BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1248

Length=903
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795256.1|  PREDICTED: probable threonine--tRNA ligase, ...    418   3e-138   Nicotiana sylvestris
gb|EYU43185.1|  hypothetical protein MIMGU_mgv1a002431mg                418   4e-138   Erythranthe guttata [common monkey flower]
gb|KDO58457.1|  hypothetical protein CISIN_1g0468081mg                  408   2e-137   Citrus sinensis [apfelsine]
ref|XP_011085644.1|  PREDICTED: probable threonine--tRNA ligase, ...    416   1e-136   
ref|XP_006363036.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    414   1e-136   Solanum tuberosum [potatoes]
ref|XP_002270988.3|  PREDICTED: probable threonine--tRNA ligase, ...    412   5e-136   Vitis vinifera
ref|XP_004243537.1|  PREDICTED: probable threonine--tRNA ligase, ...    412   7e-136   Solanum lycopersicum
ref|XP_009594560.1|  PREDICTED: probable threonine--tRNA ligase, ...    412   1e-135   Nicotiana tomentosiformis
gb|KJB10282.1|  hypothetical protein B456_001G193700                    402   2e-135   Gossypium raimondii
emb|CDP18259.1|  unnamed protein product                                412   2e-135   Coffea canephora [robusta coffee]
ref|XP_007138794.1|  hypothetical protein PHAVU_009G238000g             403   5e-135   Phaseolus vulgaris [French bean]
ref|XP_010674905.1|  PREDICTED: probable threonine--tRNA ligase, ...    410   8e-135   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB10280.1|  hypothetical protein B456_001G193700                    402   3e-134   Gossypium raimondii
ref|XP_006469541.1|  PREDICTED: threonine--tRNA ligase, mitochond...    407   4e-134   Citrus sinensis [apfelsine]
ref|XP_010270142.1|  PREDICTED: probable threonine--tRNA ligase, ...    407   7e-134   Nelumbo nucifera [Indian lotus]
ref|XP_006447722.1|  hypothetical protein CICLE_v10018290mg             408   1e-133   
gb|AES71826.2|  threonyl-tRNA synthetase/threonine-tRNA ligase, p...    406   1e-133   Medicago truncatula
ref|XP_010046021.1|  PREDICTED: threonine--tRNA ligase, mitochond...    400   1e-133   
ref|XP_002320505.2|  hypothetical protein POPTR_0014s16030g             407   1e-133   
ref|XP_011003513.1|  PREDICTED: probable threonine--tRNA ligase, ...    406   2e-133   Populus euphratica
ref|XP_003601575.1|  Threonyl-tRNA synthetase                           406   3e-133   
ref|XP_004502186.1|  PREDICTED: threonine--tRNA ligase-like isofo...    402   3e-133   Cicer arietinum [garbanzo]
ref|XP_007138795.1|  hypothetical protein PHAVU_009G238000g             405   4e-133   Phaseolus vulgaris [French bean]
ref|XP_007049264.1|  Threonyl-tRNA synthetase / threonine--tRNA l...    398   8e-133   
ref|XP_010112806.1|  Threonine--tRNA ligase                             404   1e-132   
ref|XP_004502185.1|  PREDICTED: threonine--tRNA ligase-like isofo...    403   1e-132   Cicer arietinum [garbanzo]
ref|XP_009136151.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     403   1e-132   Brassica rapa
emb|CBI28402.3|  unnamed protein product                                404   1e-132   Vitis vinifera
emb|CDX93065.1|  BnaA03g37870D                                          403   2e-132   
gb|KJB10279.1|  hypothetical protein B456_001G193700                    402   2e-132   Gossypium raimondii
gb|KCW88711.1|  hypothetical protein EUGRSUZ_A01066                     400   3e-132   Eucalyptus grandis [rose gum]
emb|CDY50043.1|  BnaC03g44930D                                          402   3e-132   Brassica napus [oilseed rape]
ref|XP_004502184.1|  PREDICTED: threonine--tRNA ligase-like isofo...    403   4e-132   
dbj|BAD94986.1|  putative protein                                       394   4e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049263.1|  Threonyl-tRNA synthetase / threonine--tRNA l...    400   3e-131   
gb|KCW88709.1|  hypothetical protein EUGRSUZ_A01064                     396   3e-131   Eucalyptus grandis [rose gum]
ref|XP_002885774.1|  hypothetical protein ARALYDRAFT_319286             399   4e-131   Arabidopsis lyrata subsp. lyrata
ref|XP_010542010.1|  PREDICTED: probable threonine--tRNA ligase, ...    399   4e-131   Tarenaya hassleriana [spider flower]
ref|XP_010412398.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    398   1e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010557693.1|  PREDICTED: probable threonine--tRNA ligase, ...    398   1e-130   Tarenaya hassleriana [spider flower]
ref|XP_010488722.1|  PREDICTED: probable threonine--tRNA ligase, ...    398   1e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010557692.1|  PREDICTED: probable threonine--tRNA ligase, ...    398   2e-130   Tarenaya hassleriana [spider flower]
ref|XP_012080702.1|  PREDICTED: probable threonine--tRNA ligase, ...    397   3e-130   Jatropha curcas
ref|XP_006297093.1|  hypothetical protein CARUB_v10013096mg             398   3e-130   
ref|XP_003554418.1|  PREDICTED: probable threonine--tRNA ligase, ...    397   3e-130   Glycine max [soybeans]
ref|XP_009365187.1|  PREDICTED: probable threonine--tRNA ligase, ...    397   3e-130   Pyrus x bretschneideri [bai li]
ref|XP_010467036.1|  PREDICTED: probable threonine--tRNA ligase, ...    396   5e-130   Camelina sativa [gold-of-pleasure]
ref|XP_008813280.1|  PREDICTED: threonine--tRNA ligase, mitochond...    391   5e-130   
ref|NP_671778.1|  putative threonyl-tRNA synthetase / threonine--...    396   6e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379968.1|  PREDICTED: probable threonine--tRNA ligase, ...    396   9e-130   Malus domestica [apple tree]
gb|KFK31774.1|  hypothetical protein AALP_AA6G156900                    395   9e-130   Arabis alpina [alpine rockcress]
ref|XP_006418545.1|  hypothetical protein EUTSA_v10002438mg             395   1e-129   Eutrema salsugineum [saltwater cress]
ref|XP_010913171.1|  PREDICTED: probable threonine--tRNA ligase, ...    395   2e-129   Elaeis guineensis
ref|XP_007217640.1|  hypothetical protein PRUPE_ppa002440mg             394   1e-128   Prunus persica
ref|XP_008813279.1|  PREDICTED: probable threonine--tRNA ligase, ...    393   2e-128   Phoenix dactylifera
ref|XP_008229866.1|  PREDICTED: probable threonine--tRNA ligase, ...    393   2e-128   Prunus mume [ume]
ref|XP_004144536.1|  PREDICTED: probable threonine--tRNA ligase, ...    392   3e-128   Cucumis sativus [cucumbers]
ref|XP_008462105.1|  PREDICTED: probable threonine--tRNA ligase, ...    390   3e-127   Cucumis melo [Oriental melon]
ref|XP_009394992.1|  PREDICTED: probable threonine--tRNA ligase, ...    389   5e-127   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADK92877.1|  threonyl-tRNA synthetase                                389   2e-126   Hypericum perforatum
ref|XP_004293445.1|  PREDICTED: probable threonine--tRNA ligase, ...    386   8e-126   Fragaria vesca subsp. vesca
ref|XP_008342168.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    383   8e-126   
gb|EEC73349.1|  hypothetical protein OsI_07557                          384   6e-125   Oryza sativa Indica Group [Indian rice]
ref|NP_001047052.1|  Os02g0538000                                       383   1e-124   
ref|XP_006647349.1|  PREDICTED: probable threonine--tRNA ligase, ...    379   2e-124   Oryza brachyantha
dbj|BAJ98256.1|  predicted protein                                      382   3e-124   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570257.1|  PREDICTED: probable threonine--tRNA ligase, ...    380   1e-123   Brachypodium distachyon [annual false brome]
ref|XP_002460938.1|  hypothetical protein SORBIDRAFT_02g037830          379   2e-123   
ref|XP_004958163.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    380   2e-123   Setaria italica
ref|XP_006856829.2|  PREDICTED: probable threonine--tRNA ligase, ...    370   1e-119   
gb|ERN18296.1|  hypothetical protein AMTR_s00055p00165940               370   2e-119   Amborella trichopoda
gb|ABR17634.1|  unknown                                                 369   6e-119   Picea sitchensis
gb|KHN02259.1|  Threonine--tRNA ligase                                  367   2e-118   Glycine soja [wild soybean]
ref|XP_002975822.1|  hypothetical protein SELMODRAFT_267898             358   5e-118   
gb|KHG13628.1|  Threonine--tRNA ligase                                  365   1e-117   Gossypium arboreum [tree cotton]
gb|EMS54585.1|  Threonyl-tRNA synthetase                                350   4e-112   Triticum urartu
ref|XP_001758898.1|  predicted protein                                  347   3e-111   
ref|XP_002973772.1|  hypothetical protein SELMODRAFT_442211             352   3e-111   
ref|XP_001766498.1|  predicted protein                                  344   3e-110   
gb|EMT17759.1|  Threonyl-tRNA synthetase                                352   1e-108   
ref|WP_019501919.1|  threonyl-tRNA synthetase                           315   3e-99    Pseudanabaena sp. PCC 6802
gb|ELS32748.1|  Ser-tRNA(Thr) hydrolase                                 314   9e-99    Pseudanabaena biceps PCC 7429
ref|WP_040688179.1|  threonyl-tRNA synthetase                           314   9e-99    
emb|CCQ65975.1|  Threonyl-tRNA synthetase                               306   1e-98    Crocosphaera watsonii WH 0402
ref|WP_027841790.1|  threonyl-tRNA synthetase                           313   2e-98    Mastigocoleus testarum
ref|WP_011316520.1|  threonyl-tRNA synthetase                           313   4e-98    Trichormus variabilis
ref|WP_015118380.1|  threonyl-tRNA synthetase                           312   8e-98    Rivularia sp. PCC 7116
ref|WP_026134857.1|  threonyl-tRNA synthetase                           312   9e-98    Scytonema hofmannii
emb|CAN65674.1|  hypothetical protein VITISV_002009                     323   2e-97    Vitis vinifera
emb|CDN13311.1|  Threonyl-tRNA synthetase                               309   6e-97    Richelia intracellularis
ref|WP_037220169.1|  threonyl-tRNA synthetase                           309   1e-96    
ref|WP_026093793.1|  threonyl-tRNA synthetase                           308   2e-96    Calothrix sp. PCC 7103
ref|WP_009546407.1|  MULTISPECIES: threonyl-tRNA synthetase             309   3e-96    Cyanothece
gb|ACB54182.1|  threonyl-tRNA synthetase                                309   3e-96    Cyanothece sp. ATCC 51142
ref|WP_015166522.1|  threonyl-tRNA synthetase                           307   4e-96    Pseudanabaena sp. PCC 7367
ref|XP_005819275.1|  threonyl-tRNA synthetase                           307   5e-96    Guillardia theta CCMP2712
ref|XP_001418593.1|  predicted protein                                  306   6e-96    Ostreococcus lucimarinus CCE9901
ref|XP_007508265.1|  threonyl-tRNA synthetase                           308   1e-95    Bathycoccus prasinos
gb|KIJ84876.1|  threonyl-tRNA synthetase                                306   2e-95    Scytonema tolypothrichoides VB-61278
ref|WP_008200810.1|  threonyl-tRNA synthetase                           306   2e-95    Microcystis
ref|WP_002792903.1|  threonyl-tRNA synthetase                           306   2e-95    Microcystis aeruginosa
ref|WP_002735307.1|  threonyl-tRNA synthetase                           305   3e-95    Microcystis aeruginosa
ref|WP_007303255.1|  threonyl-tRNA synthetase                           306   3e-95    Crocosphaera watsonii
ref|WP_002774699.1|  threonyl-tRNA synthetase                           305   3e-95    Microcystis aeruginosa
ref|WP_021831668.1|  threonyl-tRNA synthetase                           306   3e-95    Crocosphaera watsonii
ref|WP_006518939.1|  threonyl-tRNA synthetase                           305   4e-95    Leptolyngbya sp. PCC 7375
ref|WP_007308875.1|  threonyl-tRNA synthetase                           306   5e-95    Crocosphaera watsonii
ref|WP_002760217.1|  threonyl-tRNA synthetase                           305   6e-95    Microcystis aeruginosa
ref|WP_002742239.1|  threonyl-tRNA synthetase                           305   8e-95    Microcystis aeruginosa
ref|WP_016515944.1|  threonyl-tRNA synthetase                           304   8e-95    Microcystis aeruginosa
ref|WP_004160952.1|  threonyl-tRNA synthetase                           304   8e-95    Microcystis aeruginosa
ref|WP_023073466.1|  threonyl-tRNA synthetase                           304   9e-95    Leptolyngbya sp. Heron Island J
ref|WP_015145308.1|  threonyl-tRNA synthetase                           304   1e-94    Pleurocapsa minor
ref|WP_002802581.1|  threonyl-tRNA synthetase                           304   1e-94    Microcystis aeruginosa
ref|WP_002797977.1|  threonyl-tRNA synthetase                           304   1e-94    Microcystis aeruginosa
ref|WP_008276158.1|  threonyl-tRNA synthetase                           305   1e-94    Cyanothece sp. CCY0110
ref|WP_015137595.1|  threonyl-tRNA synthetase                           303   2e-94    Nostoc sp. PCC 7524
ref|WP_002752951.1|  threonyl-tRNA synthetase                           303   2e-94    Microcystis aeruginosa
ref|WP_017289915.1|  threonyl-tRNA synthetase                           303   2e-94    Leptolyngbya boryana
ref|WP_015195847.1|  threonyl-tRNA synthetase                           303   3e-94    Calothrix parietina
ref|WP_035857632.1|  MULTISPECIES: threonyl-tRNA synthetase             303   5e-94    
ref|WP_024970227.1|  threonyl-tRNA synthetase                           302   6e-94    Microcystis aeruginosa
ref|WP_045361210.1|  threonyl-tRNA synthetase                           302   8e-94    Microcystis aeruginosa
ref|WP_035153786.1|  threonyl-tRNA synthetase                           301   1e-93    Calothrix sp. 336/3
gb|ACB50845.1|  threonyl-tRNA synthetase                                303   1e-93    Cyanothece sp. ATCC 51142
gb|AFY73091.1|  threonyl-tRNA synthetase                                301   2e-93    Synechococcus sp. PCC 7502
ref|WP_012266116.1|  threonyl-tRNA synthetase                           301   2e-93    Microcystis aeruginosa
ref|WP_041429912.1|  threonyl-tRNA synthetase                           300   2e-93    
ref|WP_036799001.1|  threonyl-tRNA synthetase                           301   2e-93    
ref|WP_040936213.1|  threonyl-tRNA synthetase                           301   3e-93    
ref|WP_040943375.1|  threonyl-tRNA synthetase                           301   4e-93    
ref|WP_039202295.1|  threonyl-tRNA synthetase                           299   5e-93    Aphanizomenon flos-aquae
ref|WP_042157860.1|  threonyl-tRNA synthetase                           300   6e-93    Planktothrix agardhii
gb|KEI68755.1|  ThrS                                                    300   6e-93    Planktothrix agardhii NIVA-CYA 126/8
ref|WP_026798139.1|  threonyl-tRNA synthetase                           300   6e-93    Planktothrix prolifica
ref|WP_015182951.1|  threonyl-tRNA synthetase                           300   7e-93    Microcoleus sp. PCC 7113
emb|CEF98564.1|  Aminoacyl-tRNA synthetase, class II                    299   7e-93    Ostreococcus tauri
ref|WP_027403142.1|  threonyl-tRNA synthetase                           299   7e-93    Aphanizomenon flos-aquae
ref|WP_040929767.1|  threonyl-tRNA synthetase                           299   1e-92    
ref|XP_003080133.1|  putative threonyl-tRNA synthetase (ISS)            299   1e-92    
ref|WP_029626271.1|  threonyl-tRNA synthetase                           297   4e-92    Synechococcus sp. CB0205
ref|WP_007097510.1|  threonyl-tRNA synthetase                           297   4e-92    Synechococcus sp. RS9916
gb|EJK61406.1|  hypothetical protein THAOC_18112                        299   6e-92    Thalassiosira oceanica
gb|AHF64013.1|  threonyl-tRNA synthetase                                295   4e-91    Synechococcus sp. WH 8109
ref|WP_026101888.1|  threonyl-tRNA synthetase                           294   5e-91    Geminocystis herdmanii
ref|WP_011932685.1|  threonine--tRNA ligase                             294   5e-91    Synechococcus sp. WH 7803
ref|WP_006849637.1|  threonyl-tRNA synthetase                           294   7e-91    Synechococcus sp. WH 8109
ref|WP_011619783.1|  threonine--tRNA ligase                             293   1e-90    Synechococcus sp. CC9311
ref|WP_008314086.1|  threonyl-tRNA synthetase                           293   1e-90    Leptolyngbya sp. PCC 6406
ref|XP_003058299.1|  predicted protein                                  295   1e-90    Micromonas pusilla CCMP1545
ref|WP_040655789.1|  threonyl-tRNA synthetase                           293   2e-90    Rubidibacter lacunae
ref|XP_002499524.1|  predicted protein                                  293   2e-90    Micromonas commoda
ref|WP_006853215.1|  threonyl-tRNA synthetase                           292   3e-90    Synechococcus sp. WH 8016
ref|WP_015155755.1|  threonyl-tRNA synthetase                           292   4e-90    
gb|EAQ74155.1|  Threonyl-tRNA synthetase, class IIa                     292   4e-90    Synechococcus sp. WH 5701
ref|XP_001702766.1|  predicted protein                                  291   4e-90    Chlamydomonas reinhardtii
ref|WP_037980593.1|  threonyl-tRNA synthetase                           291   5e-90    Synechococcus sp. WH 5701
ref|WP_029521169.1|  threonyl-tRNA synthetase                           292   6e-90    Persephonella sp. IF05-L8
ref|WP_028084909.1|  threonyl-tRNA synthetase                           291   7e-90    Dolichospermum circinale
ref|WP_007102072.1|  threonyl-tRNA synthetase                           291   8e-90    Synechococcus sp. RS9917
ref|XP_002186178.1|  predicted protein                                  293   8e-90    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_035828988.1|  threonyl-tRNA synthetase                           291   1e-89    
ref|WP_006910773.1|  threonyl-tRNA synthetase                           289   2e-89    
ref|WP_006040869.1|  threonyl-tRNA synthetase                           290   2e-89    Synechococcus sp. WH 7805
ref|WP_011128342.1|  threonine--tRNA ligase                             290   3e-89    Synechococcus sp. WH 8102
ref|WP_011359737.1|  threonine--tRNA ligase                             290   3e-89    Synechococcus sp. CC9902
ref|WP_011364016.1|  threonine--tRNA ligase                             290   3e-89    Synechococcus sp. CC9605
ref|WP_009790028.1|  threonyl-tRNA synthetase                           290   4e-89    Synechococcus sp. BL107
ref|WP_006623096.1|  MULTISPECIES: threonyl-tRNA synthetase             290   4e-89    Arthrospira
ref|WP_029522023.1|  threonyl-tRNA synthetase                           290   7e-89    Persephonella sp. KM09-Lau-8
ref|YP_002049494.1|  Threonyl-tRNA synthetase, class IIa                288   7e-89    Paulinella chromatophora
ref|WP_029552911.1|  threonyl-tRNA synthetase                           289   8e-89    Synechococcus sp. CB0101
gb|AFZ46649.1|  Ser-tRNA(Thr) hydrolase                                 288   9e-89    Cyanobacterium stanieri PCC 7202
ref|WP_038555703.1|  threonyl-tRNA synthetase                           288   1e-88    Synechococcus sp. KORDI-52
ref|WP_041234532.1|  threonyl-tRNA synthetase                           288   2e-88    
ref|WP_043737949.1|  threonyl-tRNA synthetase                           288   2e-88    Synechococcus sp. RCC307
emb|CAK27848.1|  Threonyl-tRNA synthetase                               287   2e-88    Synechococcus sp. RCC307
ref|WP_043690612.1|  threonyl-tRNA synthetase                           287   3e-88    Synechococcus sp. KORDI-49
ref|WP_010474073.1|  threonyl-tRNA synthetase                           285   2e-87    Acaryochloris sp. CCMEE 5410
ref|XP_002288503.1|  threonyl-trna synthetase                           284   3e-87    Thalassiosira pseudonana CCMP1335
ref|XP_005719141.1|  threonine--tRNA ligase, chloroplast or mitoc...    286   4e-87    Chondrus crispus [carageen]
ref|WP_010998854.1|  threonyl-tRNA synthetase                           283   2e-86    Nostocaceae
ref|XP_009042795.1|  hypothetical protein AURANDRAFT_59726              278   3e-86    Aureococcus anophagefferens
ref|WP_015108040.1|  threonyl-tRNA synthetase                           282   4e-86    Cyanobium gracile
ref|WP_012676310.1|  threonyl-tRNA synthetase                           282   6e-86    Persephonella marina
ref|WP_012163482.1|  threonyl-tRNA synthetase                           281   8e-86    Acaryochloris marina
ref|WP_028952368.1|  threonyl-tRNA synthetase                           281   8e-86    Synechococcus sp. CC9616
ref|WP_006619748.1|  threonyl-tRNA synthetase                           278   8e-85    Arthrospira platensis
gb|ERT06814.1|  threonine--tRNA ligase                                  278   8e-85    Lyngbya aestuarii BL J
ref|WP_025281350.1|  threonyl-tRNA synthetase                           279   8e-85    Ectothiorhodospira haloalkaliphila
ref|WP_040484114.1|  threonyl-tRNA synthetase                           278   1e-84    
ref|XP_005757888.1|  threonine-tRNA ligase                              275   1e-84    Emiliania huxleyi CCMP1516
ref|XP_009041685.1|  hypothetical protein AURANDRAFT_55515              278   3e-84    Aureococcus anophagefferens
ref|WP_038545398.1|  threonyl-tRNA synthetase                           276   4e-84    Synechococcus sp. KORDI-100
ref|XP_005537510.1|  threonine--tRNA ligase, chloroplast or mitoc...    277   7e-84    Cyanidioschyzon merolae strain 10D
ref|WP_018954382.1|  threonyl-tRNA synthetase                           276   8e-84    Thioalkalivibrio sulfidiphilus
ref|WP_023406579.1|  threonyl-tRNA synthetase                           276   8e-84    
ref|WP_008931337.1|  threonyl-tRNA synthetase                           276   2e-83    Ectothiorhodospira sp. PHS-1
gb|EKD50172.1|  hypothetical protein ACD_62C00622G0001                  267   2e-83    uncultured bacterium
ref|WP_012638018.1|  threonine--tRNA ligase                             274   5e-83    Thioalkalivibrio sulfidiphilus
ref|WP_029155853.1|  threonyl-tRNA synthetase                           269   6e-83    
ref|WP_012674511.1|  threonyl-tRNA synthetase                           274   7e-83    Sulfurihydrogenibium azorense
gb|KDD75770.1|  class II core domain (G, H, P, S and T) tRNA synt...    272   8e-83    Helicosporidium sp. ATCC 50920
ref|XP_005757887.1|  threonine-tRNA ligase                              274   1e-82    Emiliania huxleyi CCMP1516
ref|XP_005843892.1|  hypothetical protein CHLNCDRAFT_56367              270   9e-82    Chlorella variabilis
ref|WP_018952008.1|  MULTISPECIES: threonyl-tRNA synthetase             271   1e-81    Thioalkalivibrio
ref|WP_018145452.1|  MULTISPECIES: threonyl-tRNA synthetase             270   1e-81    Thioalkalivibrio
ref|WP_018938529.1|  MULTISPECIES: threonyl-tRNA synthetase             270   1e-81    Thioalkalivibrio
ref|WP_018231351.1|  threonyl-tRNA synthetase                           270   1e-81    Thioalkalivibrio thiocyanodenitrificans
ref|WP_019593369.1|  threonyl-tRNA synthetase                           270   1e-81    Thioalkalivibrio sp. ALM2T
ref|WP_018169972.1|  threonyl-tRNA synthetase                           270   1e-81    Thioalkalivibrio sp. ALMg9
ref|WP_013034109.1|  threonyl-tRNA synthetase                           270   2e-81    Nitrosococcus halophilus
ref|WP_019571786.1|  threonyl-tRNA synthetase                           270   2e-81    Thioalkalivibrio sp. ALMg3
ref|XP_005702847.1|  threonyl-tRNA synthetase                           271   2e-81    Galdieria sulphuraria
ref|WP_028989720.1|  threonyl-tRNA synthetase                           270   2e-81    Thermithiobacillus tepidarius
ref|WP_008286257.1|  threonyl-tRNA synthetase                           270   3e-81    Hydrogenivirga sp. 128-5-R1-1
ref|WP_041917120.1|  threonyl-tRNA synthetase                           268   3e-81    
ref|WP_033396367.1|  threonyl-tRNA synthetase                           269   4e-81    
ref|WP_020252762.1|  MULTISPECIES: threonyl-tRNA synthetase             269   4e-81    
gb|AGF79858.1|  threonyl-tRNA synthetase                                268   8e-81    Desulfocapsa sulfexigens DSM 10523
ref|WP_018861694.1|  MULTISPECIES: threonyl-tRNA synthetase             268   8e-81    Thioalkalivibrio
ref|WP_012963929.1|  threonyl-tRNA synthetase                           268   1e-80    Hydrogenobacter thermophilus
ref|WP_028950350.1|  threonyl-tRNA synthetase                           268   1e-80    Sulfurihydrogenibium subterraneum
ref|WP_018864132.1|  threonyl-tRNA synthetase                           268   2e-80    Thioalkalivibrio sp. ARh3
ref|WP_019623471.1|  MULTISPECIES: threonyl-tRNA synthetase             268   2e-80    Thioalkalivibrio
ref|WP_044282131.1|  threonyl-tRNA synthetase                           267   2e-80    
ref|WP_044595895.1|  threonyl-tRNA synthetase                           268   2e-80    
gb|EHO43305.1|  threonyl-tRNA synthetase                                267   2e-80    Caldithrix abyssi DSM 13497
emb|CBE68915.1|  Threonyl-tRNA synthetase (Threonine--tRNA ligase...    268   2e-80    Candidatus Methylomirabilis oxyfera
ref|XP_005766080.1|  threonine-tRNA ligase                              266   3e-80    Emiliania huxleyi CCMP1516
gb|EGO87897.1|  threonyl-tRNA synthetase                                259   4e-80    
ref|WP_018950221.1|  threonyl-tRNA synthetase                           266   6e-80    Thioalkalivibrio sp. ALMg11
ref|WP_019626473.1|  threonyl-tRNA synthetase                           266   6e-80    Thioalkalivibrio sp. ALJT
ref|WP_036497263.1|  threonyl-tRNA synthetase                           261   2e-79    Nitrosococcus oceani
ref|WP_007546173.1|  threonyl-tRNA synthetase                           265   2e-79    Sulfurihydrogenibium yellowstonense
ref|WP_010881086.1|  threonine--tRNA ligase                             265   2e-79    Aquifex aeolicus
ref|WP_018139158.1|  MULTISPECIES: threonyl-tRNA synthetase             265   3e-79    Thioalkalivibrio
ref|WP_018940435.1|  threonyl-tRNA synthetase                           265   3e-79    Thioalkalivibrio sp. AKL11
ref|WP_017942016.1|  MULTISPECIES: threonyl-tRNA synthetase             264   3e-79    Thioalkalivibrio
ref|WP_018873330.1|  threonyl-tRNA synthetase                           264   3e-79    Thioalkalivibrio sp. ALJ16
ref|WP_024327918.1|  threonyl-tRNA synthetase                           264   3e-79    Thioalkalivibrio sp. AKL19
ref|WP_006787705.1|  threonyl-tRNA synthetase                           264   4e-79    Thiorhodospira sibirica
ref|WP_012458846.1|  threonine--tRNA ligase                             263   6e-79    Sulfurihydrogenibium sp. YO3AOP1
ref|WP_018995247.1|  threonyl-tRNA synthetase                           263   6e-79    Thioalkalivibrio sp. ALJ2
ref|WP_012982322.1|  threonyl-tRNA synthetase                           263   6e-79    Thioalkalivibrio sp. K90mix
ref|WP_018174468.1|  MULTISPECIES: threonyl-tRNA synthetase             263   8e-79    Thioalkalivibrio
ref|WP_013908194.1|  threonyl-tRNA synthetase                           263   9e-79    Thermodesulfatator indicus
ref|WP_044921429.1|  threonyl-tRNA synthetase                           263   9e-79    Anaerostipes hadrus
ref|WP_019583606.1|  threonyl-tRNA synthetase                           263   1e-78    Thioalkalivibrio sp. ALE16
ref|WP_009265830.1|  MULTISPECIES: threonyl-tRNA synthetase             263   1e-78    Anaerostipes hadrus
ref|WP_018880742.1|  threonyl-tRNA synthetase                           263   1e-78    Thioalkalivibrio sp. ALE30
ref|WP_019558893.1|  threonyl-tRNA synthetase                           263   1e-78    Thioalkalivibrio sp. ALE12
ref|WP_018874725.1|  threonyl-tRNA synthetase                           263   1e-78    Thioalkalivibrio sp. ALJ6
ref|WP_018867319.1|  MULTISPECIES: threonyl-tRNA synthetase             263   1e-78    Thioalkalivibrio
ref|WP_028484816.1|  threonyl-tRNA synthetase                           263   1e-78    Thioalkalivibrio sp. ALE17
gb|EFV22944.1|  threonyl-tRNA synthetase                                260   1e-78    Anaerostipes caccae
ref|WP_044929620.1|  threonyl-tRNA synthetase                           263   1e-78    Clostridiales
ref|WP_018249037.1|  threonyl-tRNA synthetase                           262   2e-78    Orenia marismortui
ref|WP_018140927.1|  threonyl-tRNA synthetase                           262   2e-78    Thioalkalivibrio sp. ALJ7
gb|EDS21490.1|  threonine--tRNA ligase                                  262   2e-78    Clostridium sp. SS2/1
ref|WP_036500092.1|  threonyl-tRNA synthetase                           262   2e-78    Nitrosococcus oceani
ref|WP_018935702.1|  threonyl-tRNA synthetase                           262   2e-78    Thioalkalivibrio sp. ALJ24
ref|WP_013220820.1|  threonyl-tRNA synthetase                           262   2e-78    Nitrosococcus watsonii
ref|WP_039660697.1|  threonyl-tRNA synthetase                           250   3e-78    
ref|WP_034970225.1|  threonyl-tRNA synthetase                           261   3e-78    
emb|CBL38512.1|  threonyl-tRNA synthetase /Ser-tRNA(Thr) hydrolase      262   3e-78    Anaerostipes hadrus
ref|WP_019024606.1|  MULTISPECIES: threonyl-tRNA synthetase             261   3e-78    Thioalkalivibrio
ref|WP_038050808.1|  threonyl-tRNA synthetase                           261   3e-78    Thioalkalivibrio sp. ALJ1
ref|WP_019591280.1|  threonyl-tRNA synthetase                           261   4e-78    Thioalkalivibrio sp. ALE20
ref|WP_018869317.1|  threonyl-tRNA synthetase                           261   4e-78    Thioalkalivibrio sp. ALgr3
ref|WP_011330571.1|  threonine--tRNA ligase                             261   4e-78    Nitrosococcus oceani
ref|WP_040343777.1|  threonyl-tRNA synthetase                           261   4e-78    Anaerostipes hadrus
ref|WP_014003485.1|  threonyl-tRNA synthetase                           261   4e-78    Acidithiobacillus caldus
ref|WP_038472288.1|  threonyl-tRNA synthetase                           261   4e-78    Acidithiobacillus caldus
gb|EKY25156.1|  threonine--tRNA ligase                                  261   5e-78    Anaerostipes hadrus DSM 3319
ref|WP_019590255.1|  MULTISPECIES: threonyl-tRNA synthetase             261   5e-78    Thioalkalivibrio
ref|WP_029949387.1|  MULTISPECIES: threonyl-tRNA synthetase             261   6e-78    
ref|WP_042683307.1|  threonyl-tRNA synthetase                           261   6e-78    Anaerosalibacter massiliensis
ref|WP_020250667.1|  threonyl-tRNA synthetase                           261   7e-78    
ref|WP_019642483.1|  threonyl-tRNA synthetase                           261   7e-78    
ref|WP_019570360.1|  threonyl-tRNA synthetase                           261   7e-78    
ref|WP_024329751.1|  threonyl-tRNA synthetase                           261   7e-78    
ref|WP_028491132.1|  threonyl-tRNA synthetase                           261   7e-78    
ref|WP_018946092.1|  threonyl-tRNA synthetase                           261   7e-78    
ref|WP_022261047.1|  threonyl-tRNA synthetase                           261   8e-78    
ref|WP_017925355.1|  threonyl-tRNA synthetase                           260   8e-78    
ref|WP_009494636.1|  threonyl-tRNA synthetase                           259   9e-78    
ref|WP_002951595.1|  threonyl-tRNA synthetase                           259   9e-78    
ref|WP_007291912.1|  threonyl-tRNA synthetase                           260   9e-78    
ref|WP_015902558.1|  threonine--tRNA ligase                             259   1e-77    
ref|WP_002944035.1|  threonyl-tRNA synthetase                           259   1e-77    
ref|WP_022374532.1|  threonyl-tRNA synthetase                           260   1e-77    
ref|WP_004321856.1|  threonyl-tRNA synthetase                           259   1e-77    
ref|WP_041726561.1|  threonyl-tRNA synthetase                           258   2e-77    
ref|WP_003375979.1|  MULTISPECIES: threonyl-tRNA synthetase             259   2e-77    
ref|WP_039218944.1|  threonyl-tRNA synthetase                           259   2e-77    
ref|WP_024727532.1|  threonyl-tRNA synthetase                           259   2e-77    
ref|WP_039259489.1|  threonyl-tRNA synthetase                           259   2e-77    
ref|WP_039278171.1|  threonyl-tRNA synthetase                           259   3e-77    
ref|WP_039256679.1|  threonyl-tRNA synthetase                           259   3e-77    
ref|WP_006566930.1|  threonyl-tRNA synthetase                           259   3e-77    
ref|WP_031572478.1|  threonyl-tRNA synthetase                           259   3e-77    
ref|XP_011398281.1|  Threonine-tRNA ligase                              265   3e-77    
ref|WP_027307654.1|  threonyl-tRNA synthetase                           259   4e-77    
ref|WP_013725164.1|  threonyl-tRNA synthetase                           259   4e-77    
dbj|BAL81398.1|  threonyl-tRNA synthetase                               258   5e-77    
ref|WP_035232391.1|  threonyl-tRNA synthetase                           258   5e-77    
ref|WP_010641737.1|  threonyl-tRNA synthetase                           258   5e-77    
ref|XP_002532001.1|  threonyl-tRNA synthetase, putative                 259   5e-77    
ref|WP_026486179.1|  threonyl-tRNA synthetase                           258   6e-77    
ref|WP_040623541.1|  threonyl-tRNA synthetase                           258   7e-77    
ref|WP_012992004.1|  threonyl-tRNA synthetase                           258   8e-77    
ref|WP_045668383.1|  threonyl-tRNA synthetase                           258   8e-77    
ref|WP_007475704.1|  threonyl-tRNA synthetase                           257   9e-77    
ref|WP_045705471.1|  threonyl-tRNA synthetase                           256   9e-77    
ref|WP_015419124.1|  MULTISPECIES: threonyl-tRNA synthetase             258   9e-77    
ref|WP_024893607.1|  threonyl-tRNA synthetase                           258   1e-76    
ref|WP_039229782.1|  threonyl-tRNA synthetase                           258   1e-76    
ref|WP_027365526.1|  threonyl-tRNA synthetase                           257   1e-76    
ref|WP_019021983.1|  threonyl-tRNA synthetase                           257   1e-76    
ref|WP_026477061.1|  threonyl-tRNA synthetase                           257   1e-76    
emb|CCO07271.1|  Threonine--tRNA ligase                                 257   2e-76    
ref|WP_028456768.1|  threonyl-tRNA synthetase                           256   2e-76    
gb|EHM40396.1|  threonine--tRNA ligase                                  252   2e-76    
ref|WP_035393447.1|  threonyl-tRNA synthetase                           256   2e-76    
ref|WP_012537294.1|  threonine--tRNA ligase                             257   2e-76    
ref|WP_006748584.1|  threonyl-tRNA synthetase                           257   2e-76    
gb|EKD22238.1|  hypothetical protein ACD_87C00091G0002                  248   2e-76    
ref|WP_013277380.1|  threonyl-tRNA synthetase                           256   3e-76    
ref|WP_013320235.1|  threonyl-tRNA synthetase                           256   3e-76    
ref|WP_018662589.1|  threonyl-tRNA synthetase                           256   3e-76    
ref|WP_034123487.1|  threonyl-tRNA synthetase                           256   3e-76    
gb|KHN45587.1|  Threonine--tRNA ligase                                  251   3e-76    
ref|WP_035217073.1|  threonyl-tRNA synthetase                           256   3e-76    
ref|WP_003519104.1|  threonine--tRNA ligase                             256   3e-76    
ref|WP_041278463.1|  threonyl-tRNA synthetase                           256   4e-76    
ref|WP_022037330.1|  threonyl-tRNA synthetase                           246   4e-76    
ref|WP_011877956.1|  threonine--tRNA ligase                             256   4e-76    
ref|WP_039742210.1|  threonyl-tRNA synthetase                           256   4e-76    
ref|WP_041135500.1|  threonyl-tRNA synthetase                           255   4e-76    
ref|WP_010942162.1|  threonine--tRNA ligase                             256   4e-76    
ref|WP_011712059.1|  threonine--tRNA ligase                             256   4e-76    
ref|WP_025802279.1|  threonyl-tRNA synthetase                           255   4e-76    
emb|CAG36157.1|  probable threonyl-tRNA synthetase                      256   5e-76    
dbj|BAI80964.1|  threonyl-tRNA synthetase                               256   5e-76    
ref|WP_013163470.1|  threonyl-tRNA synthetase                           256   5e-76    
ref|WP_015837514.1|  threonine--tRNA ligase                             256   5e-76    
ref|WP_041223681.1|  threonyl-tRNA synthetase                           256   5e-76    
ref|WP_034287063.1|  threonyl-tRNA synthetase                           255   6e-76    
ref|WP_012648436.1|  threonyl-tRNA synthetase                           256   6e-76    
ref|WP_013276192.1|  threonyl-tRNA synthetase                           255   6e-76    
ref|WP_012469924.1|  threonyl-tRNA synthetase                           256   6e-76    
ref|WP_035587544.1|  threonyl-tRNA synthetase                           255   7e-76    
ref|WP_012513559.1|  threonyl-tRNA synthetase                           255   7e-76    
ref|WP_003543060.1|  MULTISPECIES: threonyl-tRNA synthetase             255   8e-76    
ref|WP_034436952.1|  threonyl-tRNA synthetase                           255   8e-76    
ref|WP_022119294.1|  threonyl-tRNA synthetase                           255   9e-76    
ref|WP_024048768.1|  threonyl-tRNA synthetase                           255   9e-76    
ref|WP_014029876.1|  threonyl-tRNA synthetase                           255   1e-75    
ref|WP_012598773.1|  threonyl-tRNA synthetase                           254   1e-75    
ref|WP_039645121.1|  threonyl-tRNA synthetase                           255   1e-75    
ref|WP_038572213.1|  threonyl-tRNA synthetase                           254   1e-75    
ref|WP_035191396.1|  threonyl-tRNA synthetase                           255   1e-75    
ref|WP_022415998.1|  threonyl-tRNA synthetase                           251   1e-75    
ref|WP_015327696.1|  threonyl-tRNA synthetase                           255   1e-75    
ref|WP_039282519.1|  threonyl-tRNA synthetase                           255   1e-75    
ref|WP_003368225.1|  threonyl-tRNA synthetase                           255   1e-75    
ref|WP_038291141.1|  threonyl-tRNA synthetase [                         254   1e-75    
ref|WP_039253671.1|  threonyl-tRNA synthetase                           254   1e-75    
ref|WP_029917809.1|  threonyl-tRNA synthetase                           254   1e-75    
ref|WP_013777779.1|  threonyl-tRNA synthetase                           254   1e-75    
gb|AGF92896.1|  threonyl-tRNA synthetase                                254   1e-75    
ref|WP_024787764.1|  MULTISPECIES: threonyl-tRNA synthetase             254   2e-75    
ref|WP_024789898.1|  threonyl-tRNA synthetase                           253   2e-75    
ref|WP_032077106.1|  threonyl-tRNA synthetase                           254   2e-75    
ref|WP_015724125.1|  threonyl-tRNA synthetase                           254   3e-75    
ref|WP_026841845.1|  threonyl-tRNA synthetase                           254   3e-75    
ref|WP_011721838.1|  MULTISPECIES: threonine--tRNA ligase               254   3e-75    
ref|WP_025270409.1|  threonyl-tRNA synthetase                           253   3e-75    
emb|CCY34037.1|  threonine--tRNA ligase                                 251   3e-75    
ref|WP_023052858.1|  threonyl-tRNA synthetase                           254   3e-75    
gb|EHP89477.1|  threonyl-tRNA synthetase                                254   3e-75    
sp|A1ARE5.1|SYT_PELPD  RecName: Full=Threonine--tRNA ligase; AltN...    253   3e-75    
ref|WP_021760003.1|  threonyl-tRNA synthetase                           254   3e-75    
ref|WP_042251804.1|  threonyl-tRNA synthetase                           252   4e-75    
ref|WP_011365823.1|  threonyl-tRNA synthetase                           253   4e-75    
ref|WP_041666390.1|  threonyl-tRNA synthetase                           253   4e-75    
gb|ACZ11119.1|  threonyl-tRNA synthetase                                253   4e-75    
ref|WP_041532289.1|  threonyl-tRNA synthetase                           254   4e-75    
ref|WP_029713687.1|  threonyl-tRNA synthetase                           241   4e-75    
ref|WP_010248367.1|  threonyl-tRNA synthetase                           253   4e-75    
ref|WP_027717734.1|  threonyl-tRNA synthetase                           253   4e-75    
ref|WP_012100841.1|  threonine--tRNA ligase                             253   4e-75    
gb|EFG87724.1|  threonyl-tRNA synthetase                                251   4e-75    
ref|XP_008363774.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    254   4e-75    
ref|WP_029731661.1|  threonyl-tRNA synthetase                           253   4e-75    
gb|AKA71877.1|  threonyl-tRNA synthetase                                253   5e-75    
ref|WP_036222776.1|  threonyl-tRNA synthetase                           253   5e-75    
ref|WP_012704212.1|  threonine--tRNA ligase                             253   5e-75    
ref|WP_014521773.1|  threonyl-tRNA synthetase                           253   5e-75    
ref|WP_034109048.1|  threonyl-tRNA synthetase                           253   5e-75    
ref|WP_003357451.1|  threonyl-tRNA synthetase                           253   5e-75    
ref|WP_012048136.1|  threonine--tRNA ligase                             253   5e-75    
ref|WP_045641388.1|  threonyl-tRNA synthetase                           253   5e-75    
ref|WP_040200082.1|  threonyl-tRNA synthetase                           253   6e-75    
emb|CCQ90066.1|  Threonyl-tRNA synthetase                               252   6e-75    
ref|WP_039248059.1|  threonine--tRNA ligase                             253   6e-75    
ref|WP_013842464.1|  threonyl-tRNA synthetase                           253   6e-75    
ref|WP_031516044.1|  threonyl-tRNA synthetase                           253   7e-75    
ref|WP_024932847.1|  threonyl-tRNA synthetase                           253   7e-75    
ref|WP_044451859.1|  threonyl-tRNA synthetase                           247   7e-75    
ref|WP_013681316.1|  threonyl-tRNA synthetase                           252   7e-75    
ref|WP_038455266.1|  threonyl-tRNA synthetase                           252   7e-75    
ref|WP_022203502.1|  threonyl-tRNA synthetase                           251   7e-75    
ref|WP_028580648.1|  threonyl-tRNA synthetase                           253   7e-75    
ref|WP_007870650.1|  MULTISPECIES: threonyl-tRNA synthetase             251   7e-75    
dbj|BAQ14796.1|  putative threonyl-tRNA synthetase                      253   8e-75    
ref|WP_020257330.1|  threonyl-tRNA synthetase                           251   8e-75    
ref|WP_016876086.1|  threonyl-tRNA synthetase                           252   8e-75    
ref|WP_036688344.1|  threonyl-tRNA synthetase                           246   8e-75    
ref|WP_035308172.1|  threonyl-tRNA synthetase                           253   8e-75    
ref|WP_015258997.1|  threonyl-tRNA synthetase                           253   9e-75    
ref|WP_012530422.1|  threonine--tRNA ligase                             252   1e-74    
ref|WP_005333086.1|  threonyl-tRNA synthetase                           253   1e-74    
gb|EQE47755.1|  threonine--tRNA ligase                                  246   1e-74    
ref|WP_030036717.1|  threonyl-tRNA synthetase                           252   1e-74    
ref|WP_022669807.1|  threonyl-tRNA synthetase                           252   1e-74    
ref|WP_035155701.1|  threonyl-tRNA synthetase                           251   1e-74    
ref|WP_007061855.1|  threonyl-tRNA synthetase                           252   1e-74    
ref|WP_041285319.1|  threonyl-tRNA synthetase                           252   1e-74    
ref|WP_035164176.1|  threonyl-tRNA synthetase                           252   1e-74    
ref|WP_013608537.1|  threonyl-tRNA synthetase                           251   1e-74    
ref|WP_044936919.1|  threonyl-tRNA synthetase                           252   2e-74    
ref|WP_016646448.1|  threonyl-tRNA synthetase                           251   2e-74    
ref|WP_022846353.1|  threonyl-tRNA synthetase                           252   2e-74    
ref|WP_044920235.1|  threonyl-tRNA synthetase                           252   2e-74    
ref|WP_041584665.1|  threonyl-tRNA synthetase                           251   2e-74    
ref|WP_006427944.1|  threonyl-tRNA synthetase                           252   2e-74    
gb|AGL01161.1|  threonyl-tRNA synthetase                                252   2e-74    
gb|ABC76531.1|  threonyl-tRNA synthetase                                252   2e-74    
ref|WP_034961733.1|  threonyl-tRNA synthetase                           251   2e-74    
ref|WP_034557348.1|  threonyl-tRNA synthetase                           251   2e-74    
ref|WP_018525741.1|  threonyl-tRNA synthetase                           250   2e-74    
ref|WP_011979651.1|  threonyl-tRNA synthetase                           251   2e-74    
ref|WP_025484651.1|  threonyl-tRNA synthetase                           250   2e-74    
ref|WP_016871284.1|  MULTISPECIES: threonyl-tRNA synthetase             251   2e-74    
ref|WP_014625252.1|  threonyl-tRNA synthetase                           250   2e-74    
gb|EHC16111.1|  threonyl-tRNA synthetase                                251   2e-74    
ref|WP_022370551.1|  threonyl-tRNA synthetase                           251   2e-74    
ref|WP_040382984.1|  threonyl-tRNA synthetase                           250   2e-74    
ref|WP_006942411.1|  threonyl-tRNA synthetase                           251   2e-74    
ref|WP_022363528.1|  threonyl-tRNA synthetase                           251   2e-74    
ref|WP_008244944.1|  threonyl-tRNA synthetase                           251   2e-74    
ref|WP_013380525.1|  threonyl-tRNA synthetase                           251   2e-74    
gb|EQF34163.1|  threonine--tRNA ligase                                  246   2e-74    
gb|EQB63536.1|  Threonine-tRNA ligase                                   251   3e-74    
ref|WP_005339254.1|  threonyl-tRNA synthetase                           251   3e-74    
ref|WP_029552655.1|  threonyl-tRNA synthetase                           250   3e-74    
ref|WP_021088720.1|  threonyl-tRNA synthetase                           250   3e-74    
ref|WP_022279076.1|  threonyl-tRNA synthetase                           251   3e-74    
ref|WP_011991667.1|  threonine--tRNA ligase                             250   3e-74    
ref|WP_035108964.1|  threonyl-tRNA synthetase                           251   3e-74    
ref|WP_013886840.1|  threonyl-tRNA synthetase                           251   3e-74    
ref|WP_028321727.1|  threonyl-tRNA synthetase                           251   3e-74    
ref|WP_027626870.1|  threonyl-tRNA synthetase                           251   3e-74    
ref|WP_020675849.1|  threonyl-tRNA synthetase                           251   3e-74    
gb|AAN87390.1|  Threonyl-tRNA synthetase                                242   3e-74    
ref|WP_009295105.1|  threonyl-tRNA synthetase                           250   4e-74    
ref|WP_037379919.1|  threonyl-tRNA synthetase                           251   4e-74    
ref|WP_018084424.1|  threonyl-tRNA synthetase                           251   4e-74    
ref|WP_003403394.1|  threonine--tRNA ligase                             251   4e-74    
ref|WP_011115284.1|  MULTISPECIES: threonine--tRNA ligase               250   4e-74    
ref|WP_021083865.1|  threonyl-tRNA synthetase                           250   4e-74    
ref|WP_044823365.1|  threonyl-tRNA synthetase                           251   4e-74    
ref|WP_013240075.1|  MULTISPECIES: threonyl-tRNA synthetase             251   4e-74    
ref|WP_008477394.1|  threonyl-tRNA synthetase                           249   4e-74    
ref|WP_018137320.1|  threonyl-tRNA synthetase                           250   5e-74    
ref|WP_037387961.1|  threonyl-tRNA synthetase                           250   5e-74    
gb|KJF28419.1|  threonyl-tRNA synthetase                                250   5e-74    
ref|WP_014270722.1|  threonyl-tRNA synthetase                           249   5e-74    
ref|WP_033125850.1|  threonyl-tRNA synthetase                           249   5e-74    
ref|WP_044278164.1|  threonyl-tRNA synthetase                           241   5e-74    
ref|WP_024961856.1|  threonyl-tRNA synthetase                           250   5e-74    
gb|AEV69571.1|  Ser-tRNA(Thr) hydrolase, threonyl-tRNA synthetase...    250   5e-74    
ref|WP_009649623.1|  threonyl-tRNA synthetase                           249   5e-74    
ref|WP_023439274.1|  threonyl-tRNA synthetase                           250   6e-74    
ref|WP_012660782.1|  threonine--tRNA ligase                             249   6e-74    
ref|WP_011939482.1|  threonyl-tRNA synthetase                           250   6e-74    
ref|WP_027621854.1|  threonyl-tRNA synthetase [                         250   6e-74    
ref|WP_024737809.1|  threonyl-tRNA synthetase                           249   6e-74    
ref|WP_041715764.1|  threonyl-tRNA synthetase [                         250   6e-74    
ref|WP_007708347.1|  threonyl-tRNA synthetase [                         249   7e-74    
ref|WP_002577030.1|  threonyl-tRNA synthetase [                         249   7e-74    
ref|WP_038351631.1|  threonyl-tRNA synthetase                           250   7e-74    
ref|WP_022325399.1|  threonyl-tRNA synthetase                           250   7e-74    
ref|WP_014854752.1|  threonyl-tRNA synthetase                           250   8e-74    
ref|WP_026733623.1|  threonyl-tRNA synthetase                           249   8e-74    
ref|WP_021092512.1|  threonyl-tRNA synthetase                           249   9e-74    
ref|WP_028086002.1|  threonyl-tRNA synthetase                           250   9e-74    
ref|WP_016866980.1|  threonyl-tRNA synthetase                           249   9e-74    



