BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1278

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      491   2e-169   Nicotiana sylvestris
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      485   4e-167   Nicotiana tomentosiformis
emb|CDP07287.1|  unnamed protein product                                478   2e-164   Coffea canephora [robusta coffee]
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 478   2e-164   Nicotiana tomentosiformis
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 476   1e-163   Nicotiana sylvestris
gb|KJB14249.1|  hypothetical protein B456_002G115900                    469   4e-163   Gossypium raimondii
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               475   5e-163   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ACJ11733.1|  catalase                                                472   5e-162   Gossypium hirsutum [American cotton]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      471   8e-162   Prunus mume [ume]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    471   2e-161   Gossypium raimondii
gb|KHG25152.1|  Catalase isozyme 1                                      471   2e-161   Gossypium arboreum [tree cotton]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      470   3e-161   Solanum lycopersicum
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 469   7e-161   Solanum tuberosum [potatoes]
emb|CAD42908.1|  catalase                                               469   7e-161   Prunus persica
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 469   8e-161   Populus euphratica
gb|AJE26131.1|  catalase                                                469   9e-161   Salix matsudana [tortured willow]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               468   2e-160   Gossypium hirsutum [American cotton]
gb|AET97564.1|  catalase                                                468   2e-160   Ziziphus jujuba [Chinese jujube]
ref|XP_002301920.1|  catalase family protein                            468   2e-160   Populus trichocarpa [western balsam poplar]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           468   2e-160   
gb|AAM97542.1|  catalase 3                                              468   3e-160   Capsicum annuum
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             468   3e-160   Prunus persica
emb|CAI43948.1|  catalase                                               468   3e-160   Populus deltoides
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           468   3e-160   Sesamum indicum [beniseed]
ref|NP_001291326.1|  catalase isozyme 1                                 467   5e-160   Sesamum indicum [beniseed]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                466   9e-160   Erythranthe guttata [common monkey flower]
gb|AFU90822.1|  catalase                                                466   9e-160   Populus tomentosa [Chinese white poplar]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          466   9e-160   Soldanella alpina
emb|CAC04509.1|  catalase                                               457   1e-159   Digitalis lanata [Grecian foxglove]
ref|XP_007018034.1|  Catalase 2                                         464   8e-159   
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                464   8e-159   Erythranthe guttata [common monkey flower]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      464   9e-159   Populus euphratica
gb|KJB57963.1|  hypothetical protein B456_009G187600                    464   1e-158   Gossypium raimondii
gb|KHG12976.1|  Catalase isozyme 2                                      463   2e-158   Gossypium arboreum [tree cotton]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      462   4e-158   Vitis vinifera
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               462   5e-158   Gossypium hirsutum [American cotton]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 462   6e-158   Elaeis guineensis
gb|AHA50082.1|  catalase                                                462   7e-158   Eleutherococcus senticosus
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      460   2e-157   
gb|AIS20825.1|  CAT                                                     460   4e-157   Pyrus x bretschneideri [bai li]
ref|XP_002521709.1|  catalase, putative                                 460   4e-157   Ricinus communis
gb|KJB17473.1|  hypothetical protein B456_003G002800                    459   9e-157   Gossypium raimondii
gb|AAO17721.1|  catalase                                                458   1e-156   Hypericum perforatum
dbj|BAQ21275.1|  catalase                                               458   1e-156   Citrus tamurana
emb|CAB56850.1|  catalase                                               455   2e-156   Prunus persica
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      457   3e-156   
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             457   4e-156   Citrus clementina [clementine]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      457   4e-156   
ref|XP_010530333.1|  PREDICTED: catalase-2                              457   4e-156   Tarenaya hassleriana [spider flower]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 457   5e-156   Prunus mume [ume]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      457   5e-156   Phoenix dactylifera
gb|AHF27428.1|  catalase                                                451   6e-156   Cucurbita moschata [ayote]
ref|XP_002306976.2|  catalase family protein                            456   7e-156   
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      456   1e-155   Citrus sinensis [apfelsine]
ref|NP_001237556.1|  catalase-1/2                                       456   1e-155   Glycine max [soybeans]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      456   1e-155   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011654267.1|  PREDICTED: catalase isozyme 1                      455   2e-155   Cucumis sativus [cucumbers]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             455   2e-155   Eutrema salsugineum [saltwater cress]
dbj|BAJ33995.1|  unnamed protein product                                455   2e-155   Eutrema halophilum
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      455   2e-155   Nelumbo nucifera [Indian lotus]
ref|XP_010094556.1|  Catalase isozyme 1                                 455   3e-155   Morus notabilis
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      455   3e-155   Elaeis guineensis
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      455   3e-155   
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             454   5e-155   
gb|AAF19965.1|AF207906_1  catalase 1                                    454   6e-155   Zantedeschia aethiopica [arum-lily]
emb|CDP01803.1|  unnamed protein product                                454   7e-155   Coffea canephora [robusta coffee]
ref|XP_010061175.1|  PREDICTED: catalase-like                           454   7e-155   Eucalyptus grandis [rose gum]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 454   8e-155   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB86582.2|  catalase                                                454   8e-155   Raphanus sativus
ref|NP_001289779.1|  catalase isozyme 1                                 454   9e-155   Nelumbo nucifera [Indian lotus]
gb|AAF71742.1|AF248491_1  catalase                                      454   9e-155   Raphanus sativus
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    453   1e-154   
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      453   1e-154   Cucumis melo [Oriental melon]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             453   1e-154   Prunus persica
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         453   1e-154   Tarenaya hassleriana [spider flower]
gb|AGE15298.2|  catalase 1                                              453   1e-154   Eriobotrya japonica [loquat]
prf||2104177A  catalase                                                 453   1e-154
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          453   1e-154   Helianthus annuus
gb|ACV92695.1|  catalase                                                453   1e-154   Brassica oleracea
gb|ACA50528.1|  putative catalase 2                                     453   1e-154   Brassica napus [oilseed rape]
emb|CAD42909.1|  catalase                                               453   2e-154   Prunus persica
emb|CDX76313.1|  BnaA08g10870D                                          452   2e-154   
gb|AIA61608.1|  catalase                                                453   2e-154   Gynostemma pentaphyllum [jiaogulan]
ref|NP_001235974.1|  catalase-3                                         452   2e-154   Glycine max [soybeans]
gb|ADC95629.1|  catalase                                                452   3e-154   Bruguiera gymnorhiza [Burma mangrove]
emb|CDY40645.1|  BnaA03g53180D                                          452   4e-154   Brassica napus [oilseed rape]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         452   4e-154   Camelina sativa [gold-of-pleasure]
ref|XP_009138342.1|  PREDICTED: catalase-2                              452   4e-154   Brassica rapa
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               452   4e-154   Cucurbita pepo
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             452   4e-154   Capsella rubella
gb|AAD17936.1|  catalase                                                451   6e-154   Brassica juncea [brown mustard]
gb|AAD17935.1|  catalase                                                451   6e-154   Brassica juncea [brown mustard]
emb|CCP37650.1|  catalase-1                                             451   7e-154   Nicotiana tabacum [American tobacco]
gb|ACL27272.1|  catalase                                                451   9e-154   Nicotiana benthamiana
gb|AAB62892.1|  catalase-1                                              451   9e-154   Nicotiana glutinosa
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      451   9e-154   Nicotiana tomentosiformis
gb|AFU48609.1|  catalase 1                                              451   9e-154   Nicotiana benthamiana
ref|XP_010437527.1|  PREDICTED: catalase-2                              451   1e-153   Camelina sativa [gold-of-pleasure]
emb|CDY17510.1|  BnaC03g65530D                                          450   1e-153   Brassica napus [oilseed rape]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     454   2e-153   Eucalyptus grandis [rose gum]
gb|AAB71764.1|  catalase 1                                              450   2e-153   Nicotiana tabacum [American tobacco]
emb|CDX72514.1|  BnaC07g45360D                                          450   2e-153   
gb|AAF61732.1|AF243517_1  catalase 2                                    450   2e-153   Helianthus annuus
ref|XP_007046520.1|  Catalase 2                                         450   2e-153   Theobroma cacao [chocolate]
gb|AAB88173.1|  catalase                                                443   3e-153   Glycine max [soybeans]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         449   4e-153   Camelina sativa [gold-of-pleasure]
gb|AAR14052.2|  catalase                                                449   5e-153   Solanum tuberosum [potatoes]
ref|XP_009106100.1|  PREDICTED: catalase-2                              449   5e-153   Brassica rapa
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      449   6e-153   Nicotiana sylvestris
gb|KFK30147.1|  catalase                                                449   6e-153   Arabis alpina [alpine rockcress]
prf||1906388A  catalase                                                 449   8e-153
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               448   8e-153   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 449   9e-153   Phoenix dactylifera
emb|CAA45564.1|  catalase                                               449   9e-153   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            449   9e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012065377.1|  PREDICTED: catalase-2                              449   9e-153   Jatropha curcas
gb|AAK96854.1|  catalase                                                448   1e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      448   1e-152   Elaeis guineensis
gb|AAC19397.1|  leaf catalase                                           448   1e-152   Mesembryanthemum crystallinum
emb|CAA64220.1|  catalase                                               448   2e-152   Arabidopsis thaliana [mouse-ear cress]
gb|AAM97541.1|  catalase 2                                              447   2e-152   Capsicum annuum
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 447   2e-152   Cucumis melo [Oriental melon]
gb|EPS69543.1|  catalase                                                447   3e-152   Genlisea aurea
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      447   3e-152   Solanum tuberosum [potatoes]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             447   4e-152   Phaseolus vulgaris [French bean]
emb|CDP07288.1|  unnamed protein product                                447   4e-152   Coffea canephora [robusta coffee]
emb|CDP01802.1|  unnamed protein product                                446   6e-152   Coffea canephora [robusta coffee]
emb|CDX69111.1|  BnaC01g03420D                                          445   1e-151   
gb|AAD17933.1|  catalase                                                446   1e-151   Brassica juncea [brown mustard]
gb|AGC65520.1|  catalase                                                446   2e-151   Eriobotrya japonica [loquat]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             445   2e-151   
gb|ABM47415.1|  catalase                                                445   2e-151   Prunus avium [gean]
gb|AFN81243.1|  catalase 1                                              445   2e-151   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             445   3e-151   Populus trichocarpa [western balsam poplar]
gb|ADU56199.1|  catalase                                                444   4e-151   Hevea brasiliensis [jebe]
gb|AAR84578.1|  catalase 1a                                             444   4e-151   Lotus japonicus
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         444   7e-151   Tarenaya hassleriana [spider flower]
ref|NP_001240021.1|  catalase                                           444   7e-151   Glycine max [soybeans]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     444   1e-150   Sesamum indicum [beniseed]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              443   1e-150   Populus euphratica
ref|XP_011022275.1|  PREDICTED: catalase-like                           442   1e-150   Populus euphratica
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      443   2e-150   Fragaria vesca subsp. vesca
ref|NP_001237571.1|  catalase-4                                         442   2e-150   Glycine max [soybeans]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              442   3e-150   
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              442   4e-150   Populus euphratica
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              442   4e-150   Cicer arietinum [garbanzo]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              441   6e-150   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             442   7e-150   Eutrema salsugineum [saltwater cress]
gb|AGV54297.1|  peroxisomal catalase                                    441   7e-150   Phaseolus vulgaris [French bean]
gb|ABY21704.1|  catalase-1 precursor                                    441   1e-149   Panax ginseng [Asiatic ginseng]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             440   2e-149   Phaseolus vulgaris [French bean]
gb|AAC17731.1|  catalase 1                                              440   3e-149   Arabidopsis thaliana [mouse-ear cress]
gb|AAG43363.1|AF151368_1  catalase                                      440   3e-149   Hevea brasiliensis [jebe]
ref|XP_010692546.1|  PREDICTED: catalase                                439   4e-149   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_564121.1|  catalase 1                                            439   4e-149   Arabidopsis thaliana [mouse-ear cress]
gb|AFW69584.1|  catalase1                                               434   4e-149   
gb|AIX10947.1|  putative catalase                                       439   7e-149   Gardenia jasminoides
gb|AAD37788.1|AF149283_1  catalase 1                                    436   1e-148   Phaseolus vulgaris [French bean]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               438   1e-148   Ricinus communis
gb|AFU90823.1|  catalase                                                436   2e-148   Populus x beijingensis
ref|XP_009103333.1|  PREDICTED: catalase-1                              437   3e-148   Brassica rapa
gb|AAK67359.2|AF390210_1  catalase                                      437   3e-148   Suaeda salsa
emb|CDY01363.1|  BnaA07g11360D                                          437   3e-148   
emb|CDY31877.1|  BnaC07g15270D                                          436   5e-148   Brassica napus [oilseed rape]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          436   7e-148   Vigna radiata var. radiata [golden gram]
emb|CAA42720.1|  catalase-1                                             436   8e-148   Zea mays [maize]
ref|NP_001241808.1|  catalase isozyme B                                 436   9e-148   Zea mays [maize]
gb|AIP93616.1|  CAT1                                                    436   1e-147   Bassia scoparia [burning bush]
dbj|BAJ87148.1|  predicted protein                                      428   1e-147   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHB72694.1|  catalase                                                435   2e-147   Beta vulgaris subsp. maritima [sea beet]
ref|NP_001234186.1|  catalase isozyme 2                                 434   4e-147   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             434   6e-147   Eutrema salsugineum [saltwater cress]
dbj|BAA34205.1|  catalase                                               434   6e-147   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048861.1|  Os03g0131200                                       434   7e-147   
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 433   8e-147   Eucalyptus grandis [rose gum]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         433   8e-147   Oryza brachyantha
ref|XP_012073648.1|  PREDICTED: catalase isozyme 1                      433   1e-146   Jatropha curcas
gb|ACH63223.1|  catalase                                                433   1e-146   Rheum australe [Himalayan rhubarb]
gb|KHG21219.1|  Catalase isozyme 1                                      430   2e-146   Gossypium arboreum [tree cotton]
gb|KEH36312.1|  catalase heme-binding enzyme                            432   2e-146   Medicago truncatula
ref|NP_001105415.1|  catalase isozyme 1                                 432   3e-146   
gb|AAC17729.1|  catalase 1                                              428   3e-146   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    432   3e-146   Arabis alpina [alpine rockcress]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    432   4e-146   Oryza sativa Indica Group [Indian rice]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 433   4e-146   
gb|ADZ45555.1|  catalase                                                431   6e-146   Vigna radiata [mung bean]
gb|AIU99479.1|  catalase                                                431   7e-146   Saccharum arundinaceum
dbj|BAA05494.1|  catalase                                               431   8e-146   Oryza sativa Japonica Group [Japonica rice]
gb|AIU99481.1|  catalase                                                431   1e-145   Saccharum spontaneum [fodder cane]
ref|NP_001058635.1|  Os06g0727200                                       430   1e-145   
dbj|BAA34204.1|  catalase                                               430   1e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 430   1e-145   Oryza brachyantha
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          430   2e-145   
gb|AIU99485.1|  catalase                                                430   2e-145   Saccharum spontaneum [fodder cane]
gb|AAB07026.1|  catalase 1                                              429   3e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 429   3e-145   Vitis vinifera
ref|NP_001268098.1|  catalase                                           429   3e-145   Vitis vinifera
gb|ADZ45556.1|  catalase                                                429   3e-145   Vigna radiata [mung bean]
gb|AIM43584.1|  catalase                                                429   3e-145   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99484.1|  catalase                                                429   3e-145   Saccharum arundinaceum
gb|AIU99488.1|  catalase                                                429   3e-145   Saccharum hybrid cultivar ROC22
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               429   4e-145   Hordeum vulgare [barley]
gb|AAY59707.1|  catalase                                                429   5e-145   Oryza sativa Indica Group [Indian rice]
gb|AIU99480.1|  catalase                                                428   8e-145   Saccharum spontaneum [fodder cane]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      428   1e-144   Eucalyptus grandis [rose gum]
gb|ACB11496.1|  catalase                                                427   2e-144   Pinus sylvestris [Scotch pine]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      427   2e-144   Brachypodium distachyon [annual false brome]
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         427   3e-144   Triticum aestivum [Canadian hard winter wheat]
gb|ABK24453.1|  unknown                                                 427   3e-144   Picea sitchensis
gb|AIU99486.1|  catalase                                                427   3e-144   Saccharum spontaneum [fodder cane]
ref|XP_006828715.1|  PREDICTED: catalase-1/2                            426   5e-144   Amborella trichopoda
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                426   6e-144   Citrus sinensis [apfelsine]
gb|AIU99482.1|  catalase                                                426   8e-144   Saccharum hybrid cultivar ROC22
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             425   1e-143   Citrus clementina [clementine]
gb|AIU99487.1|  catalase                                                425   1e-143   Saccharum hybrid cultivar ROC22
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      425   2e-143   Nicotiana tomentosiformis
gb|AAA57551.1|  catalase                                                421   3e-143   Nicotiana sylvestris
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               424   3e-143   Zea mays [maize]
gb|AIU99483.1|  catalase                                                424   4e-143   Saccharum hybrid cultivar ROC22
gb|ACL35349.1|  catalase                                                424   4e-143   Picea glauca
gb|AAF79625.1|AC027665_26  F5M15.5                                      440   5e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558892.1|  PREDICTED: catalase-1                              424   5e-143   Brachypodium distachyon [annual false brome]
gb|ADN94253.1|  catalase                                                423   6e-143   Puccinellia chinampoensis
gb|EMT05040.1|  Catalase-1                                              424   8e-143   
ref|XP_010105996.1|  Catalase isozyme 1                                 418   9e-143   
dbj|BAF91369.1|  catalase                                               422   1e-142   Capsicum annuum
ref|XP_011654421.1|  PREDICTED: catalase isozyme 1-like                 420   2e-142   Cucumis sativus [cucumbers]
dbj|BAJ90861.1|  predicted protein                                      422   2e-142   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    422   2e-142   Nicotiana tabacum [American tobacco]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      422   2e-142   Nicotiana sylvestris
ref|XP_002510677.1|  catalase, putative                                 437   3e-142   
gb|ABQ44283.1|  catalase                                                416   3e-142   Saccharum hybrid cultivar NCo 376
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          421   5e-142   Solanum melongena [aubergine]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    421   5e-142   Capsicum annuum
ref|XP_002890395.1|  F5M15.5                                            436   7e-142   
gb|AFD29285.1|  catalase                                                421   8e-142   Vicia faba [broad bean]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         420   1e-141   Setaria italica
dbj|BAJ88747.1|  predicted protein                                      422   1e-141   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY31490.1|  BnaC05g15990D                                          420   1e-141   Brassica napus [oilseed rape]
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             420   1e-141   
emb|CDY29518.1|  BnaA06g14520D                                          420   1e-141   Brassica napus [oilseed rape]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       420   1e-141   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009149540.1|  PREDICTED: catalase-1                              420   2e-141   Brassica rapa
dbj|BAH37035.1|  catalase 1                                             419   2e-141   Pisum sativum [garden pea]
emb|CAG23920.1|  catalase                                               419   4e-141   Festuca arundinacea [tall fescue]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          418   6e-141   Avicennia marina
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             418   1e-140   Selaginella moellendorffii
ref|XP_009110221.1|  PREDICTED: catalase-3                              417   1e-140   Brassica rapa
emb|CDY29519.1|  BnaA06g14510D                                          417   2e-140   Brassica napus [oilseed rape]
gb|AAC48918.1|  salicylic acid binding catalase                         417   2e-140   Nicotiana tabacum [American tobacco]
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             417   3e-140   
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 417   3e-140   Tarenaya hassleriana [spider flower]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         417   3e-140   Brassica rapa
ref|XP_010498496.1|  PREDICTED: catalase-3                              417   3e-140   Camelina sativa [gold-of-pleasure]
emb|CDY33636.1|  BnaC08g19360D                                          416   4e-140   Brassica napus [oilseed rape]
gb|AIZ77475.1|  catalase                                                416   4e-140   Triticum aestivum [Canadian hard winter wheat]
emb|CDY31488.1|  BnaC05g15970D                                          417   4e-140   Brassica napus [oilseed rape]
ref|XP_009149539.1|  PREDICTED: catalase-3                              418   4e-140   Brassica rapa
emb|CDY31878.1|  BnaC07g15280D                                          416   5e-140   Brassica napus [oilseed rape]
dbj|BAC79443.1|  catalase                                               416   8e-140   Acacia ampliceps
emb|CDY01364.1|  BnaA07g11370D                                          418   8e-140   
ref|XP_006828714.1|  PREDICTED: catalase-1/2                            414   2e-139   Amborella trichopoda
gb|AGI65617.1|  catalase                                                413   3e-139   Fragaria x ananassa
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         414   4e-139   Tarenaya hassleriana [spider flower]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               414   4e-139   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ABY19573.1|  catalase                                                405   5e-139   Manihot esculenta [manioc]
dbj|BAH19523.1|  AT4G35090                                              413   5e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              413   5e-139   
ref|NP_001031791.1|  catalase 2                                         412   6e-139   Arabidopsis thaliana [mouse-ear cress]
gb|ADB03784.1|  catalase                                                413   7e-139   Ipomoea batatas [batate]
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         413   7e-139   Camelina sativa [gold-of-pleasure]
gb|AAR97905.1|  catalase                                                413   7e-139   Solanum tuberosum [potatoes]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          413   8e-139   Ipomoea batatas [batate]
emb|CAA85470.1|  catalase                                               413   8e-139   Solanum tuberosum [potatoes]
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         413   8e-139   Camelina sativa [gold-of-pleasure]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               413   9e-139   Solanum tuberosum [potatoes]
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            413   1e-138   Pisum sativum [garden pea]
gb|AAX84671.1|  catalase CAT2                                           404   1e-138   Manihot esculenta [manioc]
gb|AAD30292.1|AF139539_1  catalase 3                                    412   1e-138   Raphanus sativus
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          412   2e-138
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             412   2e-138   
gb|ABC01913.1|  catalase isozyme 1-like protein                         412   2e-138   
ref|NP_001031072.3|  catalase 3                                         408   2e-138   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             412   3e-138   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    411   3e-138   
ref|XP_010477308.1|  PREDICTED: catalase-1                              411   3e-138   
gb|ABR15776.1|  catalase                                                403   6e-138   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               410   8e-138   
dbj|BAH20307.1|  AT1G20620                                              409   9e-138   
gb|ACJ73906.1|  CAT2                                                    404   1e-137   
ref|NP_001234827.1|  catalase isozyme 1                                 410   1e-137   
ref|NP_564120.1|  catalase 3                                            410   1e-137   
gb|AAF61734.1|AF243519_1  catalase 4                                    410   1e-137   
gb|AAD30291.2|AF139538_1  catalase 2                                    410   2e-137   
ref|NP_001274863.1|  catalase isozyme 1                                 410   2e-137   
gb|AFR53082.1|  CAT                                                     409   2e-137   
emb|CAE82295.1|  catalase                                               409   3e-137   
gb|AAM65021.1|  unknown                                                 408   5e-137   
ref|XP_012073649.1|  PREDICTED: catalase isozyme 2                      408   9e-137   
gb|AAF61733.1|AF243518_1  catalase 3                                    407   3e-136   
gb|AAC49807.1|  catalase 3                                              406   5e-136   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      405   8e-136   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      402   6e-135   
gb|ACJ76836.3|  catalase                                                402   1e-134   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      402   1e-134   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               402   2e-134   
gb|AAD50974.1|AF170272_1  catalase CAT1                                 401   3e-134   
gb|AHF27433.1|  catalase                                                401   4e-134   
ref|XP_004144240.2|  PREDICTED: catalase isozyme 3                      400   7e-134   
gb|ADM96039.1|  catalase                                                400   8e-134   
gb|AHF27430.1|  catalase                                                400   9e-134   
gb|AEQ30070.1|  catalase                                                400   1e-133   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      399   2e-133   
gb|EMS61345.1|  Catalase isozyme 1                                      404   2e-133   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     399   2e-133   
gb|ABB72796.1|  catalase isozyme 1-like protein                         398   5e-133   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               398   7e-133   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      397   2e-132   
gb|AII23739.1|  catalase                                                395   3e-132   
gb|AAG61140.2|AF332973_1  catalase 2                                    395   8e-132   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      395   1e-131   
gb|AHF27429.1|  catalase                                                394   1e-131   
gb|AHF27432.1|  catalase                                                393   2e-131   
gb|ABV55108.1|  catalase 2                                              393   4e-131   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               393   5e-131   
gb|AAC19398.1|  root catalase                                           393   6e-131   
gb|AHF21552.1|  catalase                                                392   1e-130   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      392   2e-130   
ref|NP_001031073.1|  catalase 3                                         390   4e-130   
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       388   4e-130   
gb|ADU56198.1|  catalase                                                390   5e-130   
ref|XP_001752315.1|  predicted protein                                  390   9e-130   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   393   1e-129   
gb|AAL00886.1|  catalase                                                380   6e-129   
ref|XP_001784759.1|  predicted protein                                  384   2e-127   
gb|EMS35721.1|  Catalase isozyme 1                                      375   5e-127   
gb|ACN36234.1|  unknown                                                 377   8e-127   
ref|XP_010692544.1|  PREDICTED: catalase-like                           380   9e-126   
gb|AAZ29552.1|  catalase-C                                              378   4e-125   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 377   5e-125   
tpg|DAA43177.1|  TPA: catalase2                                         377   1e-124   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               376   3e-124   
gb|KIY96954.1|  catalase                                                370   5e-124   
gb|AJF34884.1|  catalase                                                375   5e-124   
prf||1803522A  catalase                                                 375   6e-124
ref|NP_001105310.1|  catalase isozyme 2                                 374   9e-124   
dbj|BAH56915.1|  AT1G20620                                              374   1e-123   
tpg|DAA43178.1|  TPA: catalase2                                         375   2e-123   
ref|NP_001045673.1|  Os02g0115700                                       372   5e-123   
gb|ABN71233.2|  catalase                                                372   6e-123   
gb|ACL81498.1|  catalase                                                372   6e-123   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          372   1e-122   
gb|ADQ28492.1|  catalase                                                371   2e-122   
gb|AAX88799.1|  catalase                                                371   2e-122   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              370   2e-122   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          370   3e-122   
gb|KJB17474.1|  hypothetical protein B456_003G002800                    368   1e-121   
ref|XP_005645077.1|  catalase                                           369   1e-121   
gb|AGT16203.1|  catalase                                                369   2e-121   
gb|AAC17730.1|  catalase 2                                              365   3e-121   
gb|ABK24449.1|  unknown                                                 367   9e-121   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      367   9e-121   
gb|KJB10391.1|  hypothetical protein B456_001G198700                    365   9e-121   
gb|ADY02963.1|  catalase                                                366   2e-120   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               366   2e-120   
gb|ABK41476.1|  catalase                                                365   3e-120   
emb|CAA43814.1|  catalase                                               363   1e-119   
gb|EMS51034.1|  Catalase isozyme 2                                      364   2e-119   
dbj|BAJ92414.1|  predicted protein                                      363   3e-119   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           363   4e-119
ref|XP_001779509.1|  predicted protein                                  363   4e-119   
dbj|BAA34714.1|  catalase                                               361   1e-118   
emb|CAH61266.1|  catalase                                               361   2e-118   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      361   2e-118   
gb|AAR84577.1|  catalase 1b                                             358   4e-118   
gb|AGT15888.1|  catalase                                                360   5e-118   
gb|AGT16054.1|  catalase                                                360   5e-118   
gb|AGT16188.1|  catalase                                                360   6e-118   
gb|AGT16310.1|  catalase                                                360   7e-118   
gb|EMT06167.1|  Catalase isozyme 2                                      365   9e-118   
gb|ADK25939.1|  catalase                                                349   2e-117   
ref|XP_001696763.1|  catalase/peroxidase                                358   2e-117   
gb|AHZ13843.1|  catalase                                                358   2e-117   
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             357   3e-117   
ref|XP_002950455.1|  catalase                                           358   4e-117   
gb|ABR16304.1|  unknown                                                 356   8e-117   
gb|ABK24543.1|  unknown                                                 356   1e-116   
gb|AAB70006.1|  catalase                                                355   3e-116   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    355   4e-116   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              355   5e-116   
emb|CAA73663.1|  catalase                                               353   1e-115   
gb|AEY70510.1|  catalase                                                344   1e-114   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          351   2e-114   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               346   1e-112   
gb|AFW66787.1|  catalase3                                               344   6e-112   
emb|CDY52649.1|  BnaAnng11640D                                          342   9e-112   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      342   8e-111   
gb|AFW66785.1|  catalase3 isoform 1                                     343   4e-109   
ref|XP_011396830.1|  Catalase isozyme 2                                 335   2e-108   
gb|AFW66789.1|  catalase3                                               322   4e-106   
gb|ACU23083.1|  unknown                                                 318   9e-106   
ref|NP_001105416.1|  catalase isozyme 3                                 327   4e-105   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        326   1e-104   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      326   1e-104   
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      322   5e-104   
gb|AKA94107.1|  catalase                                                322   2e-103   
gb|AFW66788.1|  catalase3                                               322   5e-103   
ref|XP_005708279.1|  catalase                                           321   6e-103   
gb|AFH53190.1|  catalase                                                309   9e-102   
gb|AFH53189.1|  catalase                                                309   1e-101   
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             314   5e-101   
gb|ABB88582.1|  catalase                                                315   1e-100   
gb|AFH53187.1|  catalase                                                306   2e-100   
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            314   3e-100
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 311   1e-99    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 311   2e-99    
gb|KEH36313.1|  catalase heme-binding enzyme                            310   2e-99    
gb|ACJ73905.1|  CAT1                                                    300   5e-99    
gb|KDD77132.1|  catalase                                                305   8e-97    
gb|AAP57673.1|  catalase                                                295   4e-96    
gb|AGS17821.1|  catalase 2                                              299   5e-96    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             296   3e-94    
gb|AFY26882.1|  catalase                                                287   5e-94    
gb|ABB51561.1|  truncated catalase 2                                    294   3e-93    
gb|ABS89000.1|  catalase                                                280   3e-91    
gb|AEA86295.1|  putative catalase                                       276   1e-89    
ref|NP_973873.1|  catalase 3                                            284   3e-89    
gb|AAZ03546.1|  Catalase                                                273   2e-88    
gb|ACJ71244.1|  catalase 2                                              281   2e-88    
gb|ACJ71245.1|  catalase 2                                              278   1e-87    
gb|AAT68776.1|  catalase                                                272   7e-87    
gb|AFA36510.1|  catalase                                                266   5e-85    
gb|ACV30589.1|  catalase                                                263   1e-84    
gb|AAY22485.1|  catalase                                                263   6e-84    
gb|ADR01107.1|  catalase 3                                              268   1e-83    
gb|AFV96158.1|  catalase                                                259   9e-83    
emb|CAC16850.1|  catalase                                               255   1e-81    
ref|XP_005536240.1|  catalase                                           266   2e-81    
gb|ACY30463.1|  catalase                                                260   2e-81    
gb|ABN79860.2|  catalase                                                254   5e-80    
emb|CAC17121.1|  catalase                                               250   6e-80    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     258   9e-80    
dbj|BAH20283.1|  AT1G20620                                              247   1e-78    
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             254   5e-78    
gb|AID50071.1|  catalase                                                237   6e-75    
gb|AFR42410.1|  catalase                                                237   8e-75    
gb|AFR42412.1|  catalase                                                231   8e-73    
gb|AII80275.1|  catalase                                                236   3e-72    
ref|XP_005712277.1|  unnamed protein product                            239   2e-71    
gb|AFC35182.1|  catalase dismutase                                      233   2e-71    
gb|AAG23803.1|  catalase                                                226   3e-70    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     229   1e-69    
gb|AEQ94083.1|  putative catalase                                       229   1e-69    
dbj|BAD07937.1|  catalase catA-like protein                             223   3e-69    
gb|AEG89525.1|  catalase                                                228   9e-69    
gb|AAO16182.1|  catalase-1                                              220   1e-68    
gb|AAU43642.1|  catalase                                                219   9e-68    
emb|CDW92180.1|  putative catalase                                      224   1e-67    
dbj|BAJ08969.1|  catalase                                               219   2e-67    
emb|CAA10286.1|  catalase                                               217   3e-67    
ref|XP_005642928.1|  catalase                                           226   3e-66    
emb|CAJ00337.1|  putative catalase                                      218   1e-65    
ref|WP_015881004.1|  catalase                                           223   4e-65    
ref|WP_026826608.1|  catalase                                           222   9e-65    
gb|ABY68158.1|  catalase                                                210   1e-64    
gb|ABY68162.1|  catalase                                                210   1e-64    
gb|ABY68159.1|  catalase                                                210   1e-64    
ref|WP_045670628.1|  catalase                                           221   3e-64    
gb|ABY68160.1|  catalase                                                209   3e-64    
gb|AFI48054.1|  catalase isozyme B                                      209   4e-64    
gb|ABY68161.1|  catalase                                                209   4e-64    
gb|AFI48131.1|  catalase isozyme B                                      209   5e-64    
gb|AFI48111.1|  catalase isozyme B                                      208   5e-64    
ref|WP_031421259.1|  catalase                                           220   6e-64    
gb|AFI48101.1|  catalase isozyme B                                      207   1e-63    
gb|AFI48068.1|  catalase isozyme B                                      207   2e-63    
gb|ABY68164.1|  catalase                                                207   2e-63    
emb|CDP22058.1|  unnamed protein product                                208   3e-63    
gb|AFI48130.1|  catalase isozyme B                                      205   1e-62    
emb|CAC37634.1|  catalase 1                                             211   1e-62    
ref|XP_005644653.1|  catalase-domain-containing protein                 218   2e-62    
ref|WP_016429054.1|  hypothetical protein                               214   7e-62    
gb|AFI48098.1|  catalase isozyme B                                      203   8e-62    
ref|WP_029723487.1|  catalase                                           214   8e-62    
emb|CDW92181.1|  putative catalase                                      207   2e-61    
ref|WP_029335752.1|  catalase                                           213   2e-61    
ref|WP_024371859.1|  catalase                                           213   2e-61    
ref|WP_035405433.1|  catalase                                           213   2e-61    
ref|WP_016508130.1|  catalase                                           213   2e-61    
ref|WP_010277546.1|  catalase                                           212   4e-61    
ref|WP_007497088.1|  catalase                                           212   7e-61    
ref|WP_034776647.1|  catalase                                           212   7e-61    
ref|WP_034817708.1|  catalase                                           212   7e-61    
ref|WP_034804389.1|  catalase                                           212   8e-61    
ref|WP_039169268.1|  catalase                                           212   8e-61    
ref|WP_024719958.1|  MULTISPECIES: catalase                             212   9e-61    
ref|WP_041091807.1|  catalase                                           212   9e-61    
ref|WP_008359888.1|  catalase                                           211   9e-61    
ref|WP_032122311.1|  catalase                                           211   9e-61    
gb|KGS11078.1|  catalase                                                205   1e-60    



