BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1224

Length=894
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011085044.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    297   9e-93   Sesamum indicum [beniseed]
ref|XP_011085045.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    297   1e-92   Sesamum indicum [beniseed]
ref|XP_004251999.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    289   2e-90   Solanum lycopersicum
emb|CDP08063.1|  unnamed protein product                                286   2e-90   Coffea canephora [robusta coffee]
ref|XP_006365944.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    286   5e-89   Solanum tuberosum [potatoes]
gb|EYU17635.1|  hypothetical protein MIMGU_mgv1a005073mg                284   2e-88   Erythranthe guttata [common monkey flower]
ref|XP_009796679.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    282   6e-88   Nicotiana sylvestris
ref|XP_008361188.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    276   2e-87   
ref|XP_009603400.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    281   2e-87   Nicotiana tomentosiformis
ref|XP_008337184.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    276   2e-87   
ref|XP_008384082.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    282   3e-87   
ref|XP_009366229.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    281   6e-87   Pyrus x bretschneideri [bai li]
ref|XP_009358390.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    281   8e-87   Pyrus x bretschneideri [bai li]
ref|XP_004287159.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    278   4e-86   Fragaria vesca subsp. vesca
ref|XP_007204381.1|  hypothetical protein PRUPE_ppa006750mg             275   4e-86   
ref|XP_002534406.1|  acyl-CoA thioesterase, putative                    266   2e-85   
ref|XP_010251390.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    275   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_006660849.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    277   2e-85   Oryza brachyantha
ref|XP_008243110.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    274   3e-85   
gb|KJB71600.1|  hypothetical protein B456_011G132500                    275   1e-84   Gossypium raimondii
gb|KCW63914.1|  hypothetical protein EUGRSUZ_G01596                     267   2e-84   Eucalyptus grandis [rose gum]
ref|NP_001063681.1|  Os09g0517700                                       273   6e-84   
gb|EEC84891.1|  hypothetical protein OsI_32054                          273   7e-84   Oryza sativa Indica Group [Indian rice]
tpg|DAA40553.1|  TPA: hypothetical protein ZEAMMB73_572549              266   8e-84   
ref|XP_010672467.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    272   8e-84   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ45378.1|  hypothetical protein OsJ_30024                          273   1e-83   Oryza sativa Japonica Group [Japonica rice]
gb|KDP35138.1|  hypothetical protein JCGZ_10672                         266   1e-83   Jatropha curcas
emb|CBI25684.3|  unnamed protein product                                268   2e-83   Vitis vinifera
ref|XP_002274516.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    269   3e-83   Vitis vinifera
gb|KJB10812.1|  hypothetical protein B456_001G226300                    269   5e-83   Gossypium raimondii
ref|XP_002271578.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    268   6e-83   Vitis vinifera
ref|XP_010068535.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    267   7e-83   
emb|CBI25898.3|  unnamed protein product                                267   8e-83   Vitis vinifera
ref|XP_002264355.2|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    268   1e-82   Vitis vinifera
ref|XP_012084418.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    268   1e-82   Jatropha curcas
emb|CBI24710.3|  unnamed protein product                                266   1e-82   Vitis vinifera
emb|CAN79406.1|  hypothetical protein VITISV_000710                     266   2e-82   Vitis vinifera
gb|KHG11387.1|  Acyl-coenzyme A thioesterase 9, mitochondrial           267   2e-82   Gossypium arboreum [tree cotton]
ref|XP_010039335.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    267   3e-82   Eucalyptus grandis [rose gum]
ref|XP_003576735.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    268   3e-82   
ref|XP_002532453.1|  acyl-CoA thioesterase, putative                    267   4e-82   Ricinus communis
ref|XP_010242486.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    269   4e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006492755.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    269   5e-82   Citrus sinensis [apfelsine]
ref|XP_007033682.1|  Thioesterase/thiol ester dehydrase-isomerase...    268   5e-82   
ref|XP_006442141.1|  hypothetical protein CICLE_v10019655mg             269   6e-82   Citrus clementina [clementine]
ref|XP_002462673.1|  hypothetical protein SORBIDRAFT_02g030010          268   7e-82   Sorghum bicolor [broomcorn]
ref|XP_008670323.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    268   9e-82   Zea mays [maize]
ref|XP_007033680.1|  Thioesterase/thiol ester dehydrase-isomerase...    268   9e-82   
ref|XP_004957366.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    268   9e-82   Setaria italica
ref|XP_006410113.1|  hypothetical protein EUTSA_v10017006mg             261   1e-81   
ref|XP_008788163.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    265   1e-81   Phoenix dactylifera
ref|XP_009420138.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    268   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420137.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    268   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007049522.1|  Thioesterase/thiol ester dehydrase-isomerase...    264   3e-81   
ref|XP_012075390.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    267   4e-81   Jatropha curcas
ref|XP_006410174.1|  hypothetical protein EUTSA_v10016640mg             264   5e-81   Eutrema salsugineum [saltwater cress]
ref|XP_002275033.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    265   7e-81   Vitis vinifera
gb|KJB42642.1|  hypothetical protein B456_007G161500                    263   7e-81   Gossypium raimondii
gb|AGA17934.1|  TE4                                                     265   9e-81   Humulus lupulus [common hop]
ref|XP_006447921.1|  hypothetical protein CICLE_v10015268mg             263   1e-80   Citrus clementina [clementine]
ref|XP_010101356.1|  BTB/POZ and TAZ domain-containing protein 3        271   1e-80   
emb|CDP03996.1|  unnamed protein product                                261   2e-80   Coffea canephora [robusta coffee]
ref|XP_004148940.2|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    263   4e-80   Cucumis sativus [cucumbers]
ref|XP_008338228.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    261   5e-80   
ref|XP_007153715.1|  hypothetical protein PHAVU_003G058900g             260   2e-79   Phaseolus vulgaris [French bean]
ref|XP_011001821.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    262   3e-79   Populus euphratica
ref|XP_009358935.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    259   4e-79   Pyrus x bretschneideri [bai li]
ref|XP_010069570.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    258   5e-79   Eucalyptus grandis [rose gum]
ref|XP_006294180.1|  hypothetical protein CARUB_v10023175mg             259   5e-79   Capsella rubella
gb|EMS57541.1|  hypothetical protein TRIUR3_18585                       257   6e-79   Triticum urartu
ref|XP_006858821.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    258   7e-79   Amborella trichopoda
ref|XP_011089584.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    258   8e-79   Sesamum indicum [beniseed]
ref|XP_011089585.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    257   8e-79   Sesamum indicum [beniseed]
ref|XP_003608127.1|  Acyl-coenzyme A thioesterase                       258   8e-79   
ref|XP_002323914.2|  hypothetical protein POPTR_0017s04250g             261   9e-79   Populus trichocarpa [western balsam poplar]
ref|XP_002301770.2|  hypothetical protein POPTR_0002s24110g             258   9e-79   Populus trichocarpa [western balsam poplar]
gb|AES90324.2|  acyl-CoA thioesterase, putative                         258   9e-79   Medicago truncatula
gb|KHN31009.1|  Acyl-coenzyme A thioesterase 9, mitochondrial           259   1e-78   Glycine soja [wild soybean]
ref|XP_008447218.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    259   1e-78   Cucumis melo [Oriental melon]
gb|AGA17932.1|  TE2                                                     257   2e-78   Humulus lupulus [common hop]
ref|XP_004290108.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    257   2e-78   Fragaria vesca subsp. vesca
dbj|BAK05083.1|  predicted protein                                      259   2e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004505139.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    258   2e-78   Cicer arietinum [garbanzo]
ref|XP_010908727.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    262   2e-78   Elaeis guineensis
ref|XP_002321229.2|  hypothetical protein POPTR_0014s17320g             257   3e-78   
ref|XP_011024724.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    256   3e-78   Populus euphratica
ref|XP_008372667.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    257   3e-78   
ref|XP_009761392.1|  PREDICTED: uncharacterized protein LOC104213...    254   4e-78   Nicotiana sylvestris
ref|XP_010414231.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    256   4e-78   Camelina sativa [gold-of-pleasure]
ref|XP_011080562.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    256   4e-78   Sesamum indicum [beniseed]
gb|EMT17709.1|  hypothetical protein F775_07184                         258   6e-78   
ref|XP_011010335.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    256   6e-78   Populus euphratica
ref|XP_003534487.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    256   6e-78   Glycine max [soybeans]
gb|KFK31266.1|  hypothetical protein AALP_AA6G090200                    256   6e-78   Arabis alpina [alpine rockcress]
ref|XP_009761391.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    254   7e-78   Nicotiana sylvestris
gb|AAC02743.1|  hypothetical protein                                    255   7e-78   Arabidopsis thaliana [mouse-ear cress]
gb|KHN40515.1|  Acyl-coenzyme A thioesterase 9, mitochondrial           254   1e-77   Glycine soja [wild soybean]
gb|EPS61819.1|  hypothetical protein M569_12970                         254   1e-77   Genlisea aurea
ref|XP_010242485.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    258   1e-77   Nelumbo nucifera [Indian lotus]
gb|EYU46078.1|  hypothetical protein MIMGU_mgv1a006555mg                254   1e-77   Erythranthe guttata [common monkey flower]
ref|NP_180630.2|  thioesterase/thiol ester dehydrase-isomerase su...    255   1e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009761389.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    254   2e-77   Nicotiana sylvestris
gb|KHG03224.1|  Acyl-coenzyme A thioesterase 9, mitochondrial           252   3e-77   Gossypium arboreum [tree cotton]
gb|KHN32342.1|  Acyl-coenzyme A thioesterase 9, mitochondrial           255   3e-77   Glycine soja [wild soybean]
ref|XP_003552469.2|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    253   4e-77   Glycine max [soybeans]
ref|XP_009619549.1|  PREDICTED: uncharacterized protein LOC104111...    252   6e-77   
ref|XP_010510297.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    253   9e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009619548.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    252   1e-76   
ref|XP_010469807.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    250   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_002881128.1|  thioesterase family protein                        252   2e-76   
ref|XP_003624249.1|  Acyl-CoA thioesterase                              251   2e-76   
ref|XP_004492892.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    252   2e-76   Cicer arietinum [garbanzo]
ref|XP_008235863.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    252   2e-76   Prunus mume [ume]
ref|XP_009619547.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    253   3e-76   Nicotiana tomentosiformis
ref|XP_004246984.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    252   3e-76   Solanum lycopersicum
ref|XP_003624248.1|  Acyl-CoA thioesterase                              251   3e-76   Medicago truncatula
ref|XP_007199839.1|  hypothetical protein PRUPE_ppa005627mg             251   4e-76   Prunus persica
ref|XP_006350432.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    252   4e-76   Solanum tuberosum [potatoes]
emb|CDY70798.1|  BnaCnng69840D                                          251   5e-76   Brassica napus [oilseed rape]
ref|XP_010557161.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    250   7e-76   Tarenaya hassleriana [spider flower]
emb|CDY29648.1|  BnaA04g17790D                                          250   2e-75   Brassica napus [oilseed rape]
gb|ABK24531.1|  unknown                                                 247   3e-75   Picea sitchensis
ref|XP_011470764.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    241   7e-75   Fragaria vesca subsp. vesca
ref|XP_009141094.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    248   9e-75   Brassica rapa
gb|EPS68180.1|  hypothetical protein M569_06586                         246   3e-74   Genlisea aurea
ref|XP_007139683.1|  hypothetical protein PHAVU_008G050200g             246   4e-74   Phaseolus vulgaris [French bean]
ref|XP_010551995.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    246   4e-74   Tarenaya hassleriana [spider flower]
ref|XP_010551994.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    246   4e-74   Tarenaya hassleriana [spider flower]
ref|XP_010679012.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    245   6e-74   
ref|XP_010679013.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    245   7e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010039359.1|  PREDICTED: uncharacterized protein LOC104428051    238   4e-73   
gb|ACU18617.1|  unknown                                                 240   7e-72   Glycine max [soybeans]
ref|XP_009802522.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    231   5e-70   Nicotiana sylvestris
ref|XP_009802521.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    231   8e-70   Nicotiana sylvestris
emb|CDY19958.1|  BnaA09g02930D                                          234   8e-70   Brassica napus [oilseed rape]
ref|XP_009111834.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    234   8e-70   Brassica rapa
emb|CDY00067.1|  BnaC09g02340D                                          234   8e-70   
ref|XP_009111835.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    234   9e-70   Brassica rapa
ref|XP_006395192.1|  hypothetical protein EUTSA_v10004228mg             234   1e-69   Eutrema salsugineum [saltwater cress]
ref|NP_199648.1|  thioesterase family protein                           234   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078736.1|  thioesterase family protein                        234   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865629.1|  thioesterase family protein                        233   1e-69   
ref|XP_010493652.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    233   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010493651.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    233   2e-69   Camelina sativa [gold-of-pleasure]
gb|KCW57955.1|  hypothetical protein EUGRSUZ_H00690                     233   2e-69   Eucalyptus grandis [rose gum]
ref|XP_006280409.1|  hypothetical protein CARUB_v10026342mg             233   5e-69   
gb|KFK31304.1|  hypothetical protein AALP_AA6G095500                    232   5e-69   Arabis alpina [alpine rockcress]
ref|XP_010095577.1|  hypothetical protein L484_007416                   230   2e-68   
ref|XP_010442257.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    233   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009626002.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    226   6e-66   Nicotiana tomentosiformis
ref|XP_001784039.1|  predicted protein                                  218   5e-64   
ref|XP_006365945.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    218   1e-63   Solanum tuberosum [potatoes]
ref|XP_001770748.1|  predicted protein                                  216   2e-63   
gb|KJB71601.1|  hypothetical protein B456_011G132500                    215   8e-62   Gossypium raimondii
ref|XP_001777944.1|  predicted protein                                  213   2e-61   
ref|XP_002971360.1|  hypothetical protein SELMODRAFT_94987              210   8e-61   
ref|XP_002961453.1|  hypothetical protein SELMODRAFT_76096              210   1e-60   
gb|KJB42645.1|  hypothetical protein B456_007G161500                    205   4e-59   Gossypium raimondii
ref|XP_010672468.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    204   3e-58   
ref|XP_006342415.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    200   1e-56   Solanum tuberosum [potatoes]
ref|XP_004253025.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    198   6e-56   
gb|KCW46047.1|  hypothetical protein EUGRSUZ_L00021                     187   2e-55   Eucalyptus grandis [rose gum]
ref|XP_009358934.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    177   3e-51   
emb|CBI25686.3|  unnamed protein product                                167   1e-47   Vitis vinifera
gb|KJB10811.1|  hypothetical protein B456_001G226300                    135   7e-33   Gossypium raimondii
ref|XP_002176416.1|  predicted protein                                  135   1e-32   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002288240.1|  hypothetical protein THAPSDRAFT_14923              133   2e-32   Thalassiosira pseudonana CCMP1335
gb|EWM27653.1|  Thioesterase superfamily                                134   2e-32   Nannochloropsis gaditana
ref|XP_010242488.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    133   1e-31   Nelumbo nucifera [Indian lotus]
gb|KJB71602.1|  hypothetical protein B456_011G132500                    132   1e-31   Gossypium raimondii
gb|KJB42643.1|  hypothetical protein B456_007G161500                    131   2e-31   Gossypium raimondii
ref|XP_012084425.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    130   3e-31   Jatropha curcas
ref|XP_010242487.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    131   3e-31   
ref|XP_007199838.1|  hypothetical protein PRUPE_ppa005627mg             130   4e-31   
ref|XP_003056867.1|  predicted protein                                  126   1e-29   Micromonas pusilla CCMP1545
ref|XP_004492893.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...    125   2e-29   Cicer arietinum [garbanzo]
ref|XP_010095578.1|  hypothetical protein L484_007417                   122   2e-29   
ref|XP_005848127.1|  hypothetical protein CHLNCDRAFT_145453             123   1e-28   Chlorella variabilis
ref|XP_009036439.1|  hypothetical protein AURANDRAFT_3016               120   6e-28   Aureococcus anophagefferens
ref|XP_006395191.1|  hypothetical protein EUTSA_v10004228mg             120   8e-28   
emb|CBJ27056.1|  acyl-CoA thioesterase, putative                        120   4e-27   Ectocarpus siliculosus
gb|KIZ02063.1|  Acyl-coenzyme A thioesterase 10                         116   5e-27   Monoraphidium neglectum
ref|XP_002953988.1|  hypothetical protein VOLCADRAFT_106173             117   2e-26   Volvox carteri f. nagariensis
ref|XP_002501004.1|  predicted protein                                  116   3e-26   Micromonas commoda
gb|AGM37972.1|  acyl-coenzyme A thioesterase                            107   1e-25   Caragana korshinskii
ref|XP_005848128.1|  hypothetical protein CHLNCDRAFT_145454             114   3e-25   Chlorella variabilis
gb|KCW63909.1|  hypothetical protein EUGRSUZ_G01592                     112   4e-25   Eucalyptus grandis [rose gum]
ref|XP_006442142.1|  hypothetical protein CICLE_v10019655mg             112   2e-24   
ref|XP_001418113.1|  predicted protein                                  104   3e-22   Ostreococcus lucimarinus CCE9901
gb|KCW46070.1|  hypothetical protein EUGRSUZ_L00044                   99.0    7e-22   Eucalyptus grandis [rose gum]
emb|CEF98163.1|  Thioesterase superfamily                               102   6e-21   Ostreococcus tauri
gb|KDD73141.1|  hypothetical protein H632_c2492p0                       100   7e-21   Helicosporidium sp. ATCC 50920
ref|XP_003079589.1|  acyl-CoA thioester hydrolase-like (ISS)            102   3e-20   
gb|KCW59196.1|  hypothetical protein EUGRSUZ_H01859                   92.8    5e-20   Eucalyptus grandis [rose gum]
gb|EFA78510.1|  RNA-binding region RNP-1 domain-containing protein    95.5    2e-18   Heterostelium album PN500
dbj|GAM22806.1|  hypothetical protein SAMD00019534_059810             93.2    9e-18   Acytostelium subglobosum LB1
gb|EJK72824.1|  hypothetical protein THAOC_05606                      92.8    2e-17   Thalassiosira oceanica
ref|XP_004353154.1|  acylCoA thioester hydrolase                      90.1    4e-17   Acanthamoeba castellanii str. Neff
ref|XP_637683.1|  RNA-binding region RNP-1 domain-containing protein  90.1    1e-16   Dictyostelium discoideum AX4
ref|XP_009494172.1|  hypothetical protein H696_01998                  88.2    2e-16   Fonticula alba
ref|XP_007387043.1|  Thioesterase/thiol ester dehydrase-isomerase     87.8    2e-16   Punctularia strigosozonata HHB-11173 SS5
ref|XP_011401303.1|  Acyl-coenzyme A thioesterase 9, mitochondrial    88.2    3e-16   Auxenochlorella protothecoides
ref|XP_009062950.1|  hypothetical protein LOTGIDRAFT_195153           87.0    6e-16   Lottia gigantea
gb|KJA15154.1|  hypothetical protein HYPSUDRAFT_149535                86.7    6e-16   Hypholoma sublateritium FD-334 SS-4
ref|XP_007436715.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  86.7    7e-16   
gb|ETE71179.1|  Acyl-coenzyme A thioesterase 10, mitochondrial        84.3    9e-16   Ophiophagus hannah
ref|XP_007436714.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  86.7    9e-16   Python bivittatus
ref|XP_007314761.1|  hypothetical protein SERLADRAFT_459130           85.1    1e-15   Serpula lacrymans var. lacrymans S7.9
ref|XP_007436713.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  86.7    1e-15   Python bivittatus
emb|CEG78250.1|  Putative Acyl-CoA thioester hydrolase                84.3    1e-15   Rhizopus microsporus
ref|XP_629631.1|  hypothetical protein DDB_G0292458                   86.3    2e-15   Dictyostelium discoideum AX4
ref|WP_019307666.1|  hypothetical protein                             85.1    2e-15   
ref|XP_004998419.1|  hypothetical protein PTSG_11662                  84.7    4e-15   Salpingoeca rosetta
ref|XP_004347353.2|  acyl-CoA Thioesterase                            85.1    5e-15   Capsaspora owczarzaki ATCC 30864
gb|KJE93888.1|  acyl-CoA Thioesterase                                 85.1    5e-15   Capsaspora owczarzaki ATCC 30864
emb|CEI87287.1|  Putative Acyl-CoA thioester hydrolase                84.3    6e-15   Rhizopus microsporus
emb|CEG74895.1|  Putative Acyl-CoA thioester hydrolase                84.3    7e-15   Rhizopus microsporus
ref|XP_003286177.1|  hypothetical protein DICPUDRAFT_30493            84.7    7e-15   Dictyostelium purpureum
ref|XP_007880412.1|  hypothetical protein PFL1_04692                  83.6    1e-14   Anthracocystis flocculosa PF-1
gb|EPS97299.1|  hypothetical protein FOMPIDRAFT_1128775               82.8    1e-14   Fomitopsis pinicola FP-58527 SS1
ref|XP_007398945.1|  hypothetical protein PHACADRAFT_149409           82.8    1e-14   Phanerochaete carnosa HHB-10118-sp
dbj|GAN04625.1|  thioesterase/thiol ester dehydrase-isomerase         83.2    2e-14   Mucor ambiguus
gb|EPB91441.1|  hypothetical protein HMPREF1544_01763                 83.2    2e-14   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007908784.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  82.8    2e-14   Callorhinchus milii [Australian ghost shark]
