRW-MVRLGRGGFKPVRLWYESMEGVKDLVGGDGEDGYKV--RNERASLMICWSQRPLY  409

Query  63   TVSAW  49
             +SAW
Sbjct  410  AISAW  414



>ref|XP_002960248.1| GRAS-family protein [Selaginella moellendorffii]
 gb|ABX10758.1| putative DELLA protein [Selaginella moellendorffii]
 gb|EFJ37787.1| GRAS-family protein [Selaginella moellendorffii]
Length=646

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 136/258 (53%), Gaps = 28/258 (11%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQE----LLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P   +R+TGIG  +      L E G +LA  A+ +N+ F FH VV  RL DV+ WM
Sbjct  391  PGGPPT--LRLTGIGPPQPHRHDLLHEIGLKLAQLADSVNVDFAFHGVVAARLNDVQPWM  448

Query  588  LHVKEGESVAVNCMLQMHKVLYDTS-----------------GRALVDFLGLIRSTNPIA  460
            L V+ GE+VAVN + QMHK L +                      + + L L+R+  P  
Sbjct  449  LTVRRGEAVAVNSVFQMHKALVEEPSDGGNPAAGGNGGGGRRSSPIDEVLRLVRNLKPKI  508

Query  459  VVMAEQEAEHDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNII  283
            V + EQ+A+H+      R + +L YYS +FDSL++       V   + E +  +EI NI+
Sbjct  509  VTLVEQDADHNSPVFMERFMAALHYYSTMFDSLEACNLAPGSVEQMVAETYLGQEIGNIV  568

Query  282  ACEGRERLERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGED  103
            ACEG  R ERH +  +WR + M +  F+ + +      Q+ MLL + S + Y+VE++  D
Sbjct  569  ACEGAARTERHETLTQWR-IRMARSGFQPLYLGSNAFKQANMLLTLFSGDGYRVEEK--D  625

Query  102  DGLTLSWEDQPLYTVSAW  49
              LTL W  +PL   SAW
Sbjct  626  GCLTLGWHSRPLVAASAW  643



>ref|XP_008798776.1| PREDICTED: scarecrow-like protein 18 [Phoenix dactylifera]
Length=418

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 140/245 (57%), Gaps = 17/245 (7%)
 Frame = -2

Query  744  IPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWML------H  583
            +P S IRITG G     L  TGDRL  FA  L L F+FHP++          L       
Sbjct  177  VPPS-IRITGTGTDLDVLRRTGDRLQTFARSLGLQFQFHPLLLPPSSTIGTSLCSGNSTS  235

Query  582  VKEGESVAVNCMLQMHKVLYDT-----SGRALVDFLGLIRSTNPIAVVMAEQEAEHDESS  418
            +  GE++AVNC+L +HK+L D+       R L  FL  +++ NP  V +AE+EA H+   
Sbjct  236  ILPGETLAVNCVLFLHKLLKDSRHEDDGSRELRAFLQAVKAMNPAVVTVAEREASHNSPI  295

Query  417  LESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASF  241
               R + +L YY+ VF+SL++TLP  S  R  +E+++  REI +I+A EG  R ERH  F
Sbjct  296  FLQRFMEALDYYTVVFESLEATLPPKSQERLAVEQVWLGREIEDIVAWEGEGRRERHERF  355

Query  240  GKWRKLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLY  64
             +W  L+ + G F  + ++   L Q+++LL++H   E Y++  Q   D + L W+++ L+
Sbjct  356  ARWEGLMRDAG-FSNLPLSPFALSQAKLLLRLHYPSEGYQL--QMVRDCIFLGWQNKALF  412

Query  63   TVSAW  49
            +VS+W
Sbjct  413  SVSSW  417



>ref|XP_006829673.2| PREDICTED: LOW QUALITY PROTEIN: DELLA protein RHT-1 [Amborella 
trichopoda]
Length=504

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 132/242 (55%), Gaps = 15/242 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  + E G RLA  A  +N+ F F  V   RLED++ WM
Sbjct  257  PGGPP--FLRLTGIGPPSPDGRDTIREVGIRLAELARSVNVRFAFRGVATQRLEDLKPWM  314