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   491 bits (1264),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 237/239 (99%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWISYW+QADK+LGQK+ASRLNVRPTM
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   485 bits (1249),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 236/239 (99%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DPCRHAEQ+PIP RVLTGKRDKCI+EKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPLRVLTGKRDKCIVEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWISYW+QADKSLGQK+ASRLN+RPTM
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNIRPTM  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   478 bits (1231),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 220/239 (92%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDV+KTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVSKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE+HPIPP VL+GKRDKC+I+KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIPPPVLSGKRDKCVIQKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSD RVTHEIRSIWISYW+QADKSLGQK+A+RLNVRPTM
Sbjct  434  RYRSWAPDRQERFICRWVDALSDARVTHEIRSIWISYWSQADKSLGQKIATRLNVRPTM  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   478 bits (1230),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR+DPCRHAEQ+PIPPR+LTGKRD+CIIEKENNFKQPGE
Sbjct  374  NNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSWS DRQERFICRW+ ALSDPRVTHEI +IWISYW+QADKSLG+K+ASRLNVRPTM
Sbjct  434  RYRSWSPDRQERFICRWINALSDPRVTHEIHTIWISYWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   476 bits (1225),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYD+IAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDAIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFM+RDEEVNYFPSR+DPCRHAEQ+PIPPR+LTGKRD+CIIEKENNFKQPGE
Sbjct  374  NNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSWS DRQERFICRW+ ALSDPRVTHEIR IWISYW+QADKSLG+K+ASRLNVRPTM
Sbjct  434  RYRSWSPDRQERFICRWINALSDPRVTHEIRIIWISYWSQADKSLGEKIASRLNVRPTM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   469 bits (1208),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  106  DLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  165