ref|XP_007908783.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  82.8    2e-14   Callorhinchus milii [Australian ghost shark]
ref|XP_007514166.1|  predicted protein                                82.8    2e-14   Bathycoccus prasinos
gb|KIO25285.1|  hypothetical protein M407DRAFT_75957                  82.4    2e-14   Tulasnella calospora MUT 4182
gb|KCW45309.1|  hypothetical protein EUGRSUZ_L01023                   77.4    2e-14   Eucalyptus grandis [rose gum]
ref|XP_005108973.1|  PREDICTED: acyl-coenzyme A thioesterase 10, ...  79.7    3e-14   
ref|XP_008040130.1|  Thioesterase/thiol ester dehydrase-isomerase     81.6    4e-14   Trametes versicolor FP-101664 SS1
ref|XP_007773074.1|  thioesterase thiol ester dehydrase-isomerase     81.3    4e-14   Coniophora puteana RWD-64-598 SS2
ref|XP_007855068.1|  acyl- thioester                                  82.0    5e-14   
ref|XP_007353554.1|  Thioesterase/thiol ester dehydrase-isomerase     80.9    6e-14   
gb|KIL57624.1|  hypothetical protein M378DRAFT_171567                 80.9    9e-14   Amanita muscaria Koide BX008
gb|KIK80861.1|  hypothetical protein PAXRUDRAFT_36067                 80.1    9e-14   Paxillus rubicundulus Ve08.2h10
emb|CEL60619.1|  hypothetical protein RSOLAG1IB_03857                 80.9    9e-14   Rhizoctonia solani AG-1 IB
gb|KIK35365.1|  hypothetical protein CY34DRAFT_96218                  80.1    1e-13   Suillus luteus UH-Slu-Lm8-n1
ref|XP_007249045.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  80.5    1e-13   
ref|XP_007249044.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  80.5    1e-13   
gb|EFX89579.1|  hypothetical protein DAPPUDRAFT_303215                80.5    1e-13   Daphnia pulex
gb|KIY51616.1|  Thioesterase/thiol ester dehydrase-isomerase          80.1    1e-13   Fistulina hepatica ATCC 64428
ref|XP_007304618.1|  Thioesterase/thiol ester dehydrase-isomerase     79.7    1e-13   Stereum hirsutum FP-91666 SS1
gb|KIY62154.1|  Thioesterase/thiol ester dehydrase-isomerase          79.7    1e-13   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_001637295.1|  predicted protein                                80.5    1e-13   Nematostella vectensis
gb|KIP09446.1|  hypothetical protein PHLGIDRAFT_22940                 79.7    1e-13   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_003027876.1|  hypothetical protein SCHCODRAFT_79337            79.7    2e-13   Schizophyllum commune H4-8
gb|EMD35049.1|  hypothetical protein CERSUDRAFT_116551                79.7    2e-13   Gelatoporia subvermispora B
gb|KIJ18171.1|  hypothetical protein PAXINDRAFT_161655                79.3    2e-13   Paxillus involutus ATCC 200175
ref|XP_010039372.1|  PREDICTED: uncharacterized protein LOC104428071  75.5    2e-13   
ref|XP_003287278.1|  hypothetical protein DICPUDRAFT_151354           80.1    2e-13   Dictyostelium purpureum
emb|CCM02110.1|  predicted protein                                    79.3    2e-13   Fibroporia radiculosa
ref|XP_003218888.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  79.7    2e-13   Anolis carolinensis [Carolina anole]
ref|XP_008105526.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  79.3    2e-13   Anolis carolinensis [Carolina anole]
gb|KIK09500.1|  hypothetical protein K443DRAFT_671394                 79.3    3e-13   Laccaria amethystina LaAM-08-1
emb|CDS08128.1|  hypothetical protein LRAMOSA02076                    79.3    4e-13   Lichtheimia ramosa
ref|XP_005812753.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  79.0    4e-13   Xiphophorus maculatus
ref|XP_009979924.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  79.0    4e-13   Tauraco erythrolophus
ref|XP_005812754.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  79.0    4e-13   
ref|XP_010139775.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  79.0    4e-13   Buceros rhinoceros silvestris
gb|KFV04602.1|  hypothetical protein N340_09498                       79.0    4e-13   Tauraco erythrolophus
ref|NP_001090082.1|  acyl-CoA thioesterase 9                          79.0    4e-13   Xenopus laevis [clawed frog]
gb|KIM77422.1|  hypothetical protein PILCRDRAFT_825385                78.6    5e-13   Piloderma croceum F 1598
gb|KIJ60477.1|  hypothetical protein HYDPIDRAFT_139201                78.6    6e-13   Hydnomerulius pinastri MD-312
gb|KFO83918.1|  hypothetical protein N320_01237                       78.2    6e-13   Buceros rhinoceros silvestris
ref|XP_008277283.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  78.2    7e-13   Stegastes partitus
ref|XP_007367090.1|  Thioesterase/thiol ester dehydrase-isomerase     77.8    7e-13   Dichomitus squalens LYAD-421 SS1
ref|XP_008277285.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  78.2    7e-13   Stegastes partitus
ref|XP_009082992.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.8    7e-13   Acanthisitta chloris
gb|KFP74134.1|  hypothetical protein N310_12508                       78.2    8e-13   Acanthisitta chloris
ref|XP_010115647.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.8    8e-13   Chlamydotis macqueenii
emb|CDH49162.1|  thioesterase thiol ester dehydrase-isomerase         78.2    8e-13   Lichtheimia corymbifera JMRC:FSU:9682
gb|KFP35577.1|  hypothetical protein N324_06623                       77.8    8e-13   Chlamydotis macqueenii
ref|XP_010284359.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    8e-13   Phaethon lepturus
ref|XP_010115646.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.8    9e-13   Chlamydotis macqueenii
ref|XP_009082991.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.8    9e-13   Acanthisitta chloris
emb|CDQ85670.1|  unnamed protein product                              74.3    1e-12   Oncorhynchus mykiss
ref|XP_008306075.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.8    1e-12   Cynoglossus semilaevis [half-smooth tongue sole]
ref|NP_001120589.1|  acyl-CoA thioesterase 9                          77.8    1e-12   Xenopus tropicalis [western clawed frog]
gb|EUC66954.1|  acyl-CoA thioesterase                                 77.4    1e-12   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_009701154.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.4    1e-12   
gb|KII83847.1|  hypothetical protein PLICRDRAFT_58288                 77.4    1e-12   
ref|XP_008306074.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.8    1e-12   
ref|XP_007398946.1|  hypothetical protein PHACADRAFT_261145           77.8    1e-12   
ref|XP_009275188.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.4    1e-12   
gb|KFQ67137.1|  hypothetical protein N335_07625                       75.5    1e-12   
ref|XP_006680607.1|  hypothetical protein BATDEDRAFT_12872            77.4    1e-12   
gb|KFM05928.1|  hypothetical protein AS27_07557                       77.4    1e-12   
ref|XP_009701153.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.4    1e-12   
ref|XP_009275186.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.4    1e-12   
ref|XP_010194399.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.0    1e-12   
ref|XP_009275187.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.4    1e-12   
gb|KIM37937.1|  hypothetical protein M413DRAFT_448199                 77.4    1e-12   
gb|KFP59343.1|  hypothetical protein N322_11900                       77.4    1e-12   
ref|XP_003763550.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.8    1e-12   
ref|XP_007493483.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.4    1e-12   
ref|XP_007493482.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.4    1e-12   
ref|XP_007493481.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.4    1e-12   
dbj|GAN04333.1|  mitochondrial acyl-CoA Thioesterase                  77.4    1e-12   
gb|ELT98028.1|  hypothetical protein CAPTEDRAFT_123067                76.6    2e-12   
ref|XP_008395115.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...  77.0    2e-12   
ref|XP_010194398.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.0    2e-12   
gb|KEP52668.1|  acyl-CoA thioester hydrolase                          77.0    2e-12   
ref|XP_009899078.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.0    2e-12   
emb|CAD54181.1|  acyl-CoA thioester hydrolase                         77.0    2e-12   
emb|CAH40840.1|  putative acyl-CoA hydrolase                          77.0    2e-12   
ref|XP_010076547.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    2e-12   
gb|KFV11011.1|  hypothetical protein N339_08738                       77.0    2e-12   
ref|NP_001018580.1|  acyl-CoA thioesterase 9, tandem duplicate 1      76.6    2e-12   
ref|XP_009996787.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    2e-12   
ref|XP_010076546.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    2e-12   
ref|XP_007661731.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  77.0    2e-12   
ref|XP_004080848.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    2e-12   
ref|XP_006808007.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    2e-12   
ref|XP_011486895.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    2e-12   
ref|XP_005461019.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    2e-12   
ref|XP_001509443.3|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    2e-12   
gb|KFP24394.1|  hypothetical protein N325_09245                       76.6    2e-12   
gb|KIJ34814.1|  hypothetical protein M422DRAFT_181575                 76.3    2e-12   
gb|KIM53001.1|  hypothetical protein SCLCIDRAFT_139970                76.3    2e-12   
ref|XP_009923426.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    2e-12   
ref|XP_009559377.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    2e-12   
ref|XP_005162768.1|  PREDICTED: acyl-CoA thioesterase 9, tandem d...  76.6    2e-12   
gb|KFQ08999.1|  hypothetical protein N329_05597                       76.6    2e-12   
ref|XP_007661732.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    3e-12   
ref|XP_009923425.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    3e-12   
gb|AAI59216.1|  Acot9 protein                                         76.6    3e-12   
gb|AAI71360.1|  Unknown (protein for MGC:198087)                      76.6    3e-12   
ref|XP_005945605.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    3e-12   
ref|XP_009923424.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    3e-12   
ref|XP_005461018.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.6    3e-12   
gb|KFQ21015.1|  hypothetical protein N331_02116                       76.3    3e-12   
ref|XP_005752527.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
ref|XP_010569580.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
ref|XP_008945478.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
gb|KFU90258.1|  hypothetical protein M959_06211                       76.3    3e-12   
gb|KFQ87764.1|  hypothetical protein N337_07084                       75.9    3e-12   
ref|XP_004574513.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
gb|KFZ60976.1|  hypothetical protein N321_14298                       76.3    3e-12   
ref|XP_009820636.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    3e-12   
ref|XP_010169048.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
ref|XP_005945604.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
ref|XP_009559376.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
ref|XP_010787012.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
gb|KDR74111.1|  hypothetical protein GALMADRAFT_250901                76.3    3e-12   
ref|XP_009938190.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
ref|XP_009938191.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    3e-12   
ref|XP_007541402.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
ref|XP_006461487.1|  hypothetical protein AGABI2DRAFT_151226          75.9    3e-12   
gb|KFQ41296.1|  hypothetical protein N333_04825                       75.9    3e-12   
ref|XP_009923417.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
ref|XP_010019005.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    3e-12   
ref|XP_007541401.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
emb|CAF92613.1|  unnamed protein product                              76.3    3e-12   
ref|XP_010018997.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    3e-12   
gb|KFW65110.1|  hypothetical protein AS28_11743                       76.3    4e-12   
ref|XP_010787011.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  76.3    4e-12   
ref|XP_009969905.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_009969904.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_009946703.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
gb|KFQ92387.1|  hypothetical protein Y956_08315                       75.9    4e-12   
ref|XP_009319406.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_009319404.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_009087962.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
gb|KFV67594.1|  hypothetical protein N307_00657                       75.9    4e-12   
ref|XP_010179537.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    4e-12   
ref|XP_009872081.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_007865821.1|  Thioesterase/thiol ester dehydrase-isomerase     75.5    4e-12   
ref|XP_011578452.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    4e-12   
gb|KFO15289.1|  hypothetical protein N312_03006                       75.9    4e-12   
gb|KFR14922.1|  hypothetical protein N306_07729                       75.5    4e-12   
ref|XP_009570709.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    4e-12   
ref|XP_010724117.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    4e-12   
ref|XP_009570708.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_005516751.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
gb|KGL99733.1|  hypothetical protein N301_03673                       75.9    4e-12   
ref|XP_009319405.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_010309633.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
gb|KFP46933.1|  hypothetical protein N323_03246                       74.7    4e-12   
ref|XP_009474512.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|WP_028832850.1|  hypothetical protein                             75.9    4e-12   
ref|XP_010179528.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
gb|KFP78113.1|  hypothetical protein N311_12066                       75.9    4e-12   
ref|XP_010309634.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    4e-12   
ref|XP_009891408.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_005231959.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_011578451.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|XP_011578444.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    4e-12   
ref|NP_001032476.1|  acyl-CoA thioesterase 9, tandem duplicate 2      75.9    5e-12   
ref|XP_011578438.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.9    5e-12   
gb|KFQ26955.1|  hypothetical protein N332_03111                       75.5    5e-12   
ref|XP_005503782.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    5e-12   
gb|KFV89958.1|  hypothetical protein N327_13068                       75.5    5e-12   
ref|XP_005151540.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    5e-12   
ref|XP_011578440.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    5e-12   
gb|EMC89221.1|  Acyl-coenzyme A thioesterase 9, mitochondrial         75.5    6e-12   
ref|XP_002156025.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    6e-12   
gb|EPB81767.1|  hypothetical protein HMPREF1544_11517                 75.5    6e-12   
ref|XP_009025069.1|  hypothetical protein HELRODRAFT_102324           75.5    6e-12   
ref|XP_010747945.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    6e-12   
ref|XP_010213087.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    6e-12   
gb|KFP13329.1|  hypothetical protein Z169_09119                       75.5    6e-12   
emb|CDQ83950.1|  unnamed protein product                              75.5    6e-12   
ref|XP_010747944.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    6e-12   
ref|XP_009633992.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    6e-12   
ref|XP_010213088.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    7e-12   
ref|XP_010213086.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.5    7e-12   
ref|XP_009633991.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    7e-12   
gb|KFW95611.1|  hypothetical protein N336_07326                       75.1    7e-12   
ref|XP_002161271.2|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    7e-12   
ref|XP_009511567.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    7e-12   
ref|XP_002409549.1|  acyl-CoA thioesterase, putative                  75.1    7e-12   
ref|XP_007398944.1|  hypothetical protein PHACADRAFT_261141           75.1    7e-12   
ref|XP_009511568.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    8e-12   
ref|XP_008504596.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    8e-12   
ref|XP_006112565.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    8e-12   
ref|XP_010888375.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    8e-12   
ref|XP_008920589.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    8e-12   
ref|XP_010888376.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    9e-12   
ref|XP_008504595.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    9e-12   
ref|XP_002738606.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  75.1    9e-12   
gb|KFV75814.1|  hypothetical protein N308_01056                       74.7    9e-12   
gb|KFO97995.1|  hypothetical protein N300_06063                       74.7    9e-12   
gb|KFW79670.1|  hypothetical protein N305_11211                       74.7    9e-12   
ref|XP_009663666.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    9e-12   
ref|XP_003968244.2|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    9e-12   
ref|XP_008920590.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    9e-12   
ref|XP_009663668.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
ref|XP_005037374.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
ref|XP_001870775.1|  acyl-coenzyme A thioesterase 9                   74.7    1e-11   
ref|XP_005037377.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
ref|XP_009663665.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
ref|XP_006835634.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
gb|KGL77335.1|  hypothetical protein N309_00246                       74.7    1e-11   
ref|XP_009663667.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.3    1e-11   
ref|XP_011606450.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
ref|XP_006835633.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
ref|XP_005010826.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
gb|ABM91445.1|  acyl-CoA thioesterase 9                               72.0    1e-11   
emb|CAD52849.1|  acyl-CoA thioester hydrolase                         74.7    1e-11   
ref|XP_005010827.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.3    1e-11   
ref|XP_005010825.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
ref|NP_001012841.1|  acyl-coenzyme A thioesterase 9, mitochondrial    74.3    1e-11   
gb|EOB07764.1|  Acyl-coenzyme A thioesterase 9                        74.3    1e-11   
gb|ABM91447.1|  acyl-CoA thioesterase 9                               72.0    1e-11   
ref|XP_005010824.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
ref|XP_006275172.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.7    1e-11   
ref|XP_002595227.1|  hypothetical protein BRAFLDRAFT_116049           74.3    1e-11   
emb|CAH25406.1|  acyl-CoA hydrolase                                   74.7    1e-11   
ref|XP_009488080.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.9    1e-11   
ref|XP_005010823.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  74.3    2e-11   
gb|KFQ65114.1|  hypothetical protein N334_02871                       74.3    2e-11   
emb|CDS09384.1|  hypothetical protein LRAMOSA10744                    73.9    2e-11   
emb|CEP06853.1|  hypothetical protein                                 74.3    2e-11   
ref|XP_001663937.1|  AAEL003569-PA                                    74.3    2e-11   
ref|XP_009488079.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.9    2e-11   
ref|XP_005424946.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.9    2e-11   
ref|XP_008168432.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.9    2e-11   
ref|XP_008168433.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.9    2e-11   
ref|XP_008168431.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.9    2e-11   
ref|XP_003112556.1|  hypothetical protein CRE_30876                   73.9    2e-11   
ref|XP_006034884.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.9    2e-11   
ref|XP_008168434.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.6    2e-11   
gb|KDQ54503.1|  hypothetical protein JAAARDRAFT_38173                 73.9    2e-11   
ref|XP_004382910.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.6    2e-11   
ref|XP_002196072.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.6    2e-11   
ref|XP_006034883.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.6    2e-11   
ref|XP_006034885.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.6    2e-11   
gb|KIN97269.1|  hypothetical protein M404DRAFT_160946                 73.2    3e-11   
ref|XP_004382909.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.6    3e-11   
ref|XP_008627458.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.6    3e-11   
ref|XP_010594044.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...  73.6    3e-11   
emb|CAP36255.2|  Protein CBG18926                                     73.6    3e-11   
ref|XP_008627459.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.2    3e-11   
ref|XP_005078031.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.2    3e-11   
gb|EXX70351.1|  hypothetical protein RirG_088230                      73.6    3e-11   
ref|XP_005078032.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.2    3e-11   
gb|KIJ92395.1|  hypothetical protein K443DRAFT_135304                 72.8    3e-11   
ref|XP_010392802.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.2    3e-11   
gb|KFO55740.1|  hypothetical protein N302_01107                       73.2    3e-11   
ref|XP_010392801.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.2    3e-11   
emb|CDI56824.1|  related to acyl-coa thioester hydrolase              73.2    4e-11   
ref|XP_005484418.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.2    4e-11   
ref|XP_011430037.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  73.2    4e-11   
gb|EKD00404.1|  hypothetical protein A1Q2_05241                       73.2    4e-11   
gb|EJT45193.1|  hypothetical protein A1Q1_06425                       73.2    4e-11   
ref|XP_011392760.1|  hypothetical protein UMAG_12337                  73.2    4e-11   
ref|XP_007332337.1|  hypothetical protein AGABI1DRAFT_122296          72.8    5e-11   
ref|XP_007070534.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  72.4    6e-11   
ref|XP_002424970.1|  acyl-coenzyme A thioesterase 9, putative         72.4    6e-11   
gb|EMP25649.1|  Acyl-coenzyme A thioesterase 9                        72.4    6e-11   
ref|XP_006729134.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  72.4    6e-11   
ref|XP_004410089.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  72.4    6e-11   
ref|XP_006729132.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  72.4    6e-11   
ref|XP_006729133.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  72.4    6e-11   
ref|XP_006885136.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  72.0    7e-11   
gb|EDL96100.1|  similar to acyl-CoA thioesterase, isoform CRA_a       72.0    7e-11   
ref|XP_004410088.1|  PREDICTED: acyl-coenzyme A thioesterase 9, m...  72.4    7e-11   
ref|XP_002637247.1|  Hypothetical protein CBG18926                    72.4    7e-11   
gb|ETS61503.1|  hypothetical protein PaG_04250                        72.4    7e-11   
ref|NP_001013982.1|  acyl-coenzyme A thioesterase 9, mitochondrial    72.4    7e-11   