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRA--LVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            +HV+  E+VAVN +  +H++LY T  +   +   L  +R   P  + + EQEA H+    
Sbjct  315  IHVRSTETVAVNSVFVLHRLLYTTPDQTQPIKPVLNWVRELGPKILTVVEQEASHNGLGF  374

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYSA+FDS++ +   +   +   E    REI+NI+ CEG ER+ERH    +
Sbjct  375  VDRFTEALHYYSAMFDSMEGS---NRNNQAFAELYLEREIKNIVCCEGSERVERHEPLTR  431

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVS  55
            WR    + G F  V +      Q+ MLL + S + + VE++  D  LTL W ++PL + S
Sbjct  432  WRGRFXQAG-FEPVRLGSNAFRQASMLLSLFSEDGFGVEER--DGCLTLGWHERPLISAS  488

Query  54   AW  49
            AW
Sbjct  489  AW  490



>ref|XP_007200779.1| hypothetical protein PRUPE_ppa023981mg, partial [Prunus persica]
 gb|EMJ01978.1| hypothetical protein PRUPE_ppa023981mg, partial [Prunus persica]
Length=509

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 130/229 (57%), Gaps = 8/229 (3%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +R+TG+G S + L+ETG +L+ FA++L L+FEFHP+V ++ D+   M+ V+ GE++AV+ 
Sbjct  282  VRMTGVGTSSENLMETGKQLSNFAKRLGLSFEFHPIVRKIGDIDASMVQVRRGETLAVHW  341

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
               +   LYD +G      + LI    P  V + EQ+     S L+ R V SL YYS +F
Sbjct  342  ---LQHSLYDATGPDW-KTMRLIEELAPRIVTLVEQDMSQSGSFLD-RFVGSLHYYSTMF  396

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSL+S LP D+P R  +E  +F REI NI+A  G  R      F +WR  L  +  F  V
Sbjct  397  DSLESYLPSDNPSRHNVEHCLFYREINNILAIGGPAR-SGEDKFRQWRSELGGRNGFMQV  455

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
            G++   + Q+Q++L M          QG D  + L W+D  LY  SAWT
Sbjct  456  GMSANSMAQAQLILNMFPPTHGYSLVQG-DGTIRLGWKDTSLYVASAWT  503



>ref|XP_009411905.1| PREDICTED: protein MONOCULM 1-like [Musa acuminata subsp. malaccensis]
Length=489

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 139/243 (57%), Gaps = 19/243 (8%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVV----------DRLEDVRLWMLHV  580
            IR+TG G + + L  TGDRL  FA+ LNL F+FHP++              D+      +
Sbjct  249  IRVTGTGSNLEVLRRTGDRLQTFADSLNLHFQFHPLLLPSTSSNPLSSTSADLTSSSFQI  308

Query  579  KEGESVAVNCMLQMHKVLYDTSG----RALVDFLGLIRSTNPIAVVMAEQEAEHDESSLE  412
              GE +AVNC+L +HK+L D  G      L  FL  +R+ NP  V +AE+EA H+     
Sbjct  309  HPGEILAVNCVLFLHKLLKDGGGSDGSHDLRAFLQAVRAMNPAVVTVAEREASHNSPIFL  368

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGK  235
             R   +L YY+AVF+SL++TLP  S  R  +E+++ ++EI ++++ EG  R ERH  F +
Sbjct  369  QRFTEALDYYTAVFESLEATLPPTSRERVAVEQVWLSKEIEDVVSREGDGRRERHERF-E  427

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTV  58
            W + LM +  F  + ++   L Q+++LL++H   E Y++  Q   D   L W+ + L++V
Sbjct  428  WWEALMRRAGFTNLPLSPFALSQARLLLRLHYPSEGYQL--QMVRDSFFLGWQKKSLFSV  485

Query  57   SAW  49
            S+W
Sbjct  486  SSW  488



>ref|XP_006644434.1| PREDICTED: DELLA protein SLN1-like [Oryza brachyantha]
Length=503

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 128/241 (53%), Gaps = 11/241 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGESKQ----ELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +RITGIG        EL + G RLA  A  + + F F  V  + L++VR WM
Sbjct  214  PGGPP--FLRITGIGPPSPTGHDELRDVGLRLADLARSVRVRFSFRGVAANSLDEVRPWM  271