>ref|XP_009795256.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Nicotiana 
sylvestris]
Length=677

 Score =   418 bits (1075),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 216/234 (92%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE ILQQFGFD YEVNLSTRPEK+VG+D+IWEKATSALKDAL DK W+YQID+GGGAFYG
Sbjct  444  TEEILQQFGFDKYEVNLSTRPEKAVGDDEIWEKATSALKDALEDKGWSYQIDDGGGAFYG  503

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+QE+KRPI+IHRAVLGSLERFFG
Sbjct  504  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNQERKRPIMIHRAVLGSLERFFG  563

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIE+YAGDFPLWLSPIQ R++PVTD QL++CN+V K+LKASGIR EVCSGERLPKLIRN
Sbjct  564  VLIENYAGDFPLWLSPIQARVLPVTDAQLQYCNEVGKKLKASGIRVEVCSGERLPKLIRN  623

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQKIPLMAVVGPKEVE+  VT+RSRF GELG M ID+FI   KNA ENRTF 
Sbjct  624  AEKQKIPLMAVVGPKEVETQTVTVRSRFAGELGNMSIDEFISRTKNASENRTFL  677



>gb|EYU43185.1| hypothetical protein MIMGU_mgv1a002431mg [Erythranthe guttata]
Length=676

 Score =   418 bits (1074),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 197/233 (85%), Positives = 216/233 (93%), Gaps = 0/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGFD YEVNLSTRPEKSVG DDIW+KATSALKDAL+DK W YQID+GGGAFYG
Sbjct  443  TEEILLQFGFDKYEVNLSTRPEKSVGGDDIWDKATSALKDALDDKGWNYQIDDGGGAFYG  502

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RF++TYVDSDQEKKRPI+IHRAVLGSLERFFG
Sbjct  503  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFNITYVDSDQEKKRPIMIHRAVLGSLERFFG  562

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ RL+PVTD QLE+CN+V KRLK +GIRAEVCSGERLPKLIR 
Sbjct  563  VLIEHYAGDFPLWLSPIQARLLPVTDIQLEYCNEVCKRLKENGIRAEVCSGERLPKLIRT  622

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTF  203
            AEK KIPLMAVVGPKEVE+ A+T+RSRFGGELGTM +DDFI + K+A+EN+ F
Sbjct  623  AEKLKIPLMAVVGPKEVETQALTVRSRFGGELGTMSVDDFISKTKHAVENKAF  675



>gb|KDO58457.1| hypothetical protein CISIN_1g0468081mg, partial [Citrus sinensis]
Length=432

 Score =   408 bits (1048),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/232 (82%), Positives = 213/232 (92%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLST+PEK+VG DDIWEKATSAL+DAL+DK W YQIDEGGGAFYG
Sbjct  199  TEEILLQFGFNKYEVNLSTKPEKAVGGDDIWEKATSALRDALDDKGWDYQIDEGGGAFYG  258

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+ YVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  259  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDIVYVDSNSEKKRPIMIHRAVLGSLERFFG  318

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTDTQLE+CN+V K+LK +GIRAE+C GERLPKLIRN
Sbjct  319  VLIEHYAGDFPLWLSPIQARVLPVTDTQLEYCNEVIKKLKTNGIRAEICHGERLPKLIRN  378

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KEV++  VT+RSRFGGELGTM++DDFI   K+A ENRT
Sbjct  379  AEKQKIPLMAVVGAKEVDAQTVTVRSRFGGELGTMKVDDFISRIKSATENRT  430



>ref|XP_011085644.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Sesamum 
indicum]
Length=734

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGFD YEVNLSTRPEKSVG DDIWEKAT ALKDAL+DK W+YQID GGGAFYG
Sbjct  501  TEEILLQFGFDKYEVNLSTRPEKSVGGDDIWEKATVALKDALDDKGWSYQIDNGGGAFYG  560

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+QEKKRPI+IHRAVLGSLERFFG
Sbjct  561  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNQEKKRPIMIHRAVLGSLERFFG  620

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VL+EHYAGDFPLWLSPIQ RL+PVTDTQLE+CN+V  RLKA+GIR+EVCSGERLPKLIR 
Sbjct  621  VLVEHYAGDFPLWLSPIQARLLPVTDTQLEYCNEVNNRLKANGIRSEVCSGERLPKLIRT  680

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            +EK K+PLMAVVGPKEVE+  VT+RSR G ELGTM +DDFI + K AIENRTFF
Sbjct  681  SEKLKVPLMAVVGPKEVETQTVTVRSRSGRELGTMAVDDFISKVKYAIENRTFF  734



>ref|XP_006363036.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Solanum 
tuberosum]
Length=670

 Score =   414 bits (1063),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/234 (83%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE ILQQFGFD YEVNLSTRPEK+VG+D+IWEKAT ALKDAL DK W+YQID+GGGAFYG
Sbjct  437  TEEILQQFGFDKYEVNLSTRPEKAVGDDEIWEKATFALKDALEDKGWSYQIDDGGGAFYG  496

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+QE+KRPI+IHRAVLGSLERFFG
Sbjct  497  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNQERKRPIMIHRAVLGSLERFFG  556

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIE+YAGDFPLWLSPIQ R++PVTD QL++CN+V K+LKASGIR EVCSGERLPKLIRN
Sbjct  557  VLIENYAGDFPLWLSPIQARVLPVTDAQLQYCNEVGKKLKASGIRVEVCSGERLPKLIRN  616

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQKIPLMAVVGPKEVE++ +TIRSRF GELG M ID+FI   K A ENRTF 
Sbjct  617  AEKQKIPLMAVVGPKEVETETITIRSRFAGELGNMSIDEFISRTKTASENRTFL  670



>ref|XP_002270988.3| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Vitis 
vinifera]
Length=677

 Score =   412 bits (1060),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG DDIWEKATSAL+DAL+DK W+Y+IDEGGGAFYG
Sbjct  444  TEEILLQFGFSKYEVNLSTRPEKAVGADDIWEKATSALRDALDDKGWSYRIDEGGGAFYG  503

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EK+RPI+IHRAVLGSLERFFG
Sbjct  504  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNSEKQRPIMIHRAVLGSLERFFG  563

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTDTQLE+CN+V  +LKA+GIRAEVC GERLPKLIRN
Sbjct  564  VLIEHYAGDFPLWLSPIQARVLPVTDTQLEYCNEVTNKLKANGIRAEVCHGERLPKLIRN  623

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            +EKQ+IPLMAVVGPKEVE+  VT+RSRFGGELGTM ++DFI   K+A ENRT F
Sbjct  624  SEKQRIPLMAVVGPKEVETQTVTVRSRFGGELGTMIVEDFISRTKSATENRTSF  677



>ref|XP_004243537.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Solanum 
lycopersicum]
Length=673

 Score =   412 bits (1059),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE ILQQFGFD YEVNLSTRPEK+VG+D+IWEKAT ALKDAL DK W+YQID+GGGAFYG
Sbjct  440  TEEILQQFGFDKYEVNLSTRPEKAVGDDEIWEKATFALKDALEDKGWSYQIDDGGGAFYG  499

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+QE+KRPI+IHRAVLGSLERFFG
Sbjct  500  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNQERKRPIMIHRAVLGSLERFFG  559

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIE+YAGDFPLWLSPIQ R++PVTD QL++CN+V K+LKASGIR EVCSGERLPKLIRN
Sbjct  560  VLIENYAGDFPLWLSPIQARVLPVTDAQLQYCNEVVKKLKASGIRVEVCSGERLPKLIRN  619

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQKIPLMAVVGPKEVE++ +T+RSRF GELG M ID+FI   K A +NRTF 
Sbjct  620  AEKQKIPLMAVVGPKEVETETITVRSRFAGELGNMSIDEFISRTKTASDNRTFL  673



>ref|XP_009594560.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=680

 Score =   412 bits (1058),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE ILQQFGFD YEVNLSTRPEK+VG+D+IW+KATSALKDAL DK W+YQID+GGGAFYG
Sbjct  447  TEEILQQFGFDKYEVNLSTRPEKAVGDDEIWDKATSALKDALEDKGWSYQIDDGGGAFYG  506

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RF +TYVDS+QE+KRPI+IHRAVLGSLERFFG
Sbjct  507  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFGITYVDSNQERKRPIMIHRAVLGSLERFFG  566

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIE+YAGDFPLWLSPIQ R++PVTD QL++CN+V K+LKASGIR EVCSGERLPKLIRN
Sbjct  567  VLIENYAGDFPLWLSPIQARVLPVTDAQLQYCNEVGKKLKASGIRVEVCSGERLPKLIRN  626

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQKIPLMAVVGPKEVE+  VT+RSRF GELG M ID+FI   K A ENRTF 
Sbjct  627  AEKQKIPLMAVVGPKEVETQTVTVRSRFAGELGNMSIDEFISRTKTASENRTFL  680



>gb|KJB10282.1| hypothetical protein B456_001G193700 [Gossypium raimondii]
Length=425

 Score =   402 bits (1034),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 213/233 (91%), Gaps = 0/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG+DDIWEKAT ALKDAL+DK W+YQIDEGGGAFYG
Sbjct  193  TEEILLQFGFSKYEVNLSTRPEKAVGDDDIWEKATVALKDALDDKGWSYQIDEGGGAFYG  252

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIED+LGRKWQCSTIQVDFNLP RFD+TYVDS+ EK+RPI+IHRAVLGSLERFFG
Sbjct  253  PKIDLKIEDSLGRKWQCSTIQVDFNLPNRFDITYVDSNSEKRRPIMIHRAVLGSLERFFG  312

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+PIQ R++PVTDTQL +CN+V  +LK++GIRAEVC GERLPKLIRN
Sbjct  313  VLIEHYAGDFPLWLAPIQARVLPVTDTQLGYCNEVVGKLKSNGIRAEVCHGERLPKLIRN  372

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTF  203
            AEKQKIPLMAVVG KEVE+ +VT+RSRFGGELGTM+ID+FI   + AI+NRT 
Sbjct  373  AEKQKIPLMAVVGLKEVETHSVTVRSRFGGELGTMKIDEFISSIQQAIKNRTL  425



>emb|CDP18259.1| unnamed protein product [Coffea canephora]
Length=723

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGFD YEVNLSTRP+K+VGNDDIW KATSALKDALNDK W+YQIDEGGGAFYG
Sbjct  490  TEEILLQFGFDKYEVNLSTRPDKAVGNDDIWVKATSALKDALNDKRWSYQIDEGGGAFYG  549

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDSDQEKK+P++IHRAVLGSLERFFG
Sbjct  550  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSDQEKKQPLMIHRAVLGSLERFFG  609

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP Q R++PVTD QLE+CN++ +RLKA+G+R E+CSGERLPKLIRN
Sbjct  610  VLIEHYAGDFPLWLSPTQARILPVTDAQLEYCNEIWRRLKANGLRTEICSGERLPKLIRN  669

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQKIPLMAVVGPKE E+  VT+RSR GGELGTM ID+FI   K A+E+RTF 
Sbjct  670  AEKQKIPLMAVVGPKEAETQTVTVRSRHGGELGTMPIDEFITRIKCAVESRTFL  723



>ref|XP_007138794.1| hypothetical protein PHAVU_009G238000g [Phaseolus vulgaris]
 gb|ESW10788.1| hypothetical protein PHAVU_009G238000g [Phaseolus vulgaris]
Length=478

 Score =   403 bits (1036),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 190/232 (82%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGFD YEVNLSTRPEKSVGNDDIWEKATSAL+DAL+DK W+YQID+GGGAFYG
Sbjct  245  TEQILLQFGFDKYEVNLSTRPEKSVGNDDIWEKATSALEDALDDKGWSYQIDDGGGAFYG  304

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EK+RPI+IHRAVLGS+ERFFG
Sbjct  305  PKIDIKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNTEKRRPIMIHRAVLGSMERFFG  364

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QLE+CN V  +LK  GIR EVC GERLPKLIRN
Sbjct  365  VLIEHYAGDFPLWLSPIQARVLPVTDAQLEYCNGVANKLKMYGIRVEVCHGERLPKLIRN  424

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KEVE++ VT+RSRFGGELGTM +DDFI   K A EN T
Sbjct  425  AEKQKIPLMAVVGSKEVETETVTVRSRFGGELGTMSVDDFINRIKLASENLT  476



>ref|XP_010674905.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Beta 
vulgaris subsp. vulgaris]
Length=680

 Score =   410 bits (1053),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 211/234 (90%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG DDIWEKATSALKDAL+DK W+Y+IDEGGGAFYG
Sbjct  447  TEQILLQFGFHQYEVNLSTRPEKAVGGDDIWEKATSALKDALDDKGWSYEIDEGGGAFYG  506

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLPERFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  507  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  566

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q RL+PVTD+QLE+CN+V   LKA GIRAEVC GERLPKLIR 
Sbjct  567  VLIEHYAGDFPLWLSPVQARLLPVTDSQLEYCNEVANMLKADGIRAEVCHGERLPKLIRT  626

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQ++PLMAVVGPKEVE+ +VT+RSRFGGELG M +DDF    K AIENR+ F
Sbjct  627  AEKQRVPLMAVVGPKEVEAQSVTVRSRFGGELGFMSVDDFTCRIKKAIENRSSF  680



>gb|KJB10280.1| hypothetical protein B456_001G193700 [Gossypium raimondii]
 gb|KJB10281.1| hypothetical protein B456_001G193700 [Gossypium raimondii]
Length=491

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 213/233 (91%), Gaps = 0/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG+DDIWEKAT ALKDAL+DK W+YQIDEGGGAFYG
Sbjct  259  TEEILLQFGFSKYEVNLSTRPEKAVGDDDIWEKATVALKDALDDKGWSYQIDEGGGAFYG  318

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIED+LGRKWQCSTIQVDFNLP RFD+TYVDS+ EK+RPI+IHRAVLGSLERFFG
Sbjct  319  PKIDLKIEDSLGRKWQCSTIQVDFNLPNRFDITYVDSNSEKRRPIMIHRAVLGSLERFFG  378

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+PIQ R++PVTDTQL +CN+V  +LK++GIRAEVC GERLPKLIRN
Sbjct  379  VLIEHYAGDFPLWLAPIQARVLPVTDTQLGYCNEVVGKLKSNGIRAEVCHGERLPKLIRN  438

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTF  203
            AEKQKIPLMAVVG KEVE+ +VT+RSRFGGELGTM+ID+FI   + AI+NRT 
Sbjct  439  AEKQKIPLMAVVGLKEVETHSVTVRSRFGGELGTMKIDEFISSIQQAIKNRTL  491



>ref|XP_006469541.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Citrus 
sinensis]
Length=668

 Score =   407 bits (1047),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 190/232 (82%), Positives = 213/232 (92%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLST+PEK+VG +DIWEKATSAL+DAL+DK W YQIDEGGGAFYG
Sbjct  435  TEEILLQFGFNKYEVNLSTKPEKAVGGNDIWEKATSALRDALDDKGWDYQIDEGGGAFYG  494

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+ YVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  495  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDIVYVDSNSEKKRPIMIHRAVLGSLERFFG  554

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTDTQLE+CN+V K+LK +GIRAE+C GERLPKLIRN
Sbjct  555  VLIEHYAGDFPLWLSPIQARVLPVTDTQLEYCNEVIKKLKTNGIRAEICHGERLPKLIRN  614

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KEV++  VT+RSRFGGELGTM++DDFI   K+A ENRT
Sbjct  615  AEKQKIPLMAVVGAKEVDAQTVTVRSRFGGELGTMKVDDFISRIKSATENRT  666



>ref|XP_010270142.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Nelumbo 
nucifera]
Length=677

 Score =   407 bits (1046),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/234 (81%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLSTRPEK+VG DDIWEKAT+ALKDAL+DK W YQIDEGGGAFYG
Sbjct  444  TEEILLQFGFNKYEVNLSTRPEKAVGGDDIWEKATAALKDALDDKGWDYQIDEGGGAFYG  503

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  504  PKIDLKIEDALGRKWQCSTVQVDFNLPQRFDITYVDSNTEKKRPIMIHRAVLGSLERFFG  563

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIEHYAGDFP+WLSPIQ R++PVTDTQLE+C++V K+LK +GIRAEVC GERLPKLIRN
Sbjct  564  ILIEHYAGDFPVWLSPIQARVLPVTDTQLEYCHEVTKKLKGNGIRAEVCHGERLPKLIRN  623

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +D+FI   K+A E+R  F
Sbjct  624  AEKQKIPLMAVVGPKEVETQTVTVRSRFGGELGTISVDEFISRIKSATEDRKSF  677



>ref|XP_006447722.1| hypothetical protein CICLE_v10018290mg, partial [Citrus clementina]
 gb|ESR60962.1| hypothetical protein CICLE_v10018290mg, partial [Citrus clementina]
Length=733

 Score =   408 bits (1049),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 190/232 (82%), Positives = 213/232 (92%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLST+PEK+VG +DIWEKATSAL+DAL+DK W YQIDEGGGAFYG
Sbjct  500  TEEILLQFGFNKYEVNLSTKPEKAVGGNDIWEKATSALRDALDDKGWDYQIDEGGGAFYG  559

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+ YVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  560  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDIVYVDSNSEKKRPIMIHRAVLGSLERFFG  619

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTDTQLE+CN+V K+LK +GIRAE+C GERLPKLIRN
Sbjct  620  VLIEHYAGDFPLWLSPIQARVLPVTDTQLEYCNEVIKKLKTNGIRAEICHGERLPKLIRN  679

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KEV++  VT+RSRFGGELGTM++DDFI   K+A ENRT
Sbjct  680  AEKQKIPLMAVVGAKEVDAQTVTVRSRFGGELGTMKVDDFISRIKSATENRT  731



>gb|AES71826.2| threonyl-tRNA synthetase/threonine-tRNA ligase, putative [Medicago 
truncatula]
Length=652

 Score =   406 bits (1043),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/232 (82%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE  L QFGFD YE+NLSTRPEKSVG DDIWEKATSALKDAL+DK WTYQID+GGGAFYG
Sbjct  419  TEETLSQFGFDKYEINLSTRPEKSVGEDDIWEKATSALKDALDDKGWTYQIDDGGGAFYG  478

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  479  PKIDVKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  538

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QLE+C  V  +LK  GIRAEVC GERLPKLIRN
Sbjct  539  VLIEHYAGDFPLWLSPIQARILPVTDAQLEYCKDVTNKLKKYGIRAEVCHGERLPKLIRN  598

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KE+E+  VT+RSRFGGELGTM +DDFI   K AIEN T
Sbjct  599  AEKQKIPLMAVVGSKEIETQTVTVRSRFGGELGTMSVDDFISRIKLAIENPT  650



>ref|XP_010046021.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Eucalyptus 
grandis]
Length=490

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/234 (80%), Positives = 212/234 (91%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG+DDIW+KAT+AL++AL+DK W+YQIDEGGGAFYG
Sbjct  257  TERILLQFGFSKYEVNLSTRPEKAVGDDDIWDKATTALREALDDKGWSYQIDEGGGAFYG  316

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  317  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNLEKKRPIMIHRAVLGSLERFFG  376

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QL+FCN+V ++LK + +RAEVC GERLPKLIRN
Sbjct  377  VLIEHYAGDFPLWLSPIQARILPVTDNQLDFCNEVTRKLKKNEVRAEVCHGERLPKLIRN  436

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQKIPLMAVVGPKEVE+  VT+RSRFGGELG++ IDDFI     A ENRT F
Sbjct  437  AEKQKIPLMAVVGPKEVETGTVTVRSRFGGELGSITIDDFIYRITKASENRTSF  490



>ref|XP_002320505.2| hypothetical protein POPTR_0014s16030g [Populus trichocarpa]
 gb|EEE98820.2| hypothetical protein POPTR_0014s16030g [Populus trichocarpa]
Length=686

 Score =   407 bits (1045),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/232 (82%), Positives = 212/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEKSVG+DDIWEKATSAL+DAL+DK W++QIDEGGGAFYG
Sbjct  453  TEEILLQFGFRRYEVNLSTRPEKSVGDDDIWEKATSALRDALDDKGWSFQIDEGGGAFYG  512

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  513  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDVTYVDSNTEKKRPIMIHRAVLGSLERFFG  572

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTDTQLE+C +V  +LK +GIRAEVC GERLPKLIRN
Sbjct  573  VLIEHYAGDFPLWLSPVQVRILPVTDTQLEYCKEVISKLKGNGIRAEVCQGERLPKLIRN  632

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVGPKE E+  VTIRSRF GE+GT++IDDFI   K+AIE RT
Sbjct  633  AEKQKIPLMAVVGPKEAETQTVTIRSRFSGEVGTIEIDDFISRIKSAIERRT  684



>ref|XP_011003513.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Populus 
euphratica]
Length=686

 Score =   406 bits (1044),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/232 (82%), Positives = 212/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEKSVG+DDIWEKATSAL+DAL+DK W++QIDEGGGAFYG
Sbjct  453  TEEILLQFGFRRYEVNLSTRPEKSVGDDDIWEKATSALRDALDDKGWSFQIDEGGGAFYG  512

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  513  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDVTYVDSNTEKKRPIMIHRAVLGSLERFFG  572

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTDTQLE+C +V  +LK +GIRAEVC GERLPKLIRN
Sbjct  573  VLIEHYAGDFPLWLSPVQVRILPVTDTQLEYCKEVISKLKGNGIRAEVCQGERLPKLIRN  632

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVGPKE E+  VTIRSRF GE+GT++IDDFI   K+AIE RT
Sbjct  633  AEKQKIPLMAVVGPKEAETQTVTIRSRFSGEVGTIEIDDFISRIKSAIERRT  684



>ref|XP_003601575.1| Threonyl-tRNA synthetase [Medicago truncatula]
Length=690

 Score =   406 bits (1043),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/232 (82%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE  L QFGFD YE+NLSTRPEKSVG DDIWEKATSALKDAL+DK WTYQID+GGGAFYG
Sbjct  457  TEETLSQFGFDKYEINLSTRPEKSVGEDDIWEKATSALKDALDDKGWTYQIDDGGGAFYG  516

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  517  PKIDVKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  576

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QLE+C  V  +LK  GIRAEVC GERLPKLIRN
Sbjct  577  VLIEHYAGDFPLWLSPIQARILPVTDAQLEYCKDVTNKLKKYGIRAEVCHGERLPKLIRN  636

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KE+E+  VT+RSRFGGELGTM +DDFI   K AIEN T
Sbjct  637  AEKQKIPLMAVVGSKEIETQTVTVRSRFGGELGTMSVDDFISRIKLAIENPT  688



>ref|XP_004502186.1| PREDICTED: threonine--tRNA ligase-like isoform X3 [Cicer arietinum]
Length=561

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/232 (81%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE  L QFGFD YE+NLSTRPEKSVG+DDIWEKATSALKDAL+DK WTYQID+GGGAFYG
Sbjct  328  TEETLSQFGFDKYEINLSTRPEKSVGDDDIWEKATSALKDALDDKGWTYQIDDGGGAFYG  387

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  388  PKIDVKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNTEKKRPIMIHRAVLGSLERFFG  447

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QLE+C  V  +LK  GIRAE+C GERLPKLIRN
Sbjct  448  VLIEHYAGDFPLWLSPIQARVLPVTDAQLEYCKDVTNKLKKYGIRAEICHGERLPKLIRN  507

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KEVE+  VT+RSRF GELGTM +DDF+   K AIEN T
Sbjct  508  AEKQKIPLMAVVGSKEVETQTVTVRSRFSGELGTMPVDDFVSRVKLAIENTT  559



>ref|XP_007138795.1| hypothetical protein PHAVU_009G238000g [Phaseolus vulgaris]
 gb|ESW10789.1| hypothetical protein PHAVU_009G238000g [Phaseolus vulgaris]
Length=657

 Score =   405 bits (1040),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/232 (82%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGFD YEVNLSTRPEKSVGNDDIWEKATSAL+DAL+DK W+YQID+GGGAFYG
Sbjct  424  TEQILLQFGFDKYEVNLSTRPEKSVGNDDIWEKATSALEDALDDKGWSYQIDDGGGAFYG  483

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EK+RPI+IHRAVLGS+ERFFG
Sbjct  484  PKIDIKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNTEKRRPIMIHRAVLGSMERFFG  543

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QLE+CN V  +LK  GIR EVC GERLPKLIRN
Sbjct  544  VLIEHYAGDFPLWLSPIQARVLPVTDAQLEYCNGVANKLKMYGIRVEVCHGERLPKLIRN  603

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KEVE++ VT+RSRFGGELGTM +DDFI   K A EN T
Sbjct  604  AEKQKIPLMAVVGSKEVETETVTVRSRFGGELGTMSVDDFINRIKLASENLT  655



>ref|XP_007049264.1| Threonyl-tRNA synthetase / threonine--tRNA ligase, putative isoform 
2 [Theobroma cacao]
 gb|EOX93421.1| Threonyl-tRNA synthetase / threonine--tRNA ligase, putative isoform 
2 [Theobroma cacao]
Length=492

 Score =   398 bits (1023),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 187/232 (81%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLST+PEK+VG DDIWEKAT ALKDAL+DK W+YQIDEGGGAFYG
Sbjct  259  TEEILFQFGFSKYEVNLSTKPEKAVGGDDIWEKATIALKDALDDKGWSYQIDEGGGAFYG  318

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP RFD+TYVDS+ EK+RPI+IHRAVLGSLERF G
Sbjct  319  PKIDLKIEDALGRKWQCSTIQVDFNLPNRFDITYVDSNSEKRRPIMIHRAVLGSLERFLG  378

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+PIQ R++PVTDTQL +C +V  +LKA+GIRAEVC GERLPKLIRN
Sbjct  379  VLIEHYAGDFPLWLTPIQARILPVTDTQLGYCKEVSSKLKANGIRAEVCHGERLPKLIRN  438

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVGPKEVE+ +VT+RSRFGGELGTM+ID+F    + AI+NR+
Sbjct  439  AEKQKIPLMAVVGPKEVETHSVTVRSRFGGELGTMKIDEFNSSMEQAIKNRS  490



>ref|XP_010112806.1| Threonine--tRNA ligase [Morus notabilis]
 gb|EXC34921.1| Threonine--tRNA ligase [Morus notabilis]
Length=684

 Score =   404 bits (1039),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 215/248 (87%), Gaps = 14/248 (6%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L QFGF  YEVNLSTRPEKSVG+DDIWEKATSALKDAL+DK W+YQIDEGGGAFYG
Sbjct  437  TEEMLLQFGFSKYEVNLSTRPEKSVGDDDIWEKATSALKDALDDKGWSYQIDEGGGAFYG  496

Query  721  PKIDLKIEDALGRKWQCSTIQ--------------VDFNLPERFDMTYVDSDQEKKRPIL  584
            PKIDLKIEDALGRKWQCSTIQ              VDFNLP+RFD+TYVDS  EKKRPI+
Sbjct  497  PKIDLKIEDALGRKWQCSTIQAIPRLIFSRFYGKRVDFNLPQRFDITYVDSTSEKKRPIM  556

Query  583  IHRAVLGSLERFFGVLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRA  404
            IHRAVLGSLERFFGVLIEHYAGDFPLWLSPIQ R++PVTDTQLE+CN+V K+LKA+GIRA
Sbjct  557  IHRAVLGSLERFFGVLIEHYAGDFPLWLSPIQARVLPVTDTQLEYCNEVAKKLKANGIRA  616

Query  403  EVCSGERLPKLIRNAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKN  224
            EVC GERLPKLIRNAE QKIPLMAVVG KE+E+  VT+RSRFGG++GTM +DDF+   K+
Sbjct  617  EVCHGERLPKLIRNAETQKIPLMAVVGAKELETGTVTVRSRFGGDVGTMTVDDFVGRTKS  676

Query  223  AIENRTFF  200
            AIENRT F
Sbjct  677  AIENRTSF  684



>ref|XP_004502185.1| PREDICTED: threonine--tRNA ligase-like isoform X2 [Cicer arietinum]
Length=648

 Score =   403 bits (1036),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/232 (81%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE  L QFGFD YE+NLSTRPEKSVG+DDIWEKATSALKDAL+DK WTYQID+GGGAFYG
Sbjct  415  TEETLSQFGFDKYEINLSTRPEKSVGDDDIWEKATSALKDALDDKGWTYQIDDGGGAFYG  474

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  475  PKIDVKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNTEKKRPIMIHRAVLGSLERFFG  534

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QLE+C  V  +LK  GIRAE+C GERLPKLIRN
Sbjct  535  VLIEHYAGDFPLWLSPIQARVLPVTDAQLEYCKDVTNKLKKYGIRAEICHGERLPKLIRN  594

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KEVE+  VT+RSRF GELGTM +DDF+   K AIEN T
Sbjct  595  AEKQKIPLMAVVGSKEVETQTVTVRSRFSGELGTMPVDDFVSRVKLAIENTT  646



>ref|XP_009136151.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Brassica rapa]
Length=652

 Score =   403 bits (1036),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 211/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGFD YEVNLSTRPEKSVG+DDIWEKAT ALKDAL+DK W+Y++DEGGGAFYG
Sbjct  419  TEEILSRFGFDKYEVNLSTRPEKSVGSDDIWEKATCALKDALDDKGWSYEVDEGGGAFYG  478

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  479  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  538

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTD QLEFC +V K+LKA G+RAE+C GERLPKLIRN
Sbjct  539  VLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSKKLKACGVRAELCHGERLPKLIRN  598

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DDFI +   A+E RT
Sbjct  599  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDFINKINIAVETRT  650



>emb|CBI28402.3| unnamed protein product [Vitis vinifera]
Length=688

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/245 (78%), Positives = 215/245 (88%), Gaps = 11/245 (4%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG DDIWEKATSAL+DAL+DK W+Y+IDEGGGAFYG
Sbjct  444  TEEILLQFGFSKYEVNLSTRPEKAVGADDIWEKATSALRDALDDKGWSYRIDEGGGAFYG  503

Query  721  PKIDLKIEDALGRKWQCSTIQ-----------VDFNLPERFDMTYVDSDQEKKRPILIHR  575
            PKIDLKIEDALGRKWQCSTIQ           VDFNLP+RFD+TYVDS+ EK+RPI+IHR
Sbjct  504  PKIDLKIEDALGRKWQCSTIQANRLDLSFTKEVDFNLPQRFDITYVDSNSEKQRPIMIHR  563

Query  574  AVLGSLERFFGVLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVC  395
            AVLGSLERFFGVLIEHYAGDFPLWLSPIQ R++PVTDTQLE+CN+V  +LKA+GIRAEVC
Sbjct  564  AVLGSLERFFGVLIEHYAGDFPLWLSPIQARVLPVTDTQLEYCNEVTNKLKANGIRAEVC  623

Query  394  SGERLPKLIRNAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIE  215
             GERLPKLIRN+EKQ+IPLMAVVGPKEVE+  VT+RSRFGGELGTM ++DFI   K+A E
Sbjct  624  HGERLPKLIRNSEKQRIPLMAVVGPKEVETQTVTVRSRFGGELGTMIVEDFISRTKSATE  683

Query  214  NRTFF  200
            NRT F
Sbjct  684  NRTSF  688



>emb|CDX93065.1| BnaA03g37870D [Brassica napus]
Length=659

 Score =   403 bits (1035),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 211/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGFD YEVNLSTRPEKSVG+DDIWEKAT ALKDAL+DK W+Y++DEGGGAFYG
Sbjct  426  TEEILSRFGFDKYEVNLSTRPEKSVGSDDIWEKATCALKDALDDKGWSYEVDEGGGAFYG  485

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  486  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  545

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTD QLEFC +V K+LKA G+RAE+C GERLPKLIRN
Sbjct  546  VLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSKKLKACGVRAELCHGERLPKLIRN  605

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DDFI +   A+E RT
Sbjct  606  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDFINKINIAVETRT  657



>gb|KJB10279.1| hypothetical protein B456_001G193700 [Gossypium raimondii]
Length=662

 Score =   402 bits (1034),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 213/233 (91%), Gaps = 0/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG+DDIWEKAT ALKDAL+DK W+YQIDEGGGAFYG
Sbjct  430  TEEILLQFGFSKYEVNLSTRPEKAVGDDDIWEKATVALKDALDDKGWSYQIDEGGGAFYG  489

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIED+LGRKWQCSTIQVDFNLP RFD+TYVDS+ EK+RPI+IHRAVLGSLERFFG
Sbjct  490  PKIDLKIEDSLGRKWQCSTIQVDFNLPNRFDITYVDSNSEKRRPIMIHRAVLGSLERFFG  549

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+PIQ R++PVTDTQL +CN+V  +LK++GIRAEVC GERLPKLIRN
Sbjct  550  VLIEHYAGDFPLWLAPIQARVLPVTDTQLGYCNEVVGKLKSNGIRAEVCHGERLPKLIRN  609

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTF  203
            AEKQKIPLMAVVG KEVE+ +VT+RSRFGGELGTM+ID+FI   + AI+NRT 
Sbjct  610  AEKQKIPLMAVVGLKEVETHSVTVRSRFGGELGTMKIDEFISSIQQAIKNRTL  662



>gb|KCW88711.1| hypothetical protein EUGRSUZ_A01066 [Eucalyptus grandis]
Length=575

 Score =   400 bits (1027),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/234 (80%), Positives = 212/234 (91%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG+DDIW+KAT+AL++AL+DK W+YQIDEGGGAFYG
Sbjct  342  TERILLQFGFSKYEVNLSTRPEKAVGDDDIWDKATTALREALDDKGWSYQIDEGGGAFYG  401

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  402  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNLEKKRPIMIHRAVLGSLERFFG  461

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QL+FCN+V ++LK + +RAEVC GERLPKLIRN
Sbjct  462  VLIEHYAGDFPLWLSPIQARILPVTDNQLDFCNEVTRKLKKNEVRAEVCHGERLPKLIRN  521

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQKIPLMAVVGPKEVE+  VT+RSRFGGELG++ IDDFI     A ENRT F
Sbjct  522  AEKQKIPLMAVVGPKEVETGTVTVRSRFGGELGSITIDDFIYRITKASENRTSF  575



>emb|CDY50043.1| BnaC03g44930D [Brassica napus]
Length=652

 Score =   402 bits (1033),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 211/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGFD YEVNLSTRPEKSVG+DDIWEKAT ALKDAL+DK W+Y++DEGGGAFYG
Sbjct  419  TEEILSRFGFDKYEVNLSTRPEKSVGSDDIWEKATCALKDALDDKGWSYEVDEGGGAFYG  478

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  479  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  538

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTD QLEFC +V K+LKA G+RAE+C GERLPKLIRN
Sbjct  539  VLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSKKLKACGVRAELCHGERLPKLIRN  598

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DDFI +   A+E RT
Sbjct  599  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDFINKINIAVETRT  650



>ref|XP_004502184.1| PREDICTED: threonine--tRNA ligase-like isoform X1 [Cicer arietinum]
Length=685

 Score =   403 bits (1035),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/232 (81%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE  L QFGFD YE+NLSTRPEKSVG+DDIWEKATSALKDAL+DK WTYQID+GGGAFYG
Sbjct  452  TEETLSQFGFDKYEINLSTRPEKSVGDDDIWEKATSALKDALDDKGWTYQIDDGGGAFYG  511

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  512  PKIDVKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNTEKKRPIMIHRAVLGSLERFFG  571

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QLE+C  V  +LK  GIRAE+C GERLPKLIRN
Sbjct  572  VLIEHYAGDFPLWLSPIQARVLPVTDAQLEYCKDVTNKLKKYGIRAEICHGERLPKLIRN  631

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KEVE+  VT+RSRF GELGTM +DDF+   K AIEN T
Sbjct  632  AEKQKIPLMAVVGSKEVETQTVTVRSRFSGELGTMPVDDFVSRVKLAIENTT  683



>dbj|BAD94986.1| putative protein [Arabidopsis thaliana]
Length=426

 Score =   394 bits (1012),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF+ YEVNLSTRPEKSVG DDIWEKAT AL+DAL+D+ W+Y++DEGGGAFYG
Sbjct  193  TEEILSRFGFNKYEVNLSTRPEKSVGGDDIWEKATCALRDALDDRGWSYEVDEGGGAFYG  252

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  253  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  312

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTD QLEFC +V K+L+A G+RAE+C GERLPKLIRN
Sbjct  313  VLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSKKLRACGVRAELCHGERLPKLIRN  372

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DD I +   A+E RT
Sbjct  373  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDLINKINIAVETRT  424



>ref|XP_007049263.1| Threonyl-tRNA synthetase / threonine--tRNA ligase, putative isoform 
1 [Theobroma cacao]
 gb|EOX93420.1| Threonyl-tRNA synthetase / threonine--tRNA ligase, putative isoform 
1 [Theobroma cacao]
Length=668

 Score =   400 bits (1028),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/232 (81%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLST+PEK+VG DDIWEKAT ALKDAL+DK W+YQIDEGGGAFYG
Sbjct  435  TEEILFQFGFSKYEVNLSTKPEKAVGGDDIWEKATIALKDALDDKGWSYQIDEGGGAFYG  494

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP RFD+TYVDS+ EK+RPI+IHRAVLGSLERF G
Sbjct  495  PKIDLKIEDALGRKWQCSTIQVDFNLPNRFDITYVDSNSEKRRPIMIHRAVLGSLERFLG  554

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+PIQ R++PVTDTQL +C +V  +LKA+GIRAEVC GERLPKLIRN
Sbjct  555  VLIEHYAGDFPLWLTPIQARILPVTDTQLGYCKEVSSKLKANGIRAEVCHGERLPKLIRN  614

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVGPKEVE+ +VT+RSRFGGELGTM+ID+F    + AI+NR+
Sbjct  615  AEKQKIPLMAVVGPKEVETHSVTVRSRFGGELGTMKIDEFNSSMEQAIKNRS  666



>gb|KCW88709.1| hypothetical protein EUGRSUZ_A01064 [Eucalyptus grandis]
Length=555

 Score =   396 bits (1018),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 211/234 (90%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG+DDIW+KAT+AL++AL+DK W+YQIDEGGGAFYG
Sbjct  322  TERILLQFGFSKYEVNLSTRPEKAVGDDDIWDKATTALREALDDKGWSYQIDEGGGAFYG  381

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  382  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNLEKKRPIMIHRAVLGSLERFFG  441

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD +L+FCN+V  +LK + +RAEVC GERLPKLIRN
Sbjct  442  VLIEHYAGDFPLWLSPIQARILPVTDNRLDFCNEVTPKLKENEVRAEVCHGERLPKLIRN  501

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEKQKIPLMAVVGPKEVE+  VT+RSRFGGELG++ IDDFI     A ENRT F
Sbjct  502  AEKQKIPLMAVVGPKEVETGTVTVRSRFGGELGSITIDDFIYRITKASENRTSF  555



>ref|XP_002885774.1| hypothetical protein ARALYDRAFT_319286 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62033.1| hypothetical protein ARALYDRAFT_319286 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   399 bits (1025),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 211/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF+ YEVNLSTRPEKSVG+DDIWEKAT AL+DAL+DK W+Y++DEGGGAFYG
Sbjct  417  TEEILSRFGFNKYEVNLSTRPEKSVGDDDIWEKATCALRDALDDKGWSYEVDEGGGAFYG  476

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  477  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  536

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTD QLEFC +V K+L+A G+RAE+C GERLPKLIRN
Sbjct  537  VLIEHYAGDFPLWLSPIQVRVLPVTDNQLEFCKEVSKKLRACGVRAELCHGERLPKLIRN  596

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DDFI +   A+E RT
Sbjct  597  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDFINKINIAVETRT  648



>ref|XP_010542010.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Tarenaya 
hassleriana]
Length=662

 Score =   399 bits (1026),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 208/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGFD YEVNLSTRPEKSVG DDIWEKAT AL++AL+DK W+YQIDEGGGAFYG
Sbjct  429  TEEILSQFGFDKYEVNLSTRPEKSVGGDDIWEKATCALRNALDDKGWSYQIDEGGGAFYG  488

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  489  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDVTYVDSNSEKKRPIMIHRAVLGSLERFFG  548

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFP+WLSP+Q R++PVTD QL FCN++  +LKA G RAEVC G+RLPKLIRN
Sbjct  549  VLIEHYAGDFPIWLSPVQVRVLPVTDNQLGFCNEIAGKLKACGFRAEVCHGDRLPKLIRN  608

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+ +VT+RSRFGGELGT+ +D+FI     AIE RT
Sbjct  609  AETQKIPLMAVVGPKEVETGSVTVRSRFGGELGTISVDEFISRINVAIETRT  660



>ref|XP_010412398.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=650

 Score =   398 bits (1022),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF+ YEVNLSTRPEKSVG DDIWEKAT AL+DAL+DK W+Y++DEGGGAFYG
Sbjct  417  TEEILSRFGFNKYEVNLSTRPEKSVGGDDIWEKATCALRDALDDKGWSYEVDEGGGAFYG  476

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  477  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  536

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTD QLEFC +V K+L+A G+RAE+C GERLPKLIRN
Sbjct  537  VLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSKKLRACGVRAELCHGERLPKLIRN  596

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DDFI +   A+E RT
Sbjct  597  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDFINKINIAVETRT  648



>ref|XP_010557693.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic isoform 
X2 [Tarenaya hassleriana]
Length=659

 Score =   398 bits (1022),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGFD YEVNLSTRPEKSVG+DDIWEKAT AL +AL+DK W+YQIDEGGGAFYG
Sbjct  426  TEEILSQFGFDKYEVNLSTRPEKSVGSDDIWEKATCALMNALDDKGWSYQIDEGGGAFYG  485

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  486  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDVTYVDSNTEKKRPIMIHRAVLGSLERFFG  545

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFP+WLSPIQ R++PVTD QLEFC ++ ++LKA G+RAEV  GERLPKLIRN
Sbjct  546  VLIEHYAGDFPIWLSPIQVRVLPVTDNQLEFCKEITRKLKACGVRAEVRHGERLPKLIRN  605

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+++VT+RSRFGGELGT+ +D+FI     AIE R+
Sbjct  606  AETQKIPLMAVVGPKEVETESVTVRSRFGGELGTISVDEFISRINVAIETRS  657



>ref|XP_010488722.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Camelina 
sativa]
Length=650

 Score =   398 bits (1022),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF+ YEVNLSTRPEKSVG DDIWEKAT AL+DAL+DK W+Y++DEGGGAFYG
Sbjct  417  TEEILSRFGFNKYEVNLSTRPEKSVGGDDIWEKATCALRDALDDKGWSYEVDEGGGAFYG  476

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  477  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  536

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTD QLEFC +V K+L+A G+RAE+C GERLPKLIRN
Sbjct  537  VLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSKKLRACGVRAELCHGERLPKLIRN  596

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DDFI +   A+E RT
Sbjct  597  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDFINKINIAVETRT  648



>ref|XP_010557692.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic isoform 
X1 [Tarenaya hassleriana]
Length=667

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/232 (80%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGFD YEVNLSTRPEKSVG+DDIWEKAT AL +AL+DK W+YQIDEGGGAFYG
Sbjct  434  TEEILSQFGFDKYEVNLSTRPEKSVGSDDIWEKATCALMNALDDKGWSYQIDEGGGAFYG  493

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  494  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDVTYVDSNTEKKRPIMIHRAVLGSLERFFG  553

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFP+WLSPIQ R++PVTD QLEFC ++ ++LKA G+RAEV  GERLPKLIRN
Sbjct  554  VLIEHYAGDFPIWLSPIQVRVLPVTDNQLEFCKEITRKLKACGVRAEVRHGERLPKLIRN  613

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+++VT+RSRFGGELGT+ +D+FI     AIE R+
Sbjct  614  AETQKIPLMAVVGPKEVETESVTVRSRFGGELGTISVDEFISRINVAIETRS  665



>ref|XP_012080702.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Jatropha 
curcas]
 gb|KDP30861.1| hypothetical protein JCGZ_13804 [Jatropha curcas]
Length=672

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/232 (81%), Positives = 206/232 (89%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK VG DDIWEKATSAL+DAL DK W YQIDEGGGAFYG
Sbjct  439  TEEILLQFGFSKYEVNLSTRPEKFVGGDDIWEKATSALRDALEDKGWNYQIDEGGGAFYG  498

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKK+PI+IHRAVLGSLERFFG
Sbjct  499  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNTEKKQPIMIHRAVLGSLERFFG  558

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTDTQLE+C +V  +LK + IR EVC GERLPKLIRN
Sbjct  559  VLIEHYAGDFPLWLSPIQVRVLPVTDTQLEYCKEVTNKLKGNDIRTEVCHGERLPKLIRN  618

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVG KEVE+ +VTIRSRF GELGTM+IDDFI   K A++ RT
Sbjct  619  AEKQKIPLMAVVGAKEVETQSVTIRSRFSGELGTMKIDDFISRIKFAVDKRT  670



>ref|XP_006297093.1| hypothetical protein CARUB_v10013096mg, partial [Capsella rubella]
 gb|EOA29991.1| hypothetical protein CARUB_v10013096mg, partial [Capsella rubella]
Length=698

 Score =   398 bits (1023),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGFD YEVNLSTRPEKSVG DDIW+KAT AL+DAL+DK W+Y++DEGGGAFYG
Sbjct  465  TEEILSRFGFDKYEVNLSTRPEKSVGGDDIWKKATCALRDALDDKGWSYEVDEGGGAFYG  524

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  525  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  584

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTD QLEFC +V K+L+A G+RAE+C GERLPKLIRN
Sbjct  585  VLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSKKLRACGVRAELCHGERLPKLIRN  644

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DDFI +   A+E RT
Sbjct  645  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDFINKINIAVETRT  696



>ref|XP_003554418.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic-like 
isoform X1 [Glycine max]
 ref|XP_006604617.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic-like 
isoform X2 [Glycine max]
Length=652

 Score =   397 bits (1019),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/230 (80%), Positives = 207/230 (90%), Gaps = 0/230 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLSTRPEK+VG+DDIWEKATSAL+DAL+DK WTYQID+GGGAFYG
Sbjct  419  TEEILLQFGFEKYEVNLSTRPEKAVGDDDIWEKATSALEDALDDKGWTYQIDDGGGAFYG  478

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PK+D+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EK+RPI+IHRAVLGSLERFFG
Sbjct  479  PKVDIKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNTEKRRPIMIHRAVLGSLERFFG  538

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIEHYAGDFPLWLSPIQ R++PVTD QLE+CN V  +LK  GIRAEVC GERLPKLIRN
Sbjct  539  ILIEHYAGDFPLWLSPIQARVLPVTDAQLEYCNVVTNKLKMYGIRAEVCHGERLPKLIRN  598

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIEN  212
            AEKQKIPLM VVG KEVE++ VT+RSRFGGELGTM +DDFI   K   EN
Sbjct  599  AEKQKIPLMVVVGSKEVETETVTVRSRFGGELGTMPVDDFIDRIKLGTEN  648



>ref|XP_009365187.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Pyrus 
x bretschneideri]
Length=667

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L QFGF NYEVNLSTRPEK+VG+DDIW KATSAL+DAL+DK W+YQIDEGGGAFYG
Sbjct  434  TEELLLQFGFSNYEVNLSTRPEKAVGDDDIWVKATSALRDALDDKGWSYQIDEGGGAFYG  493

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  494  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  553

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q  ++PVTDTQL++C +V  +LKA+GIR E+C GERLPKLIRN
Sbjct  554  VLIEHYAGDFPLWLSPVQAHVLPVTDTQLDYCKEVTNKLKANGIRGELCQGERLPKLIRN  613

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            +E QKIPLMAVVG KEVE+  VT+RSRFGG+LGTM IDDF+   K+AIE++ 
Sbjct  614  SEMQKIPLMAVVGAKEVETGTVTVRSRFGGDLGTMTIDDFVSTIKSAIESKA  665



>ref|XP_010467036.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Camelina 
sativa]
Length=650

 Score =   396 bits (1018),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF+ YEVNLSTRPEKSVG DDIWEKAT AL+DAL+DK W+Y+IDEGGGAFYG
Sbjct  417  TEEILSRFGFNKYEVNLSTRPEKSVGGDDIWEKATCALRDALDDKGWSYEIDEGGGAFYG  476

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  477  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  536

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTD QLEFC +V  +L+A G+RAE+C GERLPKLIRN
Sbjct  537  VLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSTKLRACGVRAELCHGERLPKLIRN  596

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DDFI +   A+E RT
Sbjct  597  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDFINKINIAVETRT  648



>ref|XP_008813280.1| PREDICTED: threonine--tRNA ligase, mitochondrial isoform X2 [Phoenix 
dactylifera]
Length=492

 Score =   391 bits (1004),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLSTRPEK+VGN DIWEKAT+AL+DAL+DK W YQIDEGGGAFYG
Sbjct  259  TEEILLQFGFNKYEVNLSTRPEKAVGNADIWEKATAALRDALDDKGWEYQIDEGGGAFYG  318

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD++YVDS+ EK+RPI+IHRAVLGSLERFFG
Sbjct  319  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDISYVDSNAEKRRPIMIHRAVLGSLERFFG  378

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLW+SPIQ R++PVTD ++++C +V  RLK+ GIRAE+C GERLPKL+RN
Sbjct  379  VLIEHYAGDFPLWISPIQARVLPVTDIEVKYCGEVVSRLKSFGIRAELCHGERLPKLVRN  438

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQK+PLMAVVGPKEVE+  VT+RSR GGE+GTM ID+FI +    IENRT
Sbjct  439  AEKQKVPLMAVVGPKEVEAQTVTVRSRMGGEVGTMTIDEFISKILFTIENRT  490



>ref|NP_671778.1| putative threonyl-tRNA synthetase / threonine--tRNA ligase [Arabidopsis 
thaliana]
 gb|AEC05873.1| putative threonyl-tRNA synthetase / threonine--tRNA ligase [Arabidopsis 
thaliana]
Length=650

 Score =   396 bits (1017),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF+ YEVNLSTRPEKSVG DDIWEKAT AL+DAL+DK W+Y++DEGGGAFYG
Sbjct  417  TEEILSRFGFNKYEVNLSTRPEKSVGGDDIWEKATCALRDALDDKGWSYEVDEGGGAFYG  476

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  477  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  536

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q R++PVTD QLEFC +V K+L+A G+RAE+C GERLPKLIRN
Sbjct  537  VLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSKKLRACGVRAELCHGERLPKLIRN  596

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DD I +   A+E RT
Sbjct  597  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTIPVDDLINKINIAVETRT  648



>ref|XP_008379968.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Malus 
domestica]
Length=669

 Score =   396 bits (1018),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L QFGF NYEVNLSTRPEK+VG+DDIW KATSAL+DAL+DK W+YQIDEGGGAFYG
Sbjct  436  TEELLLQFGFSNYEVNLSTRPEKAVGDDDIWVKATSALRDALDDKGWSYQIDEGGGAFYG  495

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  496  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  555

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q  ++PVTDTQL++C +V  +LKA+GIR E+C GERLPKLIRN
Sbjct  556  VLIEHYAGDFPLWLSPVQAHVLPVTDTQLDYCKEVTNKLKANGIRGELCQGERLPKLIRN  615

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            +E QKIPLMAVVG KEVE+  VT+RSRFGG+LGTM IDDF+   K+AIE++ 
Sbjct  616  SEMQKIPLMAVVGAKEVETRTVTVRSRFGGDLGTMPIDDFVSTIKSAIESKA  667



>gb|KFK31774.1| hypothetical protein AALP_AA6G156900 [Arabis alpina]
Length=650

 Score =   395 bits (1016),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGFD YEVNLSTRPEKSVG+DDIWEKAT AL+DAL+DK W+Y++DEGGGAFYG
Sbjct  417  TEEILSRFGFDKYEVNLSTRPEKSVGSDDIWEKATCALRDALDDKGWSYEVDEGGGAFYG  476

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  477  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  536

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFP+WLSP+Q R++PVTD QLEFC +V K+L+A G+R E+C GERLPKLIRN
Sbjct  537  VLIEHYAGDFPIWLSPVQVRVLPVTDNQLEFCKEVSKKLRACGVRVELCHGERLPKLIRN  596

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QK+PLMAVVGPKEVE+ AVT+RSRFGGELGT+ +D FI +   A+E RT
Sbjct  597  AETQKVPLMAVVGPKEVETGAVTVRSRFGGELGTIPVDVFINKINIAVETRT  648



>ref|XP_006418545.1| hypothetical protein EUTSA_v10002438mg [Eutrema salsugineum]
 gb|ESQ36981.1| hypothetical protein EUTSA_v10002438mg [Eutrema salsugineum]
Length=651

 Score =   395 bits (1015),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF+ YEVNLSTRPEKSVG+DDIWEKAT ALK+AL+DK W+Y++DEGGGAFYG
Sbjct  418  TEEILSRFGFEKYEVNLSTRPEKSVGSDDIWEKATFALKEALDDKGWSYEVDEGGGAFYG  477

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD++ +KKRPI+IHRAVLGSLERFFG
Sbjct  478  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFG  537

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFP+WLSP+Q R++PVTD QLEFC +V K+L+A G+R E+C GERLPKLIRN
Sbjct  538  VLIEHYAGDFPIWLSPVQVRVLPVTDNQLEFCKEVSKKLRACGVRVELCHGERLPKLIRN  597

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QKIPLMAVVGPKEVE+  VT+RSRFGGELGT+ +DDFI +   A+E RT
Sbjct  598  AETQKIPLMAVVGPKEVETGTVTVRSRFGGELGTILVDDFINKVNIAVETRT  649



>ref|XP_010913171.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Elaeis 
guineensis]
Length=661

 Score =   395 bits (1015),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 212/232 (91%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VGNDDIWEKAT+AL+DAL+DK W YQIDEGGGAFYG
Sbjct  428  TEEILLQFGFRKYEVNLSTRPEKAVGNDDIWEKATAALRDALDDKGWDYQIDEGGGAFYG  487

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCST+QVDFNLPERFD++YVDS+ EK+RPI+IHRAVLGSLERFFG
Sbjct  488  PKIDIKIEDALGRKWQCSTVQVDFNLPERFDISYVDSNTEKRRPIMIHRAVLGSLERFFG  547

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLW+SPIQ R++P+TD+Q+E+C +V  RLK+ GIRAE+C GERLPKLIRN
Sbjct  548  VLIEHYAGDFPLWISPIQARVLPITDSQVEYCGEVVLRLKSFGIRAELCHGERLPKLIRN  607

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQK+PLMAVVGPKEVE+  VT+RSR GGE+GTM +D+FI + + A++NRT
Sbjct  608  AEKQKVPLMAVVGPKEVETRRVTVRSRMGGEVGTMTVDEFISKIQFAVDNRT  659



>ref|XP_007217640.1| hypothetical protein PRUPE_ppa002440mg [Prunus persica]
 gb|EMJ18839.1| hypothetical protein PRUPE_ppa002440mg [Prunus persica]
Length=672

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L QFGF  YEVNLSTRPEKSVG+DDIW KATSAL+DAL+DK W+YQID+GGGAFYG
Sbjct  439  TEELLLQFGFSKYEVNLSTRPEKSVGDDDIWVKATSALRDALDDKGWSYQIDDGGGAFYG  498

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  499  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  558

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q  ++PVTDTQL++C +V  +LKA+GIR E+C GERLPKLIRN
Sbjct  559  VLIEHYAGDFPLWLSPVQAHVLPVTDTQLDYCKEVTNKLKANGIRGELCHGERLPKLIRN  618

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            +E  KIPLMAVVG KEVE+ +VT+RSRFGG+LGTM IDDF+   K+AIE+R 
Sbjct  619  SEMLKIPLMAVVGAKEVETGSVTVRSRFGGDLGTMAIDDFVSTIKSAIESRA  670



>ref|XP_008813279.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic isoform 
X1 [Phoenix dactylifera]
Length=667

 Score =   393 bits (1009),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLSTRPEK+VGN DIWEKAT+AL+DAL+DK W YQIDEGGGAFYG
Sbjct  434  TEEILLQFGFNKYEVNLSTRPEKAVGNADIWEKATAALRDALDDKGWEYQIDEGGGAFYG  493

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD++YVDS+ EK+RPI+IHRAVLGSLERFFG
Sbjct  494  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDISYVDSNAEKRRPIMIHRAVLGSLERFFG  553

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLW+SPIQ R++PVTD ++++C +V  RLK+ GIRAE+C GERLPKL+RN
Sbjct  554  VLIEHYAGDFPLWISPIQARVLPVTDIEVKYCGEVVSRLKSFGIRAELCHGERLPKLVRN  613

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQK+PLMAVVGPKEVE+  VT+RSR GGE+GTM ID+FI +    IENRT
Sbjct  614  AEKQKVPLMAVVGPKEVEAQTVTVRSRMGGEVGTMTIDEFISKILFTIENRT  665



>ref|XP_008229866.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Prunus 
mume]
Length=672

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 208/232 (90%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L QFGF  YEVNLSTRPEKSVG+DDIW KATSAL+DAL+DK W+YQID+GGGAFYG
Sbjct  439  TEELLLQFGFSKYEVNLSTRPEKSVGDDDIWVKATSALRDALDDKGWSYQIDDGGGAFYG  498

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  499  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  558

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q  ++PVTDTQL++C +V  +LKA+GIR E+C GERLPKLIRN
Sbjct  559  VLIEHYAGDFPLWLSPVQAHVLPVTDTQLDYCKEVTNKLKANGIRGELCHGERLPKLIRN  618

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            +E  KIPLMAVVG KEVE+  VT+RSRFGG+LGTM IDDF+   K+AIE+R 
Sbjct  619  SEMLKIPLMAVVGAKEVETGTVTVRSRFGGDLGTMAIDDFVSTIKSAIESRA  670



>ref|XP_004144536.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Cucumis 
sativus]
 gb|KGN43435.1| hypothetical protein Csa_7G033430 [Cucumis sativus]
Length=672

 Score =   392 bits (1008),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/234 (79%), Positives = 208/234 (89%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L QFGF+ +EVNLSTRP KSVGND+IWEKATSALKDAL DK W YQIDEGGGAFYG
Sbjct  439  TEDLLLQFGFNEFEVNLSTRPPKSVGNDEIWEKATSALKDALGDKGWGYQIDEGGGAFYG  498

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  499  PKIDIKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  558

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE+YAGDFPLWLSPIQ R++PVTD QL +C +V ++L+ASG+RAEVC GERLPKLIRN
Sbjct  559  ILIENYAGDFPLWLSPIQVRVLPVTDAQLSYCKEVSEKLRASGVRAEVCHGERLPKLIRN  618

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AE QKIPLMAVVG KEVE   VT+RSRFGGE+GT+ +DDF+   K A ENRT F
Sbjct  619  AETQKIPLMAVVGAKEVEMQTVTVRSRFGGEIGTIAVDDFVGRIKFASENRTPF  672



>ref|XP_008462105.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Cucumis 
melo]
Length=672

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 207/234 (88%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L QFGF+ +EVNLSTRP KSVGND+IWEKATSALKDAL DK W YQIDEGGGAFYG
Sbjct  439  TEELLLQFGFNEFEVNLSTRPPKSVGNDEIWEKATSALKDALGDKGWGYQIDEGGGAFYG  498

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCSTIQVDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  499  PKIDIKIEDALGRKWQCSTIQVDFNLPQRFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  558

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE+YAGDFPLWLSPIQ R++PVTD QL +C +V ++L+ASG+RAEVC  ERLPKLIRN
Sbjct  559  ILIENYAGDFPLWLSPIQVRVLPVTDAQLSYCKEVSEKLRASGVRAEVCHSERLPKLIRN  618

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AE QKIPLMAVVG KEVE   VT+RSRFGGE+GT+ +DDF+   K A ENRT F
Sbjct  619  AETQKIPLMAVVGAKEVEMQTVTVRSRFGGEIGTITVDDFVGRIKFASENRTPF  672



>ref|XP_009394992.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Musa 
acuminata subsp. malaccensis]
Length=676

 Score =   389 bits (1000),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 206/232 (89%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK VG DDIWEKAT AL+DAL+DK W YQIDEGGGAFYG
Sbjct  443  TEEILLQFGFKKYEVNLSTRPEKFVGTDDIWEKATIALRDALDDKGWAYQIDEGGGAFYG  502

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD++YVDS+ EK+RPI+IHRAVLGSLERFFG
Sbjct  503  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDISYVDSNAEKRRPIMIHRAVLGSLERFFG  562

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLW+SPIQ R++PVTDT++++C +V  +L + GIRAE+C GERLPKLIRN
Sbjct  563  VLIEHYAGDFPLWISPIQARVLPVTDTEVKYCTEVVSKLNSIGIRAELCYGERLPKLIRN  622

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQK+PLMAVVGPKEVE+  VT+RSRFGGELG M ID+FI   + A+ NRT
Sbjct  623  AEKQKVPLMAVVGPKEVETQMVTVRSRFGGELGMMTIDEFIARIQLAVSNRT  674



>gb|ADK92877.1| threonyl-tRNA synthetase [Hypericum perforatum]
Length=721

 Score =   389 bits (999),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  YEVNLSTRPEK+VG D+IW+KAT+AL++AL+DK W Y+IDEGGGAFYG
Sbjct  488  TEEILLLFGFSRYEVNLSTRPEKAVGGDEIWDKATNALRNALDDKGWDYEIDEGGGAFYG  547

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TYVD+  EKKRPILIHRAVLGSLERFFG
Sbjct  548  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDATSEKKRPILIHRAVLGSLERFFG  607

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+PIQ R++PVTD QLEFCN+V ++LK SG+RAEVC GERLPKLIRN
Sbjct  608  VLIEHYAGDFPLWLTPIQVRVLPVTDNQLEFCNEVTRKLKDSGVRAEVCHGERLPKLIRN  667

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQK+PLMAVVGPKEVE+  VT+RSR  G++GT+ IDDFI   K+ +E RT
Sbjct  668  AEKQKVPLMAVVGPKEVETQTVTVRSRSSGDVGTIDIDDFISRIKSTVEERT  719



>ref|XP_004293445.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Fragaria 
vesca subsp. vesca]
Length=667

 Score =   386 bits (991),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 206/234 (88%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L +FGF  YEVNLSTRPEKSVG+DDIWEKATSAL+DAL DK W+YQID+GGGAFYG
Sbjct  434  TEELLLKFGFSKYEVNLSTRPEKSVGDDDIWEKATSALRDALEDKGWSYQIDDGGGAFYG  493

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQVDFNLP+RFD+TY+DS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  494  PKIDLKIEDALGRKWQCSTIQVDFNLPQRFDITYIDSNSEKKRPIMIHRAVLGSLERFFG  553

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q  ++PVTDTQL++C ++  +LK SGIR E+C GERLPKLIRN
Sbjct  554  VLIEHYAGDFPLWLSPVQAHVLPVTDTQLDYCKELTNKLKVSGIRGELCHGERLPKLIRN  613

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            +E  KIPLMAVVG KEVES  VT+RSR G + GTM IDDF+   K+AIE+RT F
Sbjct  614  SEMLKIPLMAVVGAKEVESGTVTVRSRSGDDPGTMSIDDFVSRIKSAIESRTSF  667



>ref|XP_008342168.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial 
[Malus domestica]
Length=564

 Score =   383 bits (983),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L QFGF+ YEVNL TRPEK+VG DDIW KATS+L+DAL+DK W+YQIDEG GAFYG
Sbjct  331  TEELLLQFGFNKYEVNLCTRPEKAVGXDDIWAKATSSLRDALDDKGWSYQIDEGAGAFYG  390

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTI VDFNLP+RFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  391  PKIDLKIEDALGRKWQCSTIXVDFNLPQRFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  450

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSP+Q  ++PVTD+QL++C +V  +LKA+GIR E+C GERLPKLIRN
Sbjct  451  VLIEHYAGDFPLWLSPVQAHVVPVTDSQLDYCKEVTNKLKANGIRGELCQGERLPKLIRN  510

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            +E QKIPLMAVVG KEVE+  VT+RSRFGG+LGTM IDDF+   K+ IE++ 
Sbjct  511  SETQKIPLMAVVGAKEVETGTVTVRSRFGGDLGTMPIDDFVSTIKSTIESKA  562



>gb|EEC73349.1| hypothetical protein OsI_07557 [Oryza sativa Indica Group]
Length=674

 Score =   384 bits (986),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YE+NLSTRPEKSVG+DDIWEKAT ALKDAL DK W Y++DEGGGAFYG
Sbjct  440  TEQILGQFGFRYYEINLSTRPEKSVGSDDIWEKATLALKDALEDKGWEYKVDEGGGAFYG  499

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD+TYV+S+ EKKRPI+IHRA+LGSLERFFG
Sbjct  500  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYVNSNSEKKRPIMIHRAILGSLERFFG  559

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+PIQ R++PVTD +L++CN+V   LK+ GIRAEVC GERLPKLIRN
Sbjct  560  VLIEHYAGDFPLWLAPIQARILPVTDNELQYCNEVASELKSKGIRAEVCHGERLPKLIRN  619

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE +K+PLMAVVGPKEV++  +TIRSR  GE+GTM +D+F R  + AI N++
Sbjct  620  AETKKVPLMAVVGPKEVQARTLTIRSRHSGEIGTMPVDEFFRRMQLAIANKS  671



>ref|NP_001047052.1| Os02g0538000 [Oryza sativa Japonica Group]
 dbj|BAD27919.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAD28830.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAF08966.1| Os02g0538000 [Oryza sativa Japonica Group]
 dbj|BAG86789.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57138.1| hypothetical protein OsJ_07040 [Oryza sativa Japonica Group]
Length=674

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 205/232 (88%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YE+NLSTRPEKSVG+DDIWEKAT ALKDAL DK W Y++DEGGGAFYG
Sbjct  440  TEQILGQFGFRYYEINLSTRPEKSVGSDDIWEKATLALKDALEDKGWEYKVDEGGGAFYG  499

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD+TYV+S+ EKKRPI+IHRA+LGSLERFFG
Sbjct  500  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYVNSNSEKKRPIMIHRAILGSLERFFG  559

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+PIQ R++PVTD +L++CN+V   LK+ GIRAEVC GERLPKLIRN
Sbjct  560  VLIEHYAGDFPLWLAPIQARILPVTDNELQYCNEVASELKSKGIRAEVCHGERLPKLIRN  619