>ref|XP_011085044.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=560

 Score =   297 bits (761),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EV R+NELL EGRVFCDMPALADRDSILI+DTCLQNSL+CQPQQRNIHGRIFGGFLMRRA
Sbjct  384  EVKRLNELLSEGRVFCDMPALADRDSILIKDTCLQNSLMCQPQQRNIHGRIFGGFLMRRA  443

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA+ATAY+FAGSAPCF EVDH+DFLKPVDVGNFLRF SCVLYTELENP+QP+INVEVV
Sbjct  444  FELAFATAYSFAGSAPCFVEVDHVDFLKPVDVGNFLRFNSCVLYTELENPAQPMINVEVV  503

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHV RPELRSSEVSNKFYFTF+V SDAL+NG +IR VVPATEEEARRVIERMDAE
Sbjct  504  AHVMRPELRSSEVSNKFYFTFTVHSDALKNGLKIRNVVPATEEEARRVIERMDAE  558



>ref|XP_011085045.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=559

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EV R+NELL EGRVFCDMPALADRDSILI+DTCLQNSL+CQPQQRNIHGRIFGGFLMRRA
Sbjct  383  EVKRLNELLSEGRVFCDMPALADRDSILIKDTCLQNSLMCQPQQRNIHGRIFGGFLMRRA  442

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA+ATAY+FAGSAPCF EVDH+DFLKPVDVGNFLRF SCVLYTELENP+QP+INVEVV
Sbjct  443  FELAFATAYSFAGSAPCFVEVDHVDFLKPVDVGNFLRFNSCVLYTELENPAQPMINVEVV  502

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHV RPELRSSEVSNKFYFTF+V SDAL+NG +IR VVPATEEEARRVIERMDAE
Sbjct  503  AHVMRPELRSSEVSNKFYFTFTVHSDALKNGLKIRNVVPATEEEARRVIERMDAE  557



>ref|XP_004251999.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Solanum 
lycopersicum]
Length=489

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+NELL E R+FCDMPALADRDSILI+DTCLQNSLICQPQQRNIHGRIFGGFLMRRA
Sbjct  313  EVNRLNELLAESRIFCDMPALADRDSILIKDTCLQNSLICQPQQRNIHGRIFGGFLMRRA  372

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELAYATAYAFAGSAPCF EVDH+DFLKPVDVGNFLR KSCVLYTELEN S+PLINVEVV
Sbjct  373  FELAYATAYAFAGSAPCFVEVDHVDFLKPVDVGNFLRLKSCVLYTELENLSKPLINVEVV  432

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHV RPELRSSEVSN FYFTF+V  D+L+NG R+R VVP TEEEARRVIERMDAE
Sbjct  433  AHVMRPELRSSEVSNNFYFTFTVQQDSLKNGARVRNVVPGTEEEARRVIERMDAE  487



>emb|CDP08063.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R+NELL EGRVFCDMPALADRDSILI+DT LQNSLICQPQQRNIHGRIFGGFLMRRA
Sbjct  215  ETKRLNELLAEGRVFCDMPALADRDSILIRDTYLQNSLICQPQQRNIHGRIFGGFLMRRA  274

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA+ATAY+FAG+AP F EVDH+DFLKPVDVGNFLRFKSCVLYTELENP +P+INVEVV
Sbjct  275  FELAFATAYSFAGAAPRFVEVDHVDFLKPVDVGNFLRFKSCVLYTELENPDKPMINVEVV  334

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPE RSSEVSNKFYFTF+V  DA++NG +IR VVPATEEEA+RVIERMDAE
Sbjct  335  AHVTRPEFRSSEVSNKFYFTFTVRPDAIKNGLKIRNVVPATEEEAKRVIERMDAE  389



>ref|XP_006365944.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=489

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+NELL E R+FCDMPALAD+DSILI+DTCLQNSLICQPQQRNIHGRIFGGFLMRRA
Sbjct  311  EVNRLNELLAESRIFCDMPALADKDSILIKDTCLQNSLICQPQQRNIHGRIFGGFLMRRA  370

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELAYATAYAFAGSAPCF EVDH+DFLKPVDVGNFLR KSCVLYTELE+ S+PLINVEVV
Sbjct  371  FELAYATAYAFAGSAPCFVEVDHVDFLKPVDVGNFLRLKSCVLYTELESLSKPLINVEVV  430

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHV RPELRSSEVSN FYFTF+V  D+L+NG R+R VVP TEEEARRVIERMDAE
Sbjct  431  AHVMRPELRSSEVSNNFYFTFTVHQDSLKNGARVRNVVPGTEEEARRVIERMDAE  485



>gb|EYU17635.1| hypothetical protein MIMGU_mgv1a005073mg [Erythranthe guttata]
Length=497

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E+NR+NELL E RVFCDMP LADRDSILI++T LQNSL+CQPQQRNIHGRIFGGFLMRRA
Sbjct  317  EMNRLNELLSESRVFCDMPVLADRDSILIKETRLQNSLMCQPQQRNIHGRIFGGFLMRRA  376

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA+ATAYAFAGS+PCF EVDH+DFLKPVDVGNFLRF SCVLYTELENP++P+INVEVV
Sbjct  377  FELAFATAYAFAGSSPCFVEVDHVDFLKPVDVGNFLRFNSCVLYTELENPAKPMINVEVV  436

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHV RPELRSSEVSNKFYFTF+V SDA++NG  IR VVPATEEEARRVIERMDAE
Sbjct  437  AHVMRPELRSSEVSNKFYFTFTVDSDAVKNGQGIRNVVPATEEEARRVIERMDAE  491



>ref|XP_009796679.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Nicotiana sylvestris]
Length=469

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EV  +NELL EGR+FCDMPALADRDSIL++DTCLQNSLICQPQQRNIHGRIFGGFLMRRA
Sbjct  293  EVKGLNELLAEGRIFCDMPALADRDSILMKDTCLQNSLICQPQQRNIHGRIFGGFLMRRA  352

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELAYATAYAFAGSAPCF EVDH+DFLKPVDVGNFLR KSCVLYTELEN  +PLINVEV+
Sbjct  353  FELAYATAYAFAGSAPCFVEVDHVDFLKPVDVGNFLRLKSCVLYTELENLCRPLINVEVI  412

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHV RPELRSSEVSN FYFTF+V  D+L+NG RIR VVP TEEEARRVIERMDAE
Sbjct  413  AHVMRPELRSSEVSNNFYFTFTVQQDSLKNGKRIRNVVPGTEEEARRVIERMDAE  467



>ref|XP_008361188.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Malus domestica]
Length=325

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            + +R+N LL EGRVFCDMPALADRDSILI+DTCLQNS ICQPQQRNIHGRIFGGFLMRRA
Sbjct  144  DTDRLNALLAEGRVFCDMPALADRDSILIRDTCLQNSFICQPQQRNIHGRIFGGFLMRRA  203

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FE+A++T YAFAG AP F EVDH+DF++PVDVGNFLR KSCVLYTELENP++PLINVEVV
Sbjct  204  FEIAFSTTYAFAGVAPHFLEVDHVDFVRPVDVGNFLRLKSCVLYTELENPAEPLINVEVV  263

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT+PELRSSEVSNKFYFTFSV  + +++G RIR VVPATEEEA RVIERMDAE
Sbjct  264  AHVTQPELRSSEVSNKFYFTFSVPPEVMKDGIRIRNVVPATEEEAWRVIERMDAE  318



>ref|XP_009603400.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=468

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EV  +NELL EGR+FCDMPALA RDSILI DTCLQNSLICQPQQRNIHGRIFGGFLMRRA
Sbjct  292  EVKGLNELLAEGRIFCDMPALAYRDSILIMDTCLQNSLICQPQQRNIHGRIFGGFLMRRA  351

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELAYATAYAFAGSAPCF EVDH+DFLKPVDVGNFLR KSCVLYTELEN  +PLINVEV+
Sbjct  352  FELAYATAYAFAGSAPCFVEVDHVDFLKPVDVGNFLRLKSCVLYTELENLGRPLINVEVI  411

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHV RPELRSSEVSN FYFTF+V  D+L+NG RIR VVP TEEEARRVIERMDAE
Sbjct  412  AHVMRPELRSSEVSNNFYFTFTVQQDSLKNGKRIRNVVPGTEEEARRVIERMDAE  466



>ref|XP_008337184.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Malus domestica]
Length=325

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            + +R+N LL EGRVFCDMPALADRDSILI+DTCLQNS ICQPQQRNIHGRIFGGFLMRRA
Sbjct  144  DTDRLNALLAEGRVFCDMPALADRDSILIRDTCLQNSFICQPQQRNIHGRIFGGFLMRRA  203

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FE+A++T YAFAG AP F EVDH+DF++PVDVGNFLR KSCVLYTELENP++PLINVEVV
Sbjct  204  FEIAFSTTYAFAGVAPHFLEVDHVDFVRPVDVGNFLRLKSCVLYTELENPAEPLINVEVV  263

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT+PELRSSEVSNKFYFTFSV  + +++G RIR VVPATEEEA RVIERMDAE
Sbjct  264  AHVTQPELRSSEVSNKFYFTFSVPPEXMKDGIRIRNVVPATEEEAWRVIERMDAE  318



>ref|XP_008384082.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Malus domestica]
Length=513

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            + +R+N LL EGRVFCDMPALADRDSILI+DTCLQNS ICQPQQRNIHGRIFGGFLMRRA
Sbjct  332  DTDRLNALLAEGRVFCDMPALADRDSILIRDTCLQNSFICQPQQRNIHGRIFGGFLMRRA  391

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FE+A++T YAFAG AP F EVDH+DF++PVDVGNFLR KSCVLYTELENP +PLINVEVV
Sbjct  392  FEIAFSTTYAFAGVAPHFLEVDHVDFVRPVDVGNFLRLKSCVLYTELENPDEPLINVEVV  451

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT+PELRSSEVSNKFYFTFSV  +A+++G RIR+VVPATEEEARRVIERMDAE
Sbjct  452  AHVTQPELRSSEVSNKFYFTFSVPPEAMKDGIRIRSVVPATEEEARRVIERMDAE  506



>ref|XP_009366229.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Pyrus x bretschneideri]
Length=513

 Score =   281 bits (719),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            + +R+N LL EGRVFCDMPALADRDSILI+DTCLQNS ICQPQQRNIHGRIFGGFLMRRA
Sbjct  332  DTDRLNALLAEGRVFCDMPALADRDSILIRDTCLQNSFICQPQQRNIHGRIFGGFLMRRA  391

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FE+A++T YAFAG AP F EVDH+DF++PVDVGNFLR KSCVLYTELENP +PLINVEVV
Sbjct  392  FEIAFSTTYAFAGVAPHFLEVDHVDFVRPVDVGNFLRLKSCVLYTELENPDEPLINVEVV  451

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT+PELRSSEVSNKFYFTFSV  +A+++G RIR+VVPATEEEARRVIERMDAE
Sbjct  452  AHVTQPELRSSEVSNKFYFTFSVPPEAMKDGIRIRSVVPATEEEARRVIERMDAE  506



>ref|XP_009358390.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Pyrus x bretschneideri]
Length=515

 Score =   281 bits (718),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            + +R+N LL EGRVFCDMPALADRDSILI+DTCLQNS ICQPQQRNIHGRIFGGFLMRRA
Sbjct  334  DTDRVNALLAEGRVFCDMPALADRDSILIRDTCLQNSFICQPQQRNIHGRIFGGFLMRRA  393

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FE+A++T YAFAG AP F EVDH+DF++PVDVGNFLR KSCVLYTELENP++PLINVEVV
Sbjct  394  FEIAFSTTYAFAGVAPHFLEVDHVDFVRPVDVGNFLRLKSCVLYTELENPAEPLINVEVV  453

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT+PELRSSEVSNKFYFTFSV  +A+++G RIR VVPATEEEARRVIERMDAE
Sbjct  454  AHVTQPELRSSEVSNKFYFTFSVPPEAMKDGIRIRNVVPATEEEARRVIERMDAE  508



>ref|XP_004287159.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=470

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            NR+N LL EGRVFCDMPALADRDSILI+DTCLQNS ICQPQQRNIHGRIFGGFLMRRAFE
Sbjct  291  NRLNALLAEGRVFCDMPALADRDSILIRDTCLQNSFICQPQQRNIHGRIFGGFLMRRAFE  350

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA++T YAFAG+AP F EVDH+DF++PVDVGNFLR KSCVLYTELENPS+PLINVEVVAH
Sbjct  351  LAFSTTYAFAGAAPHFLEVDHVDFVRPVDVGNFLRLKSCVLYTELENPSEPLINVEVVAH  410

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VT+P+LRSSEVSNKFYFTFS+  +A+++G RIR VVPATEEEA RVIERMDAE
Sbjct  411  VTQPKLRSSEVSNKFYFTFSIHPEAVKDGVRIRNVVPATEEEALRVIERMDAE  463



>ref|XP_007204381.1| hypothetical protein PRUPE_ppa006750mg [Prunus persica]
 gb|EMJ05580.1| hypothetical protein PRUPE_ppa006750mg [Prunus persica]
Length=396

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            + NR N LL EGRVFCDMPALADRDSILI+DTCL+NS ICQPQQRNIHGRIFGGFLMRRA
Sbjct  214  DANRFNALLAEGRVFCDMPALADRDSILIRDTCLENSFICQPQQRNIHGRIFGGFLMRRA  273

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++T YAFAG AP F EVDH+DF++PVDVGNFLR KSCVLYTELENP++PLINVEVV
Sbjct  274  FELAFSTTYAFAGVAPHFLEVDHVDFVRPVDVGNFLRLKSCVLYTELENPAEPLINVEVV  333

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT+PELRSSEVSNKFYFTFS   +A+++G RIR VVPAT EEARRVIERMDAE
Sbjct  334  AHVTQPELRSSEVSNKFYFTFSAPPEAMKDGIRIRNVVPATVEEARRVIERMDAE  388



>ref|XP_002534406.1| acyl-CoA thioesterase, putative [Ricinus communis]
 gb|EEF27975.1| acyl-CoA thioesterase, putative [Ricinus communis]
Length=181