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            L +  GE+VA N +LQ+H++L D + +A +D  L  + S  P    + EQEA+H+++   
Sbjct  272  LQIAPGEAVAFNSVLQLHRLLGDPADQAPIDAVLDCVASVRPKIFTVIEQEADHNKTGFL  331

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
             R   +L YYSAVFDSLD+            E    REI +I+  EG  R ERH    +W
Sbjct  332  DRFTEALFYYSAVFDSLDAASASGGAGNAMAEAYLQREICDIVCGEGAARRERHEPLSRW  391

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            R  L   G    V +    L Q++ML+ + S E + VE+   D  LTL W  +PL++ SA
Sbjct  392  RDRLTRAG-LSAVPLGSNALRQARMLVGLFSGEGHGVEEA--DGCLTLGWHGRPLFSASA  448

Query  51   W  49
            W
Sbjct  449  W  449



>ref|XP_012088061.1| PREDICTED: scarecrow-like protein 3 [Jatropha curcas]
Length=413

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 139/246 (57%), Gaps = 21/246 (9%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H++IT +   K  L + G RL   A  L++ F+F+P+   L DV + M+ V+ GE++A  
Sbjct  171  HLKITCLNRDKAILEKLGQRLVKEAAMLDIPFQFNPLSVSLRDVTIDMIKVRSGEALAFI  230

Query  552  CMLQMHKVLYD----------------TSGRALVDFLGLIRSTNPIAVVMAEQEAEHDES  421
             +L +H +L +                 + +++ +FL +I ST+P  + + EQEA ++ +
Sbjct  231  SILNLHILLTEDDRVDAHFGGNKFNKIKNCKSMSNFLTMILSTSPKLLFLVEQEANNNLN  290

Query  420  SLESRLVNSLKYYSAVFDSLDSTL-PLDSPVRTKIEEMFAREIRNIIACEGRERLERHAS  244
             L  R V  L YYSA+FDS+DS L  L +  R  +EEMF REI NI+ACEG ER ERH  
Sbjct  291  RLVDRFVEGLHYYSAIFDSIDSALGNLSNEERLVLEEMFGREIENIVACEGLERCERHER  350

Query  243  FGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLY  64
            +GKW  + + +G F+ V +      +++ ++     + YK+    E   L + W+D+PLY
Sbjct  351  YGKW-MVRLTRGGFKPVRLWYNFDEEAKQIINSFG-KGYKI--ISEKSSLMICWQDRPLY  406

Query  63   TVSAWT  46
             VSAWT
Sbjct  407  AVSAWT  412



>emb|CDM83536.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 131/241 (54%), Gaps = 12/241 (5%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGE----SKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +RITGIG      + EL + G RLA  A  + + F F  V  + L++V  WM
Sbjct  214  PGGPP--FLRITGIGPPSPPGRDELRDVGLRLADLARSVRVRFSFRGVAANSLDEVHPWM  271

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRALVD-FLGLIRSTNPIAVVMAEQEAEHDESSLE  412
            L +  GE+VAVN +LQ+H++L DT+ +A +D  L  + S  P    + EQEA+H++    
Sbjct  272  LQIAPGEAVAVNSVLQLHRLLADTADQAPIDAVLDCVASLQPKIFTVVEQEADHNKPGFL  331

Query  411  SRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGKW  232
             R   +L YYSAVFDSLD+    +       E    REI +I+  EG  R+ERH    +W
Sbjct  332  DRFTEALFYYSAVFDSLDAA-SANGTGNAMAEAYLQREICDIVCNEGTARMERHEPLSQW  390

Query  231  RKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSA  52
            R  L   G    V +    L Q++MLL + S E + VE+   +  LTL W  +PL++ SA
Sbjct  391  RDRLGRAG-LSAVPLGASALRQARMLLGLFSGEGHSVEEA--EGCLTLGWHGRPLFSASA  447

Query  51   W  49
            W
Sbjct  448  W  448



>ref|XP_009369454.1| PREDICTED: protein SCARECROW-like [Pyrus x bretschneideri]
Length=508