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE +K+PLMAVVGPKEV++  +TIRSR  GE+GTM +D+F R  + AI N++
Sbjct  620  AETKKVPLMAVVGPKEVQARTLTIRSRHSGEIGTMPVDEFFRRIQLAIANKS  671



>ref|XP_006647349.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic-like 
[Oryza brachyantha]
Length=562

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/232 (75%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YE+NLSTRPEKSVG DDIWEKAT ALKDAL DK W Y++DEGGGAFYG
Sbjct  328  TEQILGQFGFRYYEINLSTRPEKSVGGDDIWEKATLALKDALEDKGWVYKVDEGGGAFYG  387

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD+TYVDS+ EKKRPI+IHRA+LGSLERFFG
Sbjct  388  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYVDSNTEKKRPIMIHRAILGSLERFFG  447

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+P Q R++PVTD +L +CN+V   L++ GIRAEVC GERLPKLIRN
Sbjct  448  VLIEHYAGDFPLWLAPTQARILPVTDNELPYCNEVASELRSRGIRAEVCHGERLPKLIRN  507

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QK+PLMAVVGPKEV++ ++TIRSR  GE+GTM +D+F+   + A+ N++
Sbjct  508  AEMQKVPLMAVVGPKEVQARSLTIRSRHSGEIGTMPVDEFVSRIQLAVMNKS  559



>dbj|BAJ98256.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   382 bits (981),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 206/232 (89%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF NYEVNLSTRPEKSVG+DDIWEKAT ALKDAL+DK W Y IDEGGGAFYG
Sbjct  434  TEEILGQFGFRNYEVNLSTRPEKSVGSDDIWEKATIALKDALDDKGWGYTIDEGGGAFYG  493

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD+TYVDS  EKKRPI+IHRA+LGSLERFFG
Sbjct  494  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYVDSHTEKKRPIMIHRAILGSLERFFG  553

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE+YAGDFPLWL+P Q R++PVT+ +L++CN+V   LK+ GIRAEVC GERLPKLIRN
Sbjct  554  ILIENYAGDFPLWLAPTQARILPVTNNELQYCNEVASELKSRGIRAEVCHGERLPKLIRN  613

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QK+PLMAVVGPKEVE+  +TIRSR  GE+GTM +D+FI + ++A+ +++
Sbjct  614  AETQKVPLMAVVGPKEVEARTLTIRSRHNGEMGTMPVDNFISKIQSAVADKS  665



>ref|XP_003570257.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Brachypodium 
distachyon]
Length=663

 Score =   380 bits (977),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEKSVG+DDIWEKAT ALKDALNDK W Y +DEGGGAFYG
Sbjct  430  TEQILGQFGFRYYEVNLSTRPEKSVGSDDIWEKATIALKDALNDKGWKYTVDEGGGAFYG  489

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDALGRKWQCST+QVDFNLPERFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  490  PKIDIKIEDALGRKWQCSTVQVDFNLPERFDITYVDSNTEKKRPIMIHRAVLGSLERFFG  549

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+P Q R++PVT+ +L++CN+V   LK  GIRAEVC GERLPKLIRN
Sbjct  550  VLIEHYAGDFPLWLAPTQARILPVTNNELQYCNEVASELKLRGIRAEVCHGERLPKLIRN  609

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAI  218
            AE QK+PLMAVVGPKEVES  + +RSR  GE+G M +DDFI   ++A+
Sbjct  610  AETQKVPLMAVVGPKEVESKTLAVRSRHSGEIGNMPVDDFISRIESAV  657



>ref|XP_002460938.1| hypothetical protein SORBIDRAFT_02g037830 [Sorghum bicolor]
 gb|EER97459.1| hypothetical protein SORBIDRAFT_02g037830 [Sorghum bicolor]
Length=648

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YE+NLSTRPEKSVG DDIWEKAT ALK+AL+DK W Y++DEGGGAFYG
Sbjct  415  TEQILGQFGFRYYEINLSTRPEKSVGTDDIWEKATIALKNALDDKGWEYKVDEGGGAFYG  474

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD+TYVDS+ EKKRPI+IHRA+LGSLERFFG
Sbjct  475  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYVDSNSEKKRPIMIHRAILGSLERFFG  534

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+P Q R++PVTD +L++CN+V   LK+ G+R EVC GERLPKLIRN
Sbjct  535  VLIEHYAGDFPLWLAPTQARILPVTDNELQYCNEVASELKSRGLRVEVCHGERLPKLIRN  594

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QK+PLMAVVGPKEV++  +TIRSR  GE+GTM +D+FI   + A+ N++
Sbjct  595  AETQKVPLMAVVGPKEVQARTLTIRSRHNGEIGTMPVDEFITRLQLAVANKS  646



>ref|XP_004958163.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Setaria 
italica]
Length=664

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/232 (75%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YE+NLSTRPEKSVG+DDIWEKAT ALK+AL+DK W Y++DEGGGAFYG
Sbjct  431  TEQILGQFGFKYYEINLSTRPEKSVGSDDIWEKATIALKNALDDKGWEYKVDEGGGAFYG  490

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD+TYVDS+ EKKRPI+IHRAVLGSLERFFG
Sbjct  491  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYVDSNSEKKRPIMIHRAVLGSLERFFG  550

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+P Q R++PVTD +L++CN+V   LK+ G R EVC GERLPKLIRN
Sbjct  551  VLIEHYAGDFPLWLAPTQARILPVTDNELQYCNEVASELKSRGFRVEVCHGERLPKLIRN  610

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AE QK+PLMAVVGPKEV++  +TIRSR  GE+GTM +D+FI   + A+ N++
Sbjct  611  AETQKVPLMAVVGPKEVQARTLTIRSRHNGEIGTMPVDEFITRLQLAVANKS  662



>ref|XP_006856829.2| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Amborella 
trichopoda]
Length=661

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLSTRPEK+VG++DIWE+AT+ALKDAL+DK W YQIDEGGGAFYG
Sbjct  428  TEEILMQFGFNKYEVNLSTRPEKAVGSNDIWEEATTALKDALDDKGWDYQIDEGGGAFYG  487

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQC+T+QVDFNLP+RFD+ YVDS+ E++RPI+IHRA+LGS+ERFFG
Sbjct  488  PKIDLKIEDALGRKWQCTTVQVDFNLPQRFDLYYVDSNTERRRPIMIHRALLGSMERFFG  547

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE+YAGDFPLWLSPIQ R++PVTD+Q+ +  ++  RLKA GIR E+C GERLPKLIRN
Sbjct  548  ILIENYAGDFPLWLSPIQARILPVTDSQIGYSKEMLARLKAEGIRTELCHGERLPKLIRN  607

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVGPKE+E+  +TIRSR  GELG+M I+DFI + +     RT
Sbjct  608  AEKQKIPLMAVVGPKEMENQTLTIRSRQSGELGSMSIEDFINKIRLCQAQRT  659



>gb|ERN18296.1| hypothetical protein AMTR_s00055p00165940 [Amborella trichopoda]
Length=673

 Score =   370 bits (949),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 204/232 (88%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLSTRPEK+VG++DIWE+AT+ALKDAL+DK W YQIDEGGGAFYG
Sbjct  440  TEEILMQFGFNKYEVNLSTRPEKAVGSNDIWEEATTALKDALDDKGWDYQIDEGGGAFYG  499

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQC+T+QVDFNLP+RFD+ YVDS+ E++RPI+IHRA+LGS+ERFFG
Sbjct  500  PKIDLKIEDALGRKWQCTTVQVDFNLPQRFDLYYVDSNTERRRPIMIHRALLGSMERFFG  559

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE+YAGDFPLWLSPIQ R++PVTD+Q+ +  ++  RLKA GIR E+C GERLPKLIRN
Sbjct  560  ILIENYAGDFPLWLSPIQARILPVTDSQIGYSKEMLARLKAEGIRTELCHGERLPKLIRN  619

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEKQKIPLMAVVGPKE+E+  +TIRSR  GELG+M I+DFI + +     RT
Sbjct  620  AEKQKIPLMAVVGPKEMENQTLTIRSRQSGELGSMSIEDFINKIRLCQAQRT  671



>gb|ABR17634.1| unknown [Picea sitchensis]
Length=682

 Score =   369 bits (946),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 169/234 (72%), Positives = 198/234 (85%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QF F NYE+NLST+PEK+VG+D IWEKATSALKDAL DK W Y +DEGGGAFYG
Sbjct  449  TEAILSQFDFKNYEINLSTKPEKAVGSDVIWEKATSALKDALEDKGWDYSVDEGGGAFYG  508

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLP+RFD+ Y+DS+ EKKRPI+IHRA+LGSLERFFG
Sbjct  509  PKIDLKIEDALGRKWQCSTVQVDFNLPQRFDLFYIDSNSEKKRPIMIHRAILGSLERFFG  568

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE+YAGDFPLWLSP+Q R++PVTDTQ+ +C KV  ++K   IRAE+  GERL KLIRN
Sbjct  569  ILIENYAGDFPLWLSPVQARILPVTDTQVPYCQKVVAKMKEKDIRAELSYGERLSKLIRN  628

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            +E  KIPLMAVVGP+EVES  +T+R+R GGELGTM ID+ I + K A  NR F 
Sbjct  629  SETHKIPLMAVVGPREVESGTLTVRTRHGGELGTMTIDEVIEKIKKAAANRNFL  682



>gb|KHN02259.1| Threonine--tRNA ligase [Glycine soja]
Length=660

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 199/234 (85%), Gaps = 4/234 (2%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF+ YEVNLSTRPEK+VG+DDIWEKATSAL+DAL+DK WTYQID+GGGAFYG
Sbjct  423  TEEILLQFGFEKYEVNLSTRPEKAVGDDDIWEKATSALEDALDDKGWTYQIDDGGGAFYG  482

Query  721  PKIDLKIEDALGRK----WQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLE  554
            PKID+KIEDALG      +      VDFNLP+RFD+TYVDS+ EK+RPI+IHRAVLGSLE
Sbjct  483  PKIDIKIEDALGFSAYFGYCTFGAIVDFNLPQRFDITYVDSNTEKRRPIMIHRAVLGSLE  542

Query  553  RFFGVLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPK  374
            RFFG+LIEHYAGDFPLWLSPIQ R++PVTD QLE+CN V  +LK  GIRAEVC GERLPK
Sbjct  543  RFFGILIEHYAGDFPLWLSPIQARVLPVTDAQLEYCNVVTNKLKMYGIRAEVCHGERLPK  602

Query  373  LIRNAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIEN  212
            LIRNAEKQKIPLM VVG KEVE++ VT+RSRFGGELGTM +DDFI   K   EN
Sbjct  603  LIRNAEKQKIPLMVVVGSKEVETETVTVRSRFGGELGTMPVDDFIDRIKLGTEN  656



>ref|XP_002975822.1| hypothetical protein SELMODRAFT_267898 [Selaginella moellendorffii]
 gb|EFJ23451.1| hypothetical protein SELMODRAFT_267898 [Selaginella moellendorffii]
Length=420

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 195/231 (84%), Gaps = 0/231 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF NYE+NLST+PEK+VG+DDIW KAT ALKDA++DK WTY IDEGGGAFYG
Sbjct  187  TEEILSQFGFQNYEINLSTKPEKAVGSDDIWHKATEALKDAISDKGWTYGIDEGGGAFYG  246

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GRKWQCSTIQVDFNLPERFD+TYVD  Q +K+PI+IHRA+ GS+ERF G
Sbjct  247  PKIDLKIEDAIGRKWQCSTIQVDFNLPERFDLTYVDPSQARKQPIMIHRAIFGSIERFVG  306

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE YAGDFPLW++P+Q RL+PVTDT+L +C +V  RL+   IRAE+  GERL KLIRN
Sbjct  307  ILIESYAGDFPLWIAPVQARLLPVTDTELPYCKQVLARLREKDIRAEIACGERLSKLIRN  366

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            AE QKIPLMAVVGPKEVE+  +T+R+R GGELGT+ +D+ I   + A+  R
Sbjct  367  AEVQKIPLMAVVGPKEVEAQTLTVRTRHGGELGTLSVDEVIDRIETAVATR  417



>gb|KHG13628.1| Threonine--tRNA ligase [Gossypium arboreum]
Length=651

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/233 (76%), Positives = 198/233 (85%), Gaps = 17/233 (7%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG+DDIWEKAT ALKDAL+DK W+YQIDEGGGAFYG
Sbjct  436  TEEILLQFGFSKYEVNLSTRPEKAVGDDDIWEKATVALKDALDDKGWSYQIDEGGGAFYG  495

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQ                  +K+RPI+IHRAVLGSLERFFG
Sbjct  496  PKIDLKIEDALGRKWQCSTIQA-----------------KKRRPIMIHRAVLGSLERFFG  538

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWL+PIQ +++PVTDTQL FCN+V  +LK++GIRAEVC GERLPKLIRN
Sbjct  539  VLIEHYAGDFPLWLAPIQAQVLPVTDTQLGFCNEVVGKLKSNGIRAEVCHGERLPKLIRN  598

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTF  203
            AEKQKIPLMAVVGPKEVE+ +VT+RSRFGGELGTM+ID+FI   + AI+NRT 
Sbjct  599  AEKQKIPLMAVVGPKEVETHSVTVRSRFGGELGTMKIDEFISSIQQAIKNRTL  651



>gb|EMS54585.1| Threonyl-tRNA synthetase [Triticum urartu]
Length=662

 Score =   350 bits (899),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF N+EVNLSTRPEKSVG+DDIWEKAT ALKDAL+DK W Y +DEGGGAFYG
Sbjct  350  TEEILGQFGFRNFEVNLSTRPEKSVGSDDIWEKATIALKDALDDKGWGYTVDEGGGAFYG  409

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD+TY+DS  EKKRPI+IHRA+LGSLERFFG
Sbjct  410  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYIDSHTEKKRPIMIHRAILGSLERFFG  469

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE+YAGDFPLWL+P Q R++PVT+ +L++CN+V   LK+ GIRAEVC GERLPKLIRN
Sbjct  470  ILIENYAGDFPLWLAPTQARILPVTNNELQYCNEVASELKSRGIRAEVCHGERLPKLIRN  529

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRS  284
            AE QK+PLMAVVGPKEVE+  +TIR+
Sbjct  530  AETQKVPLMAVVGPKEVEARTLTIRN  555



>ref|XP_001758898.1| predicted protein [Physcomitrella patens]
 gb|EDQ76404.1| predicted protein [Physcomitrella patens]
Length=613

 Score =   347 bits (889),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 195/227 (86%), Gaps = 0/227 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L+QFGF  +E+NLST+PEK+VG+ +IWEK+T+AL++AL DK W Y IDEGGGAFYG
Sbjct  380  TEIVLKQFGFTKFEINLSTKPEKAVGSHEIWEKSTTALREALQDKGWEYSIDEGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GRKWQCSTIQVDFNLPERF+M YVD+D  +K+PILIHRA+LGS+ERFFG
Sbjct  440  PKIDVKIEDAIGRKWQCSTIQVDFNLPERFNMVYVDTDTSRKQPILIHRAILGSIERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +L+E+YAGDFPLWL+P+Q RL+PVTD ++++C  V  +L+  GIRAEV  GERL KLIRN
Sbjct  500  ILVENYAGDFPLWLAPVQARLLPVTDHEVDYCKNVVAKLREKGIRAEVVFGERLGKLIRN  559

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNA  221
            AE QKIP+MAVVGPKEVES  +T+R+R GGELGT+ +DD   + + A
Sbjct  560  AETQKIPVMAVVGPKEVESATLTVRTRHGGELGTLSLDDLTHKIQLA  606



>ref|XP_002973772.1| hypothetical protein SELMODRAFT_442211 [Selaginella moellendorffii]
 gb|EFJ25432.1| hypothetical protein SELMODRAFT_442211 [Selaginella moellendorffii]
Length=795

 Score =   352 bits (902),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 193/230 (84%), Gaps = 0/230 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF NYE+NLST+PEK+VG+DDIW KAT ALKDA++DK WTY IDEGGGAFYG
Sbjct  390  TEEILSQFGFQNYEINLSTKPEKAVGSDDIWHKATEALKDAISDKGWTYGIDEGGGAFYG  449

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQVDFNLPERFD+TYVD  Q +K+PI+IHRA+ GS+ERF G
Sbjct  450  PKIDLKIEDAIGRTWQCSTIQVDFNLPERFDLTYVDPSQARKQPIMIHRAIFGSIERFVG  509

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE YAGDFPLW++P+Q RL+PVTDT+L +C +V  RL+   IRAE+  GERL KLIRN
Sbjct  510  ILIESYAGDFPLWIAPVQARLLPVTDTELPYCKQVLARLREKDIRAEIACGERLSKLIRN  569

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIEN  212
            AE QKIPLMAVVGPKEVE+  +T+R+R GGELGT+ +D+  R     +E+
Sbjct  570  AEVQKIPLMAVVGPKEVEAQTLTVRTRHGGELGTLSVDERHRYWTAGMES  619



>ref|XP_001766498.1| predicted protein [Physcomitrella patens]
 gb|EDQ68826.1| predicted protein [Physcomitrella patens]
Length=615

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL+QFGF  +E+NLSTRPEK+VG+D+IWEKAT+ALK AL DK W Y IDEGGGAFYG
Sbjct  382  TEMILKQFGFSKFEINLSTRPEKAVGSDEIWEKATTALKSALEDKGWEYGIDEGGGAFYG  441

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GRKWQCSTIQVDFNLPERF+M YVDSD  +K+PI+IHRA+ GS+ERFFG
Sbjct  442  PKIDVKIEDAIGRKWQCSTIQVDFNLPERFNMVYVDSDTSRKQPIMIHRAIFGSIERFFG  501

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +L E+YAGDFPLWL+P+Q RL+PVTD ++++C KV   LKA  IRAEV  GERL KLIRN
Sbjct  502  ILTENYAGDFPLWLAPVQARLLPVTDNEVDYCKKVVAELKAREIRAEVIFGERLGKLIRN  561

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            AE QKIP+MAVVG KEVE++ +T+R+R GGELG + + D     + AI  R
Sbjct  562  AETQKIPVMAVVGRKEVETETLTVRTRHGGELGNVTVADLADRIQLAISTR  612



>gb|EMT17759.1| Threonyl-tRNA synthetase [Aegilops tauschii]
Length=1141

 Score =   352 bits (903),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF NYEVNLSTRPEKSVG+DDIWEKAT ALKDAL+DK W Y +DEGGGAFYG
Sbjct  640  TEEILGQFGFRNYEVNLSTRPEKSVGSDDIWEKATIALKDALDDKGWGYTVDEGGGAFYG  699

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCST+QVDFNLPERFD+TYVDS  EKKRPI+IHRA+LGSLERFFG
Sbjct  700  PKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYVDSHTEKKRPIMIHRAILGSLERFFG  759

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE+YAGDFPLWL+P Q R++PVT+ +L++CN+V   LK+ GIRAEVC GERLPKLIRN
Sbjct  760  ILIENYAGDFPLWLAPTQARILPVTNNELQYCNEVASELKSRGIRAEVCHGERLPKLIRN  819

Query  361  AEKQKIPLMAVVGPKEVESDAVTIR  287
            AE QK+PLMAVVGPKEVE+  +TIR
Sbjct  820  AETQKVPLMAVVGPKEVEARTLTIR  844



>ref|WP_019501919.1| threonyl-tRNA synthetase [Pseudanabaena sp. PCC 6802]
Length=602

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
             E IL  FGF+NYEVNLSTRPEK VG++ IW+KAT AL+DAL+ K W Y IDEGGGAFYG
Sbjct  368  AELILTTFGFNNYEVNLSTRPEKYVGSEQIWDKATQALRDALDRKGWNYVIDEGGGAFYG  427

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR+WQCSTIQVDFNLPERFDM YV  D  + RPI+IHRA+ GSLERFFG
Sbjct  428  PKIDIKIEDAIGRRWQCSTIQVDFNLPERFDMEYVGEDGNRHRPIMIHRALFGSLERFFG  487

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +L+E+YAGDFPLWL+PIQ RLIP++D Q+++  +VE  ++ +G+R ++  SG+R+ K IR
Sbjct  488  ILVENYAGDFPLWLAPIQARLIPISDAQVDYAREVEHLMRQAGLRVQIDNSGDRMAKQIR  547

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             AE +KIP+MA++G KE+ES+ ++IRSR  G+LG +   + I + +NA++ R + 
Sbjct  548  KAELEKIPVMAIIGAKEMESNTLSIRSRKHGDLGAISTTEAIAKMQNAVQTRDWL  602



>gb|ELS32748.1| Ser-tRNA(Thr) hydrolase [Pseudanabaena biceps PCC 7429]
Length=606

 Score =   314 bits (805),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 188/235 (80%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
             E IL  FGF+NYE+NLSTRPEK VG+D IWEK+T ALK ALN K W Y IDEGGGAFYG
Sbjct  372  AELILSTFGFENYEINLSTRPEKYVGSDAIWEKSTEALKQALNHKGWDYVIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR+WQCSTIQ+DFNLP+RF M YV  D  + +PI+IHRA+ GS+ERF G
Sbjct  432  PKIDIKIEDAIGRRWQCSTIQLDFNLPDRFKMEYVGEDGVRHQPIMIHRALFGSVERFIG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            VLIE+YAGDFPLWL+P+QT+LI V+D Q+E+  +V  +++A+G+R ++  SG+R+ K IR
Sbjct  492  VLIENYAGDFPLWLAPVQTKLIAVSDGQMEYAEQVAAKMRAAGLRVQLDHSGDRMAKQIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             AE  KIP+MAV+G KEVE+  ++IRSR  GELG + ID+ I + + AI +RT+F
Sbjct  552  KAEMDKIPVMAVIGAKEVEAGTLSIRSRKHGELGAIAIDEVISKMQAAISDRTWF  606



>ref|WP_040688179.1| threonyl-tRNA synthetase [Pseudanabaena biceps]
Length=596

 Score =   314 bits (804),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 188/235 (80%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
             E IL  FGF+NYE+NLSTRPEK VG+D IWEK+T ALK ALN K W Y IDEGGGAFYG
Sbjct  362  AELILSTFGFENYEINLSTRPEKYVGSDAIWEKSTEALKQALNHKGWDYVIDEGGGAFYG  421

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR+WQCSTIQ+DFNLP+RF M YV  D  + +PI+IHRA+ GS+ERF G
Sbjct  422  PKIDIKIEDAIGRRWQCSTIQLDFNLPDRFKMEYVGEDGVRHQPIMIHRALFGSVERFIG  481

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            VLIE+YAGDFPLWL+P+QT+LI V+D Q+E+  +V  +++A+G+R ++  SG+R+ K IR
Sbjct  482  VLIENYAGDFPLWLAPVQTKLIAVSDGQMEYAEQVAAKMRAAGLRVQLDHSGDRMAKQIR  541

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             AE  KIP+MAV+G KEVE+  ++IRSR  GELG + ID+ I + + AI +RT+F
Sbjct  542  KAEMDKIPVMAVIGAKEVEAGTLSIRSRKHGELGAIAIDEVISKMQAAISDRTWF  596



>emb|CCQ65975.1| Threonyl-tRNA synthetase [Crocosphaera watsonii WH 0402]
Length=367

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP+KSVG D+ WE AT AL +ALN K W Y  D+GGGAFYG
Sbjct  133  TEKILSDFGFKDYEVNLSTRPDKSVGTDEGWELATQALVEALNGKGWDYIEDKGGGAFYG  192

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERF+G
Sbjct  193  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAVDGSRQRPIMIHRAIFGSLERFYG  252

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++ Q+E+   V   LK +G R E+ C+GERL K IR
Sbjct  253  ILIENYAGDFPLWLAPIQLRLLPVSEAQIEYGETVVATLKQAGYRVEIDCTGERLGKQIR  312

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++A+VG KEVE+  ++IR+R  G++GTM + +     K+AI N+ 
Sbjct  313  NAELEKIPVVAIVGKKEVETQTLSIRTRQQGDIGTMTLTELKESFKSAITNKA  365



>ref|WP_027841790.1| threonyl-tRNA synthetase [Mastigocoleus testarum]
Length=620

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 185/229 (81%), Gaps = 1/229 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF+NYE+NLSTRP KSVG D++WE AT+ALK+AL+ K W Y IDEGGGAFYG
Sbjct  386  TEQILSDFGFNNYEINLSTRPSKSVGTDEVWELATAALKEALDSKGWNYIIDEGGGAFYG  445

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV +D  KKRPI+IHRA+ GS+ERFFG
Sbjct  446  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMQYVAADDTKKRPIMIHRAIFGSIERFFG  505

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWLSPIQ RL+PV+D   E+   V + L   G+R EV  SGERL K IR
Sbjct  506  ILIENYAGDFPLWLSPIQCRLLPVSDEVREYAESVARELHKEGLRVEVDGSGERLGKQIR  565

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAI  218
            NAE +KIP++AVVG +E+E+  +++R+R  G+LGT+ I++ I   ++AI
Sbjct  566  NAELEKIPVVAVVGKREMENQNLSVRTRKAGDLGTLSINETITCLQSAI  614



>ref|WP_011316520.1| threonyl-tRNA synthetase [Anabaena variabilis]
 gb|ABA24938.1| threonyl-tRNA synthetase / Ser-tRNA(Thr) hydrolase [Anabaena 
variabilis ATCC 29413]
Length=614

 Score =   313 bits (801),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 185/235 (79%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRPEKSVGND++WE ATSAL+ ALN K W Y +DEGGGAFYG
Sbjct  380  TEQILSDFGFKNYEVNLSTRPEKSVGNDEVWELATSALRQALNTKGWNYIVDEGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM Y+  D  ++RPI+IHRA+ GSLERFFG
Sbjct  440  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMEYIAVDGSRQRPIMIHRAIFGSLERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+Y+GDFPLWL+P+Q RL+PV+D   E+   V   LK +GIR E   SGERL K IR
Sbjct  500  ILIENYSGDFPLWLAPVQLRLLPVSDEVREYAQLVVISLKKAGIRVETDSSGERLGKQIR  559

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             AE +KIP++AVVG KEVE+  +++R+R  G+LG + +D+ +   ++AI +++  
Sbjct  560  TAELEKIPVVAVVGKKEVENQNLSVRTRQSGDLGVLNMDEILHRLQDAINSKSVL  614



>ref|WP_015118380.1| threonyl-tRNA synthetase [Rivularia sp. PCC 7116]
 gb|AFY54805.1| threonyl-tRNA synthetase [Rivularia sp. PCC 7116]
Length=620

 Score =   312 bits (800),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 185/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF+NYE+NLSTRP KSVG D++WE AT+ALK+AL++K W Y +DEGGGAFYG
Sbjct  386  TEQILSDFGFNNYEINLSTRPSKSVGTDEVWELATAALKEALDNKGWNYIVDEGGGAFYG  445

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  KKRPI+IHRA+ GS+ERFFG
Sbjct  446  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMQYVADDDTKKRPIMIHRAIFGSIERFFG  505

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D   E+   V K L   G+R EV  SGERL K IR
Sbjct  506  ILIENYAGDFPLWLAPIQCRLLPVSDEVREYAESVAKELHKEGLRVEVDGSGERLGKQIR  565

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++AVVG +E+E+  +++R+R GG+LG + I++ +   ++ I   T
Sbjct  566  NAELEKIPVVAVVGKREMENQNLSVRTRKGGDLGALSINETVTHLQSIIALNT  618



>ref|WP_026134857.1| threonyl-tRNA synthetase [Scytonema hofmanni]
Length=614

 Score =   312 bits (799),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 184/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP KSVG D++WE ATSAL  ALN K W Y +DEGGGAFYG
Sbjct  380  TEEILSDFGFKNYEVNLSTRPGKSVGTDEVWELATSALSQALNAKGWNYSVDEGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM Y+  D  ++RPI+IHRA+ GSLERFFG
Sbjct  440  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMEYIAPDGSRQRPIMIHRAIFGSLERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAG+FPLWL+P+Q RL+PV+D   E+   V   LK +GIR EV  SGERL K IR
Sbjct  500  ILIENYAGNFPLWLAPVQLRLLPVSDDFREYAESVAISLKKAGIRVEVDSSGERLGKQIR  559

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             AE +KIP++AVVG KEVE+  +++R+R  G+LG + +D+ + + + AI+++T
Sbjct  560  TAELEKIPVVAVVGKKEVENHNLSVRTRKSGDLGVLNLDELLHQLQAAIDSKT  612



>emb|CAN65674.1| hypothetical protein VITISV_002009 [Vitis vinifera]
Length=1260

 Score =   323 bits (827),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 177/210 (84%), Gaps = 19/210 (9%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL QFGF  YEVNLSTRPEK+VG DDIWEKATSAL+DAL+DK W+Y+IDEGGGAFYG
Sbjct  445  TEEILLQFGFSKYEVNLSTRPEKAVGADDIWEKATSALRDALDDKGWSYRIDEGGGAFYG  504

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDALGRKWQCSTIQ                  +K+RPI+IHRAVLGSLERFFG
Sbjct  505  PKIDLKIEDALGRKWQCSTIQA-----------------KKQRPIMIHRAVLGSLERFFG  547

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VLIEHYAGDFPLWLSPIQ R++PVTDTQLE+CN+V  +LKA+GIRAEVC GERLPKLIRN
Sbjct  548  VLIEHYAGDFPLWLSPIQARVLPVTDTQLEYCNEVTNKLKANGIRAEVCHGERLPKLIRN  607

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGG  272
            +EKQ+IPLMAVVGPKEVE+  VT  S +GG
Sbjct  608  SEKQRIPLMAVVGPKEVETQTVT--SIWGG  635



>emb|CDN13311.1| Threonyl-tRNA synthetase [Richelia intracellularis]
Length=584

 Score =   309 bits (791),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 184/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF+NYEVNLSTRP KSVG D++WE AT+ALK AL+ K W Y IDEGGGAFYG
Sbjct  350  TEQILSDFGFENYEVNLSTRPGKSVGTDNVWELATTALKQALDTKGWDYLIDEGGGAFYG  409

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV SD  ++RPI+IHRA+ GSLERFFG
Sbjct  410  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMEYVASDNTRQRPIMIHRAIFGSLERFFG  469

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAG FPLWL+PIQ RL+PV+D   ++   +   L+ +G R EV  SGERL KLIR
Sbjct  470  ILIENYAGSFPLWLAPIQLRLLPVSDEVRDYAESIATDLRKAGFRVEVDGSGERLGKLIR  529

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             AE +KIP++AVVG +EVE+  +++R+R  G LGT+ +++ +   + AI ++T
Sbjct  530  TAELEKIPVVAVVGKREVENQTLSVRTREEGNLGTLSVNEVVSRLQTAIASKT  582



>ref|WP_037220169.1| threonyl-tRNA synthetase [Richelia intracellularis]
Length=614

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 184/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF+NYEVNLSTRP KSVG D++WE AT+ALK AL+ K W Y IDEGGGAFYG
Sbjct  380  TEQILSDFGFENYEVNLSTRPGKSVGTDNVWELATTALKQALDTKGWDYLIDEGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV SD  ++RPI+IHRA+ GSLERFFG
Sbjct  440  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMEYVASDNTRQRPIMIHRAIFGSLERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAG FPLWL+PIQ RL+PV+D   ++   +   L+ +G R EV  SGERL KLIR
Sbjct  500  ILIENYAGSFPLWLAPIQLRLLPVSDEVRDYAESIATDLRKAGFRVEVDGSGERLGKLIR  559

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             AE +KIP++AVVG +EVE+  +++R+R  G LGT+ +++ +   + AI ++T
Sbjct  560  TAELEKIPVVAVVGKREVENQTLSVRTREEGNLGTLSVNEVVSRLQTAIASKT  612



>ref|WP_026093793.1| threonyl-tRNA synthetase [Calothrix sp. PCC 7103]
Length=612

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 184/235 (78%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YE+NLSTRP KSVG+D++WE AT+AL +ALN K W Y +D+GGGAFYG
Sbjct  378  TEKILSDFGFKDYEINLSTRPNKSVGSDEVWELATNALVEALNTKGWKYIVDDGGGAFYG  437

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV SD  KKRPI+IHRA+ GSLERFFG
Sbjct  438  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMEYVASDGTKKRPIMIHRAIFGSLERFFG  497

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+PV+D   E+   + +  K  G+R E+  +GERL KLIR
Sbjct  498  ILIENYAGDFPLWLAPVQMRLLPVSDEVREYAQLIAQEFKKGGLRVEIDNTGERLGKLIR  557

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             AE +KIP++AV+G +EVE++ ++IR+R  G+LG + ++D I   +  +  +T  
Sbjct  558  TAEVEKIPVVAVIGKREVETNTLSIRTRKSGDLGALTVNDIINRLQQVVTEKTII  612



>ref|WP_009546407.1| MULTISPECIES: threonyl-tRNA synthetase [Cyanothece]
Length=642

 Score =   309 bits (791),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 185/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRPEKSVG D+ WE AT AL +ALN K W Y  D+GGGAFYG
Sbjct  408  TEKILSDFGFKDYEVNLSTRPEKSVGTDEGWELATQALVEALNSKSWEYIEDKGGGAFYG  467

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV +D  ++RPI+IHRA+ GSLERF+G
Sbjct  468  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAADGSRQRPIMIHRAIFGSLERFYG  527

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++ Q E+   V   LK +G R E+ C+GERL K IR
Sbjct  528  ILIENYAGDFPLWLAPIQLRLLPVSEAQREYGEAVVATLKEAGYRVEIDCTGERLGKQIR  587

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++A+VG KEVE+ +++IR+R  G++GTM + +  +   +AI N+T
Sbjct  588  NAELEKIPVVAIVGNKEVETQSLSIRTRQQGDIGTMDLTELKKSLDDAIANKT  640



>gb|ACB54182.1| threonyl-tRNA synthetase [Cyanothece sp. ATCC 51142]
Length=644

 Score =   309 bits (791),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 185/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRPEKSVG D+ WE AT AL +ALN K W Y  D+GGGAFYG
Sbjct  410  TEKILSDFGFKDYEVNLSTRPEKSVGTDEGWELATQALVEALNSKSWEYIEDKGGGAFYG  469

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV +D  ++RPI+IHRA+ GSLERF+G
Sbjct  470  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAADGSRQRPIMIHRAIFGSLERFYG  529

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++ Q E+   V   LK +G R E+ C+GERL K IR
Sbjct  530  ILIENYAGDFPLWLAPIQLRLLPVSEAQREYGEAVVATLKEAGYRVEIDCTGERLGKQIR  589

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++A+VG KEVE+ +++IR+R  G++GTM + +  +   +AI N+T
Sbjct  590  NAELEKIPVVAIVGNKEVETQSLSIRTRQQGDIGTMDLTELKKSLDDAIANKT  642



>ref|WP_015166522.1| threonyl-tRNA synthetase [Pseudanabaena sp. PCC 7367]
 gb|AFY71568.1| Ser-tRNA(Thr) hydrolase, threonyl-tRNA synthetase [Pseudanabaena 
sp. PCC 7367]
Length=601

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 184/235 (78%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
             E IL  FGF++YEVNLSTRPEK VG++ IW+KAT AL+ AL  K W Y IDEGGGAFYG
Sbjct  367  AELILTTFGFEDYEVNLSTRPEKYVGDEAIWDKATEALRQALAKKGWKYAIDEGGGAFYG  426

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR WQCSTIQVDFNLPERFD+ YV +D ++ RPI+IHRA+ GSLERFFG
Sbjct  427  PKIDIKIEDAIGRMWQCSTIQVDFNLPERFDLEYVGADGDRHRPIMIHRALFGSLERFFG  486

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            VL EH+AGDFPLWL+P+Q RLIPV+D Q ++   V + +K +G+R E+  SG+RL K IR
Sbjct  487  VLTEHFAGDFPLWLAPVQARLIPVSDEQRDYAQTVAETMKKAGLRVEIDRSGDRLGKQIR  546

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             AE +KIP+MAVVG KEVES+ +++R+R  GELG + I + + + + A+ N  + 
Sbjct  547  RAELEKIPVMAVVGGKEVESNTLSVRTRKSGELGAIGITEVVDKMQQAVNNHDWL  601



>ref|XP_005819275.1| threonyl-tRNA synthetase [Guillardia theta CCMP2712]
 gb|EKX32295.1| threonyl-tRNA synthetase [Guillardia theta CCMP2712]
Length=610

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 179/235 (76%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L +FGF NYE+NLSTRPEKS+G+DDIW+ ATSAL  AL  K W+Y +DEGGGAFYG
Sbjct  373  TESVLSKFGFTNYEINLSTRPEKSIGSDDIWDLATSALIKALERKGWSYAVDEGGGAFYG  432

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI DALGRKWQCSTIQ DFNLP+RFD+ YV  D   +RPI+IHRA+ GS+ERFFG
Sbjct  433  PKIDLKIRDALGRKWQCSTIQCDFNLPQRFDLEYVAPDGSSQRPIMIHRAIFGSVERFFG  492

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +L+E+YAG+FPLW +P Q RL+P+ D  + FC KV + ++ SG R EV  S ERL K IR
Sbjct  493  ILVENYAGEFPLWFAPEQLRLLPINDEVVPFCEKVAEDMRVSGFRVEVDSSAERLQKKIR  552

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            NAE  K+PL AVVG KEVE + + +R+RF G+LG M ++    + K A+E+   F
Sbjct  553  NAEIAKVPLTAVVGKKEVEENQLAMRARFTGDLGAMPVEQVKNKLKKAVEDNLSF  607



>ref|XP_001418593.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96886.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=564

 Score =   306 bits (783),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 185/235 (79%), Gaps = 2/235 (1%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  +EVNLSTRPEKSVG+D IW+ A  ALKDAL  K W Y +D+GGGAFYG
Sbjct  330  TEEILSTFGFKEFEVNLSTRPEKSVGDDKIWDTAEGALKDALQMKGWDYIVDDGGGAFYG  389

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GRKWQCST+Q+DFNLPERFD++YVD +  K+RPI+IHRA+ GSLERFFG
Sbjct  390  PKIDIKILDAIGRKWQCSTVQLDFNLPERFDLSYVDRENAKQRPIMIHRAIFGSLERFFG  449

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +L E+YAG+FPLWL+PIQ RL+PVTD   ++   V K+L+ +G+R E+C+G+RL KL+R 
Sbjct  450  ILTENYAGEFPLWLAPIQVRLLPVTDEVSDYTEGVAKKLRDAGVRVEICTGQRLAKLVRT  509

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIRE--AKNAIENRTF  203
            AEK KIP+MAVVG +E E++ + +R+   G++GT+ +D+ +      NA + ++F
Sbjct  510  AEKAKIPVMAVVGREEAENNTLAVRTFKDGDVGTLSVDEVLSRVTTANATKGQSF  564



>ref|XP_007508265.1| threonyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO20369.1| threonyl-tRNA synthetase [Bathycoccus prasinos]
Length=660

 Score =   308 bits (789),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 184/232 (79%), Gaps = 0/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
             E +L  FGF +YEVNLSTRPEK+VG+DDIWE+A  ALKD+L  K W Y +D+GGGAFYG
Sbjct  424  VEEVLGTFGFKDYEVNLSTRPEKAVGSDDIWERAELALKDSLKRKNWDYIVDDGGGAFYG  483

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GRKWQCSTIQ+DFNLP+RFD++Y+D + EK+RPI+IHRA+ GSLERFFG
Sbjct  484  PKIDIKILDAIGRKWQCSTIQLDFNLPDRFDLSYIDQNNEKQRPIMIHRAIFGSLERFFG  543