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  166  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  225

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NYFPSRYDP RHAE  PIPP V TG+R+KCIIEKENNFKQPGE
Sbjct  226  NNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGE  285

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWISYW+QADKS+GQKLASRLNVRP++
Sbjct  286  RYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  344



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   475 bits (1222),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PAIVVPGVY SDDKLLQTRIFSYSD QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIFSYSDAQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DPCRHAEQ+PIPP VLTGKRDKCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIW SYW+QADK+LGQK+ASRLNVRPTM
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPTM  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   472 bits (1215),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NYFPSRYDP RHAE  PIPP V TG+R+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWVEALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAADRQERFICRWVEALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   471 bits (1213),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP R+AE+ PIPP +L+GKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIPPNILSGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   471 bits (1211),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NYFPSRYDP RHAE  PIPP V TG+R+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWISYW+QADKS+GQKLASRLNVRP++
Sbjct  434  RYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   471 bits (1211),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NYFPSRYDP RHAE  PIPP V TG+R+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWVEA SDPRVTHEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   470 bits (1210),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTK WPED+LPLQPVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKIWPEDILPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNY PSR DPCRHAEQ+PIPPRVLTGKR+K IIEKENNFKQPGE
Sbjct  374  NNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
             YRSW+ DRQERF+CRWV+ALSDPR THEIRSIWISYW+QADKSLGQKLASRLN+RPTM
Sbjct  434  HYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   469 bits (1207),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI+AGNYPEWKLFIQ +DPDHEDRFDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSISAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR DPCRHAEQ+PIPPRVLTGKR+K IIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
             YRSW+  RQERF+CRWV+ALSD R THEIRSIWISYW+QADKSLGQKLASRLN+RPTM
Sbjct  434  HYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   469 bits (1207),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE+ PIPP +L+GKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV+ALSDPRVTHEIRS+WISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   469 bits (1207),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHE RFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEARFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE  PIPP V +GKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+CRWV+ALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   469 bits (1207),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHE RFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEARFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE  PIPP V +GKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPR THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   468 bits (1205),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NYFPSRYDP RHAE  PIPP V TG+R+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWISYW+QADKS+GQKLAS LNVRP++
Sbjct  434  RYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPSI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   468 bits (1204),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPD+EDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDYEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAEQHPIP  +  GKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIPSAIFNGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RW++ALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   468 bits (1204),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAG YPEWKLFIQ +DPDHE RFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGTYPEWKLFIQTIDPDHEARFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE  PIPP V +GKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   468 bits (1204),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++PIPP VL+GKR K  IEKENNFKQPG+
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWVEALSDPR+THEIRSIW+SYW+QADKSLGQKLASRLNVRP M
Sbjct  434  RYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASRLNVRPAM  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   468 bits (1203),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 212/239 (89%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYP+WKLFIQ +DPDHED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPKWKLFIQTIDPDHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFVENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPPNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DPCRHAEQ+PIPPRVL GKRD+CII+KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRVLNGKRDRCIIQKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALS+PRVTHEIR+IW+SYW+QADKSLGQKLASRLNV+PTM
Sbjct  434  RYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLSYWSQADKSLGQKLASRLNVKPTM  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   468 bits (1203),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DP+HEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDPNHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE+ PIPP +L+GKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV+ALSDPRVTHEIRS+WISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   468 bits (1203),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAG YPEWKLFIQ +DPDHE RFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGTYPEWKLFIQTIDPDHEARFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE  PIPP V +GKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   468 bits (1203),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++PIPP VL+GKR K  IEKENNFKQPG+
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWVEALSDPR+THEIRSIW+SYW+QADKSLGQKLAS LNVRPTM
Sbjct  434  RYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASHLNVRPTM  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   467 bits (1202),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DPDHEDRFDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RH+E +PIPP VL+GKR+K  IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIPPVVLSGKREKRCIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWVEALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRPTM
Sbjct  434  RYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   466 bits (1200),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAG YPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGTYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP +VVPGV+YSDDK+LQTRIFSYSD+QRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPGLVVPGVHYSDDKMLQTRIFSYSDSQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDPCRHAE+HPIPP VL+GKRD+C IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIPPVVLSGKRDRCCIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR++S DRQERFI RWV+ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRPTM
Sbjct  434  RYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   466 bits (1199),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 218/235 (93%), Positives = 227/235 (97%), Gaps = 0/235 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  253  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  312

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  313  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  372

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE  PIPP V +GKR+KCIIEKENNFKQPGE
Sbjct  373  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGE  432

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNV  154
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNV
Sbjct  433  RYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  487



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   466 bits (1200),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI+AGNYPEWKLFIQI++PDHED+FDFDPLDVTKTWPED++PL PVGRLVLNKNID
Sbjct  254  DLYDSISAGNYPEWKLFIQIIEPDHEDKFDFDPLDVTKTWPEDIIPLMPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPA++VPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR+DP RHAE+HPIPP VLTGKRD+C+IEKENNFKQPGE
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+++ DRQERF+CRWV+ALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM
Sbjct  434  RYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   457 bits (1177),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  27   DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  86

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  87   NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  146

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDPCRHAE+ P PP  L GKRD+  IEKENNFKQPGE
Sbjct  147  NNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHPPVALNGKRDRICIEKENNFKQPGE  206

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            +YRS+  DRQERFI RWV+ALSDPR+THEIRSIW+SYWTQADKSLGQKLASRLN+RPTM
Sbjct  207  KYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKLASRLNIRPTM  265



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   464 bits (1194),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NYFPSRYDP RHAE+ PIPP V +G+R+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIPPAVCSGRREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIRSIWI+YW+QA KSLGQKLASRLNV+P +
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWITYWSQACKSLGQKLASRLNVKPNI  492



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   464 bits (1193),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPA++VPGV+YSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPK  HH
Sbjct  314  NFFAENEQLAFCPALIVPGVHYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKNGHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDPCRHAE+HPIPP VL+GKRD+  IEKENNFK+PG 
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERHPIPPVVLSGKRDRICIEKENNFKEPGV  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RSW+TDRQERFI RWV+ALSDPR+THEIR IWISYWTQADKSLGQKLASRLNVRPTM
Sbjct  434  RFRSWATDRQERFIRRWVDALSDPRLTHEIRGIWISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   464 bits (1193),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP  V +G+R+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+CRWV+ALS+PRVTHE+RSIWISYW+QADKSLGQKLAS LNVRP++
Sbjct  434  RYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSI  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   464 bits (1193),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHE RFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEQRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTR+FSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NYFPSRYDP RHAE+ PIPP + TGKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIPPALCTGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV+A+SDPRVTHEIRSIWI+YW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   463 bits (1192),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDP HEDRFDFDPLDVTKTWPED+ PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDPLHEDRFDFDPLDVTKTWPEDIFPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP+++VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE+HPIP  VL+GKR+KCII KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DRQERFI RW++ALSDPRVTHEIRSIWISYW+QADKSLGQK+ASRLNVRP++
Sbjct  434  RYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   462 bits (1189),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 215/239 (90%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++PIPP +LTG+R+KCII KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCIIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWV+ALSDPRVT+EIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   462 bits (1189),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 212/239 (89%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDP HEDRFDFDPLDVTKTWPED+ PLQP+GR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDPLHEDRFDFDPLDVTKTWPEDIFPLQPMGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP+++VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE+HPIP  VL+GKR+KCII KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DRQERFI RW++ALSDPRVTHEIRSIWISYW+QADKSLGQK+ASRLNVRP++
Sbjct  434  RYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   462 bits (1188),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE+ PIP R+LTG+R+KC+I KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPFRILTGRREKCVIHKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWVEALSDPRVT+EIR+IWISYW+Q D+SLGQK+A+RLNV+P+M
Sbjct  434  RYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWISYWSQCDRSLGQKIATRLNVKPSM  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   462 bits (1188),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR+DP RHAE+HP+PP +LTG+RD+C+++KENNFKQPGE
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPLPPPMLTGRRDRCMVQKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+STDRQERFI R V+ALSDPRVTHEIRSIWISYWTQA KSLGQKLASRLNV+P++
Sbjct  434  RYRSFSTDRQERFISRLVDALSDPRVTHEIRSIWISYWTQACKSLGQKLASRLNVKPSI  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   460 bits (1184),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 214/239 (90%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE  PIP  + TGKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSNICTGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ALSDPRVT+EIRSIWISYW+QAD+S GQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   460 bits (1183),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE  PIP  + TGKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ALSDPRVT+EIRSIWISYW+QAD+S GQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   460 bits (1183),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPD EDRFDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDEEDRFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP+IVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMN MHRDEEVNYFPSRYDP RHAEQHPIPPR+L+GKR+KCII KENNFKQPGE
Sbjct  374  NNHHEGFMNIMHRDEEVNYFPSRYDPARHAEQHPIPPRILSGKREKCIILKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DR+ERFI RWVEAL+D R+T+EIRSIWISYW+QADKSLGQKLAS LN+RPTM
Sbjct  434  RYRSFTPDRKERFIRRWVEALTDTRITYEIRSIWISYWSQADKSLGQKLASHLNMRPTM  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   459 bits (1180),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDP HEDRFDFDPLDVTKTWPED+ PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDPLHEDRFDFDPLDVTKTWPEDIFPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP+++VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE+HPIP  V +GKR+KCII KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVYSGKREKCIIGKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DRQERFI RW++ALSD RVTHEIRSIWISYW+QADKSLGQK+ASRLNVRP++
Sbjct  434  RYRSFSADRQERFINRWIDALSDSRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   458 bits (1179),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 212/239 (89%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPK AHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKSAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++PIPP VL G+R+KC+I KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPVVLNGRREKCMIAKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DRQERF+ RW+ +LSDPRVTHEIR+IW++YW QADKSLGQKLASRLNVRP M
Sbjct  434  RYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVTYWYQADKSLGQKLASRLNVRPNM  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   458 bits (1178),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQIMDPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  238  DLYDSIAAGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  297

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYS+DKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  298  NFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHH  357

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEE++YFPSRYDP RHAE HP PP +  G+R+KCII KENNFKQPGE
Sbjct  358  NNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGE  417

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+CRWV+ALSDPRVTHEIR IWISYW+QA KSLGQKL +RLNVRP++
Sbjct  418  RYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLTARLNVRPSI  476



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ MDPDHEDRFDFDPLD+TKTWPED+LPLQPVGRLVLNKNID
Sbjct  185  DLYDSIAAGNYPEWKLYIQTMDPDHEDRFDFDPLDLTKTWPEDILPLQPVGRLVLNKNID  244

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA VVPG+YYSDDK+LQTRIF+YSDTQRHRLGPNYLQLPVNAPKC HH
Sbjct  245  NFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHH  304

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++PIP  +L+GKR+KC+IEKENNFKQPGE
Sbjct  305  NNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGE  364

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV+ALSDPRVTHEIRS+WISYW+QADKSLGQKLASRLNVRP++
Sbjct  365  RYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  423



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   457 bits (1176),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 212/239 (89%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPD EDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDQEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE  PIP  + TGKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ LS+PRVTHEIRSIWISYW+QAD+S GQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   457 bits (1176),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQIMDPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYS+DKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKCA H
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEE++YFPSRYDP RHAE HP PP +  G+R+KCII KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIR IWISYW+QA KSLGQKLASRLNVRP +
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   457 bits (1176),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 212/239 (89%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPD EDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDQEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE  PIP  + TGKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ LS+PRVTHEIRSIWISYW+QAD+S GQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   457 bits (1176),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DP  ED+FDFDP+DVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPADEDKFDFDPVDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++PIPP + +G+R++CIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPVICSGRRERCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RW+EALSDPR+THEIRSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  434  RYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRLNVRPSI  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   457 bits (1175),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 213/239 (89%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ MDPDHEDRFDFDPLD+TKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTMDPDHEDRFDFDPLDLTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA VVPGVYYSDDK+LQTRIF+YSDTQRHRLGPNYLQLPVNAPKC HH
Sbjct  314  NFFAENEQLAFNPAHVVPGVYYSDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++PIP  +L GKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPSNILYGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV+ALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   457 bits (1175),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGR++LNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRMILNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF+ENEQLAFCPAIVVPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFSENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE  PIP  VLTG+R+KC+I KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSCVLTGRREKCVIHKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQ RFICRWVEALSDPRVT+EIRSIWISYW+Q D+SLGQK+A+RLNV+P+M
Sbjct  434  RYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWISYWSQCDRSLGQKIATRLNVKPSM  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   451 bits (1160),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHED++DFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  106  DLYDSIAAGNYPEWKLFIQTIDPDHEDKYDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  165

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  166  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  225

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  226  NNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGE  285

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ALSD RVTHEIRSIWISYW+QAD+SLGQKLAS LNVRP++
Sbjct  286  RYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  344



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   456 bits (1174),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP  V +G+R+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ALS+PRVTHE+RSIWISYW+QADKSLGQKLAS LNVRP++
Sbjct  434  RYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   456 bits (1173),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIA+GNYPEWKL+IQIMDPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYS+DKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKCA H
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEE++YFPSRYDP RHAE HP PP +  G+R+KCII KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIR IWISYW+QA KSLGQKLASRLNVRP +
Sbjct  434  RYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   456 bits (1172),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DP++EDR DFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTLDPENEDRLDFDPLDVTKTWPEDVLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTR+FSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE+ P+PPR+L GKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVPPRILGGKREKCMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW +DRQERF+ RWV+ALSDPRVTHEIRSIWISYW+QAD+SLGQK+AS LN++P++
Sbjct  434  RYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   456 bits (1172),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 212/239 (89%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+ PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDIFPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPA+VVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFGENEQLAFCPALVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP RHAE+ PIP RVLTGKR+KC+I KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIPTRVLTGKREKCMISKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DRQERFI RWVEALSDP+VTHEIRSIWISYW+Q DKSL QKLA+RL+V+P+M
Sbjct  434  RYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWISYWSQCDKSLSQKLATRLSVKPSM  492



>ref|XP_011654267.1| PREDICTED: catalase isozyme 1 [Cucumis sativus]
 gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   455 bits (1171),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDR+DFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRYDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V TGKR++C+I+KENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV+ALSDPRVTHEIRSIWI+YW+QAD+S+GQKLAS LNVRP++
Sbjct  434  RYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWITYWSQADRSVGQKLASHLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   455 bits (1171),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW+EALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   455 bits (1171),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW+EALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   455 bits (1171),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQ +DPDHED+ DFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLYDSIQAGNYPEWKLFIQTIDPDHEDKLDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP +VVPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPGVVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNF+HRDEEVNYFPSRYDP RHAE+ PIPPR+ TGKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIPPRICTGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+  DRQERFI RW +ALSDPRVTHEIRSIWISYW+QADKSLGQKLA+RLNV+P+M
Sbjct  434  RYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWISYWSQADKSLGQKLATRLNVKPSM  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   455 bits (1170),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP IVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHR+EEVNYFPSRYDP RHAE++PIP  + TG+R++ +I+KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAICTGRRERTVIDKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DRQERFI RWV ALSDPRVTHEIRSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  434  RYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   455 bits (1170),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DPDHED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE+ PIP R+LTG+R+KC+I KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSRILTGRREKCVIHKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  +RQERFI RWVEALSDPRVTHEI+SIWISYW+Q DKSLGQK+A+RLNV+P M
Sbjct  434  RYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGQKIATRLNVKPCM  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   455 bits (1171),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIA+GNYPEWKL+IQIMDPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  274  DLYDSIASGNYPEWKLYIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  333

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+YYS+DKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKCA H
Sbjct  334  NFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQH  393

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEE++YFPSRYDP RHAE HP PP +  G+R+KCII KENNFKQPGE
Sbjct  394  NNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGE  453

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSDPRVTHEIR IWISYW+QA KSLGQKLASRLNVRP +
Sbjct  454  RYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  512