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            + R+N LL EGR+F DMPALADRDSILI+DTC QNSLICQPQQRNIHGRIFGGFLMR+AF
Sbjct  1    MERLNALLAEGRIFSDMPALADRDSILIKDTCHQNSLICQPQQRNIHGRIFGGFLMRKAF  60

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG+AP F EVDH+DFLKPVDVGNFLR KSCVLYTEL++P++PLINVEV+A
Sbjct  61   ELAFSTAYAFAGAAPRFVEVDHVDFLKPVDVGNFLRLKSCVLYTELQDPARPLINVEVIA  120

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            HVTRPELRSSEVSNKFYFTF+V  +A+++G RIR V PATEEE RRV+ERMDAE
Sbjct  121  HVTRPELRSSEVSNKFYFTFTVRPEAIKDGLRIRNVFPATEEEGRRVLERMDAE  174



>ref|XP_010251390.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Nelumbo nucifera]
Length=430

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EV+R+  LL EGRVFCDMPALA+RDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  254  EVDRLEALLAEGRVFCDMPALANRDSILMRDTHLENSLICQPQQRNIHGRIFGGFLMNRA  313

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG+ PCF EVDH+DFLKPVDVG+FLRFKSCVLYTEL NP QPLIN+EVV
Sbjct  314  FELAFSTAYAFAGAMPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTELHNPEQPLINIEVV  373

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSE+SN F+FTF+V  DA++NG +IR VVPATEEEARRV+ERMDAE
Sbjct  374  AHVTRPELRSSEISNTFHFTFTVRPDAMKNGLKIRNVVPATEEEARRVLERMDAE  428



>ref|XP_006660849.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Oryza brachyantha]
Length=507

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  870  K*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFL  691
            K + E  R+N LL EGRVF D+PALADRDSIL++DT L+NSLICQPQQRN+HGRIFGGFL
Sbjct  325  KLHVESERLNSLLAEGRVFSDLPALADRDSILLKDTRLENSLICQPQQRNLHGRIFGGFL  384

Query  690  MRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLIN  511
            M RAFELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVLYT+L+NP QPL+N
Sbjct  385  MHRAFELAFSTAYAFVGQKPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTQLDNPEQPLVN  444

Query  510  VEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VEVVAHVTRPELR SEVSN F+FTF+VCSDAL+NG +IR VVP+TEEEARR++ERMDAE
Sbjct  445  VEVVAHVTRPELRKSEVSNTFHFTFTVCSDALKNGLKIRHVVPSTEEEARRILERMDAE  503



>ref|XP_008243110.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Prunus mume]
Length=430

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            + NR N LL EGRVFCDMPALADRDSILI+DTCL+NS ICQPQQRNIHGRIFGGFLMRRA
Sbjct  248  DANRFNALLAEGRVFCDMPALADRDSILIRDTCLENSFICQPQQRNIHGRIFGGFLMRRA  307

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++T YAFAG AP F EVDH+DF++PVDVGNFLR KSCVLYTEL NP++PLINVEVV
Sbjct  308  FELAFSTTYAFAGVAPHFLEVDHVDFVRPVDVGNFLRLKSCVLYTELGNPAEPLINVEVV  367

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT+PELRSSEVSNKFYFTFS   +A+++G RIR VVPAT EEARRVIERMDAE
Sbjct  368  AHVTQPELRSSEVSNKFYFTFSAPPEAMKDGIRIRNVVPATVEEARRVIERMDAE  422



>gb|KJB71600.1| hypothetical protein B456_011G132500 [Gossypium raimondii]
Length=528

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+N LL EGRVFCDMPALADRDSILI+DT  +NSL+CQPQQRNIHGRIFGGFLMR+A E
Sbjct  353  DRLNTLLAEGRVFCDMPALADRDSILIRDTRHENSLMCQPQQRNIHGRIFGGFLMRKASE  412

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA++ AYAFAG+APCF EVDH+DF KPVDVGNFLRFKSCVLYTELENP +PLINVEVVAH
Sbjct  413  LAFSNAYAFAGAAPCFMEVDHVDFFKPVDVGNFLRFKSCVLYTELENPMKPLINVEVVAH  472

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VTRPELR SEVSNKFYFTF+V  DA++ G +IR VVPATEEEARRV+ERMDAE
Sbjct  473  VTRPELRCSEVSNKFYFTFTVRPDAMKEGLKIRNVVPATEEEARRVLERMDAE  525



>gb|KCW63914.1| hypothetical protein EUGRSUZ_G01596 [Eucalyptus grandis]
Length=287

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+  LL EGRVFCDMPALADRDSILI+DTC +NSLICQPQQRNIHGRIFGGFLMRRAFE
Sbjct  109  SRLQALLAEGRVFCDMPALADRDSILIRDTCFENSLICQPQQRNIHGRIFGGFLMRRAFE  168

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA+++ YAFAG+AP F EVDH+DFL+PVDVGNFLR K CVLYTEL+NP +PLINVEVVAH
Sbjct  169  LAFSSTYAFAGAAPRFIEVDHVDFLRPVDVGNFLRLKCCVLYTELDNPDEPLINVEVVAH  228

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            V RPELRSSEVSNKFYFTF+V  +AL +G RIR VVP+TEEEARRV+ERMDAE
Sbjct  229  VMRPELRSSEVSNKFYFTFTVRPEALNDGLRIRKVVPSTEEEARRVLERMDAE  281



>ref|NP_001063681.1| Os09g0517700 [Oryza sativa Japonica Group]
 dbj|BAD33834.1| acyl-CoA thioester hydrolase-like [Oryza sativa Japonica Group]
 dbj|BAF25595.1| Os09g0517700 [Oryza sativa Japonica Group]
 dbj|BAG92421.1| unnamed protein product [Oryza sativa Japonica Group]
Length=502

 Score =   273 bits (697),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  870  K*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFL  691
            K + E  R+N LL EGRVF D+PALADRDSIL++DT L+NSLICQPQQRN+HGRIFGGFL
Sbjct  320  KLHVEAERLNSLLAEGRVFSDLPALADRDSILLKDTRLENSLICQPQQRNLHGRIFGGFL  379

Query  690  MRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLIN  511
            M RAFELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVLYT+L+N  QPL+N
Sbjct  380  MHRAFELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTQLDNAEQPLVN  439

Query  510  VEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VEVVAHVTRPELR SEVSN F+FTF+VCSDAL+NG +IR VVP+TEEEARR++ERMDAE
Sbjct  440  VEVVAHVTRPELRKSEVSNTFHFTFTVCSDALKNGLKIRHVVPSTEEEARRILERMDAE  498



>gb|EEC84891.1| hypothetical protein OsI_32054 [Oryza sativa Indica Group]
Length=502

 Score =   273 bits (697),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  870  K*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFL  691
            K + E  R+N LL EGRVF D+PALADRDSIL++DT L+NSLICQPQQRN+HGRIFGGFL
Sbjct  320  KLHVEAERLNSLLAEGRVFSDLPALADRDSILLKDTRLENSLICQPQQRNLHGRIFGGFL  379

Query  690  MRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLIN  511
            M RAFELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVLYT+L+N  QPL+N
Sbjct  380  MHRAFELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTQLDNAEQPLVN  439

Query  510  VEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VEVVAHVTRPELR SEVSN F+FTF+VCSDAL+NG +IR VVP+TEEEARR++ERMDAE
Sbjct  440  VEVVAHVTRPELRKSEVSNTFHFTFTVCSDALKNGLKIRHVVPSTEEEARRILERMDAE  498



>tpg|DAA40553.1| TPA: hypothetical protein ZEAMMB73_572549 [Zea mays]
Length=292

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R++ LL EGRVF D+PALADRDSIL++DT L+NSL+CQPQQRN+HGRIFGGFLM RA
Sbjct  114  EAERLDVLLAEGRVFSDLPALADRDSILLKDTRLENSLVCQPQQRNLHGRIFGGFLMHRA  173

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVLYT+L+NP QPL+NVEVV
Sbjct  174  FELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTQLDNPEQPLVNVEVV  233

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELR SEVSN F+FTF+VCSD L+NG +IR VVP+TEEEARR++ERM+AE
Sbjct  234  AHVTRPELRKSEVSNTFHFTFTVCSDTLKNGLKIRNVVPSTEEEARRILERMEAE  288



>ref|XP_010672467.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   272 bits (695),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            ++ RINELL EGRVF D+PALADRDSILI+DTCLQ+S+ICQPQQRNIHGRIFGGFLMR+A
Sbjct  308  DIIRINELLAEGRVFVDLPALADRDSILIRDTCLQSSIICQPQQRNIHGRIFGGFLMRKA  367

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG++P F EVDH+DF+KPVDVGNFLR KS VLYTE++NP +PLINVEVV
Sbjct  368  FELAFSTAYTFAGASPRFVEVDHVDFVKPVDVGNFLRMKSSVLYTEVQNPDRPLINVEVV  427

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELR+SE+SNKFYFTF+VC +A +NG +IR+V PA+EEEARRVIERMDAE
Sbjct  428  AHVTRPELRTSEISNKFYFTFTVCPEATKNGLKIRSVYPASEEEARRVIERMDAE  482



>gb|EAZ45378.1| hypothetical protein OsJ_30024 [Oryza sativa Japonica Group]
Length=526

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  870  K*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFL  691
            K + E  R+N LL EGRVF D+PALADRDSIL++DT L+NSLICQPQQRN+HGRIFGGFL
Sbjct  344  KLHVEAERLNSLLAEGRVFSDLPALADRDSILLKDTRLENSLICQPQQRNLHGRIFGGFL  403

Query  690  MRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLIN  511
            M RAFELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVLYT+L+N  QPL+N
Sbjct  404  MHRAFELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTQLDNAEQPLVN  463

Query  510  VEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VEVVAHVTRPELR SEVSN F+FTF+VCSDAL+NG +IR VVP+TEEEARR++ERMDAE
Sbjct  464  VEVVAHVTRPELRKSEVSNTFHFTFTVCSDALKNGLKIRHVVPSTEEEARRILERMDAE  522



>gb|KDP35138.1| hypothetical protein JCGZ_10672 [Jatropha curcas]
Length=327

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            R++ LL EGRVFCDMPALADRDSILI+ TC +NSLICQPQQRNIHGRIFGGFLMR+AFEL
Sbjct  149  RLHALLAEGRVFCDMPALADRDSILIKYTCHRNSLICQPQQRNIHGRIFGGFLMRKAFEL  208

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHV  490
            A++TAYAFAG+AP F EVDH+DF+KPVDVGNFLR  SCVLYTEL++P++P+INVEVVAHV
Sbjct  209  AFSTAYAFAGAAPRFLEVDHVDFVKPVDVGNFLRLNSCVLYTELDDPTKPMINVEVVAHV  268

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            TRPELRSSEVSNKFYFTF+V  +A+E+G RIR VVPATEEEARRV+ERMDAE
Sbjct  269  TRPELRSSEVSNKFYFTFTVRPEAIEDGLRIRNVVPATEEEARRVLERMDAE  320



>emb|CBI25684.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            +VNR+  LL EGR+FCDMPALADR+SIL++DTCL+NSLICQPQQRNIHGRIFGGFL+RRA
Sbjct  214  DVNRLEALLAEGRIFCDMPALADRESILLRDTCLENSLICQPQQRNIHGRIFGGFLIRRA  273

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG  PCF EVDH+DFL+PVDVG+FL FKSCVL+T+LENP QPLIN+EVV
Sbjct  274  FELAFSTAYVFAGMVPCFLEVDHVDFLRPVDVGDFLHFKSCVLFTQLENPEQPLINIEVV  333

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   S A +NG R+R VVPATEEEARR++ERMDAE
Sbjct  334  AHVTRPELRSSEVSNTFYFTFTVRPESKATKNGFRLRNVVPATEEEARRILERMDAE  390



>ref|XP_002274516.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Vitis 
vinifera]
Length=444

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADR+SIL++ TCL+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  257  EVNRLEALLAEGRIFCDMPALADRESILLRHTCLENSLICQPQQRNIHGRIFGGFLMHRA  316

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLRFKSCVL+T+LENP QPLIN+EVV
Sbjct  317  FELAFSTAYAFAGMVPCFLEVDHVDFLRPVDVGDFLRFKSCVLFTQLENPEQPLINIEVV  376

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   + A +NG RIR VVPATEEEARR++ERMDAE
Sbjct  377  AHVTRPELRSSEVSNTFYFTFTVRPEAKATKNGFRIRNVVPATEEEARRILERMDAE  433



>gb|KJB10812.1| hypothetical protein B456_001G226300 [Gossypium raimondii]
Length=440

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E+NR+  LL EGR+FCDMPALADRDSIL++DT L+N+LICQPQQRNIHGRIFGGFLM 
Sbjct  255  HGEINRLEALLAEGRIFCDMPALADRDSILLKDTHLENALICQPQQRNIHGRIFGGFLMH  314

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLR KSCVLYTELENP QPLINVE
Sbjct  315  RAFELAFSTAYAFAGLVPCFLEVDHVDFLRPVDVGDFLRLKSCVLYTELENPDQPLINVE  374

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVTRPE+R+SEVSN FYFTFSV   + A +NG +IR VVPATEEEARR++ERMDAE
Sbjct  375  VVAHVTRPEIRTSEVSNTFYFTFSVRPEAKATKNGFKIRNVVPATEEEARRILERMDAE  433



>ref|XP_002271578.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Vitis 
vinifera]
Length=443

 Score =   268 bits (686),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            +VNR+  LL EGR+FCDMPALADR+SIL++DTCL+NSLICQPQQRNIHGRIFGGFL+RRA
Sbjct  256  DVNRLEALLAEGRIFCDMPALADRESILLRDTCLENSLICQPQQRNIHGRIFGGFLIRRA  315

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG  PCF EVDH+DFL+PVDVG+FL FKSCVL+T+LENP QPLIN+EVV
Sbjct  316  FELAFSTAYVFAGMVPCFLEVDHVDFLRPVDVGDFLHFKSCVLFTQLENPEQPLINIEVV  375

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   S A +NG R+R VVPATEEEARR++ERMDAE
Sbjct  376  AHVTRPELRSSEVSNTFYFTFTVRPESKATKNGFRLRNVVPATEEEARRILERMDAE  432



>ref|XP_010068535.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Eucalyptus grandis]
Length=393

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+  LL EGRVFCDMPALADRDSILI+DTC +NSLICQPQQRNIHGRIFGGFLMRRAFE
Sbjct  215  SRLQALLAEGRVFCDMPALADRDSILIRDTCFENSLICQPQQRNIHGRIFGGFLMRRAFE  274

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA+++ YAFAG+AP F EVDH+DFL+PVDVGNFLR K CVLYTEL+NP +PLINVEVVAH
Sbjct  275  LAFSSTYAFAGAAPRFIEVDHVDFLRPVDVGNFLRLKCCVLYTELDNPDEPLINVEVVAH  334

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            V RPELRSSEVSNKFYFTF+V  +AL +G RIR VVP+TEEEARRV+ERMDAE
Sbjct  335  VMRPELRSSEVSNKFYFTFTVRPEALNDGLRIRKVVPSTEEEARRVLERMDAE  387



>emb|CBI25898.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            +VNR+  +L EGR+FCDMPALADR+SIL++DTCL+NSLICQPQQRNIHGRIFGGFL+RRA
Sbjct  214  DVNRLEAMLAEGRIFCDMPALADRESILLRDTCLENSLICQPQQRNIHGRIFGGFLIRRA  273

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG  PCF EVDH+DFL+PVDVG+FL FKSCVL+T+LENP QPLIN+EVV
Sbjct  274  FELAFSTAYVFAGMVPCFLEVDHVDFLRPVDVGDFLHFKSCVLFTQLENPEQPLINIEVV  333

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   S A +NG R+R VVPATEEEARR++ERMDAE
Sbjct  334  AHVTRPELRSSEVSNTFYFTFTVRPESKATKNGFRLRNVVPATEEEARRILERMDAE  390



>ref|XP_002264355.2| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Vitis vinifera]
Length=443

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            +VNR+  +L EGR+FCDMPALADR+SIL++DTCL+NSLICQPQQRNIHGRIFGGFL+RRA
Sbjct  256  DVNRLEAMLAEGRIFCDMPALADRESILLRDTCLENSLICQPQQRNIHGRIFGGFLIRRA  315

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG  PCF EVDH+DFL+PVDVG+FL FKSCVL+T+LENP QPLIN+EVV
Sbjct  316  FELAFSTAYVFAGMVPCFLEVDHVDFLRPVDVGDFLHFKSCVLFTQLENPEQPLINIEVV  375

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   S A +NG R+R VVPATEEEARR++ERMDAE
Sbjct  376  AHVTRPELRSSEVSNTFYFTFTVRPESKATKNGFRLRNVVPATEEEARRILERMDAE  432



>ref|XP_012084418.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Jatropha curcas]
 gb|KDP45196.1| hypothetical protein JCGZ_15061 [Jatropha curcas]
Length=441

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 167/191 (87%), Gaps = 4/191 (2%)
 Frame = -1

Query  894  RTERXQKRK*YXE--VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRN  721
            + +R ++RK Y    VNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRN
Sbjct  246  KRKRVEERKDYENGGVNRLEALLAEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRN  305

Query  720  IHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTE  541
            IHGRIFGGFLM RAFELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLR KSCVLYTE
Sbjct  306  IHGRIFGGFLMHRAFELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRLKSCVLYTE  365

Query  540  LENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV--CSDALENGPRIRTVVPATEEE  367
            LENP QPLIN+EVVAHVTRPELRSSEVSN+FYFTF+V   + A++NG R+R VVPATEEE
Sbjct  366  LENPEQPLINIEVVAHVTRPELRSSEVSNEFYFTFTVRPEAKAMKNGFRLRNVVPATEEE  425

Query  366  ARRVIERMDAE  334
            ARR++ERMDAE
Sbjct  426  ARRILERMDAE  436



>emb|CBI24710.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E +R+  LL EGRVFCDMPALADRDSILI+DT L+ ++ICQPQQRNIHGRIFGGFLMR+A
Sbjct  214  EADRLEALLAEGRVFCDMPALADRDSILIRDTRLEYTIICQPQQRNIHGRIFGGFLMRKA  273