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +L E+YAG FP+W++P+Q RL+PVTDT  ++  +V   ++A GIR EV SGER+ KL+RN
Sbjct  544  ILTENYAGAFPVWIAPVQVRLLPVTDTVDDYIQRVANDMRAKGIRVEVKSGERMKKLVRN  603

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            AEK+KIP+M ++G +E E++ + +R+   G++GT  + D I +   A E ++
Sbjct  604  AEKEKIPIMCIIGKEEAENETLAVRTYKSGDIGTFSLTDVISKVSEATEEKS  655



>gb|KIJ84876.1| threonyl-tRNA synthetase [Scytonema tolypothrichoides VB-61278]
Length=614

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 181/233 (78%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP+KSVG D++WE AT+AL  ALN K W Y +D GGGAFYG
Sbjct  380  TERILSDFGFKNYEVNLSTRPKKSVGADEVWELATNALIQALNAKAWNYVVDAGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV +D  +KRPI+IHRA+ GSLERFFG
Sbjct  440  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMEYVAADSIRKRPIMIHRAIFGSLERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+PVT+    +   V   LK  G+R +V  +GERL K IR
Sbjct  500  ILIENYAGDFPLWLAPVQLRLLPVTEEVRAYAESVAVSLKKIGLRIQVDQTGERLGKQIR  559

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             AE +KIP++AVVG KEVE+  +++R+R  G+LG + +D+ +   + A+ ++T
Sbjct  560  TAELEKIPVVAVVGKKEVETKTLSVRTRMAGDLGILTLDELVNHLQEAMTSKT  612



>ref|WP_008200810.1| threonyl-tRNA synthetase [Microcystis sp. T1-4]
 emb|CCI32122.1| Threonyl-tRNA synthetase [Microcystis sp. T1-4]
Length=618

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 184/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYEVNLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALEVAMQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +E+ S+ +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREISSETLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_002792903.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 emb|CCI23079.1| Threonyl-tRNA synthetase [Microcystis aeruginosa PCC 9808]
Length=618

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYEVNLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGSRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALEVAVQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_002735307.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 gb|ELP53326.1| threonyl-tRNA synthetase [Microcystis aeruginosa TAIHU98]
Length=618

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYEVNLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALEVAVQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_007303255.1| threonyl-tRNA synthetase [Crocosphaera watsonii]
 gb|EAM52938.1| Threonyl-tRNA synthetase, class IIa [Crocosphaera watsonii WH 
8501]
Length=642

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP+KSVG D+ WE AT AL +ALN K W Y  D+GGGAFYG
Sbjct  408  TEKILSDFGFKDYEVNLSTRPDKSVGTDEGWELATQALVEALNGKGWDYIEDKGGGAFYG  467

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERF+G
Sbjct  468  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAVDGSRQRPIMIHRAIFGSLERFYG  527

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++ Q+E+   V   LK +G R E+ C+GERL K IR
Sbjct  528  ILIENYAGDFPLWLAPIQLRLLPVSEAQIEYGETVVATLKQAGYRVEIDCTGERLGKQIR  587

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++A+VG KEVE+  ++IR+R  G++GTM + +     K+AI N+ 
Sbjct  588  NAELEKIPVVAIVGKKEVETQTLSIRTRQQGDIGTMTLTELKESFKSAITNKA  640



>ref|WP_002774699.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 emb|CCI05433.1| Threonyl-tRNA synthetase [Microcystis aeruginosa PCC 7941]
Length=618

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYEVNLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALEVAVQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_021831668.1| threonyl-tRNA synthetase [Crocosphaera watsonii]
 emb|CCQ52903.1| Threonyl-tRNA synthetase [Crocosphaera watsonii WH 8502]
Length=642

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP+KSVG D+ WE AT AL +ALN K W Y  D+GGGAFYG
Sbjct  408  TEKILSDFGFKDYEVNLSTRPDKSVGTDEGWELATQALVEALNGKGWDYIEDKGGGAFYG  467

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERF+G
Sbjct  468  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAVDGSRQRPIMIHRAIFGSLERFYG  527

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++ Q+E+   V   LK +G R E+ C+GERL K IR
Sbjct  528  ILIENYAGDFPLWLAPIQLRLLPVSEAQIEYGETVVATLKQAGYRVEIDCTGERLGKQIR  587

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++A+VG KEVE+  ++IR+R  G++GTM + +     K+AI N+ 
Sbjct  588  NAELEKIPVVAIVGKKEVETQTLSIRTRQQGDIGTMTLTELKESFKSAITNKA  640



>ref|WP_006518939.1| threonyl-tRNA synthetase [Leptolyngbya sp. PCC 7375]
 gb|EKU97767.1| threonyl-tRNA synthetase [Leptolyngbya sp. PCC 7375]
Length=621

 Score =   305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 185/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP KSVG+DDIWE ATS+L+ AL+ K W Y ID+GGGAFYG
Sbjct  387  TEQILSDFGFTDYEVNLSTRPAKSVGSDDIWELATSSLQKALDIKGWAYVIDQGGGAFYG  446

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCST+QVDFNLPERFD+ YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  447  PKIDIKIQDAIGRMWQCSTLQVDFNLPERFDLQYVAADGSRQRPIMIHRAIFGSLERFFG  506

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +L+E+YAG FPLWL+P+Q RL+PV+D Q ++ N+V + LK  G R EV  SGERL K IR
Sbjct  507  ILVENYAGMFPLWLAPVQVRLLPVSDAQRDYANQVAQTLKQEGFRVEVDTSGERLGKQIR  566

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             AE +KIP+++V+G +EV+S  + +R+R  G+LG + + D I + ++AI  ++
Sbjct  567  TAELEKIPVISVIGQREVDSQTLGVRTRQSGDLGALTVSDVIEKLQDAIAQKS  619



>ref|WP_007308875.1| threonyl-tRNA synthetase [Crocosphaera watsonii]
 gb|EHJ15151.1| Threonyl-tRNA synthetase [Crocosphaera watsonii WH 0003]
 emb|CCQ59467.1| Threonyl-tRNA synthetase [Crocosphaera watsonii WH 0005]
Length=642

 Score =   306 bits (783),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP+KSVG D+ WE AT AL +ALN K W Y  D+GGGAFYG
Sbjct  408  TEKILSDFGFKDYEVNLSTRPDKSVGTDEGWELATQALVEALNGKGWDYIEDKGGGAFYG  467

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERF+G
Sbjct  468  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAVDGSRQRPIMIHRAIFGSLERFYG  527

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++ Q+E+   V   LK +G R E+ C+GERL K IR
Sbjct  528  ILIENYAGDFPLWLAPIQLRLLPVSEAQIEYGETVVATLKQAGYRVEIDCTGERLGKQIR  587

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++A+VG KEVE+  ++IR+R  G++GTM + +     K+AI N+ 
Sbjct  588  NAELEKIPVVAIVGKKEVETQTLSIRTRQQGDIGTMTLTELKESFKSAITNKA  640



>ref|WP_002760217.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 emb|CCH97609.1| Threonyl-tRNA synthetase [Microcystis aeruginosa PCC 9717]
Length=618

 Score =   305 bits (781),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYE+NLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYEINLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQHHYALEVAVQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_002742239.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 emb|CAO87176.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS49064.1| threonyl-tRNA synthetase [Microcystis aeruginosa DIANCHI905]
Length=618

 Score =   305 bits (780),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY++NLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYQINLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGSRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALEVAVQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  ++IR+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSIRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_016515944.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 gb|EPF21415.1| Threonine--tRNA ligase [Microcystis aeruginosa SPC777]
Length=618

 Score =   304 bits (779),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY+VNLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYQVNLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALEVAVQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_004160952.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 emb|CCI13379.1| Threonyl-tRNA synthetase [Microcystis aeruginosa PCC 9806]
Length=618

 Score =   304 bits (779),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 184/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY++NLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYQINLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q ++  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQDYALEVAMQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_023073466.1| threonyl-tRNA synthetase [Leptolyngbya sp. Heron Island J]
 gb|ESA35769.1| threonyl-trna synthetase [Leptolyngbya sp. Heron Island J]
Length=621

 Score =   304 bits (779),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 185/234 (79%), Gaps = 1/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP KSVG+DDIWE ATSAL+ AL+ K W Y IDEGGGAFYG
Sbjct  387  TEQILSDFGFTDYEVNLSTRPAKSVGSDDIWELATSALQKALDIKEWAYVIDEGGGAFYG  446

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFD+ YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  447  PKIDIKIKDAIGRLWQCSTIQVDFNLPERFDLQYVAADGSRQRPIMIHRAIFGSLERFFG  506

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +L+E+Y+G FPLWL+P+Q RL+PV+D Q ++ ++V + L+  G R EV  SGERL K IR
Sbjct  507  ILVENYSGMFPLWLAPVQVRLLPVSDAQRDYAHQVSQTLQQQGFRVEVDTSGERLGKQIR  566

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTF  203
             AE +KIP+++V+G +EV+S  + IR+R  G+LG + + D I + ++AI  +T 
Sbjct  567  TAELEKIPVISVIGQREVDSQTLGIRTRQSGDLGALTVPDVIEKLQDAIAQKTI  620



>ref|WP_015145308.1| threonyl-tRNA synthetase [Pleurocapsa minor]
 gb|AFY79009.1| threonyl-tRNA synthetase [Pleurocapsa sp. PCC 7327]
Length=628

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 182/233 (78%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP+KSVG D+ WE AT+AL +AL  K W Y  D+GGGAFYG
Sbjct  394  TEKILSDFGFKDYEVNLSTRPDKSVGTDEGWELATNALVEALKTKGWDYLEDKGGGAFYG  453

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFD+ YV ++  ++RPI+IHRA+ GSLERF+G
Sbjct  454  PKIDIKIQDAIGRTWQCSTIQVDFNLPERFDLEYVAANGSRQRPIMIHRAIFGSLERFYG  513

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++TQ E+   V    K +G R E+ C+GERL K IR
Sbjct  514  ILIENYAGDFPLWLAPIQIRLLPVSETQREYAESVAANFKQAGYRVEIDCTGERLGKQIR  573

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++AVVG +EV    ++IR+R  G+LG M +D+  R  + AIE +T
Sbjct  574  NAELEKIPVVAVVGKQEVAEQTLSIRTRKEGDLGVMTVDELQRRMQGAIEAKT  626



>ref|WP_002802581.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 emb|CCI37161.1| Threonyl-tRNA synthetase [Microcystis aeruginosa PCC 9701]
Length=618

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY++NLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYQINLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGSRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALEVAVQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_002797977.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 emb|CCI26691.1| Threonyl-tRNA synthetase [Microcystis aeruginosa PCC 9809]
Length=618

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY++NLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYQINLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALEVAMQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_008276158.1| threonyl-tRNA synthetase [Cyanothece sp. CCY0110]
 gb|EAZ90678.1| Threonyl-tRNA synthetase, class IIa [Cyanothece sp. CCY0110]
Length=642

 Score =   305 bits (780),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRPEKSVG D+ WE AT AL +ALN K W Y  D+GGGAFYG
Sbjct  408  TEKILSDFGFKDYEVNLSTRPEKSVGTDEGWELATQALVEALNSKSWEYIEDKGGGAFYG  467

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV +D  ++RPI+IHRA+ GSLERF+G
Sbjct  468  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAADGSRQRPIMIHRAIFGSLERFYG  527

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++ Q E+   V   LK +G R E+ C+GERL K IR
Sbjct  528  ILIENYAGDFPLWLAPIQLRLLPVSEAQREYGETVVATLKEAGYRVEIDCTGERLGKQIR  587

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             AE +KIP++A+VG KEVE+ +++IR+R  G++GTM + +  +   +AI N+ 
Sbjct  588  KAELEKIPVVAIVGNKEVETQSLSIRTRQQGDIGTMDLTELKKSLDDAIANKA  640



>ref|WP_015137595.1| threonyl-tRNA synthetase [Nostoc sp. PCC 7524]
 gb|AFY47139.1| threonyl-tRNA synthetase [Nostoc sp. PCC 7524]
Length=613

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 180/229 (79%), Gaps = 1/229 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP+KSVGND +WE ATSALK+AL+ K W Y +DEGGGAFYG
Sbjct  380  TEKILSDFGFKNYEVNLSTRPDKSVGNDQVWELATSALKEALDTKGWNYVVDEGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM Y+ +D  ++RPI+IHRA+ GSLERFFG
Sbjct  440  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMEYIAADGSRQRPIMIHRAIFGSLERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+PV+D    +   V   L+ +G+R E+  SGERL K IR
Sbjct  500  ILIENYAGDFPLWLAPVQVRLLPVSDEVRGYAESVITDLQKAGLRVEIDNSGERLSKQIR  559

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAI  218
             AE +KIP++AVVG KEVE+  +++R+R   +LG M + + +   + AI
Sbjct  560  TAELEKIPVVAVVGKKEVENQNLSVRTRQVRDLGVMSLSELVHRLQEAI  608



>ref|WP_002752951.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 emb|CCH91622.1| Threonyl-tRNA synthetase [Microcystis aeruginosa PCC 9432]
Length=618

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY+VNLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYQVNLSTRPSKSVGSDAVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMEYVARDGSRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  ++  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQHHYALEIAVQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAILSKT  616



>ref|WP_017289915.1| threonyl-tRNA synthetase [Leptolyngbya boryana]
Length=619

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 180/233 (77%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP +SVG+D IWEKAT AL+ AL+ K W Y IDEGGGAFYG
Sbjct  385  TEQILSDFGFSNYEVNLSTRPPQSVGSDQIWEKATIALQQALDRKGWNYVIDEGGGAFYG  444

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+ R+WQCSTIQVDFNLPERF+M YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  445  PKIDLKIEDAIARRWQCSTIQVDFNLPERFEMEYVAADGTRQRPIMIHRAIFGSLERFFG  504

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+P++  Q ++   +  +LK +G RAEV  + ERL K IR
Sbjct  505  ILIENYAGDFPLWLAPIQVRLLPISQDQRDYAEAIALQLKQTGFRAEVDRTNERLGKQIR  564

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             AE +KIP++AVVG KEVES  ++IR+R  GELG + + +     + A+ N  
Sbjct  565  TAELEKIPVVAVVGKKEVESQTLSIRTRPKGELGALTLSELCDRLQQAVFNHA  617



>ref|WP_015195847.1| threonyl-tRNA synthetase [Calothrix parietina]
 gb|AFY99188.1| Ser-tRNA(Thr) hydrolase [Calothrix sp. PCC 6303]
Length=621

 Score =   303 bits (776),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 184/232 (79%), Gaps = 1/232 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            IL  FGF +YEVNLSTRPEKSVG D++WE AT AL +ALN K W Y +DEGGGAFYGPKI
Sbjct  390  ILSDFGFKDYEVNLSTRPEKSVGEDEVWELATDALIEALNTKGWNYIVDEGGGAFYGPKI  449

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+DA+GR WQCSTIQVDFNLPERFD+ YV +D  +KRPI+IHRA+ GSLERFFG+LI
Sbjct  450  DIKIKDAIGRLWQCSTIQVDFNLPERFDLEYVAADGIRKRPIMIHRAIFGSLERFFGILI  509

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            E+YAGDFPLWL+P+Q RL+PV++   ++   V   LK +G RAE+  SG+RL K+IR AE
Sbjct  510  ENYAGDFPLWLAPVQVRLLPVSEEARDYALSVVNTLKQAGFRAEIDQSGDRLGKIIRTAE  569

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             +KIP++AV+G KE+E+  +++RSR  G+LGT+ + +  ++ +  IE++  F
Sbjct  570  LEKIPVVAVIGKKEIETQTLSVRSRMAGDLGTINLAELQQKMQQVIESKNSF  621



>ref|WP_035857632.1| MULTISPECIES: threonyl-tRNA synthetase [Cyanothece]
Length=632

 Score =   303 bits (775),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 182/235 (77%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRPEKSVG+D +W+ AT AL  ALN+K W Y  D GGGAFYG
Sbjct  398  TEKILSDFGFTDYEVNLSTRPEKSVGSDQVWQLATEALIKALNNKQWNYLEDRGGGAFYG  457

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERF M YV +D  +++PI+IHRA+ GSLERFFG
Sbjct  458  PKIDIKIKDAIGRLWQCSTIQVDFNLPERFGMEYVAADGSRQQPIMIHRAIFGSLERFFG  517

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q ++   V  RLK +G R EV  SGERL K IR
Sbjct  518  ILIENYAGDFPLWLAPIQLRLLPVSDEQQDYAKTVAIRLKKAGYRVEVDTSGERLGKQIR  577

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             +E +KIP++A+VG +EVES  ++IR+R GG+LGT+ + D     K AI N+  F
Sbjct  578  LSELEKIPVVAIVGKREVESQTLSIRTRQGGDLGTITVADLRERFKIAITNKKAF  632



>ref|WP_024970227.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
Length=618

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY+VNLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYQVNLSTRPSKSVGSDAVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  ++  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALEIAVQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQPAILSKT  616



>ref|WP_045361210.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 dbj|GAL95021.1| threonyl-tRNA synthetase [Microcystis aeruginosa NIES-44]
Length=618

 Score =   302 bits (773),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 180/229 (79%), Gaps = 1/229 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY++NLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYQINLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +  +V  +LK +G R E+  SGERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQHHYALEVAMQLKQAGYRVEIDKSGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAI  218
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLADLLEKMQTAI  612



>ref|WP_035153786.1| threonyl-tRNA synthetase [Calothrix sp. 336/3]
 gb|KFB83866.1| threonyl-tRNA synthetase [Calothrix sp. 336/3]
Length=617

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP+K VG D++W+ AT AL+DAL  K W Y IDEGGGAFYG
Sbjct  383  TEKILSDFGFKNYEVNLSTRPDKFVGKDEVWKLATIALQDALQAKGWDYVIDEGGGAFYG  442

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR+WQCSTIQVDFNLPERFDM YVDS+  ++RPI+IHRA+ GSLERFFG
Sbjct  443  PKIDIKIEDAIGRRWQCSTIQVDFNLPERFDMEYVDSNSSRQRPIMIHRAIFGSLERFFG  502

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q +L+PV+D    +   V   LK SGIR E+  +GERL K IR
Sbjct  503  ILIENYAGDFPLWLAPVQVKLLPVSDDVRNYAEFVADNLKKSGIRVEIDNTGERLGKQIR  562

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             AE +K P++ V+G KEVES +++IR+R  G+LG + I +  ++ +  I++++
Sbjct  563  AAELEKFPVVGVIGKKEVESQSLSIRTRKSGDLGILTIPELKQKLQLTIDSKS  615



>gb|ACB50845.1| threonyl-tRNA synthetase [Cyanothece sp. ATCC 51142]
Length=666

 Score =   303 bits (775),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 182/235 (77%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRPEKSVG+D +W+ AT AL  ALN+K W Y  D GGGAFYG
Sbjct  432  TEKILSDFGFTDYEVNLSTRPEKSVGSDQVWQLATEALIKALNNKQWNYLEDRGGGAFYG  491

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERF M YV +D  +++PI+IHRA+ GSLERFFG
Sbjct  492  PKIDIKIKDAIGRLWQCSTIQVDFNLPERFGMEYVAADGSRQQPIMIHRAIFGSLERFFG  551

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q ++   V  RLK +G R EV  SGERL K IR
Sbjct  552  ILIENYAGDFPLWLAPIQLRLLPVSDEQQDYAKTVAIRLKKAGYRVEVDTSGERLGKQIR  611

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             +E +KIP++A+VG +EVES  ++IR+R GG+LGT+ + D     K AI N+  F
Sbjct  612  LSELEKIPVVAIVGKREVESQTLSIRTRQGGDLGTITVADLRERFKIAITNKKAF  666



>gb|AFY73091.1| threonyl-tRNA synthetase [Synechococcus sp. PCC 7502]
Length=613

 Score =   301 bits (771),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 183/237 (77%), Gaps = 3/237 (1%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
             E IL  FGF NYEVNLSTRP+K VG+D+IW+KAT ALK ALN K W YQ+D GGGAFYG
Sbjct  377  AELILSTFGFANYEVNLSTRPDKYVGSDEIWDKATDALKSALNQKGWAYQVDAGGGAFYG  436

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR+WQCSTIQVDFNLPERFDM YV +D  + RPI+IHRA+ GSLERFFG
Sbjct  437  PKIDIKIEDAIGRRWQCSTIQVDFNLPERFDMEYVGADGNRHRPIMIHRALFGSLERFFG  496

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTD--TQLEFCNKVEKRLKASGIRAEV-CSGERLPKL  371
            +L E+YAGDFPLWL+P+Q RLI V +    LE+   V  +++  G+R +V  SG+R+ K 
Sbjct  497  ILTENYAGDFPLWLAPVQARLIAVNEDPAILEYAQSVAAKMQKLGLRVQVDTSGDRMAKQ  556

Query  370  IRNAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            IR AE +KIP+MA++G KEVE+++++IR+R  G+LG +   + I +   A++N  +F
Sbjct  557  IRKAELEKIPVMAIIGAKEVEAESLSIRTRKYGDLGVIPTMEAIEKMLTAVKNHDWF  613



>ref|WP_012266116.1| threonyl-tRNA synthetase [Microcystis aeruginosa]
 dbj|BAG02981.1| threonyl-tRNA synthetase [Microcystis aeruginosa NIES-843]
Length=618

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 182/233 (78%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY++NLSTRP KSVG+D +WE AT+AL +ALN K W Y  D+GGGAFYG
Sbjct  384  TEKILSDFGFTNYQINLSTRPSKSVGSDSVWELATAALIEALNAKKWDYIEDQGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMQYVARDGTRERPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q  +   V  +LK +G R E+  +GERL K IR
Sbjct  504  ILIENYAGDFPLWLAPIQVRLLPVSDEQQHYALGVAMQLKQAGYRVEIDKTGERLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E +KIP++AV+G +EV S  +++R+R GG+LG+M + D + + + AI ++T
Sbjct  564  TGELEKIPVLAVIGKREVSSKTLSVRTRQGGDLGSMTLVDLLGKMQTAILSKT  616



>ref|WP_041429912.1| threonyl-tRNA synthetase [Synechococcus sp. PCC 7502]
Length=597

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 183/237 (77%), Gaps = 3/237 (1%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
             E IL  FGF NYEVNLSTRP+K VG+D+IW+KAT ALK ALN K W YQ+D GGGAFYG
Sbjct  361  AELILSTFGFANYEVNLSTRPDKYVGSDEIWDKATDALKSALNQKGWAYQVDAGGGAFYG  420

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR+WQCSTIQVDFNLPERFDM YV +D  + RPI+IHRA+ GSLERFFG
Sbjct  421  PKIDIKIEDAIGRRWQCSTIQVDFNLPERFDMEYVGADGNRHRPIMIHRALFGSLERFFG  480

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTD--TQLEFCNKVEKRLKASGIRAEV-CSGERLPKL  371
            +L E+YAGDFPLWL+P+Q RLI V +    LE+   V  +++  G+R +V  SG+R+ K 
Sbjct  481  ILTENYAGDFPLWLAPVQARLIAVNEDPAILEYAQSVAAKMQKLGLRVQVDTSGDRMAKQ  540

Query  370  IRNAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            IR AE +KIP+MA++G KEVE+++++IR+R  G+LG +   + I +   A++N  +F
Sbjct  541  IRKAELEKIPVMAIIGAKEVEAESLSIRTRKYGDLGVIPTMEAIEKMLTAVKNHDWF  597



>ref|WP_036799001.1| threonyl-tRNA synthetase [Pleurocapsa sp. PCC 7319]
Length=646

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 177/221 (80%), Gaps = 1/221 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP+KSVG D+ WE AT AL +ALN+K W Y  D+GGGAFYG
Sbjct  412  TEKILSDFGFKDYEVNLSTRPDKSVGTDEGWELATQALVEALNNKGWDYLEDKGGGAFYG  471

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERF M YV +D  ++RPI+IHRA+ GSLERF+G
Sbjct  472  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFGMEYVAADGSRQRPIMIHRAIFGSLERFYG  531

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++ Q E+   V   LK +G R E+ CSGERL K IR
Sbjct  532  ILIENYAGDFPLWLAPIQVRLLPVSEAQREYAEAVAANLKQAGYRVEIDCSGERLGKQIR  591

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDF  242
            NAE +KIP++AVVG +EVE+  ++IR+R  G++GTM + + 
Sbjct  592  NAELEKIPVVAVVGKREVETQTLSIRTRQQGDIGTMTLAEL  632



>ref|WP_040936213.1| threonyl-tRNA synthetase [Prochloron didemni]
Length=646

 Score =   301 bits (771),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 181/233 (78%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP+KSVG D+ WE AT+AL  ALN K W Y  D+GGGAFYG
Sbjct  412  TEKILSDFGFKDYEVNLSTRPDKSVGTDEGWELATNALDRALNTKGWDYLEDKGGGAFYG  471

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV +D  ++RPI+IHRA+ GSLERF+G
Sbjct  472  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAADGSRQRPIMIHRAIFGSLERFYG  531

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++TQ  +   V   LK SG R E+ C+GERL K IR
Sbjct  532  ILIENYAGDFPLWLAPIQVRLLPVSETQRPYGKAVVTMLKQSGYRVEIDCTGERLGKQIR  591

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++A+VG +EVE+  ++IR+R  G++GTM I +     +  +  +T
Sbjct  592  NAELEKIPVVAIVGKREVETQTLSIRTRQQGDIGTMNITELKESLEEVLAKKT  644



>ref|WP_040943375.1| threonyl-tRNA synthetase [Prochloron didemni]
Length=646

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 182/233 (78%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP+KSVG D+ WE AT+AL  ALN K W Y  D+GGGAFYG
Sbjct  412  TEKILSDFGFKDYEVNLSTRPDKSVGTDEGWELATNALDRALNTKGWDYLEDKGGGAFYG  471

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV +D  ++RPI+IHRA+ GSLERF+G
Sbjct  472  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAADGSRQRPIMIHRAIFGSLERFYG  531

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++TQ  + + V   LK SG R E+ C+GERL K IR
Sbjct  532  ILIENYAGDFPLWLAPIQVRLLPVSETQRPYGDGVVTMLKQSGYRVEIDCTGERLGKQIR  591

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++A+VG +EVE+  ++IR+R  G++GTM I +     +  +  +T
Sbjct  592  NAELEKIPVVAIVGKREVETQTLSIRTRQQGDIGTMNITELKESLEEVLAKKT  644



>ref|WP_039202295.1| threonyl-tRNA synthetase [Aphanizomenon flos-aquae]
 gb|KHG40957.1| threonyl-tRNA synthetase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=609

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 173/222 (78%), Gaps = 1/222 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  YEVNLSTRP+KSVG DD+WE AT+AL+ ALN K W Y +D GGGAFYG
Sbjct  380  TEQILSDFGFKQYEVNLSTRPDKSVGTDDVWELATTALEQALNTKGWNYVVDAGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM Y+ +D  ++RPI+IHRA+ GSLERFFG
Sbjct  440  PKIDIKIKDAIGRLWQCSTIQVDFNLPERFDMEYIAADGSRQRPIMIHRAIFGSLERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+PV+D   E+   V    K  G R EV  SGERL K IR
Sbjct  500  ILIENYAGDFPLWLAPVQLRLLPVSDDFREYAKSVAADFKKVGFRVEVDSSGERLGKQIR  559

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFI  239
             A+ +KIP++AVVG KEVES  +++RSR  G+LG + + + +
Sbjct  560  TAQLEKIPVVAVVGKKEVESKTLSVRSRQAGDLGVLTLSELV  601



>ref|WP_042157860.1| threonyl-tRNA synthetase [Planktothrix agardhii]
Length=623

 Score =   300 bits (767),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 178/233 (76%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP KSVG D +W+ AT+AL +AL+ K W Y  DEGGGAFYG
Sbjct  389  TEQILSDFGFKNYEVNLSTRPPKSVGTDQVWDLATAALIEALDAKGWDYVTDEGGGAFYG  448

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR WQCSTIQVDFNLPERFDM YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  449  PKIDIKIEDAIGRLWQCSTIQVDFNLPERFDMQYVAADGTRQRPIMIHRAIFGSLERFFG  508

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ R++PV++ Q E+   V   LK +G R E+ CS ERL K IR
Sbjct  509  ILIENYAGDFPLWLAPIQVRILPVSNDQTEYAKSVADSLKKAGFRVEIDCSSERLGKQIR  568

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++ VVG KEV   ++++R+R  G++G + + D     + A+E + 
Sbjct  569  NAELEKIPVVIVVGKKEVAEQSLSVRTRKQGDVGMLTMPDLQSRLQLAVEEKV  621



>gb|KEI68755.1| ThrS [Planktothrix agardhii NIVA-CYA 126/8]
Length=627

 Score =   300 bits (768),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 178/233 (76%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP KSVG D +W+ AT+AL +AL+ K W Y  DEGGGAFYG
Sbjct  393  TEQILSDFGFKNYEVNLSTRPPKSVGTDQVWDLATAALIEALDAKGWDYVTDEGGGAFYG  452

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR WQCSTIQVDFNLPERFDM YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  453  PKIDIKIEDAIGRLWQCSTIQVDFNLPERFDMQYVAADGTRQRPIMIHRAIFGSLERFFG  512

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ R++PV++ Q E+   V   LK +G R E+ CS ERL K IR
Sbjct  513  ILIENYAGDFPLWLAPIQVRILPVSNDQTEYAKSVADSLKKAGFRVEIDCSSERLGKQIR  572

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++ VVG KEV   ++++R+R  G++G + + D     + A+E + 
Sbjct  573  NAELEKIPVVIVVGKKEVAEQSLSVRTRKQGDVGMLTMPDLQSRLQLAVEEKV  625



>ref|WP_026798139.1| threonyl-tRNA synthetase [Planktothrix prolifica]
Length=623

 Score =   300 bits (767),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 178/233 (76%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP KSVG D +W+ AT+AL +AL+ K W Y  DEGGGAFYG
Sbjct  389  TEQILSDFGFKNYEVNLSTRPPKSVGTDQVWDLATAALIEALDAKGWDYVTDEGGGAFYG  448

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR WQCSTIQVDFNLPERFDM YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  449  PKIDIKIEDAIGRLWQCSTIQVDFNLPERFDMQYVAADGTRQRPIMIHRAIFGSLERFFG  508

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ R++PV++ Q E+   V   LK +G R E+ CS ERL K IR
Sbjct  509  ILIENYAGDFPLWLAPIQVRILPVSNDQTEYAKSVADSLKKAGFRVEIDCSSERLGKQIR  568

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++ VVG KEV   ++++R+R  G++G + + D     + A+E + 
Sbjct  569  NAELEKIPVVIVVGKKEVAEQSLSVRTRKQGDVGMLTMPDLQSRLQLAVEEKV  621



>ref|WP_015182951.1| threonyl-tRNA synthetase [Microcoleus sp. PCC 7113]
 gb|AFZ18802.1| threonyl-tRNA synthetase [Microcoleus sp. PCC 7113]
Length=623

 Score =   300 bits (767),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 180/233 (77%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP KSVG D++WE AT+ALK AL  K W Y  D GGGAFYG
Sbjct  389  TEQILSDFGFTDYEVNLSTRPAKSVGADEVWELATTALKQALTAKGWNYIEDVGGGAFYG  448

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI DA+GR WQCSTIQVDFNLPERF + YV +D  +++PI+IHRA+ GSLERFFG
Sbjct  449  PKIDLKIRDAIGRLWQCSTIQVDFNLPERFKLEYVAADGTRQQPIMIHRAIFGSLERFFG  508

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV+D Q E+   V   LK +G R E+  SGERL K IR
Sbjct  509  ILIENYAGDFPLWLAPIQVRLLPVSDDQREYIESVATTLKKTGYRVEIDRSGERLGKQIR  568

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++AVVG +EVE+  +++R+R GGELGT+ + +     + AIE ++
Sbjct  569  NAELEKIPVVAVVGKREVENQTLSVRTRKGGELGTLTLAELQACLQGAIEEKS  621



>emb|CEF98564.1| Aminoacyl-tRNA synthetase, class II [Ostreococcus tauri]
Length=608

 Score =   299 bits (766),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 176/227 (78%), Gaps = 0/227 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF ++EVNLSTRPEKSVG D IW  A +AL+DAL +K W Y +D+GGGAFYG
Sbjct  374  TEEILSTFGFTDFEVNLSTRPEKSVGEDAIWTTAENALRDALGEKGWDYIVDDGGGAFYG  433

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GRKWQCST+Q+DFNLPERFD+ Y+D D  K+RPI+IHRA+ GSLERFFG
Sbjct  434  PKIDIKILDAIGRKWQCSTVQLDFNLPERFDLNYIDRDNNKQRPIMIHRAIFGSLERFFG  493

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +L E+YAG+FPLWL+P+Q RL+PVTD   ++   V  +L+ +G R E+C+G+RL KL+R 
Sbjct  494  ILTENYAGEFPLWLAPVQVRLLPVTDEVSDYTEGVAAKLREAGCRVEICTGQRLAKLVRT  553

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNA  221
            AEK KIP+MAVVG  E  ++ + +R+   G++G++ +D+ +     A
Sbjct  554  AEKAKIPVMAVVGRDEAANNTLAVRTYKDGDVGSLSVDEVLSRITTA  600



>ref|WP_027403142.1| threonyl-tRNA synthetase [Aphanizomenon flos-aquae]
Length=609

 Score =   299 bits (766),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 173/222 (78%), Gaps = 1/222 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L  FGF  YEVNLSTRP+KSVG DD+WE AT+AL+ ALN K W Y +D GGGAFYG
Sbjct  380  TEQVLSDFGFKEYEVNLSTRPDKSVGTDDVWELATTALEQALNTKGWNYVVDAGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM Y+ +D  ++RPI+IHRA+ GSLERFFG
Sbjct  440  PKIDIKIKDAIGRLWQCSTIQVDFNLPERFDMEYIAADGSRQRPIMIHRAIFGSLERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+PV+D   E+   V    K  G R EV  SGERL K IR
Sbjct  500  ILIENYAGDFPLWLAPVQLRLLPVSDDFREYAKSVAADFKKVGFRVEVDSSGERLGKQIR  559

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFI  239
             A+ +KIP++AVVG KEVES  +++RSR  G+LG + + + +
Sbjct  560  TAQLEKIPVVAVVGKKEVESKTLSVRSRQAGDLGVLTLSELV  601



>ref|WP_040929767.1| threonyl-tRNA synthetase [Prochloron didemni]
Length=646

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 182/233 (78%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP+KSVG D+ W+ AT+AL  ALN K W Y  D+GGGAFYG
Sbjct  412  TEKILSDFGFKDYEVNLSTRPDKSVGTDEGWKLATNALDRALNTKGWDYLEDKGGGAFYG  471

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV +D  ++RPI+IHRA+ GSLERF+G
Sbjct  472  PKIDIKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAADGSRQRPIMIHRAIFGSLERFYG  531

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+PIQ RL+PV++TQ  + + V   LK SG R E+ C+GERL K IR
Sbjct  532  ILIENYAGDFPLWLAPIQVRLLPVSETQRPYGDGVVTMLKQSGYRVEIDCTGERLGKQIR  591

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            NAE +KIP++A+VG +EVE+  ++IR+R  G++GTM I +     +  +  +T
Sbjct  592  NAELEKIPVVAIVGKREVETQTLSIRTRQQGDIGTMNITELKESLEEVLAKKT  644



>ref|XP_003080133.1| putative threonyl-tRNA synthetase (ISS), partial [Ostreococcus 
tauri]
Length=625

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 176/227 (78%), Gaps = 0/227 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF ++EVNLSTRPEKSVG D IW  A +AL+DAL +K W Y +D+GGGAFYG
Sbjct  391  TEEILSTFGFTDFEVNLSTRPEKSVGEDAIWTTAENALRDALGEKGWDYIVDDGGGAFYG  450

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GRKWQCST+Q+DFNLPERFD+ Y+D D  K+RPI+IHRA+ GSLERFFG
Sbjct  451  PKIDIKILDAIGRKWQCSTVQLDFNLPERFDLNYIDRDNNKQRPIMIHRAIFGSLERFFG  510

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +L E+YAG+FPLWL+P+Q RL+PVTD   ++   V  +L+ +G R E+C+G+RL KL+R 
Sbjct  511  ILTENYAGEFPLWLAPVQVRLLPVTDEVSDYTEGVAAKLREAGCRVEICTGQRLAKLVRT  570

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNA  221
            AEK KIP+MAVVG  E  ++ + +R+   G++G++ +D+ +     A
Sbjct  571  AEKAKIPVMAVVGRDEAANNTLAVRTYKDGDVGSLSVDEVLSRITTA  617



>ref|WP_029626271.1| threonyl-tRNA synthetase [Synechococcus sp. CB0205]
Length=602

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 177/232 (76%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLSTRPEKS+G D +W+ AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  362  TEQILSTFDFRNYEINLSTRPEKSIGEDAVWDLATQGLIEALERKGWAYKIDEGGGAFYG  421

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCST+Q+DFNLPERFD+ YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  422  PKIDLKIEDAIGRMWQCSTVQLDFNLPERFDLEYVAADGSRQRPIMIHRAIFGSLERFFG  481

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD    +   V   LKA+G+RA V  SG+RL KLIR
Sbjct  482  IMTENYAGDFPFWLAPEQIRLLPVTDEVTGYAESVAAALKAAGVRASVDHSGDRLGKLIR  541

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            N E+ KIP++ V+G KE E   +++RSR  G+LG+++++  +  AK A ++R
Sbjct  542  NGEQMKIPVLGVIGAKEAEGGTISLRSRREGDLGSIELETVVAAAKEANQDR  593



>ref|WP_007097510.1| threonyl-tRNA synthetase [Synechococcus sp. RS9916]
 gb|EAU73402.1| threonyl-tRNA synthetase [Synechococcus sp. RS9916]
Length=609

 Score =   297 bits (761),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 176/233 (76%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLSTRPEKS+G+D +W+ AT  L +AL  K W Y++DEGGGAFYG
Sbjct  372  TERILSTFDFKNYEINLSTRPEKSIGDDAVWDLATKGLIEALERKGWDYKVDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + YV +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFKLDYVAADSSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD    +   +  +LKA+G+RA V  SGERL KLIR
Sbjct  492  IMTENYAGDFPFWLAPEQIRLLPVTDEVQSYAESLCDQLKAAGVRASVDRSGERLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              EK KIP++AV+G KE E  + ++RSR  G+LG +  D  I  A+ A +NR+
Sbjct  552  TGEKMKIPVLAVIGAKEAEQASASLRSRRDGDLGLVGADALIEAARQANQNRS  604



>gb|EJK61406.1| hypothetical protein THAOC_18112, partial [Thalassiosira oceanica]
Length=711

 Score =   299 bits (766),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 179/226 (79%), Gaps = 1/226 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            T+ IL +FGFD YE+ +STRPEKSVG+DDIWE A SAL+ +L++  W Y +DEGGGAFYG
Sbjct  465  TKSILSRFGFDKYELMISTRPEKSVGSDDIWEAAESALRGSLDELGWDYGLDEGGGAFYG  524

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI+DA+GR WQCST+Q DFNLPERFD+ YV ++  K+RPI++HRA+ GS+ERFFG
Sbjct  525  PKIDLKIKDAIGRTWQCSTVQCDFNLPERFDLEYVSAEGTKERPIMVHRAIFGSIERFFG  584