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 132/230 (57%), Gaps = 8/230 (3%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+R+TG+G S + LLETG +L+ FA++L L+FEF P+V  + +V   M+ V++GE++AV+
Sbjct  280  HLRMTGVGTSSEILLETGKQLSNFAKRLGLSFEFFPIVRTVGEVDASMVQVEQGETLAVH  339

Query  552  CMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAV  373
                +   LYD +G      L LI    P  V + EQ+  H  S L+ R V SL YYS +
Sbjct  340  W---LQHSLYDATGSDW-KTLRLIEELAPRIVTLVEQDMSHSGSFLD-RFVGSLHYYSTM  394

Query  372  FDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRC  196
            FDSL+S LP D+P R K+E  MF REI NI+A  G  R      F +WR  L  + +F  
Sbjct  395  FDSLESYLPSDNPSRHKVEHGMFYREINNILAIGGPAR-SGEDKFRQWRSELGARSEFMQ  453

Query  195  VGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
            V ++   + Q+Q++L M          QG D  + L W+D  LY  SAWT
Sbjct  454  VEMSGNSMAQAQLILNMFPPTHGYSLVQG-DGTIGLGWKDTSLYVASAWT  502



>ref|XP_004252879.1| PREDICTED: scarecrow-like protein 3 [Solanum lycopersicum]
Length=468

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 152/284 (54%), Gaps = 60/284 (21%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVN  553
            H+RITG+ + K+ L +    L   AE+L++ F+F+ VV RLE++ +  L VK GE++A++
Sbjct  185  HLRITGVHQQKEVLDQMAHVLTQEAEKLDIPFQFNQVVSRLENLDVEKLRVKTGEALAIS  244

Query  552  CMLQMHKVL-YDTS---------------GRALVD-------------------------  496
             ++Q+H +L +D                  RALV+                         
Sbjct  245  SIMQLHTLLAHDNDKKSPLPFKHSNGVNLNRALVNQNTLGEFLEKDMANGCSPSNDTASS  304

Query  495  -------------FLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVFDSLDS  355
                         FL  +   +P  +V+ EQ+A H+ ++L  RL  SL +Y+A+FD L+S
Sbjct  305  SPLCSTGSTKMDSFLNALWGLSPKVMVVTEQDANHNGTTLMERLSESLHFYAALFDCLES  364

Query  354  TLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCVGITER  178
            TLP  S  R K+E+M    EIRNIIACEG ER ERH    KW +     G F  V ++  
Sbjct  365  TLPRTSLERLKVEKMLLGEEIRNIIACEGIERKERHEKLEKWFQRFDTSG-FGNVPLSYY  423

Query  177  ELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTVSAW  49
             +LQ++ LL+ +S E YK++   ED+G + + W+D+PL++VS+W
Sbjct  424  AMLQARRLLQSYSCEGYKIK---EDNGCVVICWQDRPLFSVSSW  464



>ref|XP_008235644.1| PREDICTED: protein SCARECROW-like [Prunus mume]
Length=509

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 130/229 (57%), Gaps = 8/229 (3%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEGESVAVNC  550
            +R+TG+G S + L+ETG +L+ FA++L L+FEFHP+V ++ D+   M+ V+ GE++AV+ 
Sbjct  282  VRMTGVGTSSENLMETGKQLSNFAKRLGLSFEFHPIVRKIGDIDASMVQVRRGETLAVHW  341

Query  549  MLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSAVF  370
               +   LYD +G      + LI    P  V + EQ+  H  S L+ R V SL YYS +F
Sbjct  342  ---LQHSLYDATGPDW-KTMRLIEELAPRIVTLVEQDLSHSGSFLD-RFVGSLHYYSTMF  396

Query  369  DSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFRCV  193
            DSL+S L  D+P R  +E  +F REI NI+A  G  R      F +WR  L  +  F  V
Sbjct  397  DSLESYLSSDNPSRHNVEHCLFYREINNILAIGGPAR-SGEDKFRQWRSELGGRNGFMQV  455

Query  192  GITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
            G++   + Q+Q++L M          QG D  + L W+D  LY  SAWT
Sbjct  456  GMSANSMAQAQLILNMFPPTHGYSLVQG-DGTIRLGWKDTSLYVASAWT  503