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
             ELA++T YAFAG+AP F E DH+DFLKPVDVGNFLR KSCVLYTELENP++PLINVEVV
Sbjct  274  LELAFSTTYAFAGAAPLFVEADHVDFLKPVDVGNFLRLKSCVLYTELENPTRPLINVEVV  333

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+   +A+++G +IR+VVPATEEEARRV++RMDAE
Sbjct  334  AHVTRPELRSSEVSNTFYFTFTARPEAMKDGLKIRSVVPATEEEARRVLKRMDAE  388



>emb|CAN79406.1| hypothetical protein VITISV_000710 [Vitis vinifera]
Length=418

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E +R+  LL EGRVFCDMPALADRDSILI+DT L+ ++ICQPQQRNIHGRIFGGFLMR+A
Sbjct  235  EADRLEALLAEGRVFCDMPALADRDSILIRDTRLEYTIICQPQQRNIHGRIFGGFLMRKA  294

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
             ELA++T YAFAG+AP F E DH+DFLKPVDVGNFLR KSCVLYTELENP++PLINVEVV
Sbjct  295  LELAFSTTYAFAGAAPLFVEADHVDFLKPVDVGNFLRLKSCVLYTELENPTRPLINVEVV  354

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+   +A+++G +IR+VVPATEEEARRV++RMDAE
Sbjct  355  AHVTRPELRSSEVSNTFYFTFTARPEAMKDGLKIRSVVPATEEEARRVLKRMDAE  409



>gb|KHG11387.1| Acyl-coenzyme A thioesterase 9, mitochondrial [Gossypium arboreum]
Length=440

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E+NR+  LL EGR+FCDMPALADRDSIL++DT L+N+LICQPQQRNIHGRIFGGFLM 
Sbjct  255  HGEINRLEALLAEGRIFCDMPALADRDSILLKDTHLENALICQPQQRNIHGRIFGGFLMH  314

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLR KSCVLYTELE+P QPLINVE
Sbjct  315  RAFELAFSTAYAFAGLVPCFLEVDHVDFLRPVDVGDFLRLKSCVLYTELEDPDQPLINVE  374

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVTRPE+R+SEVSN FYFTFSV   + A +NG +IR VVPATEEEARR++ERMDAE
Sbjct  375  VVAHVTRPEIRTSEVSNTFYFTFSVRPEAKATKNGFKIRNVVPATEEEARRILERMDAE  433



>ref|XP_010039335.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW46056.1| hypothetical protein EUGRSUZ_L00029 [Eucalyptus grandis]
Length=461

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+  LL EGRVFCDMPALADRDSILI+DTC +NSLICQPQQRNIHGRIFGGFLMRRAFE
Sbjct  283  SRLQALLAEGRVFCDMPALADRDSILIRDTCFENSLICQPQQRNIHGRIFGGFLMRRAFE  342

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA+++ YAFAG AP F EVDH+DFL+PVDVGNFLR K CVLYTEL+NP +PLINVEVVAH
Sbjct  343  LAFSSTYAFAGVAPRFVEVDHVDFLRPVDVGNFLRLKCCVLYTELDNPDEPLINVEVVAH  402

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            V RPELRSSEVSNKFYFTF+V  +AL +G RIR VVP+TEEEARRV+ERMDAE
Sbjct  403  VMRPELRSSEVSNKFYFTFTVRPEALNDGLRIRKVVPSTEEEARRVLERMDAE  455



>ref|XP_003576735.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Brachypodium 
distachyon]
Length=500

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            R++ LL EGRVF D+PALADRDSIL++DT L+NSLICQPQQRN+HGRIFGGFLM RAFEL
Sbjct  325  RLDALLAEGRVFSDLPALADRDSILMRDTRLENSLICQPQQRNLHGRIFGGFLMHRAFEL  384

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHV  490
            A++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVLYT+LEN  QPL+NVEVVAHV
Sbjct  385  AFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTQLENKWQPLVNVEVVAHV  444

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            TRPELR SE+SN F+FTF+V SDALENG +IR VVP+TEEEARR++ERMDAE
Sbjct  445  TRPELRKSEISNTFHFTFTVGSDALENGLKIRNVVPSTEEEARRILERMDAE  496



>ref|XP_002532453.1| acyl-CoA thioesterase, putative [Ricinus communis]
 gb|EEF29939.1| acyl-CoA thioesterase, putative [Ricinus communis]
Length=452

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  262  EVNRLEALLAEGRIFCDMPALADRNSILLRDTRLENSLICQPQQRNIHGRIFGGFLMHRA  321

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLR KSCVLYTELENP QPLIN+EVV
Sbjct  322  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRLKSCVLYTELENPEQPLINIEVV  381

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSD--ALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V S+  A++NG RIR VVPATEEEARR++ER+DAE
Sbjct  382  AHVTRPELRSSEVSNTFYFTFTVRSEAKAMKNGFRIRNVVPATEEEARRILERIDAE  438



>ref|XP_010242486.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X2 [Nelumbo nucifera]
Length=540

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EV+R+  LL EGR+FCDMPALA+RDSIL++DT LQNSLICQPQQRN+HGRIFGGFLM RA
Sbjct  360  EVDRLEALLAEGRIFCDMPALANRDSILMRDTRLQNSLICQPQQRNMHGRIFGGFLMNRA  419

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFLKPVDVG+FLR KSCVLYTEL+NP  PLIN+EVV
Sbjct  420  FELAFSTAYAFAGMVPCFLEVDHVDFLKPVDVGDFLRLKSCVLYTELDNPELPLINIEVV  479

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN F+FTF+V  +A++NG RIR+VVPATEEEARRV++RMDAE
Sbjct  480  AHVTRPELRSSEVSNTFHFTFTVRPEAMKNGLRIRSVVPATEEEARRVLDRMDAE  534



>ref|XP_006492755.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=535

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+N LL EGR+FCDMPALADRDSILI+DTC +NSL+CQPQQRNIHGRIFGGFLMR+A E
Sbjct  356  DRLNALLAEGRIFCDMPALADRDSILIKDTCHENSLMCQPQQRNIHGRIFGGFLMRKASE  415

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA++TAY FAG+AP F EVDH+DFLKPVDVGNFLR KSCVLYTELENP++PLINVEVVAH
Sbjct  416  LAFSTAYTFAGAAPLFVEVDHVDFLKPVDVGNFLRLKSCVLYTELENPARPLINVEVVAH  475

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VT PELR+SE+SNKFYFTF++  +  ++G  IR VVPATEEEARRV+ERMDAE
Sbjct  476  VTSPELRASEISNKFYFTFTIRPEVKKDGLSIRNVVPATEEEARRVLERMDAE  528



>ref|XP_007033682.1| Thioesterase/thiol ester dehydrase-isomerase superfamily protein 
isoform 3 [Theobroma cacao]
 gb|EOY04608.1| Thioesterase/thiol ester dehydrase-isomerase superfamily protein 
isoform 3 [Theobroma cacao]
Length=500

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+  LL EGRVFCDMPALADRDSILI+DTC +NSLICQPQQRNIHGRIFGGFLMR+AFE
Sbjct  325  DRLYSLLAEGRVFCDMPALADRDSILIRDTCHENSLICQPQQRNIHGRIFGGFLMRKAFE  384

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA++ AYAFAG+APCF EVDHIDF KPVDVGNFLR KS VLYTE+EN ++PLINVEVVAH
Sbjct  385  LAFSNAYAFAGAAPCFLEVDHIDFFKPVDVGNFLRLKSSVLYTEVENRAKPLINVEVVAH  444

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VTRPELRSSEVSNKFYFTF+V  +A++ G RIR VVPATEEEARRV+E MDAE
Sbjct  445  VTRPELRSSEVSNKFYFTFTVRPEAMKEGLRIRNVVPATEEEARRVLEHMDAE  497



>ref|XP_006442141.1| hypothetical protein CICLE_v10019655mg [Citrus clementina]
 gb|ESR55381.1| hypothetical protein CICLE_v10019655mg [Citrus clementina]
Length=535

 Score =   269 bits (687),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+N LL EGR+FCDMPALADRDSILI+DTC +NSL+CQPQQRNIHGRIFGGFLMR+A E
Sbjct  356  DRLNALLAEGRIFCDMPALADRDSILIKDTCHENSLMCQPQQRNIHGRIFGGFLMRKASE  415

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA++TAY FAG+AP F EVDH+DFLKPVDVGNFLR KSCVLYTELENP++PLINVEVVAH
Sbjct  416  LAFSTAYTFAGAAPLFVEVDHVDFLKPVDVGNFLRLKSCVLYTELENPARPLINVEVVAH  475

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VT PELR+SE+SNKFYFTF++  +  ++G  IR VVPATEEEARRV+ERMDAE
Sbjct  476  VTSPELRASEISNKFYFTFTIRPEVKKDGLSIRNVVPATEEEARRVLERMDAE  528



>ref|XP_002462673.1| hypothetical protein SORBIDRAFT_02g030010 [Sorghum bicolor]
 gb|EER99194.1| hypothetical protein SORBIDRAFT_02g030010 [Sorghum bicolor]
Length=524

 Score =   268 bits (685),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R++ LL EGRVF D+PALADRDSIL++DT L+NSL+CQPQQRN+HGRIFGGFLM RA
Sbjct  346  EAERLDALLAEGRVFSDLPALADRDSILMKDTRLENSLVCQPQQRNLHGRIFGGFLMHRA  405

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVLYT+L+NP QPL+NVEVV
Sbjct  406  FELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTQLDNPEQPLVNVEVV  465

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELR SEVSN F+FTF+VCSD L+NG +IR VVP+TEEEARR++ERM+AE
Sbjct  466  AHVTRPELRKSEVSNTFHFTFTVCSDMLKNGLKIRNVVPSTEEEARRILERMEAE  520



>ref|XP_008670323.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Zea 
mays]
Length=512

 Score =   268 bits (684),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R++ LL EGRVF D+PALADRDSIL++DT L+NSL+CQPQQRN+HGRIFGGFLM RA
Sbjct  334  EAERLDVLLAEGRVFSDLPALADRDSILLKDTRLENSLVCQPQQRNLHGRIFGGFLMHRA  393

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVLYT+L+NP QPL+NVEVV
Sbjct  394  FELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTQLDNPEQPLVNVEVV  453

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELR SEVSN F+FTF+VCSD L+NG +IR VVP+TEEEARR++ERM+AE
Sbjct  454  AHVTRPELRKSEVSNTFHFTFTVCSDTLKNGLKIRNVVPSTEEEARRILERMEAE  508



>ref|XP_007033680.1| Thioesterase/thiol ester dehydrase-isomerase superfamily protein 
isoform 1 [Theobroma cacao]
 ref|XP_007033681.1| Thioesterase/thiol ester dehydrase-isomerase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY04606.1| Thioesterase/thiol ester dehydrase-isomerase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY04607.1| Thioesterase/thiol ester dehydrase-isomerase superfamily protein 
isoform 1 [Theobroma cacao]
Length=524

 Score =   268 bits (684),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+  LL EGRVFCDMPALADRDSILI+DTC +NSLICQPQQRNIHGRIFGGFLMR+AFE
Sbjct  349  DRLYSLLAEGRVFCDMPALADRDSILIRDTCHENSLICQPQQRNIHGRIFGGFLMRKAFE  408

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA++ AYAFAG+APCF EVDHIDF KPVDVGNFLR KS VLYTE+EN ++PLINVEVVAH
Sbjct  409  LAFSNAYAFAGAAPCFLEVDHIDFFKPVDVGNFLRLKSSVLYTEVENRAKPLINVEVVAH  468

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VTRPELRSSEVSNKFYFTF+V  +A++ G RIR VVPATEEEARRV+E MDAE
Sbjct  469  VTRPELRSSEVSNKFYFTFTVRPEAMKEGLRIRNVVPATEEEARRVLEHMDAE  521



>ref|XP_004957366.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Setaria italica]
Length=514

 Score =   268 bits (684),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R+N LL EGRVF D+PALADRDSIL++DT L+NSL+CQPQQRN+HGRIFGGFLM RA
Sbjct  336  EAERLNALLAEGRVFSDLPALADRDSILLKDTRLENSLVCQPQQRNLHGRIFGGFLMHRA  395

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVLYT+L+NP QPL+NVEVV
Sbjct  396  FELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTQLDNPEQPLVNVEVV  455

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELR SEVSN F+FTF+VCS+ L+NG +IR VVP+TEEEARR++ERM+AE
Sbjct  456  AHVTRPELRKSEVSNTFHFTFTVCSNMLKNGLKIRNVVPSTEEEARRILERMEAE  510



>ref|XP_006410113.1| hypothetical protein EUTSA_v10017006mg [Eutrema salsugineum]
 gb|ESQ51566.1| hypothetical protein EUTSA_v10017006mg [Eutrema salsugineum]
Length=297

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R E  ++ +   ++ R+NELL EGRVF DMPALADRDSI I+DTC +NSLICQPQQRNIH
Sbjct  105  RAESKEEHEKLKDLERLNELLAEGRVFLDMPALADRDSIQIKDTCHENSLICQPQQRNIH  164

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD +DF+KPVDVGNFLRF+S VLYTE  
Sbjct  165  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFQSRVLYTEAN  224

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PLIN+EV+AHVT PELRSSEVSNKFYFTFSV  +A+++G RIR VVPATEEEARRV
Sbjct  225  NSAEPLINIEVIAHVTSPELRSSEVSNKFYFTFSVRPEAMKDGLRIRNVVPATEEEARRV  284

Query  354  IERMDAE  334
            IERMDAE
Sbjct  285  IERMDAE  291



>ref|XP_008788163.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Phoenix 
dactylifera]
Length=436

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            R+  LL EG VFCD+PALADRDSILI+DT L+NSLICQPQQRN+HGRIFGGFLM  AFEL
Sbjct  261  RLKVLLAEGLVFCDLPALADRDSILIRDTSLENSLICQPQQRNLHGRIFGGFLMNLAFEL  320

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHV  490
            A++TAYAF G  PCF EVDH+DFLKPVDVG+FLR KSCVLYT+LENP QPLIN+EVVAHV
Sbjct  321  AFSTAYAFVGQMPCFLEVDHVDFLKPVDVGDFLRLKSCVLYTQLENPEQPLINIEVVAHV  380

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            TRPELR+SEVSN FYFTF+V  +AL+NG RIR VVPATEEEARRV+ERMDAE
Sbjct  381  TRPELRTSEVSNTFYFTFTVNPNALKNGLRIRNVVPATEEEARRVLERMDAE  432



>ref|XP_009420138.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=590

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + ++ R+  LL EGRVFCD+PALA RDSILI+DT L+NSLICQPQQRN+HGRIFGGFLM 
Sbjct  410  HGDIKRLKTLLAEGRVFCDLPALAARDSILIRDTKLENSLICQPQQRNLHGRIFGGFLMN  469

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
             AFELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLR KSCVLYT+LENP+QPLINVE
Sbjct  470  LAFELAFSTAYAFVGQMPCFLEVDHVDFLKPVDVGDFLRLKSCVLYTQLENPAQPLINVE  529

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVTRPELR+SE+SN FYFTF+V  DAL+NG +IR VVPATEEEARRV+ERMDAE
Sbjct  530  VVAHVTRPELRTSEISNMFYFTFTVNPDALKNGLKIRNVVPATEEEARRVLERMDAE  586



>ref|XP_009420137.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=591

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + ++ R+  LL EGRVFCD+PALA RDSILI+DT L+NSLICQPQQRN+HGRIFGGFLM 
Sbjct  411  HGDIKRLKTLLAEGRVFCDLPALAARDSILIRDTKLENSLICQPQQRNLHGRIFGGFLMN  470

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
             AFELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLR KSCVLYT+LENP+QPLINVE
Sbjct  471  LAFELAFSTAYAFVGQMPCFLEVDHVDFLKPVDVGDFLRLKSCVLYTQLENPAQPLINVE  530

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVTRPELR+SE+SN FYFTF+V  DAL+NG +IR VVPATEEEARRV+ERMDAE
Sbjct  531  VVAHVTRPELRTSEISNMFYFTFTVNPDALKNGLKIRNVVPATEEEARRVLERMDAE  587



>ref|XP_007049522.1| Thioesterase/thiol ester dehydrase-isomerase superfamily protein 
[Theobroma cacao]
 gb|EOX93679.1| Thioesterase/thiol ester dehydrase-isomerase superfamily protein 
[Theobroma cacao]
Length=440

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E+NR+  LL EGR+FCDMPALADRDSIL++DT L+N++ICQPQQRNIHGRIFGGFLM RA
Sbjct  257  ELNRLESLLAEGRIFCDMPALADRDSILLRDTHLENAMICQPQQRNIHGRIFGGFLMHRA  316

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLR KSCVLYTELENP QPLINVEVV
Sbjct  317  FELAFSTAYAFAGLVPCFLEVDHVDFLRPVDVGDFLRLKSCVLYTELENPDQPLINVEVV  376

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPE+RSSEVSN FYFTF++   + A +NG +IR VVPATEEE RR+IERMDAE
Sbjct  377  AHVTRPEIRSSEVSNTFYFTFTLRPEAKATKNGFKIRNVVPATEEEGRRIIERMDAE  433



>ref|XP_012075390.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Jatropha curcas]
Length=553

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            R++ LL EGRVFCDMPALADRDSILI+ TC +NSLICQPQQRNIHGRIFGGFLMR+AFEL
Sbjct  375  RLHALLAEGRVFCDMPALADRDSILIKYTCHRNSLICQPQQRNIHGRIFGGFLMRKAFEL  434

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHV  490
            A++TAYAFAG+AP F EVDH+DF+KPVDVGNFLR  SCVLYTEL++P++P+INVEVVAHV
Sbjct  435  AFSTAYAFAGAAPRFLEVDHVDFVKPVDVGNFLRLNSCVLYTELDDPTKPMINVEVVAHV  494

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            TRPELRSSEVSNKFYFTF+V  +A+E+G RIR VVPATEEEARRV+ERMDAE
Sbjct  495  TRPELRSSEVSNKFYFTFTVRPEAIEDGLRIRNVVPATEEEARRVLERMDAE  546



>ref|XP_006410174.1| hypothetical protein EUTSA_v10016640mg [Eutrema salsugineum]
 gb|ESQ51627.1| hypothetical protein EUTSA_v10016640mg [Eutrema salsugineum]
Length=456

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R E  ++ +   ++ R+NELL EGRVF DMPALADRDSILI+DTC +NSLICQPQQRNIH
Sbjct  264  RAESKEEHEKLKDLERLNELLAEGRVFQDMPALADRDSILIKDTCHENSLICQPQQRNIH  323