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSG-ERLPKLIR  365
            +L+E YAGD PLWL+P+Q RL+PVTD   ++C+ V ++ K  G+R EV  G ERLPK IR
Sbjct  585  ILVESYAGDLPLWLAPVQMRLLPVTDAVKDYCHDVARQAKKMGLRVEVDRGNERLPKQIR  644

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAK  227
            NAE+ ++P+M+VVG KE+E   + +RSR  G+LG+  +DD + E K
Sbjct  645  NAEQSRVPVMSVVGMKELEEGTLAVRSRKLGDLGSFTVDDLLSELK  690



>gb|AHF64013.1| threonyl-tRNA synthetase [Synechococcus sp. WH 8109]
Length=603

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 177/233 (76%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLSTRPEKS+G+D +W+ AT  L +AL+ K W Y+IDEGGGAFYG
Sbjct  364  TERILSSFDFSNYEINLSTRPEKSIGDDTVWDLATKGLIEALDRKGWAYKIDEGGGAFYG  423

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERFD+ YV +D  K+RPI+IHRA+ GSLERFFG
Sbjct  424  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFDLDYVAADGSKQRPIMIHRAIFGSLERFFG  483

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGD+P WL+P Q RL+PVTD    +  +V  +L  +G+RA +  SG+RL KLIR
Sbjct  484  IMTENYAGDYPFWLAPEQVRLLPVTDEVQPYAEQVLDQLTKAGVRATIDRSGDRLGKLIR  543

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E+ KIP++AV+G KE E +AV++RSR  G+LG   + D +R A+ A   R 
Sbjct  544  TGEQIKIPVLAVIGAKEAEQNAVSLRSRRDGDLGVTAVADLLRAAQLANSERV  596



>ref|WP_026101888.1| threonyl-tRNA synthetase [Geminocystis herdmanii]
Length=603

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 184/235 (78%), Gaps = 1/235 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YE+NLSTRPEKSVG+D++W+ AT AL  AL+ K W Y  D+GGGAFYG
Sbjct  367  TEKILSDFGFTDYEINLSTRPEKSVGSDEVWDLATEALIHALHKKQWNYIEDQGGGAFYG  426

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI+DA+GR WQCSTIQVDFNLPERFDM YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  427  PKIDLKIKDAIGRTWQCSTIQVDFNLPERFDMEYVAKDGSRQRPIMIHRAIFGSLERFFG  486

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q +L+PV +  L++  +V + LK +G R E+  SGERL K IR
Sbjct  487  ILIENYAGDFPLWLAPVQIKLLPVNNELLDYTQEVFQELKQAGYRVEIDKSGERLGKQIR  546

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
             AE +K+P++A++G +E+E   ++IR+R  G+LG++ + +   +  N+IE++T F
Sbjct  547  IAELEKVPILAILGNRELEEKTLSIRTRQLGDLGSITLSNLKVKLANSIEHKTIF  601



>ref|WP_011932685.1| threonine--tRNA ligase [Synechococcus sp. WH 7803]
 sp|A5GJT7.1|SYT_SYNPW RecName: Full=Threonine--tRNA ligase; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Synechococcus sp. WH 7803]
 emb|CAK23202.1| Threonyl-tRNA synthetase [Synechococcus sp. WH 7803]
Length=610

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 177/233 (76%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F+ YE+NLSTRPEKS+G+D +W+ AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  372  TERILSTFDFNTYEINLSTRPEKSIGDDAVWDLATKGLIEALERKGWAYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + Y+ +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFKLDYIAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGD+PLWL+P Q RL+PVTD    +   +  +L  +G+RA +  SG+RL KLIR
Sbjct  492  IMTENYAGDYPLWLAPEQVRLLPVTDEVQPYAESLLDQLTQAGVRATIDRSGDRLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E+ KIP++AV+G KE E +AV++RSR  G+LG + + D +R A+NA   R 
Sbjct  552  TGEQMKIPVLAVIGAKEAEQNAVSLRSRRDGDLGVVAVADLLRAAQNANSQRA  604



>ref|WP_006849637.1| threonyl-tRNA synthetase [Synechococcus sp. WH 8109]
Length=611

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 177/233 (76%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLSTRPEKS+G+D +W+ AT  L +AL+ K W Y+IDEGGGAFYG
Sbjct  372  TERILSSFDFSNYEINLSTRPEKSIGDDTVWDLATKGLIEALDRKGWAYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERFD+ YV +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFDLDYVAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGD+P WL+P Q RL+PVTD    +  +V  +L  +G+RA +  SG+RL KLIR
Sbjct  492  IMTENYAGDYPFWLAPEQVRLLPVTDEVQPYAEQVLDQLTKAGVRATIDRSGDRLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E+ KIP++AV+G KE E +AV++RSR  G+LG   + D +R A+ A   R 
Sbjct  552  TGEQIKIPVLAVIGAKEAEQNAVSLRSRRDGDLGVTAVADLLRAAQLANSERV  604



>ref|WP_011619783.1| threonine--tRNA ligase [Synechococcus sp. CC9311]
 sp|Q0I902.1|SYT_SYNS3 RecName: Full=Threonine--tRNA ligase; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Synechococcus sp. CC9311]
 gb|ABI46529.1| threonyl-tRNA synthetase [Synechococcus sp. CC9311]
Length=617

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 179/232 (77%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLST+P+K++G+D +WE AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  372  TERILSTFDFSNYEINLSTKPDKAIGDDAVWELATKGLIEALKRKGWAYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF++ Y+ +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFELDYIAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD  L +  + + +LKA+GIRA +  SG+RL KLIR
Sbjct  492  IMTENYAGDFPFWLAPEQIRLLPVTDEVLGYAEEFQNQLKAAGIRASIDRSGDRLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
              EK KIP++AV+G KE E  A ++RSR  G+LG +  +  I  A++A ++R
Sbjct  552  IGEKMKIPVLAVIGAKEAEQGAASLRSRRDGDLGVITKERLIATAQSANQDR  603



>ref|WP_008314086.1| threonyl-tRNA synthetase [Leptolyngbya sp. PCC 6406]
Length=623

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 175/232 (75%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  YEVNLSTRP+KSVG D IW+ AT AL+ AL  K W Y  DEGGGAFYG
Sbjct  389  TEQILSDFGFTEYEVNLSTRPDKSVGADAIWDLATDALRQALARKGWDYVTDEGGGAFYG  448

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR WQCSTIQVDFNLPERFD+ YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  449  PKIDIKIRDAIGRLWQCSTIQVDFNLPERFDLHYVAADGSRQRPIMIHRAIFGSLERFFG  508

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +L+E+YAGDFPLWL+P+Q RL+PV+D Q ++ N V + LK  G R EV  SG+RL K IR
Sbjct  509  ILVENYAGDFPLWLAPVQLRLLPVSDGQRDYANGVAQTLKQQGYRVEVDASGDRLGKQIR  568

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             AE  KIP++AVVG +EVE   +++R+R  G+LG + + +     + AI +R
Sbjct  569  TAELAKIPVVAVVGKREVEQQTLSVRTRHSGDLGALTVVEVQGRMEGAIADR  620



>ref|XP_003058299.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58250.1| predicted protein [Micromonas pusilla CCMP1545]
Length=698

 Score =   295 bits (756),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 177/229 (77%), Gaps = 2/229 (1%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  +EVNLST+PEKSVG  +IW+KA  ALK+AL  K W Y++DEGGGAFYG
Sbjct  464  TEDILSTFGFTEFEVNLSTKPEKSVGGPEIWDKAEGALKEALAVKGWDYEVDEGGGAFYG  523

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GRKWQCST+Q+DFNLPERF++TY+D +  K+RPI+IHRA+ GSLERF+G
Sbjct  524  PKIDIKILDAIGRKWQCSTVQLDFNLPERFELTYIDEENSKRRPIMIHRAIFGSLERFYG  583

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +L E+YAG FPLW++P Q RL+PVTD    +  +   R+KA+G+R +V S ERL KL+RN
Sbjct  584  ILTENYAGAFPLWIAPTQVRLLPVTDAVTPYVEETVARMKAAGVRVDVTSKERLAKLVRN  643

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIR--EAKNA  221
            AEKQK+P+M VVG +E +   + +R+   G++G + +D+ I   EA NA
Sbjct  644  AEKQKVPVMCVVGEQEAKDGTLAVRTYADGDVGVITVDEVIARLEAANA  692



>ref|WP_040655789.1| threonyl-tRNA synthetase [Rubidibacter lacunae]
Length=620

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 177/232 (76%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  YEVNLSTRP KSVG D IW+ AT AL +ALN K W Y IDEGGGAFYG
Sbjct  386  TEKILSDFGFSEYEVNLSTRPAKSVGTDGIWQLATDALVEALNTKGWDYAIDEGGGAFYG  445

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFD+ YV +D  ++RPI++HRA+ GSLERFFG
Sbjct  446  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDLNYVAADGTRQRPIMVHRAIFGSLERFFG  505

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +L+E+YAG FPLWL+P+Q RL+PV D    +     ++L+  G R EV  SGERL K IR
Sbjct  506  ILVENYAGTFPLWLAPVQIRLLPVGDAHRSYAEATARQLQEGGFRVEVDTSGERLGKQIR  565

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            +AE +KIP++AV+G +EVE+  +++R+R  GE+G + + +   + ++++ N+
Sbjct  566  SAELEKIPMVAVIGRREVENQTLSVRTRQAGEIGALTLSELQGKMQHSVINK  617



>ref|XP_002499524.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60782.1| predicted protein [Micromonas sp. RCC299]
Length=613

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 175/231 (76%), Gaps = 0/231 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  +EVNLST+PEKSVG  +IW+KA  ALKDAL  K W Y++DEGGGAFYG
Sbjct  379  TEDILSTFGFKEFEVNLSTQPEKSVGGPEIWDKAEGALKDALAQKGWDYEVDEGGGAFYG  438

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GRKWQCST+Q+DFNLPERFD+ Y+D +  K+RPI+IHRA+ GSLERFFG
Sbjct  439  PKIDIKILDAIGRKWQCSTVQLDFNLPERFDLAYIDKENVKQRPIMIHRAIFGSLERFFG  498

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +L E+YAG FPLW++P Q RL+PVTD   ++  +  ++L+A+GIR +V S ERL KL+RN
Sbjct  499  ILTENYAGAFPLWIAPTQVRLLPVTDAVDDYVQETARKLRAAGIRCDVQSQERLAKLVRN  558

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            AEK KIP+M VVG +E +   + +R+   G+ G + +DD +     A + +
Sbjct  559  AEKAKIPVMCVVGEQEAKDGTLAVRTYADGDQGVLSVDDVVARISAANQGK  609



>ref|WP_006853215.1| threonyl-tRNA synthetase [Synechococcus sp. WH 8016]
 gb|EHA64032.1| threonyl-tRNA synthetase [Synechococcus sp. WH 8016]
Length=617

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 179/232 (77%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLST+P+K++G+D +WE AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  372  TERILSTFDFSNYEINLSTKPDKAIGDDAVWELATKGLIEALERKGWDYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + Y+ +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFALDYIAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD  L +  +++ +LKA+GIRA +  SG+RL KLIR
Sbjct  492  IMTENYAGDFPFWLAPEQIRLLPVTDEVLGYAEELQTQLKAAGIRASIDRSGDRLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
              E+ KIP++AV+G KE E  A ++RSR  G+LG +  +  I  A++A ++R
Sbjct  552  TGEQMKIPVLAVIGAKEAEQGAASLRSRRDGDLGVITKERLISTAQSANQDR  603



>ref|WP_015155755.1| threonyl-tRNA synthetase [Chroococcidiopsis thermalis]
 gb|AFY89212.1| Ser-tRNA(Thr) hydrolase, threonyl-tRNA synthetase [Chroococcidiopsis 
thermalis PCC 7203]
Length=617

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 175/233 (75%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NY+VNLSTRP KSVG+D +W  AT+ALK ALN K W Y  D GGGAFYG
Sbjct  383  TEKILSDFGFKNYQVNLSTRPAKSVGSDRVWALATTALKQALNTKAWDYVEDVGGGAFYG  442

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM YV  +  ++RPI+IHRA+ GSLERFFG
Sbjct  443  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMQYVADNGTRQRPIMIHRAIFGSLERFFG  502

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLW+SP+Q RL+P+ +   E+   V   LK +G R EV  SG+RL KLIR
Sbjct  503  ILIENYAGDFPLWISPVQLRLLPINNEVREYVESVAATLKKAGFRVEVDRSGDRLGKLIR  562

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             AE +KIP++AVVG KE+E+  +++R+R  GELG + +       +  I+ +T
Sbjct  563  TAELEKIPVVAVVGKKEIETQTLSVRTRQQGELGQLTLPALQEHLQQPIQAKT  615



>gb|EAQ74155.1| Threonyl-tRNA synthetase, class IIa [Synechococcus sp. WH 5701]
Length=603

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 177/217 (82%), Gaps = 1/217 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F  YEVNLSTRPEKS+G+D +W+ AT+ L +AL+ K W Y+IDEGGGAFYG
Sbjct  359  TETILSSFDFHTYEVNLSTRPEKSIGDDAVWDLATTGLIEALDRKGWPYKIDEGGGAFYG  418

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR WQCSTIQ+DFNLPERFD+ YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  419  PKIDIKIEDAIGRMWQCSTIQLDFNLPERFDLHYVAADGSRQRPIMIHRAIFGSLERFFG  478

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +++E+YAGDFP WL+P Q RL+PVTD  + +  +V  +L+++G+RA +  SG+RL KLIR
Sbjct  479  IMVENYAGDFPFWLAPEQVRLLPVTDEVIPYAEEVLGQLRSAGVRAAIDRSGDRLGKLIR  538

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQ  254
            + E+QKIP++AV+G KE E  +V++RSR  G+LG+++
Sbjct  539  HGEQQKIPVLAVIGAKEAEQGSVSLRSRRDGDLGSVE  575



>ref|XP_001702766.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06545.1| predicted protein [Chlamydomonas reinhardtii]
Length=579

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 170/234 (73%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
             E IL  FGF++YEVNLSTRPEKSVG+D+IW  A +AL +ALN K W YQ+D GGGAFYG
Sbjct  346  VEEILGTFGFNDYEVNLSTRPEKSVGSDEIWTTAEAALVEALNAKGWKYQVDAGGGAFYG  405

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GRKWQCST+Q+DFNLPERFDM Y D    K+RPI+IHRA+ GSLERFFG
Sbjct  406  PKIDIKIRDAIGRKWQCSTVQLDFNLPERFDMHYFDDAAAKQRPIMIHRAIFGSLERFFG  465

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            +LIE+Y G FPLWL+P+Q RL+ V D   E+ + V  +++ +G+R EV     + KLIRN
Sbjct  466  ILIENYMGAFPLWLAPVQVRLLTVNDNLAEYAHGVAAQMRKAGVRVEVVGQASIAKLIRN  525

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            AEK K P++ VVG KE ES+++ +R   G ELG + + D I     A   +  F
Sbjct  526  AEKAKTPVICVVGNKEAESNSLAVRLYGGKELGALPVQDVISRVAVATATKGSF  579



>ref|WP_037980593.1| threonyl-tRNA synthetase [Synechococcus sp. WH 5701]
Length=594

 Score =   291 bits (746),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 177/217 (82%), Gaps = 1/217 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F  YEVNLSTRPEKS+G+D +W+ AT+ L +AL+ K W Y+IDEGGGAFYG
Sbjct  350  TETILSSFDFHTYEVNLSTRPEKSIGDDAVWDLATTGLIEALDRKGWPYKIDEGGGAFYG  409

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KIEDA+GR WQCSTIQ+DFNLPERFD+ YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  410  PKIDIKIEDAIGRMWQCSTIQLDFNLPERFDLHYVAADGSRQRPIMIHRAIFGSLERFFG  469

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +++E+YAGDFP WL+P Q RL+PVTD  + +  +V  +L+++G+RA +  SG+RL KLIR
Sbjct  470  IMVENYAGDFPFWLAPEQVRLLPVTDEVIPYAEEVLGQLRSAGVRAAIDRSGDRLGKLIR  529

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQ  254
            + E+QKIP++AV+G KE E  +V++RSR  G+LG+++
Sbjct  530  HGEQQKIPVLAVIGAKEAEQGSVSLRSRRDGDLGSVE  566



>ref|WP_029521169.1| threonyl-tRNA synthetase [Persephonella sp. IF05-L8]
Length=646

 Score =   292 bits (748),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 175/230 (76%), Gaps = 1/230 (0%)
 Frame = -3

Query  889  LQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKID  710
            L+ +GFD ++V LSTRPEKSVG+D +WE AT +L+ A+     TY+IDEGGGAFYGPKID
Sbjct  415  LRSYGFDEFQVFLSTRPEKSVGDDRMWEVATDSLRKAIESVGLTYEIDEGGGAFYGPKID  474

Query  709  LKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLIE  530
            +KI+DA+GR WQCST+Q DFNLPERFDM Y+  D ++ RP +IHRA+ GS+ERF GVL+E
Sbjct  475  VKIKDAIGRMWQCSTVQFDFNLPERFDMYYIGEDNQRHRPYMIHRAIFGSIERFIGVLLE  534

Query  529  HYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCS-GERLPKLIRNAEK  353
            HYAG  PLWLSP+Q R+IP+ D  + +  +VEK+LK +G+R EV    ER+ K IR+AE 
Sbjct  535  HYAGQLPLWLSPVQARIIPIADAHIPYAKEVEKQLKEAGLRVEVDERNERMNKKIRDAEL  594

Query  352  QKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTF  203
            QKIP M VVG KE ES  V +R++  G +GTM +D+FI++AK  IE ++ 
Sbjct  595  QKIPYMLVVGDKEAESKTVAVRTKKKGNIGTMPVDEFIQKAKKLIEEKSL  644



>ref|WP_028084909.1| threonyl-tRNA synthetase [Dolichospermum circinale]
Length=611

 Score =   291 bits (745),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  YEVNLSTRP K VG D +WE AT+AL+ ALN K W Y +D GGGAFYG
Sbjct  380  TERILSDFGFKQYEVNLSTRPHKFVGTDHVWELATTALEQALNTKGWNYTVDAGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM Y+ +D  ++RPI+IHRA+ GSLERFFG
Sbjct  440  PKIDIKIQDAIGRMWQCSTIQVDFNLPERFDMEYIANDGSRQRPIMIHRAIFGSLERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+PV+D   E+   V   LK +G R E+  SGERL K IR
Sbjct  500  ILIENYAGDFPLWLAPVQLRLLPVSDDFREYAKSVATNLKKNGFRVELDSSGERLGKQIR  559

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFI  239
             AE +KIP++ V+G +EV++  +++R+R  G+LG M  ++ +
Sbjct  560  VAELEKIPVVIVIGKQEVKNQTLSVRTRQNGDLGVMSFNEIV  601



>ref|WP_007102072.1| threonyl-tRNA synthetase [Synechococcus sp. RS9917]
 gb|EAQ69877.1| threonyl-tRNA synthetase [Synechococcus sp. RS9917]
Length=612

 Score =   291 bits (745),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 174/232 (75%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLSTRPEKS+G+D +W+ AT  L +AL  K W Y++D GGGAFYG
Sbjct  372  TETILSAFDFRNYEINLSTRPEKSIGDDAVWDLATQGLIEALERKGWAYKVDAGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + YV +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFALDYVAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD  L    ++  +L+A+GIRA V  SGERL KLIR
Sbjct  492  IMTENYAGDFPFWLAPEQIRLLPVTDEVLADAQQLSDQLRAAGIRATVDRSGERLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
              E+ KIPL+AV+G KE E  +V++RSR  G+LG++     I  A  A + R
Sbjct  552  TGEQMKIPLLAVIGAKEAEQGSVSLRSRRDGDLGSVNRKALIEAASQANQER  603



>ref|XP_002186178.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65648.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=684

 Score =   293 bits (750),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 178/226 (79%), Gaps = 1/226 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGFD Y+V LSTRPEKSVG+D+IW+ AT AL+ AL  K W Y +DEGGGAFYG
Sbjct  434  TETILSRFGFDKYDVMLSTRPEKSVGSDEIWDAATVALEGALKVKGWDYNVDEGGGAFYG  493

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI DA+GR+WQCST+Q DFNLPERF + Y  +D  ++RPI++HRA+ GS+ERFFG
Sbjct  494  PKIDLKIRDAIGRQWQCSTVQCDFNLPERFGLEYASADGTRERPIMVHRAIFGSIERFFG  553

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSG-ERLPKLIR  365
            +LIE+ +GDFPLWL+P Q +L+PVTD   E+CN++  +    G+R EV  G ERL K IR
Sbjct  554  ILIENCSGDFPLWLAPTQLKLLPVTDAVHEYCNEIAAKALKMGLRIEVDRGSERLAKQIR  613

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAK  227
            NAE+ +IP+MAVVG KE+ES+++ +RSR  G+LG+ +++D + E K
Sbjct  614  NAEQARIPVMAVVGMKEMESNSLAVRSRKLGDLGSFEVEDLLSELK  659



>ref|WP_035828988.1| threonyl-tRNA synthetase [Cyanobium sp. CACIAM 14]
 gb|KEF43291.1| threonyl-tRNA synthetase [Cyanobium sp. CACIAM 14]
Length=610

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 171/216 (79%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F +YE++LSTRPEKS+G D +WE AT+ L +AL  K W YQ+DEGGGAFYG
Sbjct  372  TERILSTFDFRSYEIHLSTRPEKSIGEDAVWELATAGLVEALERKGWAYQVDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERFD+ YV +D  + RPI+IHRA+ GSLERF+G
Sbjct  432  PKIDLKIEDAIGRLWQCSTIQLDFNLPERFDLHYVAADGSRARPIMIHRAIFGSLERFYG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            V++E+YAGDFP WL+P Q RL+PVTD  L +  ++  RL A+GIR ++  SGERL KLIR
Sbjct  492  VMVENYAGDFPFWLAPEQLRLLPVTDEALPWAEELRGRLAAAGIRVQIDHSGERLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTM  257
            N E+ KIP++ V+G +E E+  V++RSR  G+LG++
Sbjct  552  NGERMKIPVLGVIGAREAETRGVSLRSRRQGDLGSV  587



>ref|WP_006910773.1| threonyl-tRNA synthetase [Cyanobium sp. PCC 7001]
 gb|EDY38865.1| threonyl-tRNA synthetase [Cyanobium sp. PCC 7001]
Length=575

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 177/233 (76%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +F F +YE+NLSTRPEKS+G D +W+ AT  L +AL+ K W Y++DEGGGAFYG
Sbjct  332  TERILSRFDFRSYEINLSTRPEKSIGEDAVWQLATQGLIEALDRKGWAYKVDEGGGAFYG  391

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERFD+ YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  392  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFDLHYVAADGSRQRPIMIHRAIFGSLERFFG  451

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD    +  ++  +LK +G+RA V  SG+RL KLIR
Sbjct  452  IMTENYAGDFPFWLAPEQIRLLPVTDEVRPYAEELLGQLKGAGVRASVDHSGDRLGKLIR  511

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            N E+ KIP++ V+G KE E+ +V++RSR  G+LG +     +  A  A ++R 
Sbjct  512  NGEQMKIPVLGVIGAKEAETGSVSLRSRRDGDLGCVAASTLLEAALRANQDRA  564



>ref|WP_006040869.1| threonyl-tRNA synthetase [Synechococcus sp. WH 7805]
 gb|EAR17500.1| threonyl-tRNA synthetase [Synechococcus sp. WH 7805]
Length=611

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 175/233 (75%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F+ YE+NLSTRPEKS+G+D +W+ AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  372  TERILSTFDFNTYEINLSTRPEKSIGDDAVWDLATKGLIEALERKGWAYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + Y+ +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFKLDYIAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGD+P WL+P Q RL+PVTD    +  ++  +L   G+RA +  SG+RL KLIR
Sbjct  492  IMTENYAGDYPFWLAPEQVRLLPVTDEVQPYAERLLDQLTQVGVRATIDRSGDRLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E+ KIP++AV+G KE E +AV++RSR  G+LG + + D +R  +NA   R 
Sbjct  552  TGEQMKIPVLAVIGAKEAEQNAVSLRSRRDGDLGVVTMADLLRAVQNANAQRA  604



>ref|WP_011128342.1| threonine--tRNA ligase [Synechococcus sp. WH 8102]
 sp|Q7U662.1|SYT_SYNPX RecName: Full=Threonine--tRNA ligase; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Synechococcus sp. WH 8102]
 emb|CAE07993.1| threonyl-tRNA synthetase [Synechococcus sp. WH 8102]
Length=611

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 175/233 (75%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F+ YE+NLSTRPEKS+G+D +W+ AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  372  TERILSTFDFNTYEINLSTRPEKSIGDDAVWDLATKGLIEALERKGWKYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + YV +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFKLDYVAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGD+P WL+P Q RL+PVTD    +   +  +L  +G+RA +  SG+RL KLIR
Sbjct  492  IMTENYAGDYPFWLAPEQVRLLPVTDEVQPYAESLLDQLTQAGVRATIDRSGDRLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E+ KIP++AV+G KE E +AV++RSR  G+LG   + D +R A++A   R 
Sbjct  552  TGEQMKIPVLAVIGAKEAEQNAVSLRSRRDGDLGVAAVADLLRAAESANSQRA  604



>ref|WP_011359737.1| threonine--tRNA ligase [Synechococcus sp. CC9902]
 sp|Q3AYC6.1|SYT_SYNS9 RecName: Full=Threonine--tRNA ligase; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Synechococcus sp. CC9902]
 gb|ABB25901.1| threonyl-tRNA synthetase / Ser-tRNA(Thr) hydrolase [Synechococcus 
sp. CC9902]
Length=611

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 177/232 (76%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F++YE+NLSTRPEKS+G++ +WE AT  L +AL  K W ++IDEGGGAFYG
Sbjct  372  TERILSTFDFNHYEINLSTRPEKSIGSEAVWELATKGLTEALERKGWNFKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + YV +D  K++PI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFGLDYVAADGSKQQPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD    +  +V  +LK +GIRA +  SG+RL K+IR
Sbjct  492  IMTENYAGDFPFWLAPEQIRLLPVTDDVQPYAEQVLNQLKTAGIRATIDQSGDRLGKIIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
              E+ KIP++AV+G KE E +A+++RSR  G+LG   +D  ++ A+ A   R
Sbjct  552  TGEQMKIPVLAVIGAKEAEQNAISLRSRRDGDLGVTSVDALLKAAQRANAER  603



>ref|WP_011364016.1| threonine--tRNA ligase [Synechococcus sp. CC9605]
 sp|Q3AKU0.1|SYT_SYNSC RecName: Full=Threonine--tRNA ligase; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Synechococcus sp. CC9605]
 gb|ABB34792.1| threonyl-tRNA synthetase [Synechococcus sp. CC9605]
Length=611

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 174/233 (75%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLSTRPEKS+G D +W+ AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  372  TERILSAFDFSNYEINLSTRPEKSIGEDAVWDLATKGLIEALERKGWAYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF++ Y+ +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFELDYIAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGD+P WL+P Q RL+PVTD    +  ++  +L  +G+RA V  SG+RL KLIR
Sbjct  492  IMTENYAGDYPFWLAPEQVRLLPVTDEVQPYAEQLLDQLTKAGVRATVDRSGDRLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E+ KIP++AV+G KE E +AV++RSR  G+LG   + D +  A+ A   R 
Sbjct  552  TGEQMKIPVLAVIGAKEAEQNAVSLRSRRDGDLGVTAVSDLLSAAQMANSERA  604



>ref|WP_009790028.1| threonyl-tRNA synthetase [Synechococcus sp. BL107]
 gb|EAU71986.1| Threonyl-tRNA synthetase, class IIa [Synechococcus sp. BL107]
Length=615

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 176/232 (76%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F+NYE+NLSTRPEKS+G++ +W+ AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  372  TERILSTFDFNNYEINLSTRPEKSIGSEAVWDLATKGLTEALERKGWNYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + YV +D  K++PI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFGLDYVAADGSKQQPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD    +  ++  +LK +GIRA +  SG+RL K+IR
Sbjct  492  IMTENYAGDFPFWLAPEQIRLLPVTDDVQPYAEQLLDQLKTAGIRATIDQSGDRLGKIIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
              E+ KIP++AV+G KE E +AV++RSR  G+LG   +D  +  AK A   R
Sbjct  552  TGEQMKIPVLAVIGAKEAEQNAVSLRSRRDGDLGVTSVDALLNAAKWANTER  603



>ref|WP_006623096.1| MULTISPECIES: threonyl-tRNA synthetase [Arthrospira]
 gb|EDZ96504.1| threonyl-tRNA synthetase [Arthrospira maxima CS-328]
 emb|CCE17559.1| threonyl-tRNA synthetase [Arthrospira sp. PCC 8005]
 gb|EKD09073.1| threonyl-tRNA synthetase [Arthrospira platensis C1]
 emb|CDM98010.1| Threonine--tRNA ligase [Arthrospira sp. PCC 8005]
Length=622

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 176/233 (76%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  YEVNLSTRP KSVGND +W+ AT AL  ALN K W Y  DEGGGAFYG
Sbjct  387  TEKILSDFGFSKYEVNLSTRPSKSVGNDAVWQLATDALIAALNTKGWDYVTDEGGGAFYG  446

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERF+M YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  447  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFNMEYVAADGSRQRPIMIHRAIFGSLERFFG  506

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q R++ V+D   ++   + + L+   IRAEV  +GERL K IR
Sbjct  507  ILIENYAGDFPLWLAPVQVRVLAVSDRFRDYAQSIAQSLRQQNIRAEVDNTGERLGKQIR  566

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            N+E +KIP+  V+G +E+++ ++++R+R  G+LGTM +     E   AI  ++
Sbjct  567  NSELEKIPVTVVIGQRELDNQSLSVRTRSSGDLGTMTLPQLTEEILKAIAEKS  619



>ref|WP_029522023.1| threonyl-tRNA synthetase [Persephonella sp. KM09-Lau-8]
Length=646

 Score =   290 bits (741),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 175/230 (76%), Gaps = 1/230 (0%)
 Frame = -3

Query  889  LQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKID  710
            L+ +GFD ++V LSTRPEKSVG+D +WE AT +L+ A+     TY+IDEGGGAFYGPKID
Sbjct  415  LRSYGFDEFQVFLSTRPEKSVGDDRMWEVATDSLRKAIESVGLTYEIDEGGGAFYGPKID  474

Query  709  LKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLIE  530
            +KI+DA+GR WQCST+Q DFNLPERFDM Y+  D ++ RP +IHRA+ GS+ERF GVL+E
Sbjct  475  VKIKDAIGRMWQCSTVQFDFNLPERFDMYYIGEDNQRHRPYMIHRAIFGSIERFIGVLLE  534

Query  529  HYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCS-GERLPKLIRNAEK  353
            HYAG  PLWLSP+Q R+IP+ D  + +  +VE +LK +G+R EV    ER+ K IR+AE 
Sbjct  535  HYAGQLPLWLSPVQARIIPIADAHIPYAKEVENQLKEAGLRVEVDERNERMNKKIRDAEL  594

Query  352  QKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTF  203
            QKIP M VVG KE ES+ V +R++  G +GTM +++FI++AK  IE ++ 
Sbjct  595  QKIPYMLVVGDKEAESETVAVRTKKKGNIGTMPVEEFIQKAKKLIEEKSL  644



>ref|YP_002049494.1| Threonyl-tRNA synthetase, class IIa [Paulinella chromatophora]
 gb|ACB43284.1| Threonyl-tRNA synthetase, class IIa [Paulinella chromatophora]
Length=599

 Score =   288 bits (738),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 178/236 (75%), Gaps = 3/236 (1%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F  YE+NLSTRPEK +G DD+W+ AT+ L +ALN K W Y+IDEGGGAFYG
Sbjct  362  TERILSAFDFTKYEINLSTRPEKFIGGDDVWDLATNGLVEALNAKNWNYKIDEGGGAFYG  421

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI+DA+GR WQCSTIQ+DFNLPERF++ YV SD  ++RPI+IHRA+ GSLERFFG
Sbjct  422  PKIDLKIKDAIGRTWQCSTIQLDFNLPERFNIEYVGSDGSRQRPIMIHRAIFGSLERFFG  481

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            V+IE  AGDFP WL+P Q RL+PVTD  + +  ++  +LK +G+RA +  +G+RL KLIR
Sbjct  482  VMIESCAGDFPFWLAPEQIRLLPVTDEVITYAEELLSQLKIAGVRASIDRTGDRLGKLIR  541

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREA--KNAIENRTF  203
            N E++KIP++AVVG KE E    ++RSR+ GELG +   + ++ A   N  +N  F
Sbjct  542  NGEQKKIPILAVVGAKEAEVGGASLRSRYEGELGLVNAYNLVQTATLANCKQNSRF  597



>ref|WP_029552911.1| threonyl-tRNA synthetase [Synechococcus sp. CB0101]
Length=614

 Score =   289 bits (739),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 169/215 (79%), Gaps = 1/215 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F +YE+NLSTRPEKS+G D +WE AT  L +AL+ K W Y+IDEGGGAFYG
Sbjct  376  TEQILSTFDFRHYEINLSTRPEKSIGEDAVWELATQGLIEALDRKGWAYKIDEGGGAFYG  435

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERFD+ YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  436  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFDLEYVAADGSRQRPIMIHRAIFGSLERFFG  495

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD   ++   V   L+A+G+RA +  SG+RL KLIR
Sbjct  496  IMTENYAGDFPFWLAPEQIRLLPVTDEVRDYAAGVAAELQAAGVRASIDHSGDRLGKLIR  555

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGT  260
            N E+ KIP++ V+G KE ES  +++RSR  G+LG+
Sbjct  556  NGEQMKIPVLGVIGAKEAESGQISLRSRRDGDLGS  590



>gb|AFZ46649.1| Ser-tRNA(Thr) hydrolase [Cyanobacterium stanieri PCC 7202]
Length=615

 Score =   288 bits (738),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP KSVG+ +IW+ AT  L DAL +K W Y +D+GGGAFYG
Sbjct  387  TEQILSDFGFTDYEVNLSTRPAKSVGSSEIWDLATQGLIDALKEKRWDYVVDDGGGAFYG  446

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR WQCSTIQVDFNLPERFD+ YV SD  ++RPI+IHRA+ GSLERFFG
Sbjct  447  PKIDIKIRDAIGRLWQCSTIQVDFNLPERFDLHYVASDGTRQRPIMIHRAIFGSLERFFG  506

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVC-SGERLPKLIR  365
            +LIE+YAGDFP WL+PIQ RL+PVT+ Q  + + V ++L+  G R EV   G+RL K IR
Sbjct  507  ILIENYAGDFPFWLAPIQLRLLPVTEEQYPYADSVAQQLRNLGYRVEVSYKGDRLGKQIR  566

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDF  242
             AE +KIPL+AV+G KEVE   +++RSR  G++G + +D+ 
Sbjct  567  TAELEKIPLVAVIGNKEVEKQTLSLRSRKDGDMGELNLDEL  607



>ref|WP_038555703.1| threonyl-tRNA synthetase [Synechococcus sp. KORDI-52]
 gb|AII49828.1| threonyl-tRNA synthetase [Synechococcus sp. KORDI-52]
Length=611

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 175/233 (75%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F +YE+NLSTRPEKS+G+D +W+ AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  372  TERILSAFDFSSYEINLSTRPEKSIGDDAVWDLATKGLIEALERKGWAYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF++ Y+ +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFELDYIAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGD+P WL+P Q RL+PVTD    +   V  +L  +G+RA +  SG+RL KLIR
Sbjct  492  IMTENYAGDYPFWLAPEQVRLLPVTDEVQPYAEHVLDQLTKAGVRATIDRSGDRLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
              E+ KIP++AV+G KE E +AV++RSR  G++G   + + +  AK+A   R 
Sbjct  552  TGEQMKIPVLAVIGAKEAEQNAVSLRSRRDGDIGVTAVAELLNAAKSANSQRA  604



>ref|WP_041234532.1| threonyl-tRNA synthetase [Cyanobacterium stanieri]
Length=631

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP KSVG+ +IW+ AT  L DAL +K W Y +D+GGGAFYG
Sbjct  403  TEQILSDFGFTDYEVNLSTRPAKSVGSSEIWDLATQGLIDALKEKRWDYVVDDGGGAFYG  462

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR WQCSTIQVDFNLPERFD+ YV SD  ++RPI+IHRA+ GSLERFFG
Sbjct  463  PKIDIKIRDAIGRLWQCSTIQVDFNLPERFDLHYVASDGTRQRPIMIHRAIFGSLERFFG  522

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVC-SGERLPKLIR  365
            +LIE+YAGDFP WL+PIQ RL+PVT+ Q  + + V ++L+  G R EV   G+RL K IR
Sbjct  523  ILIENYAGDFPFWLAPIQLRLLPVTEEQYPYADSVAQQLRNLGYRVEVSYKGDRLGKQIR  582

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDF  242
             AE +KIPL+AV+G KEVE   +++RSR  G++G + +D+ 
Sbjct  583  TAELEKIPLVAVIGNKEVEKQTLSLRSRKDGDMGELNLDEL  623



>ref|WP_043737949.1| threonyl-tRNA synthetase [Synechococcus sp. RCC307]
Length=603

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 170/216 (79%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLSTRPEKS+G+D +W+ AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  363  TETILSTFDFRNYEINLSTRPEKSIGDDAVWDLATKGLTEALQRKGWDYKIDEGGGAFYG  422

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  423  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFGLEYVAADGSRQRPIMIHRAIFGSLERFFG  482

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD  + +   ++  L A+GIR+ +  SGERL KLIR
Sbjct  483  IMTENYAGDFPFWLAPEQIRLLPVTDEVMGYAETIQSELSAAGIRSRIDRSGERLGKLIR  542

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTM  257
            + E+QKIP++AV+G +E E   +++RSR  G+LG++
Sbjct  543  SGEQQKIPVLAVIGAQEAEQGTLSLRSRRQGDLGSV  578



>emb|CAK27848.1| Threonyl-tRNA synthetase [Synechococcus sp. RCC307]
Length=609

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 170/216 (79%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLSTRPEKS+G+D +W+ AT  L +AL  K W Y+IDEGGGAFYG
Sbjct  369  TETILSTFDFRNYEINLSTRPEKSIGDDAVWDLATKGLTEALQRKGWDYKIDEGGGAFYG  428

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  429  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFGLEYVAADGSRQRPIMIHRAIFGSLERFFG  488

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD  + +   ++  L A+GIR+ +  SGERL KLIR
Sbjct  489  IMTENYAGDFPFWLAPEQIRLLPVTDEVMGYAETIQSELSAAGIRSRIDRSGERLGKLIR  548

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTM  257
            + E+QKIP++AV+G +E E   +++RSR  G+LG++
Sbjct  549  SGEQQKIPVLAVIGAQEAEQGTLSLRSRRQGDLGSV  584



>ref|WP_043690612.1| threonyl-tRNA synthetase [Synechococcus sp. KORDI-49]
 gb|AII44967.1| threonyl-tRNA synthetase [Synechococcus sp. KORDI-49]
Length=611