>ref|XP_011007026.1| PREDICTED: scarecrow-like protein 18 [Populus euphratica]
Length=439

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 135/240 (56%), Gaps = 10/240 (4%)
 Frame = -2

Query  747  LIPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEG-  571
            L P   +RITG G     L  T DRL  FA  L L F+FHP++    D     L++    
Sbjct  202  LHPPPMLRITGTGHDLSILHRTEDRLLKFAHSLGLRFQFHPLLLLNNDPASLALYLPSAI  261

Query  570  -----ESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESR  406
                 E++AVNC+L +H+ L D S R L+  L  I++ NP  V +AE+EA H+      R
Sbjct  262  TLLPDEALAVNCVLCLHRFLMDDS-RELLLLLHKIKALNPNVVTVAEREANHNHLLFLQR  320

Query  405  LVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWR  229
             + +L +Y+A+FDSL++TLP +S  R  +E++ F REI +I+A EG  R ERH  F  W 
Sbjct  321  FLEALDHYTALFDSLEATLPPNSKERLAVEQIWFGREIMDIVAAEGERRRERHLRFETWE  380

Query  228  KLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
             +L   G F  V ++   L Q+++LL++H   S   + Q  ++   L W++  L++VS+W
Sbjct  381  MMLKSSG-FSNVPLSPFALSQAKLLLRLH-YPSKGYQLQIVNNSFFLGWQNHSLFSVSSW  438



>ref|XP_001785259.1| PAL1B encoding AtPAT1-like protein [Physcomitrella patens]
 gb|EDQ49911.1| PAL1B encoding AtPAT1-like protein [Physcomitrella patens]
Length=355

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/244 (37%), Positives = 139/244 (57%), Gaps = 15/244 (6%)
 Frame = -2

Query  753  PGLIPRSHIRITGI-----GESKQELLE-TGDRLAGFAEQLNLAFEFHPVVDRLEDVRLW  592
            PG  P  H+RITGI     G +    +E  G RLA  AE + + F FHPV  +  ++  W
Sbjct  117  PGGPP--HVRITGIDDPMPGPTPNVGVEMVGKRLANLAEAVGVPFVFHPVAKKGTEIEAW  174

Query  591  MLHVKEGESVAVNCMLQMHKVLYDT--SGRALVDFLGLIRSTNPIAVVMAEQEAEHDESS  418
            ML  ++GE++AVN  LQ+H +  ++  +       L +I+  NP  + + EQE+  + + 
Sbjct  175  MLERQQGEALAVNFALQLHHMPDESVCTSNPRDRMLHMIKGLNPKVMTLVEQESNTNTAP  234

Query  417  LESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASF  241
               R + +L YYSA+F+SLD TL  +S  R  +E+   AR+I NIIACEG +R+ERH   
Sbjct  235  FFPRFLEALSYYSAIFESLDITLARESKERVNVEQQCLARDIVNIIACEGIDRVERHEMM  294

Query  240  GKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYT  61
            GKWR  L   G FR   +++      + LL+ +S + Y+++++G    L L W+++PL  
Sbjct  295  GKWRARLTMAG-FRPYPLSQTVNNTIKTLLESYS-DKYRLKEEG--GALFLGWKNRPLIV  350

Query  60   VSAW  49
             SAW
Sbjct  351  SSAW  354



>gb|ABU63412.1| DELLA protein [Selaginella kraussiana]
Length=582

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 134/250 (54%), Gaps = 20/250 (8%)
 Frame = -2

Query  753  PGLIPRSHIRITGIGE----SKQELLETGDRLAGFAEQLNLAFEFHPVVD-RLEDVRLWM  589
            PG  P+  +R+TGIG      K  L E G +LA  AE +N+ F FH VV  RLEDVR WM
Sbjct  335  PGGPPQ--LRLTGIGPPQPGGKDLLQEIGLKLAQMAESVNVEFTFHGVVAARLEDVRPWM  392

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGRA---------LVDFLGLIRSTNPIAVVMAEQEA  436
            L  + GE+VAVN + Q+H  L D  G A         + + L  +R  NP  V + EQ+A
Sbjct  393  LTCRSGEAVAVNSVFQLHATLLDGEGAAGSSPVAPSPVTEVLRWVRGLNPRIVTVVEQDA  452