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD +DF+KPVDVGNFLRFKS VLYTE  
Sbjct  324  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFKSRVLYTEAN  383

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PLIN+EV+AHVT PELRSSEVSNKFYFTFSV  +A+++G RIR VVPATEEEARRV
Sbjct  384  NSAEPLINIEVIAHVTSPELRSSEVSNKFYFTFSVRPEAMKDGLRIRNVVPATEEEARRV  443

Query  354  IERMDAE  334
            IERMDAE
Sbjct  444  IERMDAE  450



>ref|XP_002275033.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Vitis 
vinifera]
Length=520

 Score =   265 bits (678),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E +R+  LL EGRVFCDMPALADRDSILI+DT L+ ++ICQPQQRNIHGRIFGGFLMR+A
Sbjct  337  EADRLEALLAEGRVFCDMPALADRDSILIRDTRLEYTIICQPQQRNIHGRIFGGFLMRKA  396

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
             ELA++T YAFAG+AP F E DH+DFLKPVDVGNFLR KSCVLYTELENP++PLINVEVV
Sbjct  397  LELAFSTTYAFAGAAPLFVEADHVDFLKPVDVGNFLRLKSCVLYTELENPTRPLINVEVV  456

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+   +A+++G +IR+VVPATEEEARRV++RMDAE
Sbjct  457  AHVTRPELRSSEVSNTFYFTFTARPEAMKDGLKIRSVVPATEEEARRVLKRMDAE  511



>gb|KJB42642.1| hypothetical protein B456_007G161500 [Gossypium raimondii]
Length=431

 Score =   263 bits (671),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVN++  LL EGR+FCDMPALADRDSIL++DT L+N+LICQPQQRNIHGRIFGGFLM RA
Sbjct  249  EVNQLEPLLAEGRIFCDMPALADRDSILLRDTRLENALICQPQQRNIHGRIFGGFLMHRA  308

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG  PCF EVDH+DFL+PVDVG+FLR  SCVLYT+LENP QPLINVEVV
Sbjct  309  FELAFSTAYVFAGLVPCFLEVDHVDFLRPVDVGDFLRLTSCVLYTKLENPDQPLINVEVV  368

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPE+RSSEVSN FYFTFSV   + A +NG +IR VVPATEEEARR++ERMDAE
Sbjct  369  AHVTRPEIRSSEVSNTFYFTFSVRPEAKATKNGFKIRNVVPATEEEARRILERMDAE  425



>gb|AGA17934.1| TE4 [Humulus lupulus]
Length=527

 Score =   265 bits (678),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            + R+N LL EGRVFCD+PALADR+SIL++DTCL+NS ICQPQQRNI+GRIFGGFLMRRA 
Sbjct  342  IERLNALLAEGRVFCDLPALADRNSILMKDTCLENSFICQPQQRNIYGRIFGGFLMRRAV  401

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++T Y+FAG    F EVDH+DFL+PVDVG+FLR KSCVLYTEL+NP++PLINVEVVA
Sbjct  402  ELAFSTTYSFAGVVTHFLEVDHVDFLRPVDVGDFLRLKSCVLYTELQNPTEPLINVEVVA  461

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            HVTRPELRSSEVSNKFYFTFSV  +A+++G  +R VVPATEEEARRV+ERMDAE
Sbjct  462  HVTRPELRSSEVSNKFYFTFSVGPEAVKDGLLVRNVVPATEEEARRVLERMDAE  515



>ref|XP_006447921.1| hypothetical protein CICLE_v10015268mg [Citrus clementina]
 ref|XP_006469361.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Citrus sinensis]
 gb|ESR61161.1| hypothetical protein CICLE_v10015268mg [Citrus clementina]
 gb|KDO43528.1| hypothetical protein CISIN_1g013560mg [Citrus sinensis]
Length=441

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGRV CDMPALADR+SIL++DT L+N+LICQPQQRNIHGRIFGGFLM RA
Sbjct  258  EVNRLEALLAEGRVICDMPALADRNSILLRDTRLENALICQPQQRNIHGRIFGGFLMLRA  317

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLRFKSCVLYTELENP QPLIN+EVV
Sbjct  318  FELAFSTAYAFAGLMPCFLEVDHVDFLRPVDVGDFLRFKSCVLYTELENPDQPLINIEVV  377

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPE RSSEVSN FYFTF+V S A+ NG RIR VVP T+EEAR ++ERMDA+
Sbjct  378  AHVTRPEFRSSEVSNTFYFTFTV-SKAVTNGFRIRNVVPGTQEEARHILERMDAK  431



>ref|XP_010101356.1| BTB/POZ and TAZ domain-containing protein 3 [Morus notabilis]
 gb|EXB88303.1| BTB/POZ and TAZ domain-containing protein 3 [Morus notabilis]
Length=812

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            + +R++ LL EGR+FCDMPALADRDSILI+DT L+NS +CQPQQRNIHGRIFGGFLMRRA
Sbjct  629  DADRLDALLAEGRIFCDMPALADRDSILIRDTYLENSFVCQPQQRNIHGRIFGGFLMRRA  688

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++T Y+FAG AP F EVDH+DF KPVDVGNFLR KSCVLYTELENP++PLINVEVV
Sbjct  689  FELAFSTTYSFAGVAPHFLEVDHVDFFKPVDVGNFLRMKSCVLYTELENPAEPLINVEVV  748

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSNKFYFTFSV  +A+++G RIR VVPATEEEA+RV+ERMDAE
Sbjct  749  AHVTRPELRSSEVSNKFYFTFSVHPEAVKDGLRIRNVVPATEEEAKRVLERMDAE  803



>emb|CDP03996.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R+  LLGEGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  214  EFGRLEALLGEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRNIHGRIFGGFLMHRA  273

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLRFKSCVLYTEL+N  QPLIN+EVV
Sbjct  274  FELAFSTAYAFAGVMPCFLEVDHVDFLRPVDVGDFLRFKSCVLYTELQNTDQPLINIEVV  333

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN+FYFTF+V   + A+ +  RIR VVPATEEEARR++E MDA+
Sbjct  334  AHVTRPELRSSEVSNRFYFTFTVHPEAKAMNDRVRIRKVVPATEEEARRILEHMDAD  390



>ref|XP_004148940.2| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Cucumis 
sativus]
 gb|KGN44711.1| hypothetical protein Csa_7G373540 [Cucumis sativus]
Length=489

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            + RI+ LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM+RAF
Sbjct  304  IKRIDALLAEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRNIHGRIFGGFLMQRAF  363

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAY FAG  P F EVDH+DFLKPVDVG+FLRF SCVLYTE++NP QPLINVEVVA
Sbjct  364  ELAFSTAYVFAGMVPYFFEVDHVDFLKPVDVGDFLRFTSCVLYTEVDNPDQPLINVEVVA  423

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE+RSSEVSN FYFTF+V  +A  NG   R+R+VVPATEEEARR+IERMDAE
Sbjct  424  HVTRPEIRSSEVSNTFYFTFTVRPEAKANGKGFRLRSVVPATEEEARRIIERMDAE  479



>ref|XP_008338228.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Malus domestica]
Length=452

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E+N +  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  265  ELNXVKTLLAEGRIFCDMPALADRDSILLKDTRLENSLICQPQQRNIHGRIFGGFLMHRA  324

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFLKPVDVG+FLRFKSCVLYTE++NP QPLIN+EVV
Sbjct  325  FELAFSTAYAFAGLVPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTEVQNPDQPLINIEVV  384

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRS+EVSN FYFTF+V   + A +NG RI  VVPATEEEAR ++ERMDA+
Sbjct  385  AHVTRPELRSTEVSNTFYFTFTVRPEAKATKNGFRILNVVPATEEEARHIVERMDAQ  441



>ref|XP_007153715.1| hypothetical protein PHAVU_003G058900g [Phaseolus vulgaris]
 gb|ESW25709.1| hypothetical protein PHAVU_003G058900g [Phaseolus vulgaris]
Length=464

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R  + QK     + +R+  LL E R+FCDMPALA+RDSIL++DTCLQNS ICQPQQRNIH
Sbjct  260  RKNQEQKHGECEDTSRLKALLAEARIFCDMPALANRDSILMKDTCLQNSFICQPQQRNIH  319

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMRRAFELA++TAYAFAG+AP F EVDH+DFLKPVDVGNFLR KSCVLYTEL+
Sbjct  320  GRIFGGFLMRRAFELAFSTAYAFAGAAPHFLEVDHVDFLKPVDVGNFLRLKSCVLYTELD  379

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PL+NVEV+AHVT+PE RSSEVSN+FYFTF V  +++ENG RIR VVPA EEEAR+V
Sbjct  380  NLAEPLVNVEVIAHVTKPEDRSSEVSNRFYFTFGVDPESVENGLRIRHVVPAIEEEARKV  439

Query  354  IERMDAE  334
            +ER+DAE
Sbjct  440  LERIDAE  446



>ref|XP_011001821.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Populus euphratica]
Length=554

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            ++ R+N LL EGRVF DMPALADRDSILIQDT  +N+ ICQPQQRNIHGRIFGGFLMR+A
Sbjct  373  DMERLNALLSEGRVFIDMPALADRDSILIQDTRHENTFICQPQQRNIHGRIFGGFLMRKA  432

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++ AYAFAG+AP F EVDH+DF +PVDVGNFLR KSC+LYTELENP++PLINVEVV
Sbjct  433  FELAFSNAYAFAGAAPLFVEVDHVDFFRPVDVGNFLRLKSCILYTELENPAEPLINVEVV  492

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSNKF FTF+V  +A+++G RIR VVPATEEEARRV+ERMD+E
Sbjct  493  AHVTRPELRSSEVSNKFCFTFTVLHEAIKDGLRIRNVVPATEEEARRVLERMDSE  547



>ref|XP_009358935.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Pyrus 
x bretschneideri]
Length=471

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRN+HGRIFGGFLM RA
Sbjct  284  EVNRLETLLAEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRNMHGRIFGGFLMHRA  343

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFLKPVDVG+FLRFKSCVLYTE+ NP QPLIN+EVV
Sbjct  344  FELAFSTAYAFAGLVPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTEVHNPDQPLINIEVV  403

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   + A ++G R+  VVPATEEEAR ++ERMDA+
Sbjct  404  AHVTRPELRSSEVSNTFYFTFTVRPEAKATKDGFRLLNVVPATEEEARHIVERMDAQ  460



>ref|XP_010069570.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Eucalyptus 
grandis]
 gb|KCW57956.1| hypothetical protein EUGRSUZ_H00690 [Eucalyptus grandis]
Length=431

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
              R+NELL EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  252  AKRLNELLTEGRIFSDMPALADRNSILLRDTHLENSLICQPQQRNIHGRIFGGFLMHRAF  311

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLRFKSCVLYTE E P  PLI VEVVA
Sbjct  312  ELAFSTAYAFAGLVPCFLEVDHVDFLRPVDVGDFLRFKSCVLYTEPEKPDGPLIFVEVVA  371

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDA--LENGPRIRTVVPATEEEARRVIERMDAE  334
            HVTRPELRSSEVSN FYFTF+V  +A  LENG RIR VVPATEEEARR++ERMDAE
Sbjct  372  HVTRPELRSSEVSNTFYFTFTVRPEAKSLENGFRIRNVVPATEEEARRILERMDAE  427



>ref|XP_006294180.1| hypothetical protein CARUB_v10023175mg [Capsella rubella]
 gb|EOA27078.1| hypothetical protein CARUB_v10023175mg [Capsella rubella]
Length=458

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R E  ++ +   ++ R+NELL EGRVF DMPALADR+SILI+DT  +NSLICQPQQRNIH
Sbjct  266  RAEIKEEHEKLKDLERLNELLAEGRVFLDMPALADRNSILIKDTSHENSLICQPQQRNIH  325

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD +DF+KPVDVGNFLRFKS VLYTE  
Sbjct  326  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFKSRVLYTEAN  385

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PLIN+EVVAHVT PELRSSEVSN+FYFTFSV  +A+++G RIR VVPATEEEARRV
Sbjct  386  NSAEPLINIEVVAHVTSPELRSSEVSNRFYFTFSVRPEAMKDGLRIRNVVPATEEEARRV  445

Query  354  IERMDAE  334
            IERMDAE
Sbjct  446  IERMDAE  452



>gb|EMS57541.1| hypothetical protein TRIUR3_18585 [Triticum urartu]
Length=414

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R+  LL EGRVF D PALADRDSIL++DT L+ S+ICQPQQRN++GRIFGGFLM RA
Sbjct  236  EAERLKALLAEGRVFSDFPALADRDSILMKDTRLETSMICQPQQRNLYGRIFGGFLMHRA  295

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVL+T+LEN  QPL+NVEVV
Sbjct  296  FELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLFTQLENKWQPLVNVEVV  355

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELR SE+SN F+FTFSV SDAL+NG  IR VVP+TEEEARR++ RMDAE
Sbjct  356  AHVTRPELRKSEISNTFHFTFSVGSDALKNGVNIRNVVPSTEEEARRILNRMDAE  410



>ref|XP_006858821.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Amborella 
trichopoda]
 gb|ERN20288.1| hypothetical protein AMTR_s00066p00174270 [Amborella trichopoda]
Length=430

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            R+  LL EGR+ CDMPALADRDSIL++DT L+NSLICQPQQRN+HGRIFGGFLM RAFEL
Sbjct  257  RLRALLSEGRILCDMPALADRDSILLRDTRLENSLICQPQQRNLHGRIFGGFLMHRAFEL  316

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHV  490
            AY+T YAF G  P F EVDH+DFL+PVDVG+FLRFKSC+LYT+LENP QPLIN+EVVAHV
Sbjct  317  AYSTCYAFVGRMPRFLEVDHVDFLRPVDVGDFLRFKSCILYTQLENPKQPLINIEVVAHV  376

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            TRPELRSSEVSN FYFTF+V  DAL++  RIR VVPATEEEARRV+ER DAE
Sbjct  377  TRPELRSSEVSNTFYFTFTVNPDALKDDLRIRNVVPATEEEARRVLERRDAE  428



>ref|XP_011089584.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=432

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E NR+  LL EGR+FCDMPALADRDSIL++DTCL+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  254  EANRLEALLAEGRIFCDMPALADRDSILLKDTCLENSLICQPQQRNIHGRIFGGFLMHRA  313

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG  P F EVD++DFL+PVDVG+FLRFKSCVLYTE E+  +PLI+VEVV
Sbjct  314  FELAFSTAYTFAGMMPSFLEVDNVDFLRPVDVGDFLRFKSCVLYTECESSDRPLIHVEVV  373

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN+FYFTF+V   + A+ N  RIR VVPATEEEA R+IERMDA+
Sbjct  374  AHVTRPELRSSEVSNRFYFTFTVRPEAKAMNNSHRIRKVVPATEEEAHRIIERMDAD  430



>ref|XP_011089585.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=430

 Score =   257 bits (657),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E NR+  LL EGR+FCDMPALADRDSIL++DTCL+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  252  EANRLEALLAEGRIFCDMPALADRDSILLKDTCLENSLICQPQQRNIHGRIFGGFLMHRA  311

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG  P F EVD++DFL+PVDVG+FLRFKSCVLYTE E+  +PLI+VEVV
Sbjct  312  FELAFSTAYTFAGMMPSFLEVDNVDFLRPVDVGDFLRFKSCVLYTECESSDRPLIHVEVV  371

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN+FYFTF+V   + A+ N  RIR VVPATEEEA R+IERMDA+
Sbjct  372  AHVTRPELRSSEVSNRFYFTFTVRPEAKAMNNSHRIRKVVPATEEEAHRIIERMDAD  428



>ref|XP_003608127.1| Acyl-coenzyme A thioesterase [Medicago truncatula]
Length=438

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            R+  LL EGR+F DMPALADRDSILI+DTCLQNS ICQPQQRNIHGRIFGGFLMRRAFEL
Sbjct  265  RLRALLTEGRIFSDMPALADRDSILIKDTCLQNSFICQPQQRNIHGRIFGGFLMRRAFEL  324

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHV  490
            A++TAY FAG+AP F EVDH+DF KPVDVG+FLR KSCVLYTELENP++PL+NVEV+AHV
Sbjct  325  AFSTAYVFAGAAPHFLEVDHVDFFKPVDVGSFLRLKSCVLYTELENPARPLVNVEVIAHV  384

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            T+PELRSSEVSN+FYFTF V  +A++NG RIR VVP TE EA++V+ER+DAE
Sbjct  385  TKPELRSSEVSNRFYFTFGVDPEAVKNGLRIRNVVPGTEVEAQKVLERIDAE  436



>ref|XP_002323914.2| hypothetical protein POPTR_0017s04250g [Populus trichocarpa]
 gb|EEF04047.2| hypothetical protein POPTR_0017s04250g [Populus trichocarpa]
Length=554

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            ++ R+N LL EGRVF DMPALADRDSILIQDT  +N+ ICQPQQRNIHGRIFGGFLMR+A
Sbjct  373  DMERLNALLSEGRVFIDMPALADRDSILIQDTRHENTFICQPQQRNIHGRIFGGFLMRKA  432

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++ AYAFAG+AP F EVDH+DF +PVDVGNFLR KSC+LYTE+ENP++PLINVEVV
Sbjct  433  FELAFSNAYAFAGAAPLFVEVDHVDFFRPVDVGNFLRLKSCILYTEVENPAEPLINVEVV  492

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSNKF FTF+V  +A+++G RIR VVPATEEEARRV+ERMD+E
Sbjct  493  AHVTRPELRSSEVSNKFCFTFTVLHEAIKDGLRIRNVVPATEEEARRVLERMDSE  547



>ref|XP_002301770.2| hypothetical protein POPTR_0002s24110g [Populus trichocarpa]
 gb|EEE81043.2| hypothetical protein POPTR_0002s24110g [Populus trichocarpa]
Length=444

 Score =   258 bits (658),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  258  EVNRLEALLAEGRIFCDMPALADRDSILLRDTHLENSLICQPQQRNIHGRIFGGFLMHRA  317

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLR KSCVLYTE E+  +PLIN+EVV
Sbjct  318  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRIKSCVLYTEHEDSEKPLINIEVV  377

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   + A+ NG RIR VVPATEEEARRV++RMDAE
Sbjct  378  AHVTRPELRSSEVSNTFYFTFTVRREAKAMNNGFRIRKVVPATEEEARRVLKRMDAE  434