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 176/232 (76%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F NYE+NLSTRPEKS+G+D +W+ AT+ L +AL  K W Y+IDEGGGAFYG
Sbjct  372  TERILSTFDFSNYEINLSTRPEKSIGDDAVWDLATNGLIEALERKGWAYKIDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF + Y+ +D  K+RPI+IHRA+ GSLERFFG
Sbjct  432  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFKLDYIAADGSKQRPIMIHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGD+P WL+P Q RL+PVTD    +  ++ ++L  +G+RA V  SG+RL KLIR
Sbjct  492  IMTENYAGDYPFWLAPEQVRLLPVTDEVQPYAEQLLEQLTQAGVRATVDRSGDRLGKLIR  551

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            + E+ KIP++AV+G KE E  AV++RSR  G+LG   + D +  A+ A   R
Sbjct  552  SGEQMKIPVLAVIGAKEAERSAVSLRSRRDGDLGEKPVADLLTAAQVANAQR  603



>ref|WP_010474073.1| threonyl-tRNA synthetase [Acaryochloris sp. CCMEE 5410]
Length=616

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 176/232 (76%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L  FGF +YEVNLSTRP+KSVG+DDIW+ AT AL+ AL  K W Y  DEGGGAFYG
Sbjct  382  TETVLSDFGFRDYEVNLSTRPDKSVGSDDIWDLATQALRTALERKGWDYLTDEGGGAFYG  441

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI DA+GR WQCSTIQVDFNLPERF M YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  442  PKIDLKIRDAIGRLWQCSTIQVDFNLPERFKMEYVAADGTRQRPIMIHRAIFGSLERFFG  501

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+ V+D Q  +  +V  +L+  G RAE+  +GERL K IR
Sbjct  502  ILIENYAGDFPLWLAPVQIRLLVVSDAQRPYALEVLAQLQQQGFRAEIDQTGERLGKQIR  561

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +  +KIP++AVVG KEVE+ A+ IR+R   E   +++ +   + + AI+ +
Sbjct  562  QSALEKIPVVAVVGQKEVEAQALNIRTRHSEEQELLKLPELCEKMQAAIDAK  613



>ref|XP_002288503.1| threonyl-trna synthetase [Thalassiosira pseudonana CCMP1335]
 gb|EED93939.1| threonyl-trna synthetase [Thalassiosira pseudonana CCMP1335]
Length=592

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 174/226 (77%), Gaps = 1/226 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            T+ IL +FGF+ YE+ +STRPEKSVG+D IW+ AT AL  AL++  W Y  DEGGGAFYG
Sbjct  342  TKDILSRFGFNKYELMVSTRPEKSVGSDQIWDDATKALVGALDELGWEYGTDEGGGAFYG  401

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI+DA+GR WQCST+Q DFNLPERFD+ YV ++ +K+RPI++HRA+ GS+ERFFG
Sbjct  402  PKIDLKIKDAIGRTWQCSTVQCDFNLPERFDLEYVSAEGKKERPIMVHRAIFGSIERFFG  461

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSG-ERLPKLIR  365
            +L+E+ AGD P WL+P Q +L+PVTD  +++C +V K+    G+R EV  G ERL K IR
Sbjct  462  ILVENTAGDLPFWLAPTQLKLLPVTDAVVDYCKEVAKKANKMGLRVEVDRGAERLAKQIR  521

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAK  227
            NAE+ +IP+MAVVG KE+E   + +RSR  G+LG+  +DD + E K
Sbjct  522  NAEQSRIPVMAVVGMKEMEEGTLALRSRKLGDLGSFAVDDLLSELK  567



>ref|XP_005719141.1| threonine--tRNA ligase, chloroplast or mitochondrial [Chondrus 
crispus]
 emb|CDF39230.1| threonine--tRNA ligase, chloroplast or mitochondrial [Chondrus 
crispus]
Length=674

 Score =   286 bits (731),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 182/238 (76%), Gaps = 1/238 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF  YE+ LSTRPEKSVG++DIWE+AT+AL++AL  K W Y ID+GGGAFYG
Sbjct  430  TESILGRFGFREYEIMLSTRPEKSVGSNDIWERATNALEEALKVKGWDYSIDDGGGAFYG  489

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQ DFNLP+RF++ YV  D  +++PI++HRA+ GS+ERFFG
Sbjct  490  PKIDVKIKDAIGRLWQCSTIQCDFNLPQRFELEYVAKDGSRQQPIMVHRAIFGSVERFFG  549

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +L+E +AG+FPLWL+P+Q +L+PVTD    +C KV    +  G+R EV  SGERL K++R
Sbjct  550  ILVESFAGEFPLWLAPVQLKLLPVTDESRAYCEKVATDARKMGLRVEVDTSGERLGKMVR  609

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF*SV  191
            N E++++PLM +VG  EVE+  +++RSR  G+LG +   + + + + A++    F +V
Sbjct  610  NTEQERVPLMGIVGAAEVENGTISVRSRKTGDLGGIDTKETLEKIEVAVKKSVDFEAV  667



>ref|WP_010998854.1| threonyl-tRNA synthetase [Nostoc sp. PCC 7120]
 dbj|BAB76422.1| threonyl-tRNA synthetase [Nostoc sp. PCC 7120]
Length=612

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 177/229 (77%), Gaps = 1/229 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF NYEVNLSTRP+KSVGN+++WE ATSAL+ AL+ K W Y +DEGGGAFYG
Sbjct  380  TEHILSDFGFKNYEVNLSTRPDKSVGNNEVWELATSALRQALDAKGWNYIVDEGGGAFYG  439

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+GR WQCSTIQVDFNLPERFDM Y+ +D  ++RPI+IHRA+ GSLERFFG
Sbjct  440  PKIDIKIQDAIGRLWQCSTIQVDFNLPERFDMEYIATDGSRQRPIMIHRAIFGSLERFFG  499

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+PV+D    +   V   L+  G R E+  SGERL K IR
Sbjct  500  ILIENYAGDFPLWLAPVQIRLLPVSDDVRGYTESVAIALQKDGFRVEIDISGERLGKQIR  559

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAI  218
             AE +KIP++ VVG KEVE+  +++R+R  G+LG + ++D     +  I
Sbjct  560  TAELEKIPVVGVVGKKEVENQNLSVRTRANGDLGAINLNDLTNHLRETI  608



>ref|XP_009042795.1| hypothetical protein AURANDRAFT_59726 [Aureococcus anophagefferens]
 gb|EGB02506.1| hypothetical protein AURANDRAFT_59726 [Aureococcus anophagefferens]
Length=452

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 171/227 (75%), Gaps = 1/227 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGFD+YE+ LSTRP+K+VG+D+IW KAT+ALK AL+ K W + +DEGGGAFYG
Sbjct  193  TEEILSKFGFDDYELMLSTRPDKAVGSDEIWTKATAALKGALDRKGWDHGVDEGGGAFYG  252

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI+DALGR+WQCST+Q DFNLPERF++ Y  +  + +RPI++HRA+ GSLERFF 
Sbjct  253  PKIDLKIKDALGRQWQCSTVQCDFNLPERFELEYRAASGQAERPIMVHRAIFGSLERFFA  312

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSG-ERLPKLIR  365
            +L+E   GD PLWL+P Q RL+PVTD   +F   V  +    GIR E+ SG +RL K IR
Sbjct  313  ILLESCGGDLPLWLAPTQMRLLPVTDDARDFSKAVAAKAAQRGIRCEIDSGKDRLNKQIR  372

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKN  224
            NAE Q++P+M VVG KE+ S  + +R+R  G+LGT+ +D    E K+
Sbjct  373  NAETQRVPIMCVVGEKEMASGDLAVRARTMGDLGTIDVDALFDELKD  419



>ref|WP_015108040.1| threonyl-tRNA synthetase [Cyanobium gracile]
 gb|AFY27584.1| threonyl-tRNA synthetase [Cyanobium gracile PCC 6307]
Length=615

 Score =   282 bits (721),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 169/216 (78%), Gaps = 1/216 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F +YE++LSTRPEKS+G D +W+ AT+ L +AL  K W Y++DEGGGAFYG
Sbjct  377  TERILSTFDFRSYEIHLSTRPEKSIGEDAVWDLATAGLVEALERKGWAYKVDEGGGAFYG  436

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERFD+ YV +D  + RPI+IHRA+ GSLERFFG
Sbjct  437  PKIDLKIEDAIGRLWQCSTIQLDFNLPERFDLHYVAADGSRCRPIMIHRAIFGSLERFFG  496

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            V++E+YAGDFP WL+P Q RL+PVTD  L +  ++   L A+GIR  +  SG+RL KLIR
Sbjct  497  VMVENYAGDFPFWLAPEQVRLLPVTDDALPWAEELRGLLAAAGIRVGIDHSGDRLGKLIR  556

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTM  257
            N E+ KIP++ V+G +E E+  V++RSR  G+LG++
Sbjct  557  NGEQMKIPVLGVIGAREAETRTVSLRSRRQGDLGSV  592



>ref|WP_012676310.1| threonyl-tRNA synthetase [Persephonella marina]
 gb|ACO04072.1| threonyl-tRNA synthetase [Persephonella marina EX-H1]
Length=646

 Score =   282 bits (721),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 173/229 (76%), Gaps = 1/229 (0%)
 Frame = -3

Query  889  LQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKID  710
            L+ +GF+ +++ LSTRPEKSVG+D +WE AT +L+ A+      YQIDEGGGAFYGPKID
Sbjct  415  LRTYGFNEFQIFLSTRPEKSVGDDRMWEVATESLRKAIESVGLDYQIDEGGGAFYGPKID  474

Query  709  LKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLIE  530
            +KI+DA+GR WQCSTIQ DFNLPERFDM Y+  D ++ RP +IHRA+ GS+ERF GVLIE
Sbjct  475  VKIKDAIGRMWQCSTIQFDFNLPERFDMYYIGEDNKRHRPYMIHRAIFGSIERFIGVLIE  534

Query  529  HYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCS-GERLPKLIRNAEK  353
            HYAG  PLWLSP+Q ++IPV DT + +  +VEK+LK +G+R EV    ER+ + IR+AE 
Sbjct  535  HYAGLLPLWLSPVQAKIIPVADTHIPYAKEVEKKLKEAGLRVEVDERSERMNRKIRDAEL  594

Query  352  QKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            QKIP M +VG KE ++ +V++R++  G +G   +D FI+ AK  IE R+
Sbjct  595  QKIPYMLIVGDKEQQTGSVSVRTKKKGNVGLFTVDQFIQNAKKLIEERS  643



>ref|WP_012163482.1| threonyl-tRNA synthetase [Acaryochloris marina]
 gb|ABW28051.1| threonyl-tRNA synthetase [Acaryochloris marina MBIC11017]
Length=616

 Score =   281 bits (719),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 177/232 (76%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE +L  FGF +YEVNLSTRP+KSVG+D+IW+ AT  L+ AL+ K W Y  DEGGGAFYG
Sbjct  382  TETVLSDFGFRDYEVNLSTRPDKSVGSDEIWDLATQDLRTALDRKGWEYLTDEGGGAFYG  441

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI DA+GR WQCSTIQVDFNLPERF M YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  442  PKIDLKIRDAIGRLWQCSTIQVDFNLPERFKMEYVAADGTRQRPIMIHRAIFGSLERFFG  501

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+ V+D Q  +  +V ++L+  G RAE+  +GERL K IR
Sbjct  502  ILIENYAGDFPLWLAPVQIRLLVVSDAQRPYALEVLEQLQQKGFRAEIDQTGERLGKQIR  561

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +  +KIP++AVVG KEVE+  + IR+R   E   +++ +   + ++AI+ +
Sbjct  562  QSALEKIPVVAVVGQKEVEAQTLNIRTRHSEEQELLKLPELCEKMQSAIDAK  613



>ref|WP_028952368.1| threonyl-tRNA synthetase [Synechococcus sp. CC9616]
Length=609

 Score =   281 bits (718),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 172/232 (74%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F  YE+NLSTRPEKS+G+D +W+ AT  L +AL  K W+Y+IDEGGGAFYG
Sbjct  369  TERILSAFDFSTYEINLSTRPEKSIGDDAVWDLATRGLVEALERKGWSYKIDEGGGAFYG  428

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DFNLPERF++ YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  429  PKIDLKIEDAIGRMWQCSTIQLDFNLPERFELEYVAADGSRQRPIMIHRAIFGSLERFFG  488

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD    +  ++ K+LK  G+RA +  SGERL KLIR
Sbjct  489  IMTENYAGDFPFWLAPEQIRLLPVTDEVQPYAEQLLKQLKDVGVRATIDRSGERLGKLIR  548

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
              E+ KIP++ V+G KE E  +V++RSR  G+LG +     +  +  +   R
Sbjct  549  IGEQMKIPVLGVIGAKESEQQSVSLRSRRDGDLGMIAASQLVEASGRSGRER  600



>ref|WP_006619748.1| threonyl-tRNA synthetase [Arthrospira platensis]
 dbj|BAI88601.1| threonyl-tRNA synthetase [Arthrospira platensis NIES-39]
 gb|KDR55428.1| threonyl-tRNA synthetase [Arthrospira platensis str. Paraca]
Length=622

 Score =   278 bits (712),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 170/228 (75%), Gaps = 1/228 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF  YEVNLSTRP KSVGND +W+ AT AL  ALN K W Y +DEGGGAFYG
Sbjct  387  TEKILSDFGFSKYEVNLSTRPSKSVGNDGVWQLATDALISALNIKGWDYVVDEGGGAFYG  446

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+DA+ R WQCSTIQVDFNLPERF+M YV +D  ++RPI+IHRA+ GSLERFFG
Sbjct  447  PKIDIKIQDAIARLWQCSTIQVDFNLPERFNMEYVAADGSRQRPIMIHRAIFGSLERFFG  506

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+  R++ V+D   ++   + + LK   IRAEV  +GERL K IR
Sbjct  507  ILIENYAGDFPLWLAPVMVRVLVVSDRFRDYAKSIVQSLKQQNIRAEVDNTGERLGKQIR  566

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNA  221
              E +KIP+  V+G +E+++ ++++R+R  G++GTM +     E   A
Sbjct  567  ACELEKIPVTVVIGQRELDNQSLSVRTRSRGDIGTMTLPQLTEEILKA  614



>gb|ERT06814.1| threonine--tRNA ligase [Lyngbya aestuarii BL J]
Length=591

 Score =   278 bits (710),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP KSVG D  W+ AT AL  ALN K W +  D GGGAFYG
Sbjct  357  TEKILSDFGFTSYEVNLSTRPPKSVGTDAGWQLATEALIKALNTKNWEFVEDVGGGAFYG  416

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR WQCSTIQVDFNLPERF++ Y+  D  +++PI+IHRA+ GSLERFFG
Sbjct  417  PKIDIKIRDAIGRLWQCSTIQVDFNLPERFNLEYIAPDGSRQQPIMIHRAIFGSLERFFG  476

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+PV+D Q +    +   LK +G R E+  SG+RL K IR
Sbjct  477  ILIENYAGDFPLWLAPVQLRLLPVSDQQRDSTEVIAHSLKKAGFRVEIDRSGDRLGKQIR  536

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             AE  KIP++AVVG +EVE   +++RSR  GE+G++ + +  +  + AI  +
Sbjct  537  QAELDKIPVVAVVGKREVEQQTLSVRSRKAGEMGSLTLPELQQHLQTAIAQK  588



>ref|WP_025281350.1| threonyl-tRNA synthetase [Ectothiorhodospira haloalkaliphila]
 gb|AHK78933.1| threonyl-tRNA synthetase [Halorhodospira halochloris str. A]
Length=643

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 179/232 (77%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            T  +L+ FGFD++++NLSTRP+K+VG+D IWE AT+AL+ AL  K   Y++DEGGGAFYG
Sbjct  405  TLDVLRAFGFDDFDINLSTRPDKAVGSDHIWEHATAALRAALEKKGLEYELDEGGGAFYG  464

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR+WQCST+Q+DFNLPERFD+ YV  D +++RPI++HRA+LGS+ERFFG
Sbjct  465  PKIDIKIRDAIGRQWQCSTVQLDFNLPERFDLEYVADDNQRRRPIMVHRALLGSVERFFG  524

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            VLIEHYAG FPLWL+P+Q +++ +TD Q ++  +V + L+A G+RAE+    E++   IR
Sbjct  525  VLIEHYAGSFPLWLAPVQAQVLTITDRQDDYAREVVQTLRAQGLRAEMDLRNEKIGFKIR  584

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
                Q++P + V+G +E+E+ +V +RSR G +LGTM +D  I+     + +R
Sbjct  585  EHTLQRVPYLLVLGDREMETRSVAVRSRTGQDLGTMDLDVLIQRLSREVADR  636



>ref|WP_040484114.1| threonyl-tRNA synthetase [Lyngbya aestuarii]
Length=618

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  FGF +YEVNLSTRP KSVG D  W+ AT AL  ALN K W +  D GGGAFYG
Sbjct  384  TEKILSDFGFTSYEVNLSTRPPKSVGTDAGWQLATEALIKALNTKNWEFVEDVGGGAFYG  443

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR WQCSTIQVDFNLPERF++ Y+  D  +++PI+IHRA+ GSLERFFG
Sbjct  444  PKIDIKIRDAIGRLWQCSTIQVDFNLPERFNLEYIAPDGSRQQPIMIHRAIFGSLERFFG  503

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+YAGDFPLWL+P+Q RL+PV+D Q +    +   LK +G R E+  SG+RL K IR
Sbjct  504  ILIENYAGDFPLWLAPVQLRLLPVSDQQRDSTEVIAHSLKKAGFRVEIDRSGDRLGKQIR  563

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             AE  KIP++AVVG +EVE   +++RSR  GE+G++ + +  +  + AI  +
Sbjct  564  QAELDKIPVVAVVGKREVEQQTLSVRSRKAGEMGSLTLPELQQHLQTAIAQK  615



>ref|XP_005757888.1| threonine-tRNA ligase [Emiliania huxleyi CCMP1516]
 gb|EOD05459.1| threonine-tRNA ligase [Emiliania huxleyi CCMP1516]
Length=508

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 171/231 (74%), Gaps = 1/231 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF  YEV LSTRP+K+VG+D+IW+KATSAL++AL  K W Y +DEGGGAFYG
Sbjct  270  TETILTKFGFTEYEVMLSTRPDKAVGSDEIWDKATSALREALGAKGWEYDVDEGGGAFYG  329

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR WQCSTIQ DFNLP+RF + YV  D  +++PI++HRA+ GSLERFFG
Sbjct  330  PKIDIKIRDAIGRLWQCSTIQCDFNLPQRFGLEYVSPDGGREQPIMLHRAIFGSLERFFG  389

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGER-LPKLIR  365
            VLIE  AGDFP WL+P Q RL+PV+D    +C+    RLKA+GIRAEV  G R + K I+
Sbjct  390  VLIESTAGDFPFWLAPTQLRLLPVSDDYRPYCDAAVARLKAAGIRAEVDPGGRSVGKQIK  449

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIEN  212
             A + K+P+++VVG  EV ++A+ +  R GGELG + ++  I     A E 
Sbjct  450  VANQDKVPILSVVGEAEVGANALKLEMRKGGELGELPLERAIEVLAAAAEK  500



>ref|XP_009041685.1| hypothetical protein AURANDRAFT_55515 [Aureococcus anophagefferens]
 gb|EGB03610.1| hypothetical protein AURANDRAFT_55515 [Aureococcus anophagefferens]
Length=657

 Score =   278 bits (711),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 171/227 (75%), Gaps = 1/227 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGFD+YE+ LSTRP+K+VG+D+IW KAT+ALK AL+ K W + +DEGGGAFYG
Sbjct  398  TEEILSKFGFDDYELMLSTRPDKAVGSDEIWTKATAALKGALDRKGWDHGVDEGGGAFYG  457

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKI+DALGR+WQCST+Q DFNLPERF++ Y  +  + +RPI++HRA+ GSLERFF 
Sbjct  458  PKIDLKIKDALGRQWQCSTVQCDFNLPERFELEYRAASGQAERPIMVHRAIFGSLERFFA  517

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSG-ERLPKLIR  365
            +L+E   GD PLWL+P Q RL+PVTD   +F   V  +    GIR E+ SG +RL K IR
Sbjct  518  ILLESCGGDLPLWLAPTQMRLLPVTDDARDFSKAVAAKAAQRGIRCEIDSGKDRLNKQIR  577

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKN  224
            NAE Q++P+M VVG KE+ S  + +R+R  G+LGT+ +D    E K+
Sbjct  578  NAETQRVPIMCVVGEKEMASGDLAVRARTMGDLGTIDVDALFDELKD  624



>ref|WP_038545398.1| threonyl-tRNA synthetase [Synechococcus sp. KORDI-100]
 gb|AII43871.1| threonyl-tRNA synthetase [Synechococcus sp. KORDI-100]
Length=609

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 168/232 (72%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL  F F  YE+NLSTRPEKS+G D +W+ AT  L +AL  K W+Y+IDEGGGAFYG
Sbjct  369  TERILSTFDFSTYEINLSTRPEKSIGEDAVWDLATKGLVEALERKGWSYKIDEGGGAFYG  428

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKIDLKIEDA+GR WQCSTIQ+DF LPERFD+ YV  D  ++RPI+IHRA+ GSLERFFG
Sbjct  429  PKIDLKIEDAIGRMWQCSTIQLDFTLPERFDLEYVAVDGSRQRPIMIHRAIFGSLERFFG  488

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            ++ E+YAGDFP WL+P Q RL+PVTD    +  ++ ++L   G+RA +  SGERL KLIR
Sbjct  489  IMTENYAGDFPFWLAPEQIRLLPVTDEVQPYAERLLQQLTDVGVRATIDRSGERLGKLIR  548

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
              E+ KIP++ V+G KE E  +V++RSR  G+LG +     +  +  A   R
Sbjct  549  IGEQMKIPVLGVIGAKESEQQSVSLRSRRDGDLGMVTASRLVEASGRAGRER  600



>ref|XP_005537510.1| threonine--tRNA ligase, chloroplast or mitochondrial [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM81474.1| threonine--tRNA ligase, chloroplast or mitochondrial [Cyanidioschyzon 
merolae strain 10D]
Length=677

 Score =   277 bits (709),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF +Y+V+LSTRP+ S+G+++ W ++  AL+ AL DK W++ +DEG GAFYG
Sbjct  445  TETILSRFGFRDYQVHLSTRPKVSIGSEEAWSRSEQALRLALEDKGWSFTVDEGEGAFYG  504

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
             KIDLK+ DALGR WQCSTIQ DFNLPERF++ YV SD  ++RP+++HRA+ GSLERFFG
Sbjct  505  AKIDLKVRDALGRLWQCSTIQCDFNLPERFNLEYVASDGSRERPVMVHRAIFGSLERFFG  564

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            +LIE+ AGDFPLWL+PIQ RL+PV+D  L FC +V  + +   +RAE+  S  RL K + 
Sbjct  565  ILIENSAGDFPLWLAPIQLRLLPVSDKFLPFCEQVVDKARRRRLRAEIDLSANRLGKKVL  624

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFI  239
            NAE++ IP MA+VG +EVESDA+++RSR  G+LG++ +D+ +
Sbjct  625  NAEEEHIPYMAIVGKREVESDALSMRSRHKGDLGSVPVDEIL  666



>ref|WP_018954382.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ALJ17]
Length=643

 Score =   276 bits (707),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 172/229 (75%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGFD++EVNLSTRP+K+VG+D IWE AT+ALK AL  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQAFGFDDFEVNLSTRPDKAVGSDQIWEHATAALKAALEKKGLAYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERF+M YV  D  ++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIRDAIGREWQCSTVQLDFNLPERFEMEYVAEDNSRRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FPLWL+P+Q +++ +TD Q ++  +V  RL+  GIRA+     E++   IR   
Sbjct  528  EHYAGSFPLWLAPVQVQVLTITDRQDDYAREVADRLRNRGIRADADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             Q++P + V+G +E+E++ V +R+R G +LG+M ++         I +R
Sbjct  588  LQRVPYLLVLGDREMETNTVAVRTRSGEDLGSMDLNQLSERLAGEIASR  636



>ref|WP_023406579.1| threonyl-tRNA synthetase, partial [uncultured Desulfofustis sp. 
PB-SRB1]
 gb|ESQ11956.1| hypothetical protein N839_17235, partial [uncultured Desulfofustis 
sp. PB-SRB1]
Length=632

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 163/219 (74%), Gaps = 1/219 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            IL  FGF  Y++ LSTRPEKSVG+DDIWEK+T+ALK AL  K   Y+ID G G FYGPKI
Sbjct  401  ILATFGFSEYDIYLSTRPEKSVGSDDIWEKSTAALKQALEKKGLGYEIDPGEGVFYGPKI  460

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+D LGR WQCSTIQVDFNLP+RFDMTY  +D  + RPI+IHRA++GSLERF G+LI
Sbjct  461  DIKIKDQLGRSWQCSTIQVDFNLPQRFDMTYTGTDNSEHRPIMIHRALMGSLERFVGILI  520

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FPLW SP+Q R++ +TD QLE+C K+  +L+ +GIR E     E+L   IR A+
Sbjct  521  EHYAGAFPLWFSPVQARILNITDDQLEYCEKIYNQLRKAGIRVEKDLRNEKLNYKIREAQ  580

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFI  239
              KIP M +VG KE E+  +T+R R G  L  M+I +F+
Sbjct  581  MMKIPFMLIVGEKEKENGTLTVRLRDGKNLPPMKIVEFV  619



>ref|WP_008931337.1| threonyl-tRNA synthetase [Ectothiorhodospira sp. PHS-1]
 gb|EHQ51770.1| threonyl-tRNA synthetase [Ectothiorhodospira sp. PHS-1]
Length=643

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 170/223 (76%), Gaps = 1/223 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            T  +LQ FGF+N+++NLSTRP+K+VG+D IWE AT+AL+ AL  K   Y++DEGGGAFYG
Sbjct  405  TLAVLQAFGFENFDINLSTRPDKAVGSDHIWEHATAALRAALEKKGLAYEVDEGGGAFYG  464

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D  +KRPI+IHRA+LGS+ERFFG
Sbjct  465  PKIDIKIRDAIGRQWQCSTVQLDFNLPERFDMEYVADDNTRKRPIMIHRALLGSVERFFG  524

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            VLIEHYAG FPLWL+P+Q +++ +TD Q ++  +V   L+  G RAE     E++   IR
Sbjct  525  VLIEHYAGHFPLWLAPVQVQVLTITDRQNDYARQVADLLREQGFRAEADLRNEKIGFKIR  584

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIR  236
                Q++P + V+G +E ++  V +R+R G +LG+M+ID  I+
Sbjct  585  EHTLQRVPYLLVLGDREKDTGTVAVRTRDGRDLGSMEIDSLIQ  627



>gb|EKD50172.1| hypothetical protein ACD_62C00622G0001 [uncultured bacterium]
Length=352

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRP-EKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPK  716
            +L+ FGF NYE+ L+TRP EK VG   +W+ A +AL+ AL  +  +YQ+DEGGGAFYGPK
Sbjct  116  MLRSFGFVNYELYLATRPQEKYVGEIQLWDDAQNALRRALEAEGVSYQVDEGGGAFYGPK  175

Query  715  IDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVL  536
            ID+KIEDA+GR+WQCSTIQ DFNLPERFDMTY+ SD  K RP +IHRA+LGSLERFFG+L
Sbjct  176  IDIKIEDAIGRQWQCSTIQFDFNLPERFDMTYIGSDGAKHRPYMIHRALLGSLERFFGIL  235

Query  535  IEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVC-SGERLPKLIRNA  359
            IEHYAG FPLWL+P+Q  +I VT  QL +  ++ ++L  +G R  +    E+L   IR A
Sbjct  236  IEHYAGHFPLWLAPVQAVVINVTTDQLAYAREISEKLNQAGFRVALSDHNEKLGYKIREA  295

Query  358  EKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKN  224
            + QK+P M VVG  EVE+  + IR   GG+LG+   +DF++  ++
Sbjct  296  QLQKVPYMIVVGKNEVEAGTLAIRQSQGGDLGSFTFEDFVKRLQD  340



>ref|WP_012638018.1| threonine--tRNA ligase [Thioalkalivibrio sulfidiphilus]
 sp|B8GRI1.1|SYT_THISH RecName: Full=Threonine--tRNA ligase; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Thioalkalivibrio sulfidiphilus 
HL-EbGr7]
 gb|ACL72535.1| threonyl-tRNA synthetase [Thioalkalivibrio sulfidiphilus HL-EbGr7]
Length=643

 Score =   274 bits (701),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 172/229 (75%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGFD+++VNLSTRP+K+VG+D IWE AT+ALK AL  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQAFGFDDFDVNLSTRPDKAVGSDQIWEHATAALKAALEKKGLDYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERF+M YV  D  ++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIRDAIGREWQCSTVQLDFNLPERFEMEYVAEDNSRRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FPLWL+P+Q +++ +TD Q ++  +V  RL+  GIRA+     E++   IR   
Sbjct  528  EHYAGSFPLWLAPVQVQVLTITDRQDDYAREVADRLRNRGIRADADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             Q++P + V+G +E+E++ V +R+R G +LG+M ++         I +R
Sbjct  588  LQRVPYLLVLGDREMETNTVAVRTRSGEDLGSMDLNQLSERLAGEIASR  636



>ref|WP_029155853.1| threonyl-tRNA synthetase, partial [Cloacimonetes bacterium SCGC 
AAA252-I16]
Length=459

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 170/230 (74%), Gaps = 1/230 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
             L+ FGFD Y++ LST+P+K VG D  WE+AT +LK+AL      Y++D G G FYGPKI
Sbjct  225  FLKSFGFDRYDIFLSTKPDKCVGEDIDWERATESLKEALEISGLEYKVDLGEGVFYGPKI  284

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+DAL R WQC+TIQ DFNLPERFDMTY+  D E  RP +IHRA+LGSLERFFGVLI
Sbjct  285  DIKIKDALDRSWQCTTIQFDFNLPERFDMTYIGDDNEAHRPYMIHRALLGSLERFFGVLI  344

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG+FP+WL+P+Q ++IP+++ Q+++   + + L+ + IRA++    E++   IR AE
Sbjct  345  EHYAGNFPVWLAPVQLQVIPISEHQIDYAKLILQALRDANIRADIDVQNEKVGYKIREAE  404

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            KQKIP M V+G KEVE++ +++R    G++GT  + DFI+     I+N+T
Sbjct  405  KQKIPYMIVIGNKEVENNNISVRKHLKGDIGTTDLKDFIKLITQEIQNKT  454



>ref|WP_012674511.1| threonyl-tRNA synthetase [Sulfurihydrogenibium azorense]
 gb|ACN99193.1| threonyl-tRNA synthetase [Sulfurihydrogenibium azorense Az-Fu1]
Length=641

 Score =   274 bits (700),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 171/228 (75%), Gaps = 1/228 (0%)
 Frame = -3

Query  889  LQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKID  710
            L+ +GFD +E+ LSTRPEKSVG+D +WE AT +L+ A+      Y+IDEGGGAFYGPKID
Sbjct  413  LKSYGFDEFEIYLSTRPEKSVGDDRMWEVATQSLRKAIESTGIDYKIDEGGGAFYGPKID  472

Query  709  LKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLIE  530
            +KI+DA+GR WQCSTIQ DFNLP+RFDM Y+  D ++ RP +IHRA+ GS+ERF GVL+E
Sbjct  473  VKIKDAIGRMWQCSTIQFDFNLPQRFDMYYIGEDNQRHRPYMIHRAIFGSIERFIGVLLE  532

Query  529  HYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCS-GERLPKLIRNAEK  353
            HYAG  P+WLSP+Q ++IP+ D  L+F NKV+  L  + +R EV    ER+ K IR+AE 
Sbjct  533  HYAGFLPVWLSPVQVKIIPIADKHLDFANKVKDILLQNKVRVEVDDRSERMNKKIRDAEL  592

Query  352  QKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            QKIP M V+G KEVE+++V +R +  G+  +M +D+F+++  + I+ +
Sbjct  593  QKIPFMLVIGDKEVENNSVAVREKASGKTESMTVDNFVKKITSLIKEK  640



>gb|KDD75770.1| class II core domain (G, H, P, S and T) tRNA synthetase [Helicosporidium 
sp. ATCC 50920]
Length=561

 Score =   272 bits (695),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 160/234 (68%), Gaps = 0/234 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
             E + + FGF  +EV LSTRP+ SVG+D +WE A  ALKDAL  K W Y  D GGGAFYG
Sbjct  328  VESVFEAFGFRQFEVCLSTRPQGSVGSDAVWEHAEGALKDALGRKGWAYAEDSGGGAFYG  387

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID++I DALGR WQCST+Q+DFNLPERF + Y  SD  + RPI+IHRA+ GSLERFFG
Sbjct  388  PKIDVRIRDALGRSWQCSTVQLDFNLPERFGLEYAGSDGRQHRPIMIHRALFGSLERFFG  447

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGERLPKLIRN  362
            VL+EHYAG FPLWL+P    L+PV      +  +V  ++KASG+R +V  G    KLI N
Sbjct  448  VLVEHYAGRFPLWLAPTHLALVPVDAQAEAYAREVAAQMKASGVRVQVMGGASTSKLILN  507

Query  361  AEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTFF  200
            A K+++PLMAVVGP+E  +  +++R   G +LG +   + +     AI+ R  F
Sbjct  508  ATKERVPLMAVVGPREAAAGTLSMRGGQGAQLGELPSGEVLDRIVEAIKTRGEF  561



>ref|XP_005757887.1| threonine-tRNA ligase [Emiliania huxleyi CCMP1516]
 gb|EOD05458.1| threonine-tRNA ligase [Emiliania huxleyi CCMP1516]
Length=678

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 171/231 (74%), Gaps = 1/231 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF  YEV LSTRP+K+VG+D+IW+KATSAL++AL  K W Y +DEGGGAFYG
Sbjct  440  TETILTKFGFTEYEVMLSTRPDKAVGSDEIWDKATSALREALGAKGWEYDVDEGGGAFYG  499

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR WQCSTIQ DFNLP+RF + YV  D  +++PI++HRA+ GSLERFFG
Sbjct  500  PKIDIKIRDAIGRLWQCSTIQCDFNLPQRFGLEYVSPDGGREQPIMLHRAIFGSLERFFG  559

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCSGER-LPKLIR  365
            VLIE  AGDFP WL+P Q RL+PV+D    +C+    RLKA+GIRAEV  G R + K I+
Sbjct  560  VLIESTAGDFPFWLAPTQLRLLPVSDDYRPYCDAAVARLKAAGIRAEVDPGGRSVGKQIK  619

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIEN  212
             A + K+P+++VVG  EV ++A+ +  R GGELG + ++  I     A E 
Sbjct  620  VANQDKVPILSVVGEAEVGANALKLEMRKGGELGELPLERAIEVLAAAAEK  670



>ref|XP_005843892.1| hypothetical protein CHLNCDRAFT_56367 [Chlorella variabilis]
 gb|EFN51790.1| hypothetical protein CHLNCDRAFT_56367 [Chlorella variabilis]
Length=594

 Score =   270 bits (689),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 171/248 (69%), Gaps = 14/248 (6%)
 Frame = -3

Query  901  TEGILQQFGFDNYE--------------VNLSTRPEKSVGNDDIWEKATSALKDALNDKC  764
            TE +L QFGF ++E              VNLSTRP+K VG+ +IW++A  ALK AL  K 
Sbjct  346  TELLLSQFGFHDFEASCKRKPPPRPCLQVNLSTRPDKFVGSPEIWDQAEHALKAALQRKG  405

Query  763  WTYQIDEGGGAFYGPKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPIL  584
            W +  D GGGAFYGPKID+KI DA+GRKWQCST+Q+DFNLPERFDM Y+     K+RPI+
Sbjct  406  WAFAEDVGGGAFYGPKIDIKICDAIGRKWQCSTVQLDFNLPERFDMFYISDANIKERPIM  465

Query  583  IHRAVLGSLERFFGVLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRA  404
            IHRA+LGSLERF G+LIE+YAG FPLWL+P+Q RL+PV D  + + + V + L+A+G+R 
Sbjct  466  IHRAILGSLERFMGILIENYAGAFPLWLAPVQCRLVPVNDAVMGYVSGVAQALQAAGLRV  525

Query  403  EVCSGERLPKLIRNAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKN  224
            EV SG  + K IR AEK KIP+M VVG +E  +  V +R+   G++G M ++D +     
Sbjct  526  EVSSGLSVGKAIRAAEKDKIPVMCVVGQREASAGTVAVRTYSHGDVGCMLVEDLVERMAK  585

Query  223  AIENRTFF  200
            A  N+  F
Sbjct  586  ASANKQPF  593



>ref|WP_018952008.1| MULTISPECIES: threonyl-tRNA synthetase [Thioalkalivibrio]
Length=638

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q E+  +V K L+A G R E     E++   IR   
Sbjct  528  EHYAGHFPAWLAPVQAEVLTITERQDEYAREVTKTLRAMGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M+++DF    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMRLEDFGERLREEVGSR  636



>ref|WP_018145452.1| MULTISPECIES: threonyl-tRNA synthetase [Thioalkalivibrio]
Length=638

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLDYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q E+  +V K L+A G R E     E++   IR   
Sbjct  528  EHYAGHFPAWLAPVQAEVLTITERQDEYAREVTKTLRAMGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M+++DF    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMRLEDFGERLREEVGSR  636



>ref|WP_018938529.1| MULTISPECIES: threonyl-tRNA synthetase [Thioalkalivibrio]
Length=638

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLDYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q E+  +V K L+A G R E     E++   IR   
Sbjct  528  EHYAGHFPAWLAPVQAEVLTITERQDEYAREVTKTLRAMGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M+++DF    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMRLEDFGERLREEVGSR  636



>ref|WP_018231351.1| threonyl-tRNA synthetase [Thioalkalivibrio thiocyanodenitrificans]
Length=643

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 170/232 (73%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            T  +L+ FGFD+YEVNLSTRP+K+VG++ IW  AT+AL+ AL  K   Y +DEGGGAFYG
Sbjct  405  TLDVLRAFGFDDYEVNLSTRPDKAVGSEKIWTHATAALRAALEKKGLDYSVDEGGGAFYG  464

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR+WQCST+Q+DFNLPERF M YV  D  + RPI+IHRA+LGS+ERFFG
Sbjct  465  PKIDIKIRDAIGREWQCSTVQLDFNLPERFGMEYVAEDNSRHRPIMIHRALLGSVERFFG  524

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            VLIEHYAG FPLWL+P+Q +++ +TD Q ++  +V + L+  G+R E     E++   IR
Sbjct  525  VLIEHYAGLFPLWLAPVQVQVLTITDRQDDYAREVAESLRNRGLRVETDLRNEKIGFKIR  584

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
                Q++P + V+G +E+E+  V +R+R G +LG+M +DD  R     I +R
Sbjct  585  EHTLQRVPYLLVLGDREMETKTVAVRTRAGEDLGSMDLDDLARRLSGEIASR  636



>ref|WP_019593369.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ALM2T]
Length=638

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLDYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q E+  +V K L+A G R E     E++   IR   
Sbjct  528  EHYAGHFPAWLAPVQAEVLTITERQDEYAREVTKTLRAMGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M+++DF    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMRLEDFGERLREEVGSR  636



>ref|WP_018169972.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ALMg9]
Length=638