Query  435  EHDESSLESRLVNSLKYYSAVFDSLDS-TLPLDSPVRTKIEEMFAREIRNIIACEGRERL  259
            +H+      R + +L YYS +FDSL++  L   S  +   E    RE+ +I+A +G ER 
Sbjct  453  DHNGVDFLDRFMAALHYYSTMFDSLEACNLAAGSLEQVVAEAYLGREVVDIVAADGPERR  512

Query  258  ERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWE  79
            ERH +  +WR  ++  G F+ + +      Q+ MLL + S + Y+V + G    LTL W 
Sbjct  513  ERHETLEQWRSRMISAG-FQPLFLGSNAFRQASMLLTLFSGDGYRVVENG--GCLTLGWH  569

Query  78   DQPLYTVSAW  49
             + L   SAW
Sbjct  570  SRSLIAASAW  579



>ref|XP_010925126.1| PREDICTED: DELLA protein DWARF8-like [Elaeis guineensis]
Length=583

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 126/236 (53%), Gaps = 12/236 (5%)
 Frame = -2

Query  729  IRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWMLHVKEGES  565
            +R+TGIG    + +  L E G RLA  A  + + F F  V   R++DVR WML V  GE+
Sbjct  282  LRLTGIGPPSPDGRDALREVGLRLAELALSVRVRFAFRGVAASRIDDVRPWMLQVVPGEA  341

Query  564  VAVNCMLQMHKVLYDTSGRALVDF---LGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
            VAVN +LQ+H++L D    A       LG I    P  V + EQEA+H+  S   R   +
Sbjct  342  VAVNSVLQLHRLLGDPGDDAAAPIDSVLGWIVRIQPKIVTVVEQEADHNRPSFLDRFTEA  401

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIEEMF-AREIRNIIACEGRERLERHASFGKWRKLLM  217
            L YYS +FDSL++        +  + E++  RE+ NI+ CEG  R+ERH    +WR  L 
Sbjct  402  LFYYSTMFDSLEAGGGATQKQQQAVAEVYLQREVCNIVCCEGAARVERHEPLVRWRARLG  461

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
              G  R V +      Q+ MLL + S E Y VE+   D  LTL W  +PL + SAW
Sbjct  462  RAG-LRAVHLGSNAFKQASMLLTLFSGEGYCVEEV--DGCLTLGWHSRPLISASAW  514



>ref|XP_010502027.1| PREDICTED: scarecrow-like protein 18, partial [Camelina sativa]
Length=372

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 137/236 (58%), Gaps = 13/236 (6%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDV-------RLWMLHVKEG  571
            +RITG G     L  TGDRL  FA  L L F+FH +V   ED+       RL  L   +G
Sbjct  140  LRITGCGRDLTGLNRTGDRLTRFANSLGLQFQFHTLVIVEEDIAGLLLQIRLLALSFVQG  199

Query  570  ESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSL  391
            E++AVNC+  +HK   D  G  +  FL +I+S NP  V MAE+EA H + S  +R   ++
Sbjct  200  ETIAVNCVHFLHKFFND-DGDMIGHFLSVIKSLNPRIVTMAEREANHGDHSFLNRFSEAV  258

Query  390  KYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLME  214
             +Y A+FDSL++TLP +S  R  +E+  F +EI +++A E RER +RH  F  W +++  
Sbjct  259  DHYVAIFDSLEATLPPNSRERLTLEQRWFGKEIFDVVAAEARERKQRHRRFEIWEEMMKR  318

Query  213  QGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
             G F  V I    L Q+++LL++H   E Y +  Q  ++ L L W+ + L++VS+W
Sbjct  319  FG-FVNVPIGSFALSQAKLLLRLHYPSEGYNL--QFLNNSLFLGWQSRLLFSVSSW  371



>gb|EPS64600.1| lateral suppressor protein, partial [Genlisea aurea]
Length=392

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/240 (37%), Positives = 134/240 (56%), Gaps = 13/240 (5%)
 Frame = -2

Query  744  IPRSHIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLEDVRLWMLHVKEG--  571
             P   +RITG G     L  TGDRLA FA  L L F+F+P++ R ++    ++       
Sbjct  158  FPPPSLRITGTGSDLDILRRTGDRLAKFAHSLGLRFQFNPLIIRDDEQNPQIIFSSPAII  217