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   454 bits (1168),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW+EALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPERQERFIQRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   454 bits (1168),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL D+IAAGNYPEWKL+IQIMDPDHEDRFDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLTDAIAAGNYPEWKLYIQIMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAEQ PIPPR+L G R+KC I+KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIPPRILNGGREKCCIQKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            +YRSW+ DRQERFI RW++ALSDPRVTHEIR+IWI+YW+Q DK LGQKLASRLN++PT+
Sbjct  434  KYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWITYWSQCDKFLGQKLASRLNIKPTL  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   454 bits (1168),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPD+ED++DFDPLDVTKTWPED+LPLQPVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDYEDKYDFDPLDVTKTWPEDILPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPAIVVPG++YSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEV+YFPSRYDP RHAE HPIP  VLTG+R+K II KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIPSAVLTGRREKTIIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFICRWV+ALSDPRVT+EIRSIWISYW+QADKSLGQKLASRLN+RP++
Sbjct  434  RYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNIRPSI  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   454 bits (1168),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEW+L+IQ++DPDHED+FDFDPLDVTK WPED++PLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWQLYIQVIDPDHEDKFDFDPLDVTKIWPEDIVPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQ+RIFSY+DTQRHRLGPNYLQLPVNAPKC HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCTHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR+D  RHAE+ PIPP VL GKRD+C+IEKENNFKQPGE
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWVEALSDPRVT EIRSIWISYWTQADKSLGQK+AS LNVRP+M
Sbjct  434  RYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   454 bits (1167),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDP+HEDRFDFDPLDVTKTWPED+ PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPEHEDRFDFDPLDVTKTWPEDIFPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPAI+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFNENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE+ PIP  V+TG+R+K II KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSSVVTGRREKSIINKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ALSDPRVTHEIR IWISYW+Q DKSLGQK+A+RLNV+PTM
Sbjct  434  RYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWISYWSQCDKSLGQKIATRLNVKPTM  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   454 bits (1167),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLF+QI+DP  ED+FDFDPLDVTKTWPEDLLPLQPVGR+VLNKNID
Sbjct  253  DLYDSIAAGNYPEWKLFVQIIDPADEDKFDFDPLDVTKTWPEDLLPLQPVGRMVLNKNID  312

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  313  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  372

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  373  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  432

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  433  RYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   454 bits (1167),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQ +DPDH D +DFDPLDV+KTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLYDSIQAGNYPEWKLFIQTIDPDHGDMYDFDPLDVSKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP IVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HR+EEVNYFPSRYDP RHAE++PIPP++ TGKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIPPQICTGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RW++ALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNV+P+M
Sbjct  434  RYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVKPSM  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   454 bits (1167),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLF+QI+DP  ED+FDFDPLDVTKTWPEDLLPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFVQIIDPADEDKFDFDPLDVTKTWPEDLLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 229/239 (96%), Gaps = 2/239 (1%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DPDHED+FDFDPLDVTKTWPED+LPL PVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPDHEDKFDFDPLDVTKTWPEDILPLMPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP+IVVPGV+YSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPSIVVPGVFYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPPNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NYFPSRYDP RHAE++PIP  +LTGKR+K IIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEINYFPSRYDPVRHAERYPIPTAMLTGKREKTIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ALSD   THEIRS+WISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSWTPDRQERFICRWVDALSD--XTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  490



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQ +DPDHEDR+DFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIMAGNYPEWKLFIQTIDPDHEDRYDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++P PP V TGKR++C+I+KENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV+ALSDPRVTHEIRSIWISYW+QAD+S+GQKLAS LNVRP++
Sbjct  434  RYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNVRPSI  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ MDPDHEDRFDFDPLD+TKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTMDPDHEDRFDFDPLDLTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA VVPG+YYSDDK+LQTRIF+YSDTQRHRLGPNYLQLPVNAPKC HH
Sbjct  314  NFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++PIP  +L+GKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV+ALSDPRVTHEIRSIWISYW+QADKSLGQKL SRLNVRP++
Sbjct  434  RYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDP  ED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDPVDEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPA+VVPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKC HH
Sbjct  314  NFFAENEQVAFCPALVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCVHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR+DP RHAE+ P PP + +G+R+KCIIEKENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSPPAICSGRREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWVEALSD R THEIRSIWISYW+QADKSLGQKLASRLNVRP+ 
Sbjct  434  RYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWISYWSQADKSLGQKLASRLNVRPSF  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLD TKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDDTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRY P RHAE  PIP  ++TGKRDKC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIPSSIITGKRDKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ LS+ RVT+EIRSIWISYW+QAD+S GQKLA+RLNVRP++
Sbjct  434  RYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>prf||2104177A catalase
Length=492

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 209/237 (88%), Positives = 225/237 (95%), Gaps = 0/237 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDR DFDPLDVTKTWPED+ PLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRLDFDPLDVTKTWPEDIFPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEE++YFPSRYDP RHAEQ+PIPP  L+GKRDKC+IEKENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  148
            RYRS+S DRQERFI R V  LSDPRVTHE+RSIW+SYW+QADKSLGQK+ASRLNV+P
Sbjct  434  RYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 209/237 (88%), Positives = 225/237 (95%), Gaps = 0/237 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDR DFDPLDVTKTWPED+ PLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDRLDFDPLDVTKTWPEDIFPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEE++YFPSRYDP RHAEQ+PIPP  L+GKRDKC+IEKENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  148
            RYRS+S DRQERFI R V  LSDPRVTHE+RSIW+SYW+QADKSLGQK+ASRLNV+P
Sbjct  434  RYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   453 bits (1165),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLF+QI+DP  ED+FDFDPLDVTKTWPEDLLPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFVQIIDPADEDKFDFDPLDVTKTWPEDLLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   453 bits (1165),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 207/237 (87%), Positives = 228/237 (96%), Gaps = 0/237 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLF+QI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFVQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++CIIEKENNF+QPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFQQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  148
            RYRSW  DRQERF+ R+VEAL++PRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP
Sbjct  434  RYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   453 bits (1165),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ MDPDHEDRFDFDPLD+TKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTMDPDHEDRFDFDPLDLTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA VVPG+YYSDDK+LQTRIF+YSDTQRHRLGPNYLQLPVNAPKC HH
Sbjct  314  NFFAENEQLAFNPAHVVPGIYYSDDKVLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++PIP  +L+GKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV+ALSDPRVTHEIRSIWISYW+QADKSLGQKL SRLNVRP++
Sbjct  434  RYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   452 bits (1164),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ++DP  ED+FDFDPLDVTKTWPE+LLPLQPVGR+VLNKNID
Sbjct  239  DLYDSIAAGNYPEWKLFIQVIDPADEDKFDFDPLDVTKTWPENLLPLQPVGRMVLNKNID  298

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  299  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  358

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  359  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  418

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW+EALSDPR+THEIRSIWISYW+QADK+LGQKLASRLNVRP++
Sbjct  419  RYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  477



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   453 bits (1165),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKL+IQ +DPDHEDR+DFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIGAGNYPEWKLYIQTIDPDHEDRYDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTR+FSYSDTQRHRLGPNYLQLP NAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPANAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V TGKR++C+I+KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIDKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWV ALSDPRVTHEIRSIWISYW+QAD+S+GQKLAS LN+RP++
Sbjct  434  RYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNMRPSI  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   452 bits (1164),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DP++EDR DFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTLDPENEDRLDFDPLDVTKTWPEDVLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP N+PKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANSPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE+ P+PPR L GKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVPPRTLGGKREKCMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW +DRQERF+ RWV+ALSDPRVTHEIRSIWISYW+QAD+SLGQK+AS LN++P++
Sbjct  434  RYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   452 bits (1163),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQI+DP HE RFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQIIDPVHEGRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNY PSR+DP RHAE+ PIPP V TG+R+KCIIEKENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIPPAVCTGRREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF  RWVEALSDPRVTHEI SIWISYWTQ DK LGQKLA+RLNVRP++
Sbjct  434  RYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWISYWTQCDKFLGQKLATRLNVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   452 bits (1162),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLF+QI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  247  DLYDSIAAGNYPEWKLFVQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  306

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  307  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  366

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  367  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  426

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP +
Sbjct  427  RYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  485



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   452 bits (1163),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +G R++C+I KENNFK+PGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAPPAVCSGTRERCVIAKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+  +RQERFICRW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   452 bits (1163),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLF+QI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFVQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP +
Sbjct  434  RYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   452 bits (1162),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHED++DFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDKYDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ALSD RVTHEIRSIWISYW+QAD+SLGQKLAS LNVRP++
Sbjct  434  RYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   452 bits (1162),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+  +RQERFI RW+EALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   451 bits (1161),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLF+QI+DP  EDRFDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFVQIIDPADEDRFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP + +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAICSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLA+RLNVRP++
Sbjct  434  RYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLANRLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   451 bits (1161),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ++DP  ED+FDFDPLDVTKTWPE+LLPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQVIDPADEDKFDFDPLDVTKTWPENLLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW+EALSDPR+THEIRSIWISYW+QADK+LGQKLASRLNVRP++
Sbjct  434  RYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   451 bits (1161),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  314  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYDP RHAE++PIP  + TGKR+KC+I+KENNFKQPG+
Sbjct  374  NNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWVEALSDPR+T+EIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   451 bits (1160),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  314  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYDP RHAE++PIP  + TGKR+KC+I+KENNFKQPG+
Sbjct  374  NNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWVEALSDPR+T+EIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   451 bits (1160),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDP HEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPSHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  314  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYDP RHAE++PIP  + TGKR+KC+I KENNFKQPGE
Sbjct  374  NNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVILKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWVEALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   451 bits (1160),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  314  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYDP RHAE++PIP  + TGKR+KC+I+KENNF QPGE
Sbjct  374  NNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFNQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWVEALSDPR+T+EIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   451 bits (1160),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  253  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  312

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  313  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  372

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYDP RHAE++PIP  + TGKR+KC+I+KENNFKQPG+
Sbjct  373  NNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGD  432

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWVEALSDPR+T+EIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  433  RYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   451 bits (1160),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYD  RHAE++P PP V +GKR++C+I KENNFK+PGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+  +RQERFICRW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   450 bits (1158),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ++DP  ED+FDFDPLDVTKTWPE+LLPLQPVGR+VLNKNID
Sbjct  239  DLYDSIAAGNYPEWKLFIQVIDPADEDKFDFDPLDVTKTWPENLLPLQPVGRMVLNKNID  298

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  299  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  358

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  359  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  418

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW+EALSDPR+THEIRSIWISYW+QADK+LGQKLAS LNVRP++
Sbjct  419  RYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASHLNVRPSI  477



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   454 bits (1167),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEW+L+IQ++DPDHED+FDFDPLDVTK WPED++PLQPVGRLVLNKNID
Sbjct  346  DLYDSIAAGNYPEWQLYIQVIDPDHEDKFDFDPLDVTKIWPEDIVPLQPVGRLVLNKNID  405

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQ+RIFSY+DTQRHRLGPNYLQLPVNAPKC HH
Sbjct  406  NFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCTHH  465

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR+D  RHAE+ PIPP VL GKRD+C+IEKENNFKQPGE
Sbjct  466  NNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGE  525

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RWVEALSDPRVT EIRSIWISYWTQADKSLGQK+AS LNVRP+M
Sbjct  526  RYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  584



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   450 bits (1158),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  314  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYDP RHAE++PIP  + TGKR+KC+I+KENNFKQPG+
Sbjct  374  NNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWVEALSDPR+T+EIR+IWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   450 bits (1157),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLF+QI+DP  ED+FDFDPLDVTKTWPEDLLPLQPVGR+VLNKNID
Sbjct  242  DLYDSIAAGNYPEWKLFVQIIDPADEDKFDFDPLDVTKTWPEDLLPLQPVGRMVLNKNID  301

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  302  NFFTENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  361

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMN MHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  362  NNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  421

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  422  RYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  480



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   450 bits (1158),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 208/238 (87%), Positives = 225/238 (95%), Gaps = 0/238 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIA GNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIADGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEV YFPSRYDP RHAEQ PIPP +L+GKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVIYFPSRYDPVRHAEQSPIPPVMLSGKRNKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPT  145
            R+RSW  DRQERFI R V ALSDPRVTHE+ +IW+SYW+QADKSLGQK+ASRLNV+P+
Sbjct  434  RFRSWDPDRQERFIRRIVGALSDPRVTHEVCTIWVSYWSQADKSLGQKIASRLNVKPS  491



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   450 bits (1158),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDP HEDRFDFDPLDVTKTWPED+ PLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPAHEDRFDFDPLDVTKTWPEDIFPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP+I+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPSIIVPGLYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++PIP  + +GKR+KCII+KENNF+QPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPTAICSGKREKCIIDKENNFQQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWV+ALSDPRVT+EIRSIWISYW++ADKSLGQKLASRL+VRP++
Sbjct  434  RYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWISYWSKADKSLGQKLASRLSVRPSI  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   443 bits (1139),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKLF+Q +DP+HED+FDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  70   DLHDSIAAGNYPEWKLFVQTIDPEHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  129

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYLQLP NAPKCAHH
Sbjct  130  NFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHH  189

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSRYDP RHAE  PIPP + +G+R+KC IEKENNFKQPGE
Sbjct  190  NNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGE  249

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQ+RF  RWV+ALSDPRVTHEIRS+WISYW+QAD+SLGQK+ASRL++RP +
Sbjct  250  RYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  308



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   449 bits (1156),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYD  RHAE++P PP V +GKR++C+I KENNFK+PGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+  +RQERFICRW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   449 bits (1154),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  237  DLYDSIAAGNYPEWKLFIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  296

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  297  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  356

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYD  RHAE +PIP  V +GKR+KCII+KENNFKQPGE
Sbjct  357  NNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGE  416

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+++ DRQERFI RWVEALSDPR+T+EIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  417  RYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  475



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   449 bits (1155),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDP  ED+FDFDPLDVTKTWPE+LLPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPADEDKFDFDPLDVTKTWPEELLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NF AENEQLAFCPAI+VPG+YYSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVN+PKC+HH
Sbjct  314  NFLAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNSPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP +
Sbjct  434  RYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   449 bits (1155),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  314  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYDP RHAE++PIP  + TGKR+KC+I+KENNFKQ G+
Sbjct  374  NNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQAGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWVEALSDPR+T+EIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   449 bits (1155),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYD  RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAPPAVCSGKRERCVIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+  +RQERFI RW+EALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>prf||1906388A catalase
Length=492

 Score =   449 bits (1154),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYD  RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   448 bits (1153),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  247  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  306

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NF  ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  307  NFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  366

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYDP RHAE++PIP  + TGKR+KC+I+KENNFKQPGE
Sbjct  367  NNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGE  426

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWVE LSDPR+T+EIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  427  RYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  485



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   449 bits (1154),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLY SIAAGNYPEWKL+IQ MDPDHEDRFDFDPLDVTKTWPED+LPLQ VGR+VLNKNID
Sbjct  254  DLYGSIAAGNYPEWKLYIQTMDPDHEDRFDFDPLDVTKTWPEDILPLQAVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNF+HRDEEVNYFPSRYDP RHAE+ PIP R+LTG+R+KC+I+KENNFKQPGE
Sbjct  374  NNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIPSRILTGRREKCVIQKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQ RFI RWVEALSDPRVTHEI+SIWISYW+Q DKSLG+K+A+RLNV+P+M
Sbjct  434  RYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGRKIATRLNVKPSM  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   449 bits (1154),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYD  RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   449 bits (1154),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYD  RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_012065377.1| PREDICTED: catalase-2 [Jatropha curcas]
 gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   449 bits (1154),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPLDEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPPNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++PIPP VLTG+R+K +I KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPPVLTGRREKTVIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DR++RFI RWVEALSDPRVT+EIRSIWISYW+QADKSLGQK+AS LN+RPTM
Sbjct  434  RYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKIASHLNMRPTM  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   448 bits (1153),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYD  RHAE++P PP V +GKR++CIIEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   448 bits (1153),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHED+FDFDPLDV+K WPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVSKIWPEDIVPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG++YSDDKLLQTR+FSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE+ P+PPRVLTGKR+KC+I KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLPPRVLTGKREKCVIGKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQERF+ RWVEALSD RVTHEIR IWI+YW+Q DKSLGQKLA+RLN+RP+M
Sbjct  434  RYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWITYWSQCDKSLGQKLATRLNMRPSM  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   448 bits (1152),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DP  ED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP IVVPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRD+EV+YFPSRYDP RHAE++PIPP VL G RD+ II+KENNFKQPGE
Sbjct  374  NNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIPPNVLNGNRDRQIIQKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW   RQERFICRWV+ALSDPR+THEIR+IWISYW+QADKS+G KLASRLNVRPTM
Sbjct  434  RYRSWDPARQERFICRWVDALSDPRITHEIRNIWISYWSQADKSVGMKLASRLNVRPTM  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   448 bits (1152),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYD  RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+++ +RQERFI RW++ALSDPR+THEIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   447 bits (1151),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDP HEDRFDFDPLDVTKTWPED+ PLQP+GRLVLNKNID
Sbjct  246  DLYDSIAAGNYPEWKLFIQTMDPAHEDRFDFDPLDVTKTWPEDIFPLQPLGRLVLNKNID  305

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  306  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  365

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYDP RHAE +PIP  V +GKR+KCII+KENNF+QPGE
Sbjct  366  NNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPIPTTVCSGKREKCIIQKENNFQQPGE  425

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DRQERFI RWVEALSDPR+T+EIRSIWISYW+QADKSLGQKLASRLNVRP++
Sbjct  426  RYRSFSADRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   447 bits (1151),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 205/236 (87%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AG+YPEWKL+IQ +DPDHED++DFDP+DVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIEAGSYPEWKLYIQTIDPDHEDKYDFDPVDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR DP  HAE++P PP V TGKR++C+IEKENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQPPAVYTGKRERCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVR  151
            RYRSW  DRQERF+ RWV+ALSDPRVTHEIR+IWISYW+QADKSLGQKLASRLNV+
Sbjct  434  RYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGQKLASRLNVK  489