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLDYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q E+  +V K L+A G R E     E++   IR   
Sbjct  528  EHYAGHFPAWLAPVQAEVLTITERQDEYAREVTKTLRAMGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M+++DF    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMRLEDFGERLREEVGSR  636



>ref|WP_013034109.1| threonyl-tRNA synthetase [Nitrosococcus halophilus]
 gb|ADE16259.1| threonyl-tRNA synthetase [Nitrosococcus halophilus Nc 4]
Length=644

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 164/219 (75%), Gaps = 1/219 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +L  FGF+ YEV+LSTRPEKSVG+D IWE+AT AL+ AL  K   Y +DEGGGAFYGPKI
Sbjct  408  MLSAFGFERYEVDLSTRPEKSVGSDAIWERATQALRSALEKKGLDYAVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KIEDA+GRKWQCST+Q+DFNLPERF+M YV  D  + +PI+IHRAVLGSLERFFGVLI
Sbjct  468  DIKIEDAIGRKWQCSTVQLDFNLPERFEMEYVAEDGARHQPIMIHRAVLGSLERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHY G FP WL+P+Q  ++ +TD Q E+  +VE+ LK  G R+ +    E++   IR   
Sbjct  528  EHYEGKFPPWLAPVQVAVMNITDRQAEYACQVEETLKNKGFRSLLDLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFI  239
             +++P + V+G +EVE+  V +R+R+  +LG M +D FI
Sbjct  588  LRRVPYLLVIGDREVENQTVAVRTRYSKDLGAMSLDAFI  626



>ref|WP_019571786.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ALMg3]
Length=638

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFERFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLDYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q E+  +V K L+A G R E     E++   IR   
Sbjct  528  EHYAGHFPAWLAPVQAEVLTITERQDEYAREVTKTLRAMGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M+++DF    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMRLEDFGERLREEVGSR  636



>ref|XP_005702847.1| threonyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME26327.1| threonyl-tRNA synthetase [Galdieria sulphuraria]
Length=674

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 173/227 (76%), Gaps = 1/227 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            IL +FGF  +EV LSTRPEK VG+D+IWE+AT+ALK+A+  + W Y ID+GGGAFYGPKI
Sbjct  439  ILSRFGFHEFEVTLSTRPEKYVGSDEIWERATNALKEAMEAENWRYMIDQGGGAFYGPKI  498

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+K+ DA+GR WQCSTIQ DFNLPERF + YV ++  ++RPI++HRA+ GSLERFFG+L+
Sbjct  499  DIKVRDAIGRLWQCSTIQCDFNLPERFQLEYVSNEGVRRRPIMVHRAIFGSLERFFGILL  558

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            E+ AGD PLWL+P+Q + I +++     CNK  +  +  G+R +V  SG+R+ K IRN E
Sbjct  559  ENCAGDLPLWLAPVQLKWIGLSEEAKATCNKYYEYAQQKGLRTQVDQSGDRISKCIRNGE  618

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIE  215
             +KIPLMA+VGPKE+++  +++RSR  G+LG + ++  + +  +A +
Sbjct  619  LEKIPLMAIVGPKELQTGLISVRSRSLGDLGQLSLETLLNKMVSATQ  665



>ref|WP_028989720.1| threonyl-tRNA synthetase [Thermithiobacillus tepidarius]
Length=645

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 164/230 (71%), Gaps = 1/230 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            IL  FGF+ YE+NLSTRP +SVG+D IWE AT+AL+ AL  K   YQ+DEGGGAFYGPKI
Sbjct  408  ILTAFGFERYEINLSTRPAESVGSDAIWESATAALRTALERKGLAYQVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            DLKIEDA+GRKWQCST+Q+DFNLPERFDM YV  D  ++RPI+IHRA+LGSLERFFGVLI
Sbjct  468  DLKIEDAIGRKWQCSTVQLDFNLPERFDMEYVAEDGSRRRPIMIHRALLGSLERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHY G FP WL+P+Q  ++ +TD Q ++  +  + LK  G R E     E++   IR   
Sbjct  528  EHYEGKFPPWLAPVQAVVMNITDAQADYAQEATETLKKMGFRVESDLRNEKIGFKIRAHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             +++P + VVG +E  +  V +RSR G +LGTM I DF       +E+R 
Sbjct  588  LRRVPYLLVVGDREQAAGTVAVRSRDGRDLGTMPIRDFGALLGRMVESRA  637



>ref|WP_008286257.1| threonyl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1]
 gb|EDP76052.1| threonyl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1]
Length=641

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +L+ FGFD++++ +STRPE ++G+D+ WE + +ALK A+ D  +TY+IDEGGGAFYGPKI
Sbjct  412  MLKDFGFDDFKIYVSTRPEDAIGSDEQWEVSENALKKAVEDLGYTYEIDEGGGAFYGPKI  471

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR WQCSTIQ DFNLPERFDMTYV  D +K RP +IHRA LGS+ERF G+L+
Sbjct  472  DVKIRDAIGRLWQCSTIQFDFNLPERFDMTYVGPDNKKHRPYMIHRAFLGSIERFTGILL  531

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCS-GERLPKLIRNAE  356
            EHYAG  P+WLSP Q R++P+ D  LE+  KV  RL+  G R ++    ER+   IR AE
Sbjct  532  EHYAGLLPVWLSPTQARIVPIADRHLEYGRKVLSRLQEEGFRVDMDERDERMNAKIREAE  591

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
              KIP + VVG +EVE+  V++RS+  G LG+M +++FI   +  +E +
Sbjct  592  LMKIPYVLVVGDREVEAGTVSVRSKKEGNLGSMSLEEFIEHLREKVERK  640



>ref|WP_041917120.1| threonyl-tRNA synthetase [Desulfocapsa sulfexigens]
Length=579

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 168/230 (73%), Gaps = 2/230 (1%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            IL+ FGFD Y++ LSTRP+K VG+D+ WEK+T ALK AL  K   Y++D G G FYGPKI
Sbjct  348  ILKTFGFDEYDIYLSTRPDKYVGSDENWEKSTEALKLALEKKGLEYKLDPGEGVFYGPKI  407

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+D LGR WQCSTIQVDFNLPERF M+Y  SD +K +PI+IHRA++GSLERF GVLI
Sbjct  408  DIKIKDQLGRSWQCSTIQVDFNLPERFKMSYTGSDNQKHQPIMIHRALMGSLERFIGVLI  467

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FPLW +P Q R++ +TD Q ++C++V  RL+ +G+R E     E+L   IR A+
Sbjct  468  EHYAGVFPLWFAPTQARIMNITDAQADYCDEVYNRLRKAGVRVEKDLRNEKLNYKIREAQ  527

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIRE-AKNAIENR  209
             +KIP M ++G KE + + VTIR R G  +  + IDDF R+ A+  +E R
Sbjct  528  MEKIPYMLIIGDKEKDCNTVTIRLRNGDNIADVTIDDFARKVAEECLEGR  577



>ref|WP_033396367.1| threonyl-tRNA synthetase [Thermodesulfatator atlanticus]
Length=634

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 168/233 (72%), Gaps = 1/233 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            T   L  FGF  Y++ LSTRP+K VG+++IWEKA  AL+ AL DK  +Y+ID G G FYG
Sbjct  400  TVYFLSTFGFKEYQIFLSTRPDKYVGSEEIWEKAEGALRKALEDKGLSYEIDPGEGVFYG  459

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI+D LGR WQCSTIQVDFN+PERF++TY+  D ++ RPI+IHRA+LGSLERFFG
Sbjct  460  PKIDIKIKDVLGRFWQCSTIQVDFNIPERFNITYIGEDNQRHRPIMIHRALLGSLERFFG  519

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            VLIEHYAG FP+WLSP+Q  +I V D  + F  +V +RLK + IR       E+L   IR
Sbjct  520  VLIEHYAGAFPVWLSPVQAIVITVADRHIPFAERVLERLKGADIRVSPDFRNEKLGFKIR  579

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             A+ QKIP M ++G KEVE++A+TIR+R G  L  M ++DFI   +  I  +T
Sbjct  580  EAQLQKIPYMLIIGDKEVENEALTIRTRKGENLPLMSVEDFIARIREEISAKT  632



>ref|WP_020252762.1| MULTISPECIES: threonyl-tRNA synthetase [unclassified Cloacimonetes]
Length=643

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 170/230 (74%), Gaps = 1/230 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
             L+ FGFD Y++ LST+P+K VG D  WE+AT +LK+AL      Y++D G G FYGPKI
Sbjct  409  FLKSFGFDRYDIFLSTKPDKCVGEDIDWERATESLKEALEISGLEYKVDLGEGVFYGPKI  468

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+DAL R WQC+TIQ DFNLPERFDMTY+  D E  RP +IHRA+LGSLERFFGVLI
Sbjct  469  DIKIKDALDRSWQCTTIQFDFNLPERFDMTYIGDDNEAHRPYMIHRALLGSLERFFGVLI  528

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG+FP+WL+P+Q ++IP+++ Q+++   + + L+ + IRA++    E++   IR AE
Sbjct  529  EHYAGNFPVWLAPVQLQVIPISEHQIDYAKLILQALRDANIRADIDVQNEKVGYKIREAE  588

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            KQKIP M V+G KEVE++ +++R    G++GT  + DFI+     I+N+T
Sbjct  589  KQKIPYMIVIGNKEVENNNISVRKHLKGDIGTTDLKDFIKLITQEIQNKT  638



>gb|AGF79858.1| threonyl-tRNA synthetase [Desulfocapsa sulfexigens DSM 10523]
Length=641

 Score =   268 bits (686),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 168/230 (73%), Gaps = 2/230 (1%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            IL+ FGFD Y++ LSTRP+K VG+D+ WEK+T ALK AL  K   Y++D G G FYGPKI
Sbjct  410  ILKTFGFDEYDIYLSTRPDKYVGSDENWEKSTEALKLALEKKGLEYKLDPGEGVFYGPKI  469

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+D LGR WQCSTIQVDFNLPERF M+Y  SD +K +PI+IHRA++GSLERF GVLI
Sbjct  470  DIKIKDQLGRSWQCSTIQVDFNLPERFKMSYTGSDNQKHQPIMIHRALMGSLERFIGVLI  529

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FPLW +P Q R++ +TD Q ++C++V  RL+ +G+R E     E+L   IR A+
Sbjct  530  EHYAGVFPLWFAPTQARIMNITDAQADYCDEVYNRLRKAGVRVEKDLRNEKLNYKIREAQ  589

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIRE-AKNAIENR  209
             +KIP M ++G KE + + VTIR R G  +  + IDDF R+ A+  +E R
Sbjct  590  MEKIPYMLIIGDKEKDCNTVTIRLRNGDNIADVTIDDFARKVAEECLEGR  639



>ref|WP_018861694.1| MULTISPECIES: threonyl-tRNA synthetase [Thioalkalivibrio]
Length=638

 Score =   268 bits (686),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQNFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q  +  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDAYAEEVTKALRDKGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G +E+E+  V +R+R G +LG+M ++DF    +  + NR
Sbjct  588  LKRVPYLLVLGDREMENGQVAVRTRSGEDLGSMGLEDFATRLREEVANR  636



>ref|WP_012963929.1| threonyl-tRNA synthetase [Hydrogenobacter thermophilus]
 dbj|BAI69749.1| threonyl-tRNA synthetase [Hydrogenobacter thermophilus TK-6]
 gb|ADO45676.1| threonyl-tRNA synthetase [Hydrogenobacter thermophilus TK-6]
Length=637

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 171/230 (74%), Gaps = 1/230 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +L+ FGF+ ++V +ST+PE ++G+ D W+ A ++LK A+      YQIDEGGGAFYGPKI
Sbjct  407  MLRDFGFEEFKVYISTKPEDAIGSPDQWQLAENSLKKAVESMGIPYQIDEGGGAFYGPKI  466

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+DA+GR WQCSTIQ DFNLPERFDM YV  D ++ RP +IHRA+LGS+ERF G+L+
Sbjct  467  DVKIKDAIGRLWQCSTIQFDFNLPERFDMEYVGPDNKRHRPYMIHRALLGSIERFTGILL  526

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCS-GERLPKLIRNAE  356
            EHYAG  P+WLSP+Q RLIP+ +  +++  K+E RLK  G+R EV    ERL   IR+AE
Sbjct  527  EHYAGALPVWLSPVQVRLIPIGEAHMDYTKKLENRLKEEGLRVEVDDRDERLSAKIRDAE  586

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
             QKIP + V+G KEV    +++RS+  G LG+M +++FI+  K+ I+++ 
Sbjct  587  VQKIPYVIVIGDKEVSQGKISVRSKKEGNLGSMSVEEFIKHIKDKIKSKA  636



>ref|WP_028950350.1| threonyl-tRNA synthetase [Sulfurihydrogenibium subterraneum]
Length=641

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 170/228 (75%), Gaps = 1/228 (0%)
 Frame = -3

Query  889  LQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKID  710
            L+ +GF+ +E+ LSTRPEKSVG+D +WE AT +L+ A+      Y++DEGGGAFYGPKID
Sbjct  413  LKSYGFEEFEIYLSTRPEKSVGDDRMWEVATQSLRKAIESTGLDYKVDEGGGAFYGPKID  472

Query  709  LKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLIE  530
            +KI+DA+GR WQCSTIQ DFNLPERFDM Y+  D ++ RP ++HRA+ GS+ERF GVLIE
Sbjct  473  VKIKDAIGRMWQCSTIQFDFNLPERFDMYYIGEDNQRHRPYMVHRAIFGSIERFIGVLIE  532

Query  529  HYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCS-GERLPKLIRNAEK  353
            HY G  P+WLSP+Q ++IP+ D  L+F NKV+  L  + +R EV    ER+ K IR+AE 
Sbjct  533  HYTGFLPVWLSPVQVKIIPIADKHLDFANKVKDILLQNKVRVEVDDRSERMNKKIRDAEL  592

Query  352  QKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            QK+P M V+G KE+E++++++R +  G+  +M ID+F+ + +  I+ +
Sbjct  593  QKVPFMLVIGDKEIENNSLSVREKGVGKTESMSIDNFVEKIRFLIKEK  640



>ref|WP_018864132.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ARh3]
Length=638

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 168/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDAIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q  +  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDAYAEEVTKALRDKGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G +E+E+  V +R+R G +LG+M ++DF    +  + NR
Sbjct  588  LKRVPYLLVLGDREMENGQVAVRTRSGEDLGSMSLEDFATRLREEVANR  636



>ref|WP_019623471.1| MULTISPECIES: threonyl-tRNA synthetase [Thioalkalivibrio]
Length=638

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 168/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDAIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q  +  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDAYAEEVTKALRDKGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G +E+E+  V +R+R G +LG+M ++DF    +  + NR
Sbjct  588  LKRVPYLLVLGDREMENGQVAVRTRSGEDLGSMSLEDFATRLREEVANR  636



>ref|WP_044282131.1| threonyl-tRNA synthetase [Caldithrix abyssi]
Length=636

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 163/218 (75%), Gaps = 1/218 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +L +FGF +YEV LSTRPEK VG+   W+ AT ALK+AL  K   YQID G G FYGPKI
Sbjct  409  VLSKFGFTDYEVYLSTRPEKFVGDVQSWDHATEALKNALERKEMDYQIDPGEGVFYGPKI  468

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+D LGR+WQCSTIQVDFNLPERFD+T+VDSD +  RPI IHRA+LGSLERFFG+LI
Sbjct  469  DIKIKDVLGRRWQCSTIQVDFNLPERFDLTFVDSDGQAYRPITIHRALLGSLERFFGILI  528

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FPLWL+P+Q  ++P+ D   ++ +++ ++L+  G+R EV    E++   IR AE
Sbjct  529  EHYAGFFPLWLAPLQVIVLPIADRHFDYADQIAEQLRLKGVRVEVDKRNEKIGFKIREAE  588

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDF  242
             QK+P M ++G KEVE   +++R +  G+LG MQ  DF
Sbjct  589  VQKVPYMLILGDKEVEEKRLSVRHKGEGDLGAMQYQDF  626



>ref|WP_044595895.1| threonyl-tRNA synthetase [Candidatus Methylomirabilis oxyfera]
Length=672

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 158/219 (72%), Gaps = 1/219 (0%)
 Frame = -3

Query  895  GILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPK  716
              L  FGFD Y+  ++TRPEK++G+ ++W  AT AL+ A +D    YQID+GGGAFYGPK
Sbjct  427  AFLSSFGFDRYDAYIATRPEKAIGDQELWNDATEALRRAADDAGLAYQIDDGGGAFYGPK  486

Query  715  IDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVL  536
            IDLK+ DALGR WQC+T+Q DFNLPERFD+TYV  D    RP ++HRA+LGSLERFFGVL
Sbjct  487  IDLKVRDALGRAWQCTTVQFDFNLPERFDITYVGEDNRPHRPFMVHRAILGSLERFFGVL  546

Query  535  IEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNA  359
            +EH+AG FP WL+P+Q RL+PV D    +  +V ++L+A+GIR E     E++   IR+A
Sbjct  547  VEHHAGAFPTWLAPVQARLVPVADRFQPYAQQVSEQLRAAGIRTETDVRNEKVGYKIRDA  606

Query  358  EKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDF  242
            E QK P + VVG KE  S AV++R R G ++G M ID F
Sbjct  607  EMQKTPYILVVGEKEATSGAVSVRGRGGRDMGVMPIDQF  645



>gb|EHO43305.1| threonyl-tRNA synthetase [Caldithrix abyssi DSM 13497]
Length=639

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 163/218 (75%), Gaps = 1/218 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +L +FGF +YEV LSTRPEK VG+   W+ AT ALK+AL  K   YQID G G FYGPKI
Sbjct  412  VLSKFGFTDYEVYLSTRPEKFVGDVQSWDHATEALKNALERKEMDYQIDPGEGVFYGPKI  471

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+D LGR+WQCSTIQVDFNLPERFD+T+VDSD +  RPI IHRA+LGSLERFFG+LI
Sbjct  472  DIKIKDVLGRRWQCSTIQVDFNLPERFDLTFVDSDGQAYRPITIHRALLGSLERFFGILI  531

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FPLWL+P+Q  ++P+ D   ++ +++ ++L+  G+R EV    E++   IR AE
Sbjct  532  EHYAGFFPLWLAPLQVIVLPIADRHFDYADQIAEQLRLKGVRVEVDKRNEKIGFKIREAE  591

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDF  242
             QK+P M ++G KEVE   +++R +  G+LG MQ  DF
Sbjct  592  VQKVPYMLILGDKEVEEKRLSVRHKGEGDLGAMQYQDF  629



>emb|CBE68915.1| Threonyl-tRNA synthetase (Threonine--tRNA ligase) (ThrRS) [Candidatus 
Methylomirabilis oxyfera]
Length=680

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 158/219 (72%), Gaps = 1/219 (0%)
 Frame = -3

Query  895  GILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPK  716
              L  FGFD Y+  ++TRPEK++G+ ++W  AT AL+ A +D    YQID+GGGAFYGPK
Sbjct  435  AFLSSFGFDRYDAYIATRPEKAIGDQELWNDATEALRRAADDAGLAYQIDDGGGAFYGPK  494

Query  715  IDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVL  536
            IDLK+ DALGR WQC+T+Q DFNLPERFD+TYV  D    RP ++HRA+LGSLERFFGVL
Sbjct  495  IDLKVRDALGRAWQCTTVQFDFNLPERFDITYVGEDNRPHRPFMVHRAILGSLERFFGVL  554

Query  535  IEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNA  359
            +EH+AG FP WL+P+Q RL+PV D    +  +V ++L+A+GIR E     E++   IR+A
Sbjct  555  VEHHAGAFPTWLAPVQARLVPVADRFQPYAQQVSEQLRAAGIRTETDVRNEKVGYKIRDA  614

Query  358  EKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDF  242
            E QK P + VVG KE  S AV++R R G ++G M ID F
Sbjct  615  EMQKTPYILVVGEKEATSGAVSVRGRGGRDMGVMPIDQF  653



>ref|XP_005766080.1| threonine-tRNA ligase [Emiliania huxleyi CCMP1516]
 gb|EOD13651.1| threonine-tRNA ligase [Emiliania huxleyi CCMP1516]
Length=631

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 158/209 (76%), Gaps = 2/209 (1%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            TE IL +FGF  YEV LSTRPEK+VG+D+IWE+AT AL+ AL  K W+Y +DEGGGAFYG
Sbjct  372  TETILTKFGFAEYEVMLSTRPEKAVGSDEIWERATGALEGALQQKGWSYGVDEGGGAFYG  431

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR WQCSTIQ DFNLPERFDM Y  +D  K+RPI++HRA+ GSLERFFG
Sbjct  432  PKIDIKIRDAIGRLWQCSTIQCDFNLPERFDMEYASADGTKERPIMVHRAIFGSLERFFG  491

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLE-FCNKVEKRLKASGIRAEV-CSGERLPKLI  368
            VL+E  AGDFP WL+P+Q RL+PV     + +C+ V  R +  G+RAEV   G  L K I
Sbjct  492  VLLESTAGDFPFWLAPVQLRLLPVVSDDFKPYCDGVIARARRLGLRAEVDVGGRSLSKQI  551

Query  367  RNAEKQKIPLMAVVGPKEVESDAVTIRSR  281
            + A K+K+PL AVVG KEVE   ++ ++R
Sbjct  552  KIANKEKVPLYAVVGAKEVEGGTLSFQAR  580



>gb|EGO87897.1| threonyl-tRNA synthetase [Clostridium botulinum C str. Stockholm]
Length=368

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 162/226 (72%), Gaps = 2/226 (1%)
 Frame = -3

Query  880  FGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKIDLKI  701
            FGF+ Y V LSTRPE S+G+D+ WE AT+ L  ALN+    Y+I+EG GAFYGPKID  +
Sbjct  141  FGFE-YFVELSTRPEDSMGSDEDWEAATNGLVKALNEAGLEYKINEGDGAFYGPKIDFHL  199

Query  700  EDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLIEHYA  521
             D LGR WQC TIQ+DF +PERFD++YV +D EK RP++ HR + GS+ERF G+L EHYA
Sbjct  200  RDCLGRTWQCGTIQLDFQMPERFDLSYVGADGEKHRPVMAHRVIFGSIERFIGILTEHYA  259

Query  520  GDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAEKQKI  344
            G FP WL+P+Q +++ +TD Q+E+C ++EK LK +GIR E+    E++   IR A+ QKI
Sbjct  260  GAFPTWLAPVQVKIMNITDNQIEYCKEIEKTLKENGIRVELDLRNEKIGYKIREAQLQKI  319

Query  343  PLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRT  206
            P M V+G KE+  + + +RSR  G+LG MQ+ DF+   K  ++ +T
Sbjct  320  PYMLVLGDKEMNENTIAVRSRKQGDLGAMQLVDFVAMVKKEVQEKT  365



>ref|WP_018950221.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ALMg11]
Length=638

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 170/229 (74%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +L+ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLKTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q ++  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPAWLTPVQAEVLTITERQDDYAREVTKTLRDRGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M+++DF    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMRLEDFGERLREEVSSR  636



>ref|WP_019626473.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ALJT]
Length=638

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 167/232 (72%), Gaps = 1/232 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            T  +LQ FGF+ ++VNLST+PE +VG+D IWE AT++L+ A+  K   Y +DEGGGAFYG
Sbjct  405  TLAVLQTFGFEKFDVNLSTKPEDAVGSDAIWEHATASLRSAIEKKGLEYSVDEGGGAFYG  464

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFG
Sbjct  465  PKIDIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFG  524

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            VLIEHYAG FP WL+P+Q  ++ +T+ Q  +  +V K L+  G R E     E++   IR
Sbjct  525  VLIEHYAGHFPTWLTPVQAEVLTITERQDAYAEEVTKALRDKGFRVEADLRNEKIGFKIR  584

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
                +++P + V+G KE+E+  V +R+R G +LG M ++DF    +  +  R
Sbjct  585  EHTLKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSVEDFGERLREEVAGR  636



>ref|WP_036497263.1| threonyl-tRNA synthetase, partial [Nitrosococcus oceani]
Length=496

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 161/219 (74%), Gaps = 1/219 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +L  FGFD YE++LSTRPEKSVG + IWE+AT AL+ AL+ K   Y +DEGGGAFYGPKI
Sbjct  260  MLAAFGFDRYEIDLSTRPEKSVGPEAIWEQATQALRSALDKKGLDYAVDEGGGAFYGPKI  319

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KIEDA+GRKWQCST+Q+DFNLPERF M YV  D  + RPI+IHRAVLGSLERFFGVLI
Sbjct  320  DIKIEDAIGRKWQCSTVQLDFNLPERFAMEYVAEDGARHRPIMIHRAVLGSLERFFGVLI  379

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHY G FP WL+P+Q  ++ +TD Q  +  +VE+ ++  G R+ +    E++   IR   
Sbjct  380  EHYEGKFPPWLAPVQVVVMSITDRQEGYARQVEEAMRNKGFRSLLDLRNEKIGFKIREHI  439

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFI  239
             ++IP + V+G +EV +  V +R+R+  +LG M +D F+
Sbjct  440  LRRIPYLLVIGDREVANQTVAVRTRYSQDLGAMSLDAFM  478



>ref|WP_007546173.1| threonyl-tRNA synthetase [Sulfurihydrogenibium yellowstonense]
 gb|EEP60943.1| threonyl-tRNA synthetase [Sulfurihydrogenibium yellowstonense 
SS-5]
Length=643

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 164/228 (72%), Gaps = 1/228 (0%)
 Frame = -3

Query  889  LQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKID  710
            L+ +GFD +EV LST+PEK VG+D +WE A ++L+ A+      Y+IDEGGGAFYGPKID
Sbjct  413  LKSYGFDEFEVYLSTKPEKYVGDDKMWEIAENSLRKAIESTGLDYKIDEGGGAFYGPKID  472

Query  709  LKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLIE  530
            +KI+DA+GR WQCSTIQ DFNLPERFDM Y+  D +K RP +IHRA+ GS+ERF GVL+E
Sbjct  473  VKIKDAIGRLWQCSTIQFDFNLPERFDMYYIGEDNQKHRPYMIHRAIFGSIERFIGVLLE  532

Query  529  HYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCS-GERLPKLIRNAEK  353
            HYAG  P+WLSP+Q ++IP+ D  LE+   V+++L  + IR E+    ER+ K IR+AE 
Sbjct  533  HYAGFLPVWLSPVQVKIIPIADKHLEYAETVKQKLLENDIRVELDDRNERMNKKIRDAEL  592

Query  352  QKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            QKIP M VVG KE E+  V +R +      T+ ID+F+ + K  I N+
Sbjct  593  QKIPFMLVVGDKEAETGTVAVREKGKQGSQTLSIDEFVSKIKEIISNK  640



>ref|WP_010881086.1| threonine--tRNA ligase [Aquifex aeolicus]
 ref|NP_214149.1| threonyl-tRNA synthetase [Aquifex aeolicus VF5]
 sp|O67583.1|SYT_AQUAE RecName: Full=Threonine--tRNA ligase; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Aquifex aeolicus VF5]
 gb|AAC07549.1| threonyl-tRNA synthetase [Aquifex aeolicus VF5]
Length=638

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 171/228 (75%), Gaps = 1/228 (0%)
 Frame = -3

Query  889  LQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKID  710
            L+ FGF+ +++ LSTRPE S+G+D+ WE + +ALK A+ D  + Y+IDEGGGAFYGPKID
Sbjct  410  LKDFGFNEFKIYLSTRPEYSIGSDEQWEVSQNALKKAIEDLGYEYEIDEGGGAFYGPKID  469

Query  709  LKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLIE  530
            +KI DA+GR WQ STIQ DFNLPERFDMTYV  D +K RP +IHRA+LGS+ERF G+L+E
Sbjct  470  VKIRDAIGRMWQLSTIQFDFNLPERFDMTYVGPDNKKHRPYMIHRALLGSIERFTGILLE  529

Query  529  HYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAEK  353
            HYAG  P+WLSP Q  +IP+ D   E+  KV + LK +GIRAE+    ER+   IR+AE 
Sbjct  530  HYAGLLPIWLSPTQVMIIPIADRHHEYAKKVYEFLKENGIRAEMDLREERMNAKIRDAEL  589

Query  352  QKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            +KIP++ VVG +E +++ V++R++  G LG+M+++ F+   K  I+N+
Sbjct  590  KKIPVILVVGDREAQNNTVSVRTKKEGNLGSMELNKFLDWIKEKIKNK  637



>ref|WP_018139158.1| MULTISPECIES: threonyl-tRNA synthetase [Thioalkalivibrio]
Length=638

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 168/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q ++  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDDYAREVTKTLRDKGFRVESDLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M ++ F    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSVEAFGERLREEVASR  636



>ref|WP_018940435.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. AKL11]
Length=638

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 168/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q ++  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDDYAREVTKTLRDKGFRVESDLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M ++ F    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSVEAFGERLREEVASR  636



>ref|WP_017942016.1| MULTISPECIES: threonyl-tRNA synthetase [Thioalkalivibrio]
Length=638

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 168/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q ++  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDDYAREVTKTLRDKGFRVESDLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M ++ F    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSVEAFGERLREEVASR  636



>ref|WP_018873330.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ALJ16]
Length=638

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 166/229 (72%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q  +  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDAYAEEVTKALRDKGFRVEADLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M ++ F    +  +  R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSVEAFGEHLREEVAGR  636



>ref|WP_024327918.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. AKL19]
Length=638

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 168/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q ++  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDDYAREVTKTLRGKGFRVESDLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M ++ F    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSLEAFGERLREEVGSR  636



>ref|WP_006787705.1| threonyl-tRNA synthetase [Thiorhodospira sibirica]
 gb|EGZ45702.1| threonyl-tRNA synthetase [Thiorhodospira sibirica ATCC 700588]
Length=643

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 164/222 (74%), Gaps = 1/222 (0%)
 Frame = -3

Query  901  TEGILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYG  722
            T G+L+ FGF+++++NLSTRP+K+VG+  IWE AT AL  AL  K   + ID GGGAFYG
Sbjct  405  TLGVLRAFGFEDFDINLSTRPDKAVGSAAIWEHATQALTAALEKKGLAFAIDAGGGAFYG  464

Query  721  PKIDLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFG  542
            PKID+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D  ++RPI+IHRA+LGSLERFFG
Sbjct  465  PKIDIKIRDAIGRQWQCSTVQLDFNLPERFDMEYVAEDNSRQRPIMIHRALLGSLERFFG  524

Query  541  VLIEHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIR  365
            VLIEHYAG FPLWL+P+Q  ++ +TD Q  +   ++ RL+  G+RA +    E++   IR
Sbjct  525  VLIEHYAGVFPLWLAPVQVAVLTITDRQDAYARALQARLQKQGLRAAIDLRNEKIGFKIR  584

Query  364  NAEKQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFI  239
                Q+IP + +VG +E E+  V +R+R G + G+M +D+ I
Sbjct  585  EHTLQRIPYLLIVGDREEETHTVAVRTRSGEDWGSMNLDELI  626



>ref|WP_012458846.1| threonine--tRNA ligase [Sulfurihydrogenibium sp. YO3AOP1]
 sp|B2V6M2.1|SYT_SULSY RecName: Full=Threonine--tRNA ligase; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Sulfurihydrogenibium sp. YO3AOP1]
 gb|ACD65754.1| threonyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1]
Length=643

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 164/228 (72%), Gaps = 1/228 (0%)
 Frame = -3

Query  889  LQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKID  710
            L+ +GFD +EV LST+PEK VG+D +WE A ++L+ A+      Y+ID+GGGAFYGPKID
Sbjct  413  LKSYGFDEFEVYLSTKPEKYVGDDKMWEVAENSLRKAIESTGLDYKIDDGGGAFYGPKID  472

Query  709  LKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLIE  530
            +KI+DA+GR WQCSTIQ DFNLPERFDM Y+  D +K RP +IHRA+ GS+ERF GVL+E
Sbjct  473  VKIKDAIGRLWQCSTIQFDFNLPERFDMYYIGEDNQKHRPYMIHRAIFGSIERFIGVLLE  532

Query  529  HYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEVCS-GERLPKLIRNAEK  353
            HYAG  P+WLSP+Q ++IP+ D  LE+   V+++L  + IR E+    ER+ K IR+AE 
Sbjct  533  HYAGFLPVWLSPVQVKIIPIADKHLEYAETVKQKLLENDIRVELDDRNERMNKKIRDAEL  592

Query  352  QKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
            QKIP M VVG KE E+  V +R +      T+ ID+F+ + K  I N+
Sbjct  593  QKIPFMLVVGDKEAETGTVAVREKGKQGSQTLSIDEFVSKIKEIISNK  640



>ref|WP_018995247.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ALJ2]
Length=638

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 167/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDAIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q ++  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDDYAREVTKTLRDKGFRVESDLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M ++ F    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSVEAFGERLREEVASR  636



>ref|WP_012982322.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. K90mix]
 gb|ADC71427.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. K90mix]
Length=638

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 168/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D+IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDEIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q ++  +V + L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDDYAREVTRALRDKGFRVESDLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M ++ F    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSVEAFGERLREEVASR  636



>ref|WP_018174468.1| MULTISPECIES: threonyl-tRNA synthetase [Thioalkalivibrio]
Length=638

 Score =   263 bits (672),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 167/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDAIWEHATASLRSAIEKKGLEYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q ++  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDDYAREVTKTLRDKGFRVESDLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M ++ F    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSVEAFGERLREEVASR  636



>ref|WP_013908194.1| threonyl-tRNA synthetase [Thermodesulfatator indicus]
 gb|AEH45452.1| threonyl-tRNA synthetase [Thermodesulfatator indicus DSM 15286]
Length=637

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 164/231 (71%), Gaps = 1/231 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
             L  FGF  Y++ LSTRPEK VG++ IWEKA  AL+ AL DK   Y+ID G G FYGPKI
Sbjct  406  FLSTFGFKEYQIFLSTRPEKYVGDEAIWEKAEGALRKALEDKGLPYEIDPGEGVFYGPKI  465

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI+D LGR WQCSTIQVDFN+PERF++TY+  D ++ RPI+IHRA+LGSLERF GVLI
Sbjct  466  DIKIKDVLGRFWQCSTIQVDFNIPERFNLTYIGEDNQRHRPIMIHRALLGSLERFLGVLI  525

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP+WL+P+Q  +I V D  + F  +V + LK +GIR +     E+L   IR A+
Sbjct  526  EHYAGAFPVWLAPVQAIIITVADRHIPFAEQVLEHLKGAGIRVKPDFRNEKLGFKIREAQ  585

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENRTF  203
             QKIP M ++G KE+E+ A+TIR+R G  L  M  +DF+ + +  +  +T 
Sbjct  586  LQKIPYMIIIGDKELENKALTIRTRKGENLPLMSTEDFVAKVQEEVSAKTL  636



>ref|WP_044921429.1| threonyl-tRNA synthetase [Anaerostipes hadrus]
Length=641

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 164/229 (72%), Gaps = 2/229 (1%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +   FGF  Y V LSTRP+ S+G+D+ WE AT +L+ AL+D    Y ++EG GAFYGPKI
Sbjct  405  VYNLFGF-KYHVELSTRPDDSMGSDEDWELATDSLRAALDDLGLDYVVNEGDGAFYGPKI  463

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D  +ED++GR WQC TIQ+DF LP RFD+ Y  +D EK RPI+IHR   GS+ERF G+LI
Sbjct  464  DFHLEDSIGRTWQCGTIQLDFQLPLRFDLHYTGADGEKHRPIMIHRVAFGSIERFIGILI  523

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EH+AG FP WL+P+Q  +IP++D  L++ NKV   LKA+GIRA++    E++   IR A+
Sbjct  524  EHFAGAFPTWLAPVQVEVIPISDKHLDYANKVLDTLKAAGIRADIDTRAEKMGYKIREAQ  583

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             QKIP M VVG KE E++AV++RSRF G+ G M++DDF+   K  I NR
Sbjct  584  LQKIPYMLVVGGKEEENEAVSVRSRFKGDEGQMKLDDFLAAIKEEIANR  632



>ref|WP_019583606.1| threonyl-tRNA synthetase [Thioalkalivibrio sp. ALE16]
Length=638

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 167/229 (73%), Gaps = 1/229 (0%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +LQ FGF+ ++VNLST+PE +VG+D IWE AT++L+ A+  K   Y +DEGGGAFYGPKI
Sbjct  408  VLQTFGFEKFDVNLSTKPEDAVGSDAIWEHATASLRSAIEKKGLKYSVDEGGGAFYGPKI  467

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D+KI DA+GR+WQCST+Q+DFNLPERFDM YV  D E++RPI+IHRA+LGS+ERFFGVLI
Sbjct  468  DIKIHDAIGREWQCSTVQLDFNLPERFDMEYVAEDNERRRPIMIHRALLGSVERFFGVLI  527

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EHYAG FP WL+P+Q  ++ +T+ Q ++  +V K L+  G R E     E++   IR   
Sbjct  528  EHYAGHFPTWLAPVQAEVLTITERQDDYAREVTKTLRDKGFRVESDLRNEKIGFKIREHT  587

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             +++P + V+G KE+E+  V +R+R G +LG M ++ F    +  + +R
Sbjct  588  LKRVPYLLVLGDKEMENGQVAVRTRSGEDLGVMSLEAFGERLREEVASR  636



>ref|WP_009265830.1| MULTISPECIES: threonyl-tRNA synthetase [Lachnospiraceae]
 gb|EFV15359.1| threonyl-tRNA synthetase [Lachnospiraceae bacterium 5_1_63FAA]
 emb|CDA33378.1| threonine--tRNA ligase [Lachnospiraceae bacterium CAG:25]
Length=641

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 164/229 (72%), Gaps = 2/229 (1%)
 Frame = -3

Query  892  ILQQFGFDNYEVNLSTRPEKSVGNDDIWEKATSALKDALNDKCWTYQIDEGGGAFYGPKI  713
            +   FGF  Y V LSTRP+ S+G+D+ WE AT +L+ AL+D    Y ++EG GAFYGPKI
Sbjct  405  VYNLFGF-KYHVELSTRPDDSMGSDEDWELATDSLRAALDDLGLDYVVNEGDGAFYGPKI  463

Query  712  DLKIEDALGRKWQCSTIQVDFNLPERFDMTYVDSDQEKKRPILIHRAVLGSLERFFGVLI  533
            D  +ED++GR WQC TIQ+DF LP RFD+ Y  +D EK RPI+IHR   GS+ERF G+LI
Sbjct  464  DFHLEDSIGRTWQCGTIQLDFQLPLRFDLHYTGADGEKHRPIMIHRVAFGSIERFIGILI  523

Query  532  EHYAGDFPLWLSPIQTRLIPVTDTQLEFCNKVEKRLKASGIRAEV-CSGERLPKLIRNAE  356
            EH+AG FP WL+P+Q  +IP++D  L++ NKV   LKA+GIRA++    E++   IR A+
Sbjct  524  EHFAGAFPTWLAPVQVEVIPISDKHLDYANKVLDTLKAAGIRADIDTRAEKMGYKIREAQ  583

Query  355  KQKIPLMAVVGPKEVESDAVTIRSRFGGELGTMQIDDFIREAKNAIENR  209
             QKIP M VVG KE E++AV++RSRF G+ G M++DDF+   K  I NR
Sbjct  584  LQKIPYMLVVGGKEEENEAVSVRSRFKGDEGQMKLDDFLAAIKEEIANR  632



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2077268246224