>gb|AES90324.2| acyl-CoA thioesterase, putative [Medicago truncatula]
Length=451

 Score =   258 bits (659),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            + +  QK     +  R+  LL EGR+F DMPALADRDSILI+DTCLQNS ICQPQQRNIH
Sbjct  263  KKKEEQKHGENADNARLRALLTEGRIFSDMPALADRDSILIKDTCLQNSFICQPQQRNIH  322

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMRRAFELA++TAY FAG+AP F EVDH+DF KPVDVG+FLR KSCVLYTELE
Sbjct  323  GRIFGGFLMRRAFELAFSTAYVFAGAAPHFLEVDHVDFFKPVDVGSFLRLKSCVLYTELE  382

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            NP++PL+NVEV+AHVT+PELRSSEVSN+FYFTF V  +A++NG RIR VVP TE EA++V
Sbjct  383  NPARPLVNVEVIAHVTKPELRSSEVSNRFYFTFGVDPEAVKNGLRIRNVVPGTEVEAQKV  442

Query  354  IERMDAE  334
            +ER+DAE
Sbjct  443  LERIDAE  449



>gb|KHN31009.1| Acyl-coenzyme A thioesterase 9, mitochondrial [Glycine soja]
Length=484

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R ++ QK     +  R+  LL EGR+FCDMPALA+RDS+L++DTCLQNS ICQPQQRNIH
Sbjct  273  RMKQEQKHGESEDPARLKALLAEGRIFCDMPALANRDSVLMKDTCLQNSFICQPQQRNIH  332

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMRRAFELA++TAYAFAG+AP F EVDH+DF KPVDVGNFLR KSCVLYTEL+
Sbjct  333  GRIFGGFLMRRAFELAFSTAYAFAGAAPHFLEVDHVDFFKPVDVGNFLRLKSCVLYTELD  392

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PL+NVEVVAHVT+PE RSSEVSN+FYFTF V   A++NG R+  VVPATEEEAR+V
Sbjct  393  NIAEPLVNVEVVAHVTKPEHRSSEVSNRFYFTFGVDPVAIKNGLRLLHVVPATEEEARKV  452

Query  354  IERMDAE  334
            +ERMDAE
Sbjct  453  LERMDAE  459



>ref|XP_008447218.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Cucumis 
melo]
 ref|XP_008447219.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Cucumis 
melo]
Length=489

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            + RI+ LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM+RAF
Sbjct  304  LKRIDALLAEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRNIHGRIFGGFLMQRAF  363

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAY FAG  P F EVDH+DFLKPVDVG+FLRF SCVLYTE++NP  PLIN+EVVA
Sbjct  364  ELAFSTAYVFAGMVPYFFEVDHVDFLKPVDVGDFLRFTSCVLYTEVDNPDHPLINIEVVA  423

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE+RSSEVSN FYFTF+V  +A  NG   R+R VVPATEEEARR+IERMDAE
Sbjct  424  HVTRPEIRSSEVSNTFYFTFTVRPEAKANGKGFRLRNVVPATEEEARRIIERMDAE  479



>gb|AGA17932.1| TE2 [Humulus lupulus]
Length=437

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 154/177 (87%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E NR+  LL EGR+FCDMPALADRDSIL++DT  +NSLICQPQQRNIHGRIFGGFL+ RA
Sbjct  258  EANRLQTLLAEGRIFCDMPALADRDSILLRDTRQENSLICQPQQRNIHGRIFGGFLLHRA  317

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F E+DH+DF +PVDVG+FLR KSCVLYTEL NP QPLIN+EVV
Sbjct  318  FELAFSTAYAFAGLVPYFLEIDHVDFXRPVDVGDFLRLKSCVLYTELHNPDQPLINIEVV  377

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   + A +NG RIR VVPATEEEARR++ERMDAE
Sbjct  378  AHVTRPELRSSEVSNTFYFTFTVRPEAKATKNGYRIRNVVPATEEEARRILERMDAE  434



>ref|XP_004290108.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=435

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 162/190 (85%), Gaps = 4/190 (2%)
 Frame = -1

Query  894  RTERXQKRK*-YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNI  718
            RT   QKR+    EVNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNI
Sbjct  237  RTRGGQKREFENGEVNRLESLLAEGRIFCDMPALADRDSILLRDTSLENSLICQPQQRNI  296

Query  717  HGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTEL  538
            HGRIFGGFLM RAFELA++TAYAFAG  PCF EVD +DFL+PVDVG+FLRFKSCVLYTE+
Sbjct  297  HGRIFGGFLMHRAFELAFSTAYAFAGLVPCFLEVDLVDFLRPVDVGDFLRFKSCVLYTEV  356

Query  537  ENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEA  364
             NP QPLI +EVVAHVTRPELRSSEVSN FYFTF+V   + A +NG RIR VVPATEEEA
Sbjct  357  -NPDQPLITIEVVAHVTRPELRSSEVSNTFYFTFTVRPEAKATKNGFRIRNVVPATEEEA  415

Query  363  RRVIERMDAE  334
            RR++ER DA+
Sbjct  416  RRILERKDAQ  425



>dbj|BAK05083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=523

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R+  LL EGRVF D PALADRDSIL++DT L+NSLICQPQQRN++GRIFGGFLM RA
Sbjct  345  EAERLKALLAEGRVFSDFPALADRDSILMKDTRLENSLICQPQQRNLYGRIFGGFLMHRA  404

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVL+T+LEN  QPL+NVEVV
Sbjct  405  FELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLFTQLENKWQPLVNVEVV  464

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELR SE+SN F+FTFSV SDAL+NG  IR VVP+TEEEARR++ RMDAE
Sbjct  465  AHVTRPELRKSEISNTFHFTFSVGSDALKNGLNIRNVVPSTEEEARRILNRMDAE  519



>ref|XP_004505139.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Cicer arietinum]
Length=487

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            + +  QK     +  R+N LL EGR+F DMPALADRDSILI+DTCLQNS ICQPQQRNIH
Sbjct  299  KKKEEQKHGESRDNARLNALLAEGRIFSDMPALADRDSILIKDTCLQNSFICQPQQRNIH  358

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMRRAFELA++TAY+FAG+AP F EVDH+DF +PVDVGNFLR KSCVLYTEL+
Sbjct  359  GRIFGGFLMRRAFELAFSTAYSFAGAAPHFLEVDHVDFFRPVDVGNFLRLKSCVLYTELD  418

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            NP +PL+NVEV+AHVT+PELRSSEVSN+FYFTF V  +A +NG RIR VVP TE EA++V
Sbjct  419  NPERPLVNVEVIAHVTKPELRSSEVSNRFYFTFGVDPEATKNGLRIRNVVPGTEVEAQKV  478

Query  354  IERMDAE  334
            +ER+DA+
Sbjct  479  LERIDAD  485



>ref|XP_010908727.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Elaeis 
guineensis]
Length=651

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            ++  LL EGRVFCD+PALADRDSIL++DT L+NSLICQPQQRN+HGRIFGGFLM  AFEL
Sbjct  476  KLKILLAEGRVFCDLPALADRDSILMRDTSLENSLICQPQQRNLHGRIFGGFLMNLAFEL  535

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHV  490
            A++TAYAF G  PCF EVDH+DFLKPVDVG+FLR KSCVLYT+LENP +PLIN+EVVAHV
Sbjct  536  AFSTAYAFVGQMPCFLEVDHVDFLKPVDVGDFLRLKSCVLYTQLENPQEPLINIEVVAHV  595

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            TRPELR+SEVSN FYFTF+V  +AL+NG RIR VVPATEEEARRV+ER+DAE
Sbjct  596  TRPELRTSEVSNTFYFTFTVNPNALKNGLRIRNVVPATEEEARRVLERIDAE  647



>ref|XP_002321229.2| hypothetical protein POPTR_0014s17320g [Populus trichocarpa]
 gb|EEE99544.2| hypothetical protein POPTR_0014s17320g [Populus trichocarpa]
Length=456

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E NR+  LL EGR+FCDMPALADR+SIL++DTCL+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  270  EANRLEALLAEGRIFCDMPALADRNSILLRDTCLENSLICQPQQRNIHGRIFGGFLMHRA  329

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLR KSCVLYTE EN  +PLIN+EVV
Sbjct  330  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRIKSCVLYTEHENSEKPLINIEVV  389

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+    + A  NG RIR VVPATEEEARR++E MDAE
Sbjct  390  AHVTRPELRSSEVSNTFYFTFTARPEAKATNNGFRIRKVVPATEEEARRILEHMDAE  446



>ref|XP_011024724.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Populus euphratica]
Length=448

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  262  EVNRLEALLAEGRIFCDMPALADRDSILLRDTHLENSLICQPQQRNIHGRIFGGFLMHRA  321

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLR KSCVLYTE E+  +PLIN+EVV
Sbjct  322  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRIKSCVLYTEHEDSEKPLINIEVV  381

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   + A+ NG RIR VVPATEEEARRV++RMDA+
Sbjct  382  AHVTRPELRSSEVSNTFYFTFTVRREAKAMNNGFRIRKVVPATEEEARRVLKRMDAD  438



>ref|XP_008372667.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Malus domestica]
 ref|XP_008346271.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Malus domestica]
Length=470

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRN+HGRIFGGFLM RA
Sbjct  283  EVNRLETLLAEGRIFCDMPALADRDSILLRDTXLENSLICQPQQRNMHGRIFGGFLMHRA  342

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFLKPVDVG+FLRFKSCVLYTE+ NP +P+IN+EVV
Sbjct  343  FELAFSTAYAFAGLVPCFLEVDHVDFLKPVDVGDFLRFKSCVLYTEVHNPDRPVINIEVV  402

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   + A ++G R+  VVPATEEEAR ++ERMDA+
Sbjct  403  AHVTRPELRSSEVSNTFYFTFTVRPEAKATKDGFRLLNVVPATEEEARHIVERMDAQ  459



>ref|XP_009761392.1| PREDICTED: uncharacterized protein LOC104213559 isoform X3 [Nicotiana 
sylvestris]
Length=363

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            VNR+ ELL EGR+FCDMPALADRD+IL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  178  VNRLEELLAEGRIFCDMPALADRDTILLRDTRLENSLICQPQQRNIHGRIFGGFLMLRAF  237

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  P F EVDH++FL+PVDVG+FLRFKSCVLYTE EN  QPLINVEVVA
Sbjct  238  ELAFSTAYAFAGLMPSFLEVDHVNFLRPVDVGDFLRFKSCVLYTEHENTDQPLINVEVVA  297

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE RSSEVSN+FYFTF+V  +A  N    RIR VVPATEEEARRV+ERMDA+
Sbjct  298  HVTRPEQRSSEVSNRFYFTFTVRPEAKANNSQFRIRKVVPATEEEARRVLERMDAD  353



>ref|XP_010414231.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Camelina sativa]
Length=465

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            RTE  Q+ +   ++ R++ELL EGRVF DMPALADR+SILI+DT  + SLICQPQQRNIH
Sbjct  273  RTEIKQEHEKLKDLERLDELLAEGRVFLDMPALADRNSILIKDTSHEYSLICQPQQRNIH  332

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD +DF+KPVDVGNFLRFKS VLYTE  
Sbjct  333  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFKSRVLYTEAN  392

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PLIN+EVVAHVT PELRSSEVSN+FYFTFSV  +A+++G RIR VVPATEEEARRV
Sbjct  393  NSAEPLINIEVVAHVTSPELRSSEVSNRFYFTFSVRPEAMKDGLRIRNVVPATEEEARRV  452

Query  354  IERMDAE  334
            IERMDAE
Sbjct  453  IERMDAE  459



>ref|XP_011080562.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Sesamum 
indicum]
Length=440

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 153/186 (82%), Gaps = 2/186 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            +NR   LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  255  INRFEALLAEGRIFCDMPALADRDSILLKDTRLENSLICQPQQRNIHGRIFGGFLMHRAF  314

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYTE EN  QPLINVEVVA
Sbjct  315  ELAFSTAYTFAGMMPSFLEVDHVDFLRPVDVGDFLRFKSCVLYTERENSDQPLINVEVVA  374

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALEN--GPRIRTVVPATEEEARRVIERMDAEkcc*  322
            HVTRPE RS+EVSN+FYFTF+V  +A     G RIR VVPATEEEA R++ERMDA+    
Sbjct  375  HVTRPEFRSTEVSNRFYFTFTVRPEAKAKNAGQRIRKVVPATEEEAHRIVERMDADSWQS  434

Query  321  c*KLRH  304
               + H
Sbjct  435  IMHVNH  440



>gb|EMT17709.1| hypothetical protein F775_07184 [Aegilops tauschii]
Length=512

 Score =   258 bits (658),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R+  LL EGRVF D PALADRDSIL++DT L+ S+ICQPQQRN++GRIFGGFLM RA
Sbjct  334  EAERLKALLAEGRVFSDFPALADRDSILMKDTRLETSMICQPQQRNLYGRIFGGFLMHRA  393

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAF G  PCF EVDH+DFLKPVDVG+FLRFKSCVL+T+LEN  QPL+NVEVV
Sbjct  394  FELAFSTAYAFVGQRPCFLEVDHVDFLKPVDVGDFLRFKSCVLFTQLENKWQPLVNVEVV  453

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELR SE+SN F+FTFSV SDAL+NG  IR VVP+TEEEARR+++RMDAE
Sbjct  454  AHVTRPELRKSEISNTFHFTFSVGSDALKNGVNIRNVVPSTEEEARRILDRMDAE  508



>ref|XP_011010335.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Populus 
euphratica]
Length=456

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 154/177 (87%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADR+SIL++DTCL+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  270  EVNRLEALLAEGRIFCDMPALADRNSILLRDTCLENSLICQPQQRNIHGRIFGGFLMHRA  329

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLR KSCVL+TE EN  +PLIN+EVV
Sbjct  330  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRIKSCVLFTEHENSEKPLINIEVV  389

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+    + A  NG RIR VVPATEEEARR++E MDAE
Sbjct  390  AHVTRPELRSSEVSNTFYFTFTARPEAKATNNGFRIRKVVPATEEEARRILEHMDAE  446



>ref|XP_003534487.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Glycine max]
 gb|KHN22147.1| Acyl-coenzyme A thioesterase 9, mitochondrial [Glycine soja]
Length=448

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E NR+  LL EGR+FCDMPALADRDSIL++DT L+N+LICQPQQRNIHGRIFGGFLM RA
Sbjct  264  EKNRLQALLAEGRIFCDMPALADRDSILLKDTSLENALICQPQQRNIHGRIFGGFLMHRA  323

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLR KSCVLYTE+ +P QPLINVEVV
Sbjct  324  FELAFSTAYAFAGLVPCFLEVDHVDFLRPVDVGDFLRLKSCVLYTEVHDPDQPLINVEVV  383

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN F+FTF+V   + A++NG ++R VVPATEEEA R++ER+DA+
Sbjct  384  AHVTRPELRSSEVSNTFHFTFTVRPEAKAMKNGFKLRNVVPATEEEAWRILERIDAD  440



>gb|KFK31266.1| hypothetical protein AALP_AA6G090200 [Arabis alpina]
Length=451

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R E  ++ +   ++ R+NELL EGRVF DMPALADRDSILI+DT  +NSLICQPQQRNIH
Sbjct  259  RAEGKEEHEKLKDLERLNELLAEGRVFLDMPALADRDSILIKDTYHENSLICQPQQRNIH  318

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD +DF+KPVDVGNFLRFKS VLYTE  
Sbjct  319  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFKSRVLYTEAN  378

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            + ++PLIN+EVVAHVT PELRSSEVSN+FYFTFSV  + ++NG  IR VVPATEEEARRV
Sbjct  379  SSAEPLINIEVVAHVTSPELRSSEVSNRFYFTFSVRPETMKNGLTIRNVVPATEEEARRV  438

Query  354  IERMDAE  334
            IERMDAE
Sbjct  439  IERMDAE  445



>ref|XP_009761391.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Nicotiana sylvestris]
Length=399

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            VNR+ ELL EGR+FCDMPALADRD+IL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  214  VNRLEELLAEGRIFCDMPALADRDTILLRDTRLENSLICQPQQRNIHGRIFGGFLMLRAF  273

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  P F EVDH++FL+PVDVG+FLRFKSCVLYTE EN  QPLINVEVVA
Sbjct  274  ELAFSTAYAFAGLMPSFLEVDHVNFLRPVDVGDFLRFKSCVLYTEHENTDQPLINVEVVA  333

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE RSSEVSN+FYFTF+V  +A  N    RIR VVPATEEEARRV+ERMDA+
Sbjct  334  HVTRPEQRSSEVSNRFYFTFTVRPEAKANNSQFRIRKVVPATEEEARRVLERMDAD  389



>gb|AAC02743.1| hypothetical protein [Arabidopsis thaliana]
Length=438

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            ++ R+NELL EGRVF DMPALADR+SILI+DT  +NSLICQPQQRNIHGRIFGGFLMR+A
Sbjct  258  DLERLNELLAEGRVFLDMPALADRNSILIKDTSHENSLICQPQQRNIHGRIFGGFLMRKA  317

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++ AY FAG +P F EVD +DF+KPVDVGNFLRFKS VLYTE  + ++PLIN+EVV
Sbjct  318  FELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFKSRVLYTEATSSAEPLINIEVV  377

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT PELRSSEVSN+FYFTFSV  +A+++G +IR VVPATEEEARRVIERMDAE
Sbjct  378  AHVTSPELRSSEVSNRFYFTFSVRPEAMKDGLKIRNVVPATEEEARRVIERMDAE  432



>gb|KHN40515.1| Acyl-coenzyme A thioesterase 9, mitochondrial [Glycine soja]
Length=397

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E NR+  LL EGR+FCDMPALADR+SIL++DT L+N+LICQPQQRNIHGRIFGGFLM RA
Sbjct  213  EKNRLRALLAEGRIFCDMPALADRNSILLKDTSLENALICQPQQRNIHGRIFGGFLMHRA  272

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG APCF EVDH+DFL+PVDVG+FLR KSCVLYTE+ +P QPLINVEVV
Sbjct  273  FELAFSTAYAFAGLAPCFLEVDHVDFLRPVDVGDFLRLKSCVLYTEVHDPDQPLINVEVV  332

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELR+SEVSN F+F+F+V   + A++NG ++R VVPATEEEARR++ER+DA+
Sbjct  333  AHVTRPELRTSEVSNTFHFSFTVRPEAKAMKNGFKLRNVVPATEEEARRILERIDAD  389