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   447 bits (1151),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGN+PEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGRLVLN+NID
Sbjct  254  DLYDSIAAGNFPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDVLPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPK AHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKNAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHA++ PIP    +G+R+K  IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHADKVPIPSVPFSGRREKVSIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQERFI RWV+ALSDPR+T EIRSIWISYWTQADKSLGQKLASRLNVRPTM
Sbjct  434  RYRSWDPDRQERFIRRWVDALSDPRLTQEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   447 bits (1150),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  314  NFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYD  RHAE +PIP  V +GKR+KCII+KENNFKQPGE
Sbjct  374  NNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+++ DRQERFI RWVEALSDPR+T+EIRSIWI+YW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   447 bits (1150),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKL+IQ +DP+ ED+FDFDPLDVTK WPED+LPLQPVGR+VLNKNID
Sbjct  254  DLHDSIAAGNYPEWKLYIQTLDPEQEDKFDFDPLDVTKIWPEDVLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTRIFSY+D+QRHRLGPNYLQ+P NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGPNYLQIPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE+ P+PPR+L GKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW++DRQERF+ RWV+ALS+PRVTHEIRSIWISYW+QAD+SLGQK+AS LN++P++
Sbjct  434  RYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   447 bits (1149),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEW+LFIQIMDPDHEDRFDFDPLDV+K WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWRLFIQIMDPDHEDRFDFDPLDVSKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            N+FAE EQLAF PA VVPG+YY++DKLLQTRIF+Y DTQRHRLGPNY+QLPVNAPKCAHH
Sbjct  314  NYFAETEQLAFNPAFVVPGIYYTEDKLLQTRIFAYGDTQRHRLGPNYMQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSR+DP RHA +HPIP  VL GKRD+C+I KENNFKQ GE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIPSTVLRGKRDRCVIPKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFICRWV+ LSD RVTHEIRSIWISYW+QADKSLGQK+A+RLNVRPTM
Sbjct  434  RYRSWAPDRQERFICRWVDILSDARVTHEIRSIWISYWSQADKSLGQKMATRLNVRPTM  492



>emb|CDP01802.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   446 bits (1146),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 209/246 (85%), Positives = 229/246 (93%), Gaps = 7/246 (3%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPD+ED++DFDPLDVTKTWPED+LPLQPVGRLVLN+NID
Sbjct  224  DLYDSIAAGNYPEWKLFIQTIDPDYEDKYDFDPLDVTKTWPEDILPLQPVGRLVLNRNID  283

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPAIVVPG++YSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  284  NFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  343

Query  498  NNHHDGFMNFMHRDEE-------VNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKEN  340
            NNHHDGFMNFMHRDEE       V+YFPSRYDP RHAE HPIP  VLTG+R+K II KEN
Sbjct  344  NNHHDGFMNFMHRDEEHCTFCPCVDYFPSRYDPVRHAEMHPIPSAVLTGRREKTIIPKEN  403

Query  339  NFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRL  160
            NFKQPGERYRS++ DRQERFICRWV+ALSDPRVT+EIRSIWISYW+QADKSLGQKLASRL
Sbjct  404  NFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRL  463

Query  159  NVRPTM  142
            N+RP++
Sbjct  464  NIRPSI  469



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   445 bits (1145),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPEDLLPLQPVGR+VLNKNID
Sbjct  242  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDLLPLQPVGRMVLNKNID  301

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKC HH
Sbjct  302  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCGHH  361

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRY+P RHAE++P PP V  GKR++C+IEKENNFK+PGE
Sbjct  362  NNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKYPTPPAVCAGKRERCVIEKENNFKEPGE  421

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR +  +RQERFI RW+EALSDPR+THEIRSIWISYW+QADKSLGQKLAS LNVRP +
Sbjct  422  RYRYFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASHLNVRPNI  480



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   446 bits (1146),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 204/243 (84%), Positives = 231/243 (95%), Gaps = 4/243 (2%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ++DP  ED+FDFDPLDVTKTWPE+LLPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQVIDPADEDKFDFDPLDVTKTWPENLLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  433

Query  318  RYRSWSTD----RQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVR  151
            RYRS++ +    RQERFI RW+EALSDPR+THEIRSIWISYW+QADK+LGQKLASRLNVR
Sbjct  434  RYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVR  493

Query  150  PTM  142
            P++
Sbjct  494  PSI  496



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   446 bits (1146),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHEDRFDFDPLD TKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDRFDFDPLDDTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA VVPGVYYS+DK+LQTR+F+YSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFNPAFVVPGVYYSNDKMLQTRLFAYSDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRY P RHAE  PIP  ++TGKRDKC+IEKENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIPSNIITGKRDKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ LS+PRVT+EIRSIWISYW+QAD+S GQKLA+RLNVRP++
Sbjct  434  RYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   445 bits (1145),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPL PVGRLVLNKNID
Sbjct  252  DLYDSIKAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLMPVGRLVLNKNID  311

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  312  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  371

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++P P  + TGKR+KCIIEKENNFKQPGE
Sbjct  372  NNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGE  431

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DR+ERF+ RWVEALSDPRVT+EIRSIWISYW+QADKSLGQKLAS LN+RP++
Sbjct  432  RYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  490



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   445 bits (1145),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ MDPDHEDRFDFDPLD+TKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTMDPDHEDRFDFDPLDLTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA VVPG+YYSDDKLLQTRIF+YSDTQRHRLGPNY+QLPVNAPKC HH
Sbjct  314  NFFAENEQLAFNPAFVVPGIYYSDDKLLQTRIFAYSDTQRHRLGPNYMQLPVNAPKCPHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH DGFMNFMHRDEEVNYFPSRYDP RHAE+ PIP  +LTGKR++ +IEKENNFKQPGE
Sbjct  374  NNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSNILTGKRERRVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI R V+ALSDPRV+HEIRSIWISYW+QADKSLGQK+A+RLNVRP++
Sbjct  434  RYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWISYWSQADKSLGQKIATRLNVRPSI  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   445 bits (1144),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ++DP  ED+FDFDPLDVTKTWPE+LLPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQVIDPADEDKFDFDPLDVTKTWPENLLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERFI RW+EAL DPR+THEIRSIWI YW+QADK+ GQKLASRLNVRP++
Sbjct  434  RYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIFYWSQADKTFGQKLASRLNVRPSI  492



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   445 bits (1144),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPL PVGRLVLNKNID
Sbjct  254  DLYDSIKAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLMPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++P P  + TGKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DR+ERF+ RWVEALSDPRVT+EIRSIWISYW+QADKSLGQKLAS LN+RP++
Sbjct  434  RYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  492



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   444 bits (1142),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DP  E++FDFDPLDVTKTWPED+LPLQPVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPADEEKFDFDPLDVTKTWPEDILPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP+IVVPGVYYSDDKLLQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE++PIP  +L+G  +KC+I KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPSAILSGNCEKCVIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S+DR+ERFI RWVEA+SDPRVT+EIRSIWISYW QADKSLGQK+AS LN+RPTM
Sbjct  434  RYRSFSSDRKERFIRRWVEAMSDPRVTYEIRSIWISYWYQADKSLGQKIASHLNMRPTM  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   444 bits (1142),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLY+SIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYESIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG+ YSDDK+LQTRIFSY+D+QRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGISYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++PIPP + TG R++C IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQ+RF+ RWV+ALSDPRVTHEIRS WISYW+QAD+SLGQK+AS LN+RP++
Sbjct  434  RYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWISYWSQADRSLGQKIASHLNLRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   444 bits (1141),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DP  ED+FDFDP+DVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPADEDKFDFDPVDVTKTWPEDIVPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            +FFAENEQLAFCP I+VPG++YSDDKLLQTR+FSYSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  SFFAENEQLAFCPGIIVPGIHYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P+P  V +G+R++CIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVPSVVCSGRRERCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DR+ERFI RW+EALSDPR+THEIRSIWISYW+QAD+SLGQKLASR+NVRP +
Sbjct  434  RYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRMNVRPNI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   444 bits (1141),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKLF+Q +DP+HED+FDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLHDSIAAGNYPEWKLFVQTIDPEHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSRYDP RHAE  PIPP + +G+R+KC IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQ+RF  RWV+ALSDPRVTHEIRS+WISYW+QAD+SLGQK+ASRL++RP +
Sbjct  434  RYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   444 bits (1142),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTK WPED+LPL PVGRLVLN+N+D
Sbjct  275  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKIWPEDILPLMPVGRLVLNRNVD  334

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENE LAF P+++VPG+Y+S+DK+LQTRIF+Y+DTQRHR+GPNYLQLPVNAPKC HH
Sbjct  335  NFFAENEMLAFSPSMIVPGIYFSNDKMLQTRIFAYADTQRHRIGPNYLQLPVNAPKCPHH  394

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNFMHRDEEVNYFPSRYDPCRHAE+ PIPP VL+G+R K +IEKENNFKQPG+
Sbjct  395  NNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIPPVVLSGQRVKTVIEKENNFKQPGD  454

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RW++ALSDPR+T EIRSIW+SYWTQADKSLGQKLASRLNVRP M
Sbjct  455  RYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVSYWTQADKSLGQKLASRLNVRPAM  513



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   443 bits (1140),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPL PVGRLVLNKNID
Sbjct  254  DLYDSIRAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLMPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++P P  + TGKR+KCIIEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DR+ERF+ RWVEALSDPRVT+EIRSIWISYW+QADKSLGQKLAS LN+RP +
Sbjct  434  RYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   442 bits (1138),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPL PVGRLVLNKNID
Sbjct  238  DLYDSIRAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLMPVGRLVLNKNID  297

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  298  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  357

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++P P  + TGKR+KCIIEKENNFKQPGE
Sbjct  358  NNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGE  417

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DR+ERF+ RWVEALSDPRVT+EIRSIWISYW+QADKSLGQKLAS LN+RP +
Sbjct  418  RYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  476



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   443 bits (1139),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPA++VPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLPVNAPK AHH
Sbjct  314  NFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKSAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR+DP RHAE HPIP  V TG+R+K IIEKENNFKQ GE
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRFDPVRHAESHPIPSAVYTGRREKSIIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQER+I RWV+ALSDPR THEIRSIWISYW+QADKSLGQKLAS LNVRP  
Sbjct  434  RYRSFAPDRQERYIRRWVDALSDPRCTHEIRSIWISYWSQADKSLGQKLASHLNVRPNF  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   442 bits (1138),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKLF+Q +DP+HED+FDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLHDSIAAGNYPEWKLFVQTIDPEHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSRYDP RHAE+ PIPP + +G+R+KC IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQ+RF  RWV+ALSDPRVTHEIRS+WISYW+QAD+SLGQK+AS L+ RP +
Sbjct  434  RYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRPNI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   442 bits (1137),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLY+SIAAGNYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  255  DLYESIAAGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  314

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYLQLP NAPKCAHH
Sbjct  315  NFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHH  374

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSR+DP RHAE+ P PP  L+GKR++CI  KENNFKQPGE
Sbjct  375  NNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGE  434

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+W+ DRQ+RF  RW+EALSDPRVTHE+RSIWISYW+QAD+SLGQK+AS LN+RP++
Sbjct  435  RYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  493



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   442 bits (1138),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPL PVGRLVLNKNID
Sbjct  273  DLYDSIRAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLMPVGRLVLNKNID  332

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHH
Sbjct  333  NFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHH  392

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE++P P  + TGKR+KCIIEKENNFKQPGE
Sbjct  393  NNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGE  452

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+S DR+ERF+ RWVEALSDPRVT+EIRSIWISYW+QADKSLGQKLAS LN+RP +
Sbjct  453  RYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  511



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   442 bits (1136),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLY+SIAAGNYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLYESIAAGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSR+DP RHAE+ P PP  L+GKR++CI  KENNFKQPGE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+W+ DRQ+RF  RW+EALSDPRVTHE+RSIWISYW+QAD+SLGQK+AS LN+RP++
Sbjct  434  RYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   441 bits (1135),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 203/243 (84%), Positives = 229/243 (94%), Gaps = 4/243 (2%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGN PEWKLFIQ++DP  ED+FDFDPLDVTKTWPE+LLPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNSPEWKLFIQVIDPADEDKFDFDPLDVTKTWPENLLPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++C+IEKENNFK+PG 
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGG  433

Query  318  RYRSWSTD----RQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVR  151
            RYRS++ D    RQERFI RW+EALSDPR+THEIRSIWISYW+QADK+LGQKLASRLNVR
Sbjct  434  RYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVR  493

Query  150  PTM  142
            P++
Sbjct  494  PSI  496



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   442 bits (1137),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 208/265 (78%), Positives = 231/265 (87%), Gaps = 26/265 (10%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DP  ED+FDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDK--------------  361
            NNHHDGFMNFMHRDEEVNYFPSRYDP RHAE++P PP V +GKR++              
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERVSNQIKPIFFSVSV  433

Query  360  ------------CIIEKENNFKQPGERYRSWSTDRQERFICRWVEALSDPRVTHEIRSIW  217
                        CIIEKENNFK+PGERYRS++ +RQERFI RW+EALSDPR+THEIRSIW
Sbjct  434  SYGSESLKFVLQCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIW  493

Query  216  ISYWTQADKSLGQKLASRLNVRPTM  142
            ISYW+QADKSLGQKLASRLNVRP++
Sbjct  494  ISYWSQADKSLGQKLASRLNVRPSI  518



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   441 bits (1135),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKLFIQ +DP HED+FDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLHDSIAAGNYPEWKLFIQTIDPAHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSRYD  RHAE  PIPP + +G+R+KC IEKENNFKQ GE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RSW+ DRQ+RFI RWV+ALSDPRVTHEIRS+WISYW+QAD+SLGQK+AS LN+RP +
Sbjct  434  RFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   441 bits (1133),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+DPDHEDRF+FDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDPDHEDRFNFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDKLLQ+RIFSY+DTQRHRLGPNYLQLP NAPK AHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPANAPKSAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR+D  RH+E+HP+PP VLTG+  + +IEKENNFKQPGE
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRFDSVRHSEKHPLPPPVLTGRCTRAMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+  DRQERFI R V+ALSDPRVTHEIRSIWISYW+QADKSLG+K+ASRLNVRP++
Sbjct  434  RYRSFPPDRQERFIRRVVDALSDPRVTHEIRSIWISYWSQADKSLGEKIASRLNVRPSI  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKLFIQ +DP HED+FDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLHDSIAAGNYPEWKLFIQTIDPAHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSRYD  RHAE  PIPP + +G+R+KC IEKENNFKQ GE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RSW+ DRQ+RFI RWV+ALSDPRVTHEIRS+WISYW+QAD+SLGQK+AS LN+RP +
Sbjct  434  RFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   440 bits (1131),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYP+W LF+Q+MDP HED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPQWNLFVQVMDPAHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQ+AFCPA+VVPG++YSDDKLLQTRIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR DP RHAE++P  P V +G R+KC I KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFIRKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW +DRQERF+ R+VEALS+PRVTHEIRSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  434  RYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   440 bits (1131),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ MDPDHED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTMDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP IVVPG+ YS+DKLLQTRIFSYSDTQRHRLG NYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPGIVVPGISYSEDKLLQTRIFSYSDTQRHRLGSNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR DP RH+E+ PIP  + +G+RDKC+IEKENNF+QPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIPSTICSGRRDKCVIEKENNFEQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ R V  LSDPR+THE+RSIWISYWTQ D+SLGQKLA RLNVRP++
Sbjct  434  RYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWISYWTQCDRSLGQKLAFRLNVRPSI  492



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   439 bits (1130),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+D   ED+FDFDPLDVTKTWPED+LPL PVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDQADEDKFDFDPLDVTKTWPEDILPLLPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGV YSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP RHAE+HPIP  V+ GKR++ II KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERHPIPSNVINGKRERQIIAKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFICR V+ALSDPR+THEIRSIW+SYW+QADKSLG K+ASRLNVRPTM
Sbjct  434  RYRSMDPARQERFICRVVDALSDPRITHEIRSIWVSYWSQADKSLGMKVASRLNVRPTM  492



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   439 bits (1130),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYP+W LF+Q+MDP HED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPQWNLFVQVMDPAHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQ+AFCPA+VVPG++YSDDKLLQTRIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR DP RHAE++P  P V +G R+KC I KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFIGKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW +DRQERF+ R+VEALS+PRVTHEIRSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  434  RYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF  492



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   434 bits (1116),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D DHED+FDFDPLDVTKTWPED++PLQPVGR+VLNKN+D
Sbjct  115  DLYDSIAAGNYPEWKLYIQTIDLDHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNVD  174

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  175  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  234

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR+DP RHAE+ PIPPRVLTG R+KCII+KENNFKQ GE
Sbjct  235  NNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGE  294

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+AL+DPRVTHE R+IWISYW+Q D +LGQKLASRLN++P+M
Sbjct  295  RYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  353



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   439 bits (1128),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDPDHED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPDHEDQFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAF PA VVPG+YYS+DKLLQ RIF+YSDT RHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQLAFNPAHVVPGIYYSEDKLLQGRIFAYSDTHRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG+MN MHRDEE++YFPSRYDP RHAE+HPIP RVLTG+R++ +IEKENNFKQP E
Sbjct  374  NNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIPTRVLTGRRERRVIEKENNFKQPVE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ALSDPR+THEIRSIWISYW+QADKSLGQK+A RLNVRPTM
Sbjct  434  RYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKIAFRLNVRPTM  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   436 bits (1120),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 224/234 (96%), Gaps = 0/234 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKL+IQ +DP+ ED+FDFDPLDVT+  PED+LPLQPVGR+VLNKNID
Sbjct  195  DLHDSIAAGNYPEWKLYIQTLDPEQEDKFDFDPLDVTRICPEDVLPLQPVGRMVLNKNID  254