Query  570  ----ESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRL  403
                E++AVN    +H+ L D    AL  FL  I+S  P  + +AE+EA H+      R 
Sbjct  218  LSPEETLAVNFNHYLHRHLRDRD--ALRLFLRRIKSLGPAIISLAEREANHNHPIFHHRF  275

Query  402  VNSLKYYSAVFDSLDSTLPLDSPVRTKIEEM-FAREIRNIIACEGRERLERHASFGKWRK  226
            V +L +Y  VFDSL++TLP +S  R  +E++ F +EI +I+A EG  R ERH  F  W  
Sbjct  276  VEALNHYGVVFDSLEATLPPNSHDRYAVEQIWFGKEIADIVAAEGEVRRERHERFRSW-D  334

Query  225  LLMEQGKFRCVGITERELLQSQMLLKMH-SMESYKVEKQGEDDGLTLSWEDQPLYTVSAW  49
            L+M    F  V ++   + Q+++LL++H   E Y++     +D L L W++QPL++VS+W
Sbjct  335  LMMRSCGFNNVALSPFAVSQAKLLLRLHYPSEGYQLHV--FNDSLFLGWQNQPLFSVSSW  392



>ref|XP_010929728.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAIP-like [Elaeis 
guineensis]
Length=681

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 120/194 (62%), Gaps = 10/194 (5%)
 Frame = -2

Query  624  VVDRLEDVRLWMLHVKEGESVAVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAE  445
            + DRLED+R  MLH + GE++AVN +  +H+V     G  L   L +IR   P  V + E
Sbjct  494  LADRLEDLRPSMLHRRVGEALAVNAVCHLHRV----PGAHLGQLLSMIRDQAPKIVTLVE  549

Query  444  QEAEHDESSLESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGR  268
            +EA H+      R + +L YYSA+FDSLD+T P DS  R K+E+ +FA EI+NI+A EG 
Sbjct  550  KEASHNGPYFLGRFLEALHYYSALFDSLDATFPADSAARAKVEQYIFAPEIKNIVASEGA  609

Query  267  ERLERHASFGKWRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LT  91
            ER+ RH    +WRK +ME   F+ V ++   + QS++LL +++ + Y++    ED+G + 
Sbjct  610  ERVARHERLERWRK-VMEGRGFKGVALSANSVNQSRILLGLYACDGYRLT---EDNGFMF  665

Query  90   LSWEDQPLYTVSAW  49
            L W+D+ +   SAW
Sbjct  666  LGWQDRAIIAASAW  679



>ref|XP_008242703.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein DWARF8-like [Prunus 
mume]
Length=537

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 139/259 (54%), Gaps = 17/259 (7%)
 Frame = -2

Query  753  PGLIPRSHIRITGIG----ESKQELLETGDRLAGFAEQLNLAFEFHPVV-DRLEDVRLWM  589
            PG  P   +R+TGIG    + +  L E G RLA  A  +N+ F F  V   RLEDV+ WM
Sbjct  276  PGGPPL--LRLTGIGPPSPDGRDSLREIGLRLAELARSVNVRFAFRGVAASRLEDVKPWM  333

Query  588  LHVKEGESVAVNCMLQMHKVLYDTSGR--ALVDFLGLIRSTNPIAVVMAEQEAEHDESSL  415
            L V   E+VAVN ++Q+H++L     R   +   LG IR+ NP  V + EQEA+H+++  
Sbjct  334  LQVSPKEAVAVNSIMQLHRLLGSDPNRNSPIEMMLGWIRNLNPKIVTVVEQEADHNKTGF  393

Query  414  ESRLVNSLKYYSAVFDSLDSTLPLDSPVRTKIEEMFAREIRNIIACEGRERLERHASFGK  235
              R   +L YYS +FDSL++      P +   E    R I   + CE     ++H   GK
Sbjct  394  LDRFTEALYYYSTMFDSLEAC--AMQPEKALAEMYIQRXICVGLCCESAAGEQKHKPLGK  451