>gb|EPS61819.1| hypothetical protein M569_12970, partial [Genlisea aurea]
Length=418

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 156/173 (90%), Gaps = 3/173 (2%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            R+NELL EGRVFCDMPALA+RDSIL+++TCL+NSL+CQPQQRN HGRIFGGFLMRRAFEL
Sbjct  248  RVNELLTEGRVFCDMPALANRDSILMKETCLENSLVCQPQQRNSHGRIFGGFLMRRAFEL  307

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPS-QPLINVEVVAH  493
            AY TAY+FAG+APCF EVDH+DFLKPVDVGNFLRFKS VLYTE E+ S +P++N+EVVAH
Sbjct  308  AYVTAYSFAGTAPCFVEVDHVDFLKPVDVGNFLRFKSRVLYTERESSSRRPMMNIEVVAH  367

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            V RPELRSSEVSNKFYFTF++ SD  E G  IR VVPATEEEA +VIERMDAE
Sbjct  368  VMRPELRSSEVSNKFYFTFTLRSD--EGGAAIRNVVPATEEEAWQVIERMDAE  418



>ref|XP_010242485.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X1 [Nelumbo nucifera]
Length=558

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 160/193 (83%), Gaps = 18/193 (9%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EV+R+  LL EGR+FCDMPALA+RDSIL++DT LQNSLICQPQQRN+HGRIFGGFLM RA
Sbjct  360  EVDRLEALLAEGRIFCDMPALANRDSILMRDTRLQNSLICQPQQRNMHGRIFGGFLMNRA  419

Query  678  felayatayafagsAPCFKEVDHIDFLKP------------------VDVGNFLRFKSCV  553
            FELA++TAYAFAG  PCF EVDH+DFLKP                  VDVG+FLR KSCV
Sbjct  420  FELAFSTAYAFAGMVPCFLEVDHVDFLKPAQPLSKAYIYFNPGTSAQVDVGDFLRLKSCV  479

Query  552  LYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATE  373
            LYTEL+NP  PLIN+EVVAHVTRPELRSSEVSN F+FTF+V  +A++NG RIR+VVPATE
Sbjct  480  LYTELDNPELPLINIEVVAHVTRPELRSSEVSNTFHFTFTVRPEAMKNGLRIRSVVPATE  539

Query  372  EEARRVIERMDAE  334
            EEARRV++RMDAE
Sbjct  540  EEARRVLDRMDAE  552



>gb|EYU46078.1| hypothetical protein MIMGU_mgv1a006555mg [Erythranthe guttata]
Length=439

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            ++NR   LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  257  DMNRFQVLLAEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRNIHGRIFGGFLMHRA  316

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYTE E   QPLI++EVV
Sbjct  317  FELAFSTAYAFAGMMPSFLEVDHVDFLRPVDVGDFLRFKSCVLYTENETSDQPLIHLEVV  376

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPE+RSSEVSN+FYFTF+V   + A  NG RIR VVPATEEEARR+IERMDA+
Sbjct  377  AHVTRPEMRSSEVSNRFYFTFTVRPEAKASNNGHRIRKVVPATEEEARRIIERMDAD  433



>ref|NP_180630.2| thioesterase/thiol ester dehydrase-isomerase superfamily protein 
[Arabidopsis thaliana]
 gb|AAT85723.1| At2g30720 [Arabidopsis thaliana]
 gb|AAV74243.1| At2g30720 [Arabidopsis thaliana]
 gb|AEC08432.1| thioesterase/thiol ester dehydrase-isomerase superfamily protein 
[Arabidopsis thaliana]
Length=455

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            ++ R+NELL EGRVF DMPALADR+SILI+DT  +NSLICQPQQRNIHGRIFGGFLMR+A
Sbjct  275  DLERLNELLAEGRVFLDMPALADRNSILIKDTSHENSLICQPQQRNIHGRIFGGFLMRKA  334

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++ AY FAG +P F EVD +DF+KPVDVGNFLRFKS VLYTE  + ++PLIN+EVV
Sbjct  335  FELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFKSRVLYTEATSSAEPLINIEVV  394

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT PELRSSEVSN+FYFTFSV  +A+++G +IR VVPATEEEARRVIERMDAE
Sbjct  395  AHVTSPELRSSEVSNRFYFTFSVRPEAMKDGLKIRNVVPATEEEARRVIERMDAE  449



>ref|XP_009761389.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=445

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            VNR+ ELL EGR+FCDMPALADRD+IL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  260  VNRLEELLAEGRIFCDMPALADRDTILLRDTRLENSLICQPQQRNIHGRIFGGFLMLRAF  319

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  P F EVDH++FL+PVDVG+FLRFKSCVLYTE EN  QPLINVEVVA
Sbjct  320  ELAFSTAYAFAGLMPSFLEVDHVNFLRPVDVGDFLRFKSCVLYTEHENTDQPLINVEVVA  379

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE RSSEVSN+FYFTF+V  +A  N    RIR VVPATEEEARRV+ERMDA+
Sbjct  380  HVTRPEQRSSEVSNRFYFTFTVRPEAKANNSQFRIRKVVPATEEEARRVLERMDAD  435



>gb|KHG03224.1| Acyl-coenzyme A thioesterase 9, mitochondrial [Gossypium arboreum]
Length=392

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 156/186 (84%), Gaps = 2/186 (1%)
 Frame = -1

Query  885  RXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRI  706
            R  K      VNR++    +GR+FCDMPALADRDSIL++DT L+N+LICQPQQRNIHGRI
Sbjct  201  RDSKTGKAAAVNRLSPETEQGRIFCDMPALADRDSILLRDTRLENALICQPQQRNIHGRI  260

Query  705  FGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPS  526
            FGGFLM RAFELA++TAY FAG  PCF EVDH+DFL+PVDVG+FLR  SCVLYTELEN  
Sbjct  261  FGGFLMHRAFELAFSTAYVFAGLVPCFLEVDHVDFLRPVDVGDFLRLTSCVLYTELENLD  320

Query  525  QPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVI  352
            QPLINVEVVAHVTRPE+RSS+VSN FYFTFSV   + A +NG +IR VVPATEEEARR++
Sbjct  321  QPLINVEVVAHVTRPEIRSSDVSNTFYFTFSVRPEAKATKNGFKIRNVVPATEEEARRIL  380

Query  351  ERMDAE  334
            ERMDAE
Sbjct  381  ERMDAE  386



>gb|KHN32342.1| Acyl-coenzyme A thioesterase 9, mitochondrial [Glycine soja]
Length=489

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R  + +K     +  R+  LL EGR+F DMPALA+R+SIL++DTCLQNS ICQPQQRN H
Sbjct  278  RKNQEEKHGESEDTARLKALLAEGRIFSDMPALANRNSILMEDTCLQNSFICQPQQRNTH  337

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMRRAFELA++TAYAFAG+AP F EVDH+DF KPV+VGNFLR KSCVLYTEL+
Sbjct  338  GRIFGGFLMRRAFELAFSTAYAFAGAAPHFLEVDHVDFFKPVEVGNFLRLKSCVLYTELD  397

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PL+NVEVVAHVT+PE RSSEVSN+FYFTF V  +A++NG R+R VVPATEEEAR+V
Sbjct  398  NLAEPLVNVEVVAHVTKPEHRSSEVSNRFYFTFGVDPEAIKNGLRLRHVVPATEEEARKV  457

Query  354  IERMDAE  334
            +ERMDAE
Sbjct  458  LERMDAE  464



>ref|XP_003552469.2| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Glycine max]
Length=448

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 167/191 (87%), Gaps = 4/191 (2%)
 Frame = -1

Query  894  RTERXQKRK*YX--EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRN  721
            +T+R  +++ +   E NR+  LL EGR+FCDMPALADR+SIL++DT L+N+LICQPQQRN
Sbjct  250  KTKRGGEKRDFENGEKNRLRALLAEGRIFCDMPALADRNSILLKDTSLENALICQPQQRN  309

Query  720  IHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTE  541
            IHGRIFGGFLM RAFELA++TAYAFAG APCF EVDH+DFL+PVDVG+FLR KSCVLYTE
Sbjct  310  IHGRIFGGFLMHRAFELAFSTAYAFAGLAPCFLEVDHVDFLRPVDVGDFLRLKSCVLYTE  369

Query  540  LENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEE  367
            + +P QPLINVEVVAHVTRPELR+SEVSN F+F+F+V   + A++NG ++R VVPATEEE
Sbjct  370  VHDPDQPLINVEVVAHVTRPELRTSEVSNTFHFSFTVRPEAKAMKNGFKLRNVVPATEEE  429

Query  366  ARRVIERMDAE  334
            ARR++ER+DA+
Sbjct  430  ARRILERIDAD  440



>ref|XP_009619549.1| PREDICTED: uncharacterized protein LOC104111540 isoform X3 [Nicotiana 
tomentosiformis]
Length=407

 Score =   252 bits (643),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            VNR+ ELL EGR+FCDMPALADRD+IL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  222  VNRLEELLAEGRIFCDMPALADRDTILLRDTRLENSLICQPQQRNIHGRIFGGFLMLRAF  281

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  P F EVDH++FL+PVDVG+FLRFKSCVLYTE EN  QPLINVEVVA
Sbjct  282  ELAFSTAYAFAGLMPSFLEVDHVNFLRPVDVGDFLRFKSCVLYTEHENTDQPLINVEVVA  341

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE RSSEVSN+FYFTF+V ++A       RIR VVPATEEEARRV+ERMDA+
Sbjct  342  HVTRPEQRSSEVSNRFYFTFTVRTEAKATNSQFRIRKVVPATEEEARRVLERMDAD  397



>ref|XP_010510297.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Camelina sativa]
Length=468

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R E  ++ +   ++ R++ELL EGRVF DMPALADR+SILI+DT  + SLICQPQQRNIH
Sbjct  276  RAEIKEEHEKLKDLERLDELLAEGRVFMDMPALADRNSILIKDTSHEYSLICQPQQRNIH  335

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD +DF+KPVDVGNFLRFKS VLYTE  
Sbjct  336  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFKSRVLYTEAN  395

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PLIN+EVVAHVT PELRSSEVSN+FYFTFSV  +A+++G RIR VVPATEEEARRV
Sbjct  396  NSAEPLINIEVVAHVTSPELRSSEVSNRFYFTFSVRPEAMKDGLRIRNVVPATEEEARRV  455

Query  354  IERMDAE  334
            IERMDAE
Sbjct  456  IERMDAE  462



>ref|XP_009619548.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Nicotiana tomentosiformis]
Length=443

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            VNR+ ELL EGR+FCDMPALADRD+IL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  258  VNRLEELLAEGRIFCDMPALADRDTILLRDTRLENSLICQPQQRNIHGRIFGGFLMLRAF  317

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  P F EVDH++FL+PVDVG+FLRFKSCVLYTE EN  QPLINVEVVA
Sbjct  318  ELAFSTAYAFAGLMPSFLEVDHVNFLRPVDVGDFLRFKSCVLYTEHENTDQPLINVEVVA  377

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE RSSEVSN+FYFTF+V ++A       RIR VVPATEEEARRV+ERMDA+
Sbjct  378  HVTRPEQRSSEVSNRFYFTFTVRTEAKATNSQFRIRKVVPATEEEARRVLERMDAD  433



>ref|XP_010469807.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A thioesterase 
9, mitochondrial [Camelina sativa]
Length=393

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R E  ++ +   ++ R++EL  EGRVF DMPALADR+SILI+DT  + SLICQPQQRNIH
Sbjct  193  RAEIKEEHEKLKDLERLDELXAEGRVFMDMPALADRNSILIKDTSHEYSLICQPQQRNIH  252

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD +DF+KPVDVGNFLRFKS VLYTE  
Sbjct  253  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFKSRVLYTEAN  312

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PLIN EVVAHVT PELRSSEVSN+FYFTFSV  +A+++G RIR VVPATEEEARRV
Sbjct  313  NSAEPLINTEVVAHVTSPELRSSEVSNRFYFTFSVRPEAMKDGLRIRNVVPATEEEARRV  372

Query  354  IERMDAE  334
            IERMDAE
Sbjct  373  IERMDAE  379



>ref|XP_002881128.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57387.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=459

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            ++ R+NELL EGRVF DMPALADR+SILI+DT  +NSLICQPQQRNIHGRIFGGFLMR+A
Sbjct  279  DLERLNELLAEGRVFLDMPALADRNSILIKDTYHENSLICQPQQRNIHGRIFGGFLMRKA  338

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++ AY FAG +P F EVD +DF+KPVDVGNFLRFKS VLYTE  + ++PLIN+EVV
Sbjct  339  FELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRFKSRVLYTEANSSAEPLINIEVV  398

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVT PELRSSEVSN+FYFTFSV  +A+++G +IR VVPATEEEAR VIERMDAE
Sbjct  399  AHVTSPELRSSEVSNRFYFTFSVRPEAMKDGLKIRNVVPATEEEARTVIERMDAE  453



>ref|XP_003624249.1| Acyl-CoA thioesterase [Medicago truncatula]
 gb|AES80467.1| acyl-CoA thioesterase, putative [Medicago truncatula]
 gb|AFK46403.1| unknown [Medicago truncatula]
Length=423

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  ++ +LL EGR+FCDMPALADRDSIL++DT L+NSLIC PQQRNIHGRIFGGFLM RA
Sbjct  239  EEKKLKDLLAEGRIFCDMPALADRDSILLRDTSLENSLICHPQQRNIHGRIFGGFLMNRA  298

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLR KSCVLYTEL +P QPLINVEVV
Sbjct  299  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRLKSCVLYTELHDPDQPLINVEVV  358

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN F+FTF+V   + A++NG ++R VVPATEEEARR++ER+DA+
Sbjct  359  AHVTRPELRSSEVSNTFHFTFTVRPEAKAMKNGFKLRNVVPATEEEARRILERIDAD  415



>ref|XP_004492892.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=451

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R+++LL EGR+FCDMPALADRDSIL++DT L+NSL+CQPQQRNIHGRIFGGFLM RA
Sbjct  267  EQKRLHDLLAEGRIFCDMPALADRDSILLRDTSLENSLLCQPQQRNIHGRIFGGFLMNRA  326

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLR KSCVLYTEL +P QPLINVEVV
Sbjct  327  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRLKSCVLYTELHDPDQPLINVEVV  386

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN F+F+F+V   + A+++G ++R VVPATEEEARR++ER+DA+
Sbjct  387  AHVTRPELRSSEVSNTFHFSFTVRPEAKAMKDGFKLRNVVPATEEEARRILERIDAD  443



>ref|XP_008235863.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Prunus 
mume]
Length=450

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 156/177 (88%), Gaps = 3/177 (2%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  265  EVNRLETLLAEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRNIHGRIFGGFLMHRA  324

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYTE+ NP QPLIN+EVV
Sbjct  325  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTEV-NPDQPLINIEVV  383

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   + A +NG RI  VVPATEEEAR +++RMD++
Sbjct  384  AHVTRPELRSSEVSNTFYFTFTVRPEAKAKKNGFRILNVVPATEEEARHIVDRMDSQ  440



>ref|XP_009619547.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=489

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            VNR+ ELL EGR+FCDMPALADRD+IL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  304  VNRLEELLAEGRIFCDMPALADRDTILLRDTRLENSLICQPQQRNIHGRIFGGFLMLRAF  363

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  P F EVDH++FL+PVDVG+FLRFKSCVLYTE EN  QPLINVEVVA
Sbjct  364  ELAFSTAYAFAGLMPSFLEVDHVNFLRPVDVGDFLRFKSCVLYTEHENTDQPLINVEVVA  423

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE RSSEVSN+FYFTF+V ++A       RIR VVPATEEEARRV+ERMDA+
Sbjct  424  HVTRPEQRSSEVSNRFYFTFTVRTEAKATNSQFRIRKVVPATEEEARRVLERMDAD  479



>ref|XP_004246984.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Solanum 
lycopersicum]
Length=479

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            VNR+ ELL EGR+FCDMPALADRD+IL+QDT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  288  VNRLEELLAEGRIFCDMPALADRDTILLQDTRLENSLICQPQQRNIHGRIFGGFLMLRAF  347

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  P F EVDH++FL+PVDVG+FLRFKSCVLYTE E+  QPLINVEVVA
Sbjct  348  ELAFSTAYAFAGLMPSFLEVDHVNFLRPVDVGDFLRFKSCVLYTEHESTDQPLINVEVVA  407

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE RSSEVSN+FYFTF+V  +A       RIR VVPATEEEARRV+ERMDA+
Sbjct  408  HVTRPEQRSSEVSNRFYFTFTVRPEAKATNTQFRIRKVVPATEEEARRVLERMDAD  463



>ref|XP_003624248.1| Acyl-CoA thioesterase [Medicago truncatula]
 gb|ABN08987.1| Phosphoglucomutase/phosphomannomutase C terminal; Thioesterase 
superfamily [Medicago truncatula]
 gb|AES80466.1| acyl-CoA thioesterase, putative [Medicago truncatula]
Length=444

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  ++ +LL EGR+FCDMPALADRDSIL++DT L+NSLIC PQQRNIHGRIFGGFLM RA
Sbjct  260  EEKKLKDLLAEGRIFCDMPALADRDSILLRDTSLENSLICHPQQRNIHGRIFGGFLMNRA  319

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLR KSCVLYTEL +P QPLINVEVV
Sbjct  320  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRLKSCVLYTELHDPDQPLINVEVV  379

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN F+FTF+V   + A++NG ++R VVPATEEEARR++ER+DA+
Sbjct  380  AHVTRPELRSSEVSNTFHFTFTVRPEAKAMKNGFKLRNVVPATEEEARRILERIDAD  436



>ref|XP_007199839.1| hypothetical protein PRUPE_ppa005627mg [Prunus persica]
 gb|EMJ01038.1| hypothetical protein PRUPE_ppa005627mg [Prunus persica]
Length=450

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 156/177 (88%), Gaps = 3/177 (2%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  265  EVNRLETLLAEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRNIHGRIFGGFLMHRA  324

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYTE+ NP QPLIN+EVV
Sbjct  325  FELAFSTAYAFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTEV-NPDQPLINIEVV  383

Query  498  AHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V   + A +NG RI  VVPATEEEAR +++RMD++
Sbjct  384  AHVTRPELRSSEVSNTFYFTFTVRPEAKAKKNGFRILNVVPATEEEARHIVDRMDSQ  440



>ref|XP_006350432.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Solanum tuberosum]