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDKLLQTRIFSY+D+QRHRLGPNYLQ+P NAPKCAHH
Sbjct  255  NFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGPNYLQIPANAPKCAHH  314

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RHAE+ P+PPR+L GKR+KC+IEKENNFKQPGE
Sbjct  315  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGE  374

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLN  157
            RYRSW++DRQERF+ RWV+ALS+PRVTHEIRSIWISYW+QAD+SLGQK+AS LN
Sbjct  375  RYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLN  428



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   438 bits (1126),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI+AGNYPEWKL+IQIMDP HED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSISAGNYPEWKLYIQIMDPAHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP IVVPGV YS+DKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR DP R+AE  P+P  + +GKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ R V  LSDPR+THE+R+IWISYW Q DKSLGQKLA+RLNV+P++
Sbjct  434  RYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKLATRLNVKPSI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   436 bits (1121),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 203/222 (91%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  819  WKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQLAFCP  640
            WKLFIQ +DPDHE RFDFDPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQLAFCP
Sbjct  225  WKLFIQTIDPDHEARFDFDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCP  284

Query  639  AIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHR  460
            AIVVPGVYYSDDKLLQTRIFSY+DTQRHRLGPNYLQLP NAPKCAHHNNHH+GFMNFMHR
Sbjct  285  AIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHR  344

Query  459  DEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTDRQERF  280
            DEEVNYFPSRYDP RHAE  PIPP V +GKR++CIIEKENNFKQPGERYRSW+ DRQERF
Sbjct  345  DEEVNYFPSRYDPVRHAESFPIPPAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERF  404

Query  279  ICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNV  154
            ICRWV+ALSDPRVTHEIRSIWISYW+QADKSLGQKLASRLNV
Sbjct  405  ICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  446



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   437 bits (1124),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 201/237 (85%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEW LF+Q+MDP HED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWHLFVQVMDPAHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQ+AFCPAIVVPGV+YSDDKLLQTRIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR +P RHA+++P  P   +G R+KC+IEKENNF+QPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPTTPVFCSGNREKCMIEKENNFQQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  148
            RYRSW  DRQERF+ R+VEAL++PRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP
Sbjct  434  RYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   437 bits (1124),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIA+GNYPEWKLFIQ +DP  ED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIASGNYPEWKLFIQTIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP+IVVPGV+YSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPSIVVPGVHYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP RHAE++PIP  VL G R+K  I KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERYPIPSNVLNGCREKQCIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFICR V+ALSDPRVTHEIRSIWISYW+QADKSLG K+ASRLNVRPTM
Sbjct  434  RYRSMDPARQERFICRVVDALSDPRVTHEIRSIWISYWSQADKSLGMKVASRLNVRPTM  492



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   437 bits (1123),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 201/237 (85%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEW LF+Q+MDP HED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWHLFVQVMDPAHEDKFDFDPLDVTKIWPEDVLPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQ+AFCPAIVVPGV+YSDDKLLQTRIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR +P RHA+++P  P   +G R+KC+IEKENNF+QPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPTTPVFCSGNREKCMIEKENNFQQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  148
            RYRSW  DRQERF+ R+VEAL++PRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP
Sbjct  434  RYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   436 bits (1122),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 200/237 (84%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIA+GNYPEW LF+Q+MDP HED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIASGNYPEWNLFVQVMDPAHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQ+AFCPAIVVPGV+YSDDKLLQTRIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR +P RHA+++P  P   +G R+KC+IEKENNF+QPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPTTPVFCSGNREKCMIEKENNFQQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  148
            RYRSW  DRQERF+ R+VEAL++PRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP
Sbjct  434  RYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   436 bits (1121),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKLFIQ +DP+HED+FDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLHDSIAAGNYPEWKLFIQTIDPEHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYL LP NAPK AHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLLLPANAPKSAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSRYDP RHAE+ PIPP V +G+R+K  IEKENNFKQ GE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKIAIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RSW+ DRQ+RFI RWV+ALSDPRVTHEIRS+WISYW+QAD+SLGQK+AS LN+RP +
Sbjct  434  RFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   436 bits (1121),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D DHED+FDFDPLDVTKTWPED++PLQPVGR+VLNKN+D
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLDHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNVD  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR+DP RHAE+ PIPPRVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+AL+DPRVTHE R+IWISYW+Q D +LGQKLASRLN++P+M
Sbjct  434  RYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   436 bits (1121),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D DHED+FDFDPLDVTKTWPED++PLQPVGR+VLNKN+D
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLDHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNVD  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR+DP RHAE+ PIPPRVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+AL+DPRVTHE R+IWISYW+Q D +LGQKLASRLN++P+M
Sbjct  434  RYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  492



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   436 bits (1120),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DP  ED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPADEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPG++YSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHR EEV+YFPSRYDP RHAE+ PIP  + TG+R++ II KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRGEEVDYFPSRYDPVRHAEKFPIPSNICTGRRERQIIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFICR V+ALSDPR+THEIRSIWISYWTQADKSLG K+ASRLNV+ TM
Sbjct  434  RYRSMDPARQERFICRVVDALSDPRITHEIRSIWISYWTQADKSLGMKVASRLNVKATM  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   428 bits (1101),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKLFIQ +D DHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  64   DLTDSIAAGNYPEWKLFIQTIDADHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  123

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPA+ VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  124  NFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  183

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNF+HRDEEVNYFPSR+DP RHAE++P+PPRVL+G R+KCII+KENNFKQ GE
Sbjct  184  NNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGE  243

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RF+ RWV+AL+D RVTHEI+SIW+SYW+Q D SLGQKLASRL ++P M
Sbjct  244  RYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  302



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   435 bits (1119),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQI+D   ED+FDFDPLDVTKTWPED+LPL PVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIIDQADEDKFDFDPLDVTKTWPEDILPLLPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVVPGV YSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP RHAE+HPIP  V+ GKR++ II KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERHPIPSNVINGKRERQIIAKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFICR V+AL DPR+THEIRSIW+SYW QADKSLG K+ASRLNVRPTM
Sbjct  434  RYRSMDPARQERFICRVVDALFDPRITHEIRSIWVSYWFQADKSLGMKVASRLNVRPTM  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   434 bits (1116),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWK  IQIM P+HED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKPSIQIMGPEHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NF   NEQLAFCP+IVVPGVYYSDDK+LQTRIFSYSDTQR+RLGPNYLQLP NAPKCAHH
Sbjct  314  NFLYMNEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEE++YFPSRYD  RHAE +PIP  V +GKR+KCII+KENNFKQPGE
Sbjct  374  NNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWVEALSDPR+T+EIRSIWI+YW+QADKSLGQKLASRLNVRP++
Sbjct  434  RYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   434 bits (1115),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEW LF+Q+MDP HED++DFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWNLFVQVMDPAHEDKYDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQ+AFCPAIVVPGV+YSDDKLLQ+RIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQIAFCPAIVVPGVHYSDDKLLQSRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHR+EEVNYFPSR +P RHAE++P  P V +G R+KCII+KENNF+QPGE
Sbjct  374  NNHHEGFMNFMHREEEVNYFPSRLNPVRHAEKYPTSPIVCSGNREKCIIKKENNFQQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW +DRQERF+ R+VEAL++PRVTHEIRSIWISYW+QADKSLGQKLA+RLNV+P  
Sbjct  434  RYRSWDSDRQERFVKRFVEALAEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVKPNF  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   434 bits (1115),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGN+PEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLN+NID
Sbjct  254  DLYDSIAAGNFPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDIVPLQPVGRMVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPPNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP +HA ++PIP   LTG+R+K +I KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW   RQ+RFI RW++ALSDPR+THEIRSIW+SYW+QAD+SLGQKLASRL+ +P+M
Sbjct  434  RYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   434 bits (1115),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGN+PEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLN+NID
Sbjct  254  DLYDSIAAGNFPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDIVPLQPVGRMVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPPNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP +HA ++PIP   LTG+R+K +I KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW   RQ+RFI RW++ALSDPR+THEIRSIW+SYW+QAD+SLGQKLASRL+ +P+M
Sbjct  434  RYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   433 bits (1114),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ+MDP  ED FDFDPLD+TK WPED+LPLQPVGRLVLNKN+D
Sbjct  254  DLYDSIAAGNYPEWKLYIQVMDPALEDSFDFDPLDMTKEWPEDILPLQPVGRLVLNKNVD  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA VVPG+YYS+DKLLQ RIF+YSDT R+RLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFNPAFVVPGIYYSNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMN MHRDEE+NYFPS++DP RHAE++PIP +++TGKR+K IIEKENNFKQPGE
Sbjct  374  NNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKREKVIIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RW++AL++PRVTHE RSIWISYWTQADKSLGQKLASRL+ RP+M
Sbjct  434  RYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWISYWTQADKSLGQKLASRLSARPSM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   433 bits (1114),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGN+PEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLN+NID
Sbjct  254  DLYDSIAAGNFPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP +HA ++PIP   LTG+R+K +I KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSVNLTGRREKTVIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW   RQERFI RW++ALSDPR+THEIRSIW+SYW+QAD+SLGQKLASRL+ +P+M
Sbjct  434  RYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_012073648.1| PREDICTED: catalase isozyme 1 [Jatropha curcas]
Length=492

 Score =   433 bits (1113),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ MDPDHEDRFDFDPLDVTKTWPED+LPL PVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTMDPDHEDRFDFDPLDVTKTWPEDILPLHPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENE LAFCP IVVPGV YS+DKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEMLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSRYDP RH+E  P P  + +GKR+KC+I KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRYDPVRHSEAFPFPATICSGKREKCVIPKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ R V  LSDPRVTHEI SIWI+Y+TQ D+SLGQKLASRLNV+P++
Sbjct  434  RYRSWAPDRQERFLNRIVGCLSDPRVTHEICSIWINYFTQCDRSLGQKLASRLNVKPSI  492



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   433 bits (1113),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ++DP  ED+FDFDPLDVT+TWPED+LPL PVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQVIDPVDEDKFDFDPLDVTRTWPEDILPLIPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP IVVPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPGIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR+DP RHAE++PIP  VL G+R+K II KENNF++PG 
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKYPIPQNVLNGRREKQIIAKENNFEEPGV  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQERFICRW+ ALSDPRVT EIRSIWISYW+QADKSLG KLA+RLNV+PTM
Sbjct  434  RYRSFDPARQERFICRWIGALSDPRVTPEIRSIWISYWSQADKSLGMKLANRLNVKPTM  492



>gb|KHG21219.1| Catalase isozyme 1 [Gossypium arboreum]
Length=432

 Score =   430 bits (1106),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 219/239 (92%), Gaps = 6/239 (3%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHE RFDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  200  DLYDSIAAGNYPEWKLFIQTIDPDHEQRFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  259

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAIVV G+YYSDDKLLQTR+FSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  260  NFFAENEQLAFCPAIVVRGIYYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPANAPKCAHH  319

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDE++NYFPSRYDP  HAE+ PIPP + TGKR+K      NNFKQPGE
Sbjct  320  NNHHEGFMNFMHRDEQINYFPSRYDPSHHAERFPIPPALCTGKREK------NNFKQPGE  373

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI  WV+ALSDPRVTHEI SIWI+YW+QADKSLGQKLA RLNVRP++
Sbjct  374  RYRSWAPDRQERFINSWVDALSDPRVTHEICSIWITYWSQADKSLGQKLACRLNVRPSI  432



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   432 bits (1111),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLF+Q +DP HED+FDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFVQTIDPAHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYLQLP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSR+DP RHAE+ PIP    +  R+KC I K+NNFKQPGE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRHDPVRHAEKVPIPTANFSACREKCNIPKQNNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQ+RF+ RWV+ALSDPRVTHEIRSIWISYW+QAD+SLGQK+AS LN+RP++
Sbjct  434  RYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   432 bits (1110),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D DHED+FDFDPLDVTKTWPED++PLQPVGR+VLNKN+D
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLDHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNVD  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAISVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR+DP RHAE+ PIPPRVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+AL+DPRVTHE R+IWISYW+Q D +LGQKL SRLN++P+M
Sbjct  434  RYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLPSRLNLKPSM  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   428 bits (1101),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKLFIQ +D DHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  160  DLTDSIAAGNYPEWKLFIQTIDADHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  219

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPA+ VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  220  NFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  279

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNF+HRDEEVNYFPSR+DP RHAE++P+PPRVL+G R+KCII+KENNFKQ GE
Sbjct  280  NNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGE  339

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RF+ RWV+AL+D RVTHEI+SIW+SYW+Q D SLGQKLASRL ++P M
Sbjct  340  RYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  398



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   432 bits (1110),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEW LF+Q+MDP HED+FDFDPLDVTK WPED+LP+QPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPEWNLFVQVMDPAHEDKFDFDPLDVTKIWPEDVLPMQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQ+AFCPA+VVPG++YSDDKLLQ+RIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQIAFCPALVVPGIHYSDDKLLQSRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHR+EEVNYFPSR+DP R+A+++P  P V +G R+KCII KENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRNEEVNYFPSRFDPVRNAQKYPTTPIVCSGNREKCIIGKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW + RQERF+ R+VEAL++PRVTHEIRSIWISYW+QADKSLGQKLASRLN RP+ 
Sbjct  434  RYRSWDSARQERFVKRFVEALAEPRVTHEIRSIWISYWSQADKSLGQKLASRLNARPSF  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   432 bits (1110),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLTDSIAAGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCA+H
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNFMHRDEEVNYFPSR+D  RHAE+ PIPPRVLTG R+KC+I+KENNFKQ GE
Sbjct  374  NNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RF+ RWV+ALSDPR+THE+R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   433 bits (1114),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGN+PEWKL+IQ +D DHED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  309  DLYDSIAAGNFPEWKLYIQTIDADHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  368

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  369  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  428

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR+DP RHAE+ PIPPRVLTG R+KCII KENNFKQ GE
Sbjct  429  NNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIHKENNFKQAGE  488

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI R V+ALSDPRVTHE RSIWISYW+Q D SLGQKLASRLN++P M
Sbjct  489  RYRSFDPARQDRFIQRVVDALSDPRVTHEHRSIWISYWSQCDASLGQKLASRLNLKPNM  547



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   431 bits (1108),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKLFIQ +DP+HED+FDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLHDSIAAGNYPEWKLFIQTIDPEHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDK+LQTRIFSY+D+QRHRLGPNYL LP NAPK AHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLLLPANAPKSAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSRYDP RHAE+ PIPP + +G+R+K  IEKENNFKQ GE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RSW+ DRQ+RF  RWV+ALSDPRVTHEIRS+WISYW+QAD+SLGQK+AS L++RP +
Sbjct  434  RFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   431 bits (1108),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D DHED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLDHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+A CPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIALCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPSRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPRVTHE  +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   431 bits (1108),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLTDSIAAGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCA+H
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNFMHRDEEVNYFPSR+D  RHAE+ PIPPRVLTG R+KC+I+KENNF+Q GE
Sbjct  374  NNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RF+ RWV+ALSDPR+THE+R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   431 bits (1107),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D +HED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLEHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPRVTHE  +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   430 bits (1106),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLTDSIAAGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCA+H
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNFMHRDEEVNYFPSR+D  RHAE+ PIPPRVLTG R+KC+I+KENNF+Q GE
Sbjct  374  NNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RF+ RWV+ALSDPR+THE+R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   430 bits (1106),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLTDSIAAGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCA+H
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNFMHRDEEVNYFPSR+D  RHAE+ PIPPRVLTG R+KC+I+KENNF+Q GE
Sbjct  374  NNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RF+ RWV+ALSDPR+THE+R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   430 bits (1106),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIA+GNYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLTDSIASGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTR+FSY+DTQRHRLGPNYL LPVNAPKCA+H
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLMLPVNAPKCAYH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNFMHRDEEVNYFPSR+D  RHAE+ P+PPRVLTG R+KC+I KENNFKQ GE
Sbjct  374  NNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVPPRVLTGCREKCVINKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPR+THE+R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   430 bits (1105),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D DHED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLDHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG R+KCIIEKENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPTRHAEKVPIPSRVLTGCREKCIIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RS+   RQ+RFI RWV+ALSDPRVTHE  +IWI+YW+Q D SLGQKLASRLN++P M
Sbjct  434  RFRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWINYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   430 bits (1105),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D +HED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLEHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPRVTHE  +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYP+W LF+Q+MDP HED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGNYPQWNLFVQVMDPAHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQ+AFCPA+VVP ++YSDD +LQTRIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQIAFCPALVVPFIHYSDDNVLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR DP RHAE++P  P V +G R+KC I KENNFKQPGE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFIRKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW +DRQERF+ R+VEAL +PRVTHEIRSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  434  RYRSWDSDRQERFVKRFVEALWEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 219/237 (92%), Gaps = 0/237 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQ MDP+HED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIKAGNYPEWKLFIQTMDPEHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENE LAF PA+VVPG+YY++DK+LQ RIF+YSDTQRHRLGPNYLQLPVNAPKCA H
Sbjct  314  NFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGPNYLQLPVNAPKCAFH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNFMHRDEEV+YFPSR+DP RHAE  PIP  +  GKR+K +IEKENNFKQPGE
Sbjct  374  NNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  148
            RYRS++ DRQERFI RWVE LSDPRVT+EIRSIWISYW+QAD+SLGQKLASRLNV+P
Sbjct  434  RYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 219/237 (92%), Gaps = 0/237 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI AGNYPEWKLFIQ MDP+HED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIKAGNYPEWKLFIQTMDPEHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENE LAF PA+VVPG+YY++DK+LQ RIF+YSDTQRHRLGPNYLQLPVNAPKCA H
Sbjct  314  NFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGPNYLQLPVNAPKCAFH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNFMHRDEEV+YFPSR+DP RHAE  PIP  +  GKR+K +IEKENNFKQPGE
Sbjct  374  NNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  148
            RYRS++ DRQERFI RWVE LSDPRVT+EIRSIWISYW+QAD+SLGQKLASRLNV+P
Sbjct  434  RYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+DSIAAGNYPEWKLFIQ +DP+HED+FDFDPLDVTKTWPED++PLQPVGRLVLNKNID
Sbjct  254  DLHDSIAAGNYPEWKLFIQTIDPEHEDKFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPGVYYSDDK+LQTRIFSY+D QRHRLGPNYL LP NAPK AHH
Sbjct  314  NFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADPQRHRLGPNYLLLPANAPKSAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSRYDP RHAE+ PIPP + +G+R+K  IEKENNFKQ GE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RSW+ DRQ+RF  RWV+ALSDPRVTHEIRS+WISYW+QAD+SLGQK+AS L++RP +
Sbjct  434  RFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ  D +HED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTTDLEHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPRVTHE  +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D +HED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLEHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPRVTHE  +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D +HED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLEHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV ALSDPRVTHE  +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVGALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   429 bits (1103),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKLFIQ +D DHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLTDSIAAGNYPEWKLFIQTIDADHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPA+ VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNF+HRDEEVNYFPSR+DP RHAE++P+PPRVL+G R+KCII+KENNFKQ GE
Sbjct  374  NNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RF+ RWV+AL+D RVTHEI+SIW+SYW+Q D SLGQKLASRL ++P M
Sbjct  434  RYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   429 bits (1102),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAA NYPEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLTDSIAARNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCA+H
Sbjct  314  NFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNFMHRDEEVNYFPSR+D  RHAE+ PIPPRVLTG R+KC+I+KENNFKQ GE
Sbjct  374  NNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RF+ RWV+ALSDPR+THE+R IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   428 bits (1101),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D +HED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLEHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPRVTHE  +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   428 bits (1100),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ+MDP  ED FDFDPLD+TK WPED+LPLQPVGRLVLN+N+D
Sbjct  254  DLYDSIAAGNYPEWKLYIQVMDPALEDSFDFDPLDMTKIWPEDILPLQPVGRLVLNQNVD  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA VVPG+Y+S+DKLLQ RIF+YSDT R+RLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFNPAFVVPGIYFSNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEE+NYFPS++DP RHAE++PIP +++TGKR++ IIEKENNFKQ GE
Sbjct  374  NNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKRERVIIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERFI RW++ALS+PRVTHE RSIWISYWTQADKS+GQKLAS L+ RP+M
Sbjct  434  RYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISYWTQADKSIGQKLASSLSARPSM  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   427 bits (1099),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ MDP  ED++DFDPLDVTKTWPED+ PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTMDPRDEDKYDFDPLDVTKTWPEDIFPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF P ++VPGVYY++DKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFGPGLIVPGVYYTEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP    TGKR+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHTGKREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ +RQERF+ RWV ALSDPRVTHEI SIWISYW+Q DKSLGQK+A+RLN++  M
Sbjct  434  RYRSFAPERQERFVKRWVAALSDPRVTHEICSIWISYWSQCDKSLGQKIAARLNMKANM  492