Query  234  WRKLLMEQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDG-LTLSWEDQPLYTV  58
            WR  L + G FR + +      Q+ MLL + S E Y+VE   E+DG LTL W  +PL   
Sbjct  452  WRARLGQAG-FRPLHLGSNAFKQASMLLTLFSAEGYRVE---ENDGCLTLGWHSRPLIAA  507

Query  57   SAWTPFDIAGSSSSYSQPT  1
            SAW    +A ++++ +QP 
Sbjct  508  SAWQVMPMAEATTA-NQPV  525



>ref|XP_004292218.1| PREDICTED: protein SCARECROW-like [Fragaria vesca subsp. vesca]
Length=503

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/231 (39%), Positives = 126/231 (55%), Gaps = 8/231 (3%)
 Frame = -2

Query  732  HIRITGIGESKQELLETGDRLAGFAEQLNLAFEFHPVVDRLED-VRLWMLHVKEGESVAV  556
            H+R+TGIG S + LLETG +L+ FA +L L+FEFHP+     D +   M+ V+ GE+VAV
Sbjct  272  HVRMTGIGTSSEVLLETGKQLSNFARRLGLSFEFHPITRNFGDHLDTSMVQVRRGETVAV  331

Query  555  NCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNSLKYYSA  376
            + +      LYD +G      + LI   +P  V + EQ+  H+  S   R V SL YYS 
Sbjct  332  HWL---QHSLYDATGPDWRT-MKLIEELSPRIVTLVEQDMSHNGGSFLDRFVGSLHYYST  387

Query  375  VFDSLDSTLPLDSPVRTKIEE-MFAREIRNIIACEGRERLERHASFGKWRKLLMEQGKFR  199
            +FDSL++ LP D+P R  +E  +  REI NI+A  G  R      F  WR  L     F 
Sbjct  388  MFDSLEAYLPSDNPNRHLVEHCLMYREINNILAIGGPAR-SGEDKFRHWRSELGASNSFM  446

Query  198  CVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
             VG++   + Q+Q++L M    +     QG D  + L W+D  LY  SAWT
Sbjct  447  QVGMSGNSMAQAQLILNMFPPSNGYSLVQG-DGTIRLGWKDTSLYVASAWT  496



>ref|XP_002983047.1| hypothetical protein SELMODRAFT_117648 [Selaginella moellendorffii]
 gb|EFJ15856.1| hypothetical protein SELMODRAFT_117648 [Selaginella moellendorffii]
Length=348

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 136/237 (57%), Gaps = 17/237 (7%)
 Frame = -2

Query  729  IRITGIGESKQELLETGDRLAGFAEQLNL-AFEFHPVVDRLE-----DVRLWMLHVKEGE  568
            +RITG+G S  EL  TG RL  FA  +     ++HPV  RL+     D   + L   + +
Sbjct  119  LRITGVGSSFAELQSTGRRLTEFATSIGYHKLDYHPV--RLDSPDQLDPSAFSLGDDDDQ  176

Query  567  SV--AVNCMLQMHKVLYDTSGRALVDFLGLIRSTNPIAVVMAEQEAEHDESSLESRLVNS  394
             V  AVNC + +H++L +    AL   L +IR+ NP  V ++E EA H+  S   R V +
Sbjct  177  DVGLAVNCSMFLHRLLGNHP--ALERTLCMIRAWNPRIVTVSEMEANHNTPSFVDRFVEA  234

Query  393  LKYYSAVFDSLDSTLPLDSPVRTKIE-EMFAREIRNIIACEGRERLERHASFGKWRKLLM  217
            L +YSAVFD L+S L    P R  IE  MFA EIR+I+ACEG +R+ RHA    WR  + 
Sbjct  235  LHFYSAVFDCLESALARTDPDRIYIEGAMFAGEIRSILACEGADRIVRHARSESWRDFMR  294

Query  216  EQGKFRCVGITERELLQSQMLLKMHSMESYKVEKQGEDDGLTLSWEDQPLYTVSAWT  46
              G F+ VG+++  L Q+ + L ++S ++Y++ +  E+  L L W D P+ ++S W+
Sbjct  295  WSG-FKDVGLSDHSLYQAHVFLTLYS-QAYRLTR--EEQALILGWHDTPVVSISTWS  347



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1600433394064