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   427 bits (1098),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKLFIQ +D DHED+FDFDPLDVTKTWPED++PLQPVGR++LNKNID
Sbjct  254  DLTDSIAAGNYPEWKLFIQTIDADHEDKFDFDPLDVTKTWPEDIIPLQPVGRMILNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF+HRDEEVNYFPSR+DP RHA+++PIP RVLTG R+KCIIEKENNFKQ GE
Sbjct  374  NNHHEGFMNFIHRDEEVNYFPSRFDPTRHAQKYPIPTRVLTGCREKCIIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSD RVTHEI+ IWISYW+Q D SLGQKL SRL  +P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDARVTHEIQGIWISYWSQCDTSLGQKLGSRLKAKPNM  492



>sp|P55313.1|CATA2_WHEAT RecName: Full=Catalase [Triticum aestivum]
 emb|CAA64077.1| catalase [Triticum aestivum]
Length=492

 Score =   427 bits (1097),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKLFIQ +D DHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLTDSIAAGNYPEWKLFIQTIDADHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPA+ VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDG MNF+HRDEEVNYFPSR DP RHAE+ P+PPRVL+G R+KCII+KENNFKQ GE
Sbjct  374  NNHHDGLMNFIHRDEEVNYFPSRVDPTRHAEKDPMPPRVLSGCREKCIIDKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RF+ RWV+AL+D RVTHEI+SIW+SYW+Q D SLGQKLASRL ++P M
Sbjct  434  RYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   427 bits (1097),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DP  EDR+DFDPLDVTKTWPED+ PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPRDEDRYDFDPLDVTKTWPEDIFPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA+VVPG+YY++DKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP    +G R+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+  DRQERF+ RWV ALSDPRVTHEI SIWISYW+Q+DKSLGQK+A+RLN++  M
Sbjct  434  RYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWISYWSQSDKSLGQKIAARLNMKANM  492



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   427 bits (1097),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D +HED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLEHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG  +KCII+KENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCGEKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPRVTHE  +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIRRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006828715.1| PREDICTED: catalase-1/2 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   426 bits (1096),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ ++ +  DRFDFDPLDVTKTWPED+LPL  VGR+VLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTINLEDVDRFDFDPLDVTKTWPEDILPLLLVGRMVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFTENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNF HRDEEV+YFPSR+DP RHAE+ P+PP++ +GKR+KC+IEKENNFKQPGE
Sbjct  374  NNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMPPQICSGKREKCMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS++ DRQERFI RWV+ALSDPRVTHEI SIWISYW+Q DKSLGQKLA+ LN++P M
Sbjct  434  RYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWISYWSQCDKSLGQKLATHLNLKPNM  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   426 bits (1094),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DPDHED+FDFDPLDVTK WPED++PLQPVGRLVLNKNID
Sbjct  239  DLYDSIAAGNYPEWKLYIQTIDPDHEDQFDFDPLDVTKWWPEDIIPLQPVGRLVLNKNID  298

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENE LAF P IVVPG+YYS+DK+LQ RIF+Y DTQRHRLGPNYL LPVNAPKC H 
Sbjct  299  NFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHR  358

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP RHAE++PIP  V+TG+R+K  IEKENNFKQPGE
Sbjct  359  NNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGE  418

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RW++AL DPRVTHE+RSIW+SYW+QAD+SLGQKLASRLNVRP++
Sbjct  419  RYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  477



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   426 bits (1095),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D +HED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLEHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPV+APKCAHH
Sbjct  314  NFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVDAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RV TG R+KCII+KENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVQTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPRVTHE  +IWISYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   425 bits (1093),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DPDHED+FDFDPLDVTK WPED++PLQPVGRLVLNKNID
Sbjct  255  DLYDSIAAGNYPEWKLYIQTIDPDHEDQFDFDPLDVTKWWPEDIIPLQPVGRLVLNKNID  314

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENE LAF P IVVPG+YYS+DK+LQ RIF+Y DTQRHRLGPNYL LPVNAPKC H 
Sbjct  315  NFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHR  374

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP RHAE++PIP  V+TG+R+K  IEKENNFKQPGE
Sbjct  375  NNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGE  434

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RW++AL DPRVTHE+RSIW+SYW+QAD+SLGQKLASRLNVRP++
Sbjct  435  RYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  493



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   425 bits (1093),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D +HED+FDFDP DVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLEHEDKFDFDPFDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHA + PIP RVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAGKVPIPTRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+ALSDPRVTHE  +IW+SYW+Q D SLGQKLASRLN++P M
Sbjct  434  RYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWMSYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   425 bits (1092),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMD +  D+FDFDPLDVTKTWPED+LPL PVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDTEDVDKFDFDPLDVTKTWPEDILPLMPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF P  +VPGVYYS+DKLLQTRIF+Y+DTQRHR+GPNY+QLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH DG MNFMHRDEEV+Y PSR+DPCRHAEQ+PIP RVLTG+R+ C+IEKENNFKQ GE
Sbjct  374  NNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQ+R++ +WVE LSDPRVT+EIRSIWISY +QADKS GQK+ASRL V+PTM
Sbjct  434  RYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   421 bits (1081),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMD +  D+FDFDPLDVTKTWPED+LPL PVGRLVLN+NID
Sbjct  145  DLYDSIAAGNYPEWKLFIQIMDTEDVDKFDFDPLDVTKTWPEDILPLMPVGRLVLNRNID  204

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF P  +VPG+YYS+DKLLQTRIF+Y+DTQRHR+GPNY+QLPVNAPKCAHH
Sbjct  205  NFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHH  264

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH DG MNFMHRDEEV+Y PSR+DPCRHAEQ+PIP RVLTG+R+ C+IEKENNFKQ GE
Sbjct  265  NNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGE  324

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQ+R++ +WVE LSDPRVT+EIRSIWISY +QADKS GQK+ASRL ++PTM
Sbjct  325  RYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  383



>sp|P18122.1|CATA1_MAIZE RecName: Full=Catalase isozyme 1 [Zea mays]
Length=492

 Score =   424 bits (1090),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D DHED+FDFDPLDVTKTWPED++PLQPVGR+VLNKN+D
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLDHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNVD  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI VP ++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQIAFCPAISVPAIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR+DP RHAE+ PIPPRVLT  R+KCII+KENNFKQ GE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTRCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+   RQ+RFI RWV+AL+ PRVTHE R+IWISYW+Q D +LGQKL SRLN++P+M
Sbjct  434  RYRSFDPARQDRFIQRWVDALTHPRVTHEHRTIWISYWSQCDAALGQKLPSRLNLKPSM  492



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   424 bits (1090),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +D +HED+FDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDLEHEDKFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQ+AFCPAI+VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPV+APKCAHH
Sbjct  314  NFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVDAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP RVLTG R+KCII+KENNFKQ GE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+    Q+RFI RWV+ALSDPRVTHE  +IWISYW+Q D SLGQ+LASRLN++P M
Sbjct  434  RYRSFDPAGQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQELASRLNLKPNM  492



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   424 bits (1090),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 217/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DP  EDR+DFDPLDVTKTWPED+ PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLFIQTIDPRDEDRYDFDPLDVTKTWPEDIFPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF PA+VVPG+YY++DKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR+DP RHAE+ PIP    +G R+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS+  DRQERF+ RWV ALSDPRVTHEI SIWI YW+Q+DKSLGQK+A+RLN++  M
Sbjct  434  RYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIFYWSQSDKSLGQKIAARLNMKANM  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   440 bits (1131),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858   DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
             DLYDSIAAGNYP+W LF+Q+MDP HED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  775   DLYDSIAAGNYPQWNLFVQVMDPAHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  834

Query  678   NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
             NFF ENEQ+AFCPA+VVPG++YSDDKLLQTRIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  835   NFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  894

Query  498   NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
             NNHHDGFMNFMHRDEEVNYFPSR DP RHAE++P  P V +G R+KC I KENNFKQPGE
Sbjct  895   NNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFIGKENNFKQPGE  954

Query  318   RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
             RYRSW +DRQERF+ R+VEALS+PRVTHEIRSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  955   RYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF  1013


 Score =   409 bits (1051),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 212/238 (89%), Gaps = 0/238 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+D+IA+GNYPEWKLFIQ MDP  ED+FDFDPLDVTK WPED+LPLQPVGRLVLN+ ID
Sbjct  293  DLHDAIASGNYPEWKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTID  352

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF E EQLAF P +VVPG+YYSDDKLLQ RIF+Y DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  353  NFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHH  412

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NY+PS++DP R AE+ P P    TG R KC+I+KENNFKQ G+
Sbjct  413  NNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGD  472

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPT  145
            RYRSW+ DRQ+RF+ RWVE LS+PR+THEIR IWISYW+QAD+SLGQKLASRLNVRP+
Sbjct  473  RYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  530



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   424 bits (1089),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWK +IQI+DPDHE RFDFDPLDVTKTWPED++PLQPVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKFYIQIIDPDHEGRFDFDPLDVTKTWPEDIIPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEEV+YFPSR+DP +HA ++PIP     G+R+K +IEKENNFKQPGE
Sbjct  374  NNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSSTCNGRREKMVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFI RW++ALSDPR+THEI+SIW+SYW+QAD+SLGQKLASRL+ +P+M
Sbjct  434  RYRSMDPARQERFINRWIDALSDPRLTHEIKSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>gb|ADN94253.1| catalase [Puccinellia chinampoensis]
Length=492

 Score =   423 bits (1088),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 217/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKLFIQ +D DHEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLTDSIAAGNYPEWKLFIQTIDCDHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI VPG++YSDDKLLQTRIFSY+DTQRHRLGPNYL LPVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAITVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR+DP RHAE++PIP R LTG R+KCIIEKENNFKQ GE
Sbjct  374  NNHHDGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPSRTLTGCREKCIIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RS+    Q+RFI  WV+AL+D RVTHEI+ IWISYW+Q D SLGQKLASRL ++P M
Sbjct  434  RFRSFDPAGQDRFIQWWVDALTDTRVTHEIQGIWISYWSQCDASLGQKLASRLKMKPNM  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   424 bits (1091),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSI AGNYPEW  +IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGRLVLN+NID
Sbjct  288  DLTDSIGAGNYPEWTFYIQTIDPDHEDRFDFDPLDVTKTWPEDVVPLQPVGRLVLNRNID  347

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP I+VPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKC+HH
Sbjct  348  NFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCSHH  407

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEEV+YFPSR+DP +HA ++PIP R L G+R+K +IEKENNFKQPGE
Sbjct  408  NNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRTLNGRREKMVIEKENNFKQPGE  467

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFI RW++ALSDPR+THEI++IW+SYW+QADKSLGQKLASRL+ +P+M
Sbjct  468  RYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADKSLGQKLASRLSSKPSM  526



>ref|XP_010105996.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXC51646.1| Catalase isozyme 1 [Morus notabilis]
Length=359

 Score =   418 bits (1075),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQ +DPDHEDRFDFDPLDVTKTWPED+LPLQPVGR+VLNKNID
Sbjct  126  DLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRMVLNKNID  185

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP IVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLP NAPKCAHH
Sbjct  186  NFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHH  245

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHR+EEVNYFPSRYDP RHAE++PIP  + TG+R++ +I+KENNFKQPGE
Sbjct  246  NNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAICTGRRERTVIDKENNFKQPGE  305

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQA  196
            RYRS+S DRQERFI RWV ALSDPRVTHEIRSIWISYW+Q 
Sbjct  306  RYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISYWSQV  346



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   422 bits (1086),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIM+P+  D+FDFDPLDVTKTWPED+LPL PVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMNPEDVDKFDFDPLDVTKTWPEDILPLMPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF P  +VPGVYYS+DKLLQTRIF+Y+DTQRHR+GPNY+QLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH DG MNFMHRDEEV+Y PSR+DPCR AEQ+PIP  VLTG+R+KC+I KENNFKQ GE
Sbjct  374  NNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQ+R+I +WVE+LSDPRVTHEIRSIWISY +QADKS GQK+ASRL V+PTM
Sbjct  434  RYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_011654421.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=431

 Score =   420 bits (1080),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  834  GNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNIDNFFAENEQ  655
            GNYPEW+L+IQ +DPDHED++DFDPLDVTKTWPED+LPLQPVGRLVLNKNIDNFFAENEQ
Sbjct  201  GNYPEWELYIQTIDPDHEDKYDFDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQ  260

Query  654  LAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFM  475
            LAFCPAI+VPG+YYSDDKLLQTRIFSY+DTQR+RLGPNYLQLPVNAPKCA+HNNHHDGFM
Sbjct  261  LAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRYRLGPNYLQLPVNAPKCAYHNNHHDGFM  320

Query  474  NFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWSTD  295
            NFM RDEE+NYFPSR DP RHAE++P P  V TGKR++C+IEKENNFKQPGERYRSW +D
Sbjct  321  NFMDRDEEINYFPSRIDPTRHAERYPQPSAVYTGKRERCVIEKENNFKQPGERYRSWPSD  380

Query  294  RQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVR  151
            RQERF+ RWV+ALSDPRVTHEIR+IWISYW+QADKSLG KLAS  N++
Sbjct  381  RQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGHKLASHFNLK  428



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   422 bits (1086),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEW  +IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGRLVLN+NID
Sbjct  254  DLTDSIAAGNYPEWTFYIQTIDPDHEDRFDFDPLDVTKTWPEDVVPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP I+VPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKC+HH
Sbjct  314  NFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEEV+YFPSR+DP +HA ++PIP R L G+R+K  I+KENNFKQPGE
Sbjct  374  NNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPARALNGRREKACIDKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFI RW++ALSDPR+THEI++IW+SYW+QADKSLGQKLASRL+ +P+M
Sbjct  434  RYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADKSLGQKLASRLSAKPSM  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   422 bits (1085),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMD +  D+FDFDPLDVTKTWPED+LPL PVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDTEDVDKFDFDPLDVTKTWPEDILPLMPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF P  +VPG+YYS+DKLLQTRIF+Y+DTQRHR+GPNY+QLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH DG MNFMHRDEEV+Y PSR+DPCRHAEQ+PIP RVLTG+R+ C+IEKENNFKQ GE
Sbjct  374  NNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQ+R++ +WVE LSDPRVT+EIRSIWISY +QADKS GQK+ASRL ++PTM
Sbjct  434  RYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   422 bits (1085),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMD +  D+FDFDPLDVTKTWPED+LPL PVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDTEDVDKFDFDPLDVTKTWPEDILPLMPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF P  +VPG+YYS+DKLLQTRIF+Y+DTQRHR+GPNY+QLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH DG MNFMHRDEEV+Y PSR+DPCRHAEQ+PIP RVLTG+R+ C+IEKENNFKQ GE
Sbjct  374  NNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQ+R++ +WVE LSDPRVT+EIRSIWISY +QADKS GQK+ASRL ++PTM
Sbjct  434  RYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   437 bits (1123),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSI+AGNYPEWKL+IQIMDP HED+FDFDPLDVTKTWPED+LPLQPVGRLVLNKNID
Sbjct  736  DLYDSISAGNYPEWKLYIQIMDPAHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNID  795

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP IVVPGV YS+DKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  796  NFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  855

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEEVNYFPSR DP R+AE  P+P  + +GKR+KC+IEKENNFKQPGE
Sbjct  856  NNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVIEKENNFKQPGE  915

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ R V  LSDPR+THE+R+IWISYW Q DKSLGQKLA+RLNV+P++
Sbjct  916  RYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKLATRLNVKPSI  974


 Score =   400 bits (1027),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/238 (77%), Positives = 212/238 (89%), Gaps = 0/238 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGN+PEWKL IQ MDP  ED+F FDPLD+TK WPED+ PL PVGRLVLN+NID
Sbjct  254  DLYDSIAAGNFPEWKLMIQTMDPADEDKFSFDPLDMTKIWPEDMFPLHPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            N+FAENE LAF PA VVPGVYYS+DKL Q R+F+YSDTQRHRLG NYLQLPVNAPKC +H
Sbjct  314  NWFAENEMLAFNPAHVVPGVYYSNDKLFQLRLFAYSDTQRHRLGTNYLQLPVNAPKCPYH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YF SRYDP RHAE+ PIP  + +G+R+KC+IEKE+NF+QPG+
Sbjct  374  NNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVIEKEDNFRQPGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPT  145
            RYRSW+ DRQERF+CR V ALS+PR+THEIRSIW+S+WTQ DKSLGQKLASRLN RP+
Sbjct  434  RYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKLASRLNNRPS  491



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   416 bits (1069),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL D+IAAGN+PEW L+IQ MDP+HEDRF+FDPLDVTKTWPED+ PLQPVGR+VLN+NID
Sbjct  101  DLTDAIAAGNFPEWTLYIQTMDPEHEDRFNFDPLDVTKTWPEDVFPLQPVGRMVLNRNID  160

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP ++VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  161  NFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHH  220

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYDP ++A ++PIP   +TG+RDK +I KENNFKQPGE
Sbjct  221  NNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIPTVHITGRRDKTVIAKENNFKQPGE  280

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+    RQERFI RWV+ALSDPR+THEIRSIW+S W+QAD+SLGQKLASRL+ +P+M
Sbjct  281  RYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLSNWSQADRSLGQKLASRLSAKPSM  339



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   421 bits (1083),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMDP+  D+FDFDPLDVTKTWPED+LPL PVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMDPEDVDKFDFDPLDVTKTWPEDILPLMPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF P  +VPGVYYS+DKLLQTRIF+Y+DTQRHR+GPNY+QLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH DG MNFMHRDEEV+Y PSR+DPCR AEQ+PIP  VLTG+R+KC+I KENNFKQ GE
Sbjct  374  NNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYR+W  DRQ+R+I +WVE+LSDPRVTHEIRSIWISY +QADKS GQK+ASRL V+PTM
Sbjct  434  RYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLLVKPTM  492



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   421 bits (1082),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIM+P+  D+FDFDPLDVTKTWPED+LPL PVGRLVLN+NID
Sbjct  254  DLYDSIAAGNYPEWKLFIQIMNPEDVDKFDFDPLDVTKTWPEDILPLMPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF P  +VPGVYYS+DKLLQTRIF+Y+DTQRHR+GPNY+QLPVNAPKCAHH
Sbjct  314  NFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH DG MNFMHRDEEV+Y PSR+DPCR AEQ+PIP  VLTG+R+KC+I KENNFKQ GE
Sbjct  374  NNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQ+R+I +WVE+LSDPR THEIRSIWISY +QADKS GQK+ASRL V+PTM
Sbjct  434  RYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   436 bits (1120),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYP+W LF+Q+MDP HED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  743  DLYDSIAAGNYPQWNLFVQVMDPAHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  802

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF E EQ+AFCPA+VVPG++YSDDKLLQTRIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  803  NFFNEYEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  862

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHHDGFMNFMHRDEEVNYFPSR DP RHAE++P  P V TG R+KC I KENNF+QPGE
Sbjct  863  NNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCTGNREKCFIGKENNFQQPGE  922

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW +DRQERF+ R+VEALS+PRVTHEIRSIWISYW+QADKSLGQKLA+RLNVRP  
Sbjct  923  RYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF  981


 Score =   409 bits (1052),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 213/238 (89%), Gaps = 0/238 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+D+I++GNYPEWKLFIQ MDP  ED+FDFDPLDVTK WPED+LPLQPVGRLVLN+ ID
Sbjct  261  DLHDAISSGNYPEWKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTID  320

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF E EQLAF P +VVPG+YYSDDKLLQ RIF+Y DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  321  NFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHH  380

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NY+PS++DP R AE+ PIP    TG R KC+I+KENNFKQ G+
Sbjct  381  NNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPTNSYTGIRTKCVIKKENNFKQAGD  440

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPT  145
            RYRSW+ DRQ+RF+ RWVE LS+PR+THEIR IWISYW+QAD+SLGQKLASRLNVRP+
Sbjct  441  RYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  498



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   421 bits (1081),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 192/241 (80%), Positives = 223/241 (93%), Gaps = 2/241 (1%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DP HEDRFDFDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDPAHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDK+LQTR+FSY+D+QRHRLGPNYLQ+PVNAPKCAHH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKMLQTRVFSYADSQRHRLGPNYLQIPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMN +HRDEEVNYFPSR+D  RHAE+ PIP   L+ +R+KC I K+N+FKQ GE
Sbjct  374  NNHHEGFMNAIHRDEEVNYFPSRHDAVRHAERVPIPTTHLSARREKCNIPKQNHFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALS--DPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPT  145
            RYR+W+ DRQERF+ RWVEALS  DPR+THEIRSIW+SYW+QAD+SLGQKLAS LN+RP+
Sbjct  434  RYRTWAPDRQERFLRRWVEALSDPDPRITHEIRSIWVSYWSQADRSLGQKLASHLNMRPS  493

Query  144  M  142
            +
Sbjct  494  I  494



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYD+IAAGN+PEWKL+IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGR+VLN+NID
Sbjct  254  DLYDAIAAGNFPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDVIPLQPVGRMVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCP ++VPG+YYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFTENEQLAFCPGVIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPSRYD  ++A ++PIP   LTG+R+K +I+KENNFKQPGE
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSRYDAAKNAPRYPIPSVPLTGRREKTMIKKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFI RW++ALSDPR+THEIRSIW+SYW+Q D+SLGQKLASRL+ +P+M
Sbjct  434  RYRSMDPARQERFIKRWIDALSDPRLTHEIRSIWLSYWSQTDRSLGQKLASRLSAKPSM  492



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   422 bits (1084),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEW  +IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGRLVLN+NID
Sbjct  295  DLTDSIAAGNYPEWTFYIQTIDPDHEDRFDFDPLDVTKTWPEDVVPLQPVGRLVLNRNID  354

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP I+VPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKC+HH
Sbjct  355  NFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCSHH  414

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEEV+YFPSR+DP +HA ++PIP R L G+R+K  I+KENNFKQPGE
Sbjct  415  NNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPARALNGRREKACIDKENNFKQPGE  474

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFI RW++ALSDPR+THEI++IW+SYW+QADKSLGQKLASRL+ +P+M
Sbjct  475  RYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADKSLGQKLASRLSAKPSM  533



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAG++PEW +FIQ++DPDHED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGSFPEWHMFIQVIDPDHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPAIVVPG +YSDDKLLQ+RIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR +P RHAE++P  P    G R+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQNPIACAGNREKCMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQERF+ R+V+AL++PRVTHEIRSIWIS WT+AD+SLGQKLA+RLNV P  
Sbjct  434  RYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWISNWTKADESLGQKLATRLNVSPNF  492



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   420 bits (1079),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKLFIQ M+  +E+ +DFDPLDVTKTWPEDL PLQPVGRLVLNKNID
Sbjct  246  DLQDSIAAGNYPEWKLFIQTMEIKNENNYDFDPLDVTKTWPEDLFPLQPVGRLVLNKNID  305

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPA+VVPGVYY+DDKLLQTRIFSY+DTQRHRLGPNYL LP NAPKCAHH
Sbjct  306  NFFAENEQLAFCPALVVPGVYYTDDKLLQTRIFSYADTQRHRLGPNYLLLPANAPKCAHH  365

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF HRDEEVNYFPSR+DPCRHAE+ PIP   L G+R+K +IEKENNF QPG 
Sbjct  366  NNHHEGFMNFTHRDEEVNYFPSRFDPCRHAERVPIPSHPLGGRREKVMIEKENNFAQPGA  425

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RSW  DRQERFI R V+ALSDPRVTHEIRSIW+SYW+QAD+ LGQK+A++LNV+  M
Sbjct  426  RFRSWPADRQERFIARVVDALSDPRVTHEIRSIWLSYWSQADRMLGQKIATKLNVKANM  484



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAG++PEW +FIQ++DPDHED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGSFPEWHMFIQVIDPDHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPAIVVPG +YSDDKLLQ+RIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR +P RHAE++P  P    G R+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQNPIACAGNREKCMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQERF+ R+V+AL++PRVTHEIRSIWIS WT+AD+SLGQKLA+RLNV P  
Sbjct  434  RYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWISNWTKADESLGQKLATRLNVSPNF  492



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   420 bits (1079),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEW  +IQ +DPD+E+RFDFDPLDVTKTWPED++PLQPVGRLVLN+NID
Sbjct  254  DLTDSIAAGNYPEWTFYIQTIDPDYEERFDFDPLDVTKTWPEDVVPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF+ENEQLAFCP I+VPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKC+HH
Sbjct  314  NFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEEV+YFPSR+DP +HA ++PIP R L G+R+K +IEKENNFKQPGE
Sbjct  374  NNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRTLNGRREKMVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFI RW++ALSDPR+THEI++IW+SYW+QADKSLGQKLASRL+ +P+M
Sbjct  434  RYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADKSLGQKLASRLSSKPSM  492



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   420 bits (1079),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAG++PEW +FIQ++DPDHED+FDFDPLDVTK WPED+LPLQPVGRLVLNKNID
Sbjct  254  DLYDSIAAGSFPEWHMFIQVIDPDHEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF ENEQLAFCPAIVVPG +YSDDKLLQ+RIFSY+D+QRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSYADSQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+G MNFMHRDEEVNYFPSR +P RHAE++P  P    G R+KC+IEKENNFKQPGE
Sbjct  374  NNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQNPIACAGNREKCMIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQERF+ R+V+AL++PRVTHEIRSIWIS WT+AD+SLGQKLA+RLNV P  
Sbjct  434  RYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWISNWTKADESLGQKLATRLNVSPNF  492



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   419 bits (1078),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 191/241 (79%), Positives = 223/241 (93%), Gaps = 2/241 (1%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+IQ +DP HEDRF+FDPLDVTKTWPED++PLQPVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYIQTIDPAHEDRFEFDPLDVTKTWPEDIIPLQPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPAI+VPG+YYSDDK+LQTR+FSY+D+QRHRLGPNYLQLPVNAPKC+HH
Sbjct  314  NFFAENEQLAFCPAIIVPGIYYSDDKMLQTRVFSYADSQRHRLGPNYLQLPVNAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMN +HRDEEVNYFPSR+D  RHAE+ PIP   L+ +R+KC I K+N+FKQ GE
Sbjct  374  NNHHEGFMNAIHRDEEVNYFPSRHDTVRHAERVPIPTTHLSARREKCNIPKQNHFKQAGE  433

Query  318  RYRSWSTDRQERFICRWVEALS--DPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPT  145
            RYR+W+ DRQERF+ RWVEALS  DPR+THEIRSIW+SYW+QAD+SLGQKLAS LN+RP+
Sbjct  434  RYRTWAPDRQERFLRRWVEALSDTDPRITHEIRSIWVSYWSQADRSLGQKLASHLNMRPS  493

Query  144  M  142
            +
Sbjct  494  I  494



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   419 bits (1076),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 217/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL D+IAAGNYPEW  +IQ +DPDHEDRFDFDPLDVTKTWPED++PLQPVGRLVLN+NID
Sbjct  254  DLTDAIAAGNYPEWTFYIQTIDPDHEDRFDFDPLDVTKTWPEDVVPLQPVGRLVLNRNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCP I+VPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYL LP NAPKC+HH
Sbjct  314  NFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCSHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DG MNFMHRDEEV+YFPSR+DP   A ++PIP R L G+R+K +IEKENNFKQPGE
Sbjct  374  NNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPIPSRTLNGRREKMVIEKENNFKQPGE  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRS    RQERFI RW++ALSDPR+THEI++IW+SYW+QAD+SLGQKLA RL+V+P+M
Sbjct  434  RYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADRSLGQKLAGRLSVKPSM  492



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   418 bits (1075),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKL+ QIMDPD EDRFDFDPLD TK WPED++PL PVGR+VLNKNID
Sbjct  254  DLYDSIAAGNYPEWKLYFQIMDPDQEDRFDFDPLDTTKIWPEDIIPLIPVGRMVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENE LAF P ++VPG+ +S+DK+LQTRIF+Y DTQRHRLGPNYL LPVNAPKCA+H
Sbjct  314  NFFAENEMLAFSPHMIVPGINFSNDKMLQTRIFAYGDTQRHRLGPNYLLLPVNAPKCAYH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH+DGFMNFMHRDEEV+YFPS+YDP RHAE+HPIP  V+TG+RD+ +IEKE+NFKQ G+
Sbjct  374  NNHYDGFMNFMHRDEEVDYFPSKYDPTRHAERHPIPNAVITGRRDRRVIEKEDNFKQAGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQERF+ RWV+ALSDPR+T EIRSIW+SYW+QADKS GQKLASRLNVRPTM
Sbjct  434  RYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWVSYWSQADKSFGQKLASRLNVRPTM  492



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   418 bits (1074),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL DSIAAGNYPEWKLFIQ M+  +E+ +DFDPLDVTKTWPEDL PLQPVGRLVLNKNID
Sbjct  254  DLQDSIAAGNYPEWKLFIQTMEIKNENNYDFDPLDVTKTWPEDLFPLQPVGRLVLNKNID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAFCPA+VVPGVYY+DDKLLQTRIFSY+DTQRHRLGPNYL LP NAPKCAHH
Sbjct  314  NFFAENEQLAFCPALVVPGVYYTDDKLLQTRIFSYADTQRHRLGPNYLLLPANAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNF HRDEEVNYFPSR+DPCRHAE+ PIP   L G+R+K +IEKENNF QPG 
Sbjct  374  NNHHEGFMNFTHRDEEVNYFPSRFDPCRHAERVPIPSHPLGGRREKVMIEKENNFAQPGA  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            R+RSW  +RQERFI R V+ALSDPRVTHEIRSIW+SYW+QAD+ LGQK+A++LNV+  M
Sbjct  434  RFRSWPAERQERFIARVVDALSDPRVTHEIRSIWLSYWSQADRMLGQKIATKLNVKANM  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 217/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+D+IA+GNYPEWKLFIQ MDP  ED+FDFDPLDVTK WPED+LPLQPVGRLVLN+ ID
Sbjct  254  DLHDAIASGNYPEWKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF E EQLAF P +VVPG+YYSDDKLLQ RIF+Y DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NY+PS++DP R AE+ PIP +  TG R KCII+KENNFKQPG+
Sbjct  374  NNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQ+RF+ RWVE LS+PR+THEIRSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 217/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DL+D+IA+GNYPEWKLFIQ MDP  ED+FDFDPLDVTK WPED+LPLQPVGRLVLN+ ID
Sbjct  254  DLHDAIASGNYPEWKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTID  313

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFF E EQLAF P +VVPG+YYSDDKLLQ RIF+Y DTQRHRLGPNYLQLPVNAPKCAHH
Sbjct  314  NFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHH  373

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNHH+GFMNFMHRDEE+NY+PS++DP R AE+ PIP +  TG R KCII+KENNFKQPG+
Sbjct  374  NNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGD  433

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW+ DRQ+RF+ RWVE LS+PR+THEIRSIWISYW+QAD+SLGQKLASRLNVRP++
Sbjct  434  RYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 217/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  858  DLYDSIAAGNYPEWKLFIQIMDPDHEDRFDFDPLDVTKTWPEDLLPLQPVGRLVLNKNID  679
            DLYDSIAAGNYPEWKLFIQIMD +  D+FDFDPLDVTKTWPED+LPL PVGRLVLN+NID
Sbjct  251  DLYDSIAAGNYPEWKLFIQIMDTEDVDKFDFDPLDVTKTWPEDILPLMPVGRLVLNRNID  310

Query  678  NFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHH  499
            NFFAENEQLAF P  +VPG+YYS+DKLLQTRIF+Y+DTQRHR+GPNY+QLPVNAPKCAHH
Sbjct  311  NFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHH  370

Query  498  NNHHDGFMNFMHRDEEVNYFPSRYDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGE  319
            NNH DG MNFMHRDEEV+Y PSR+DPCRHAEQ+PIP RVLTG+R+ C+IEKENNFKQ GE
Sbjct  371  NNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGE  430

Query  318  RYRSWSTDRQERFICRWVEALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  142
            RYRSW  DRQ+R++ +WVE LSDPRVT+EIRSIWI   +QADKS GQK+ASRL ++PTM
Sbjct  431  RYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWICSLSQADKSCGQKVASRLTLKPTM  489



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1894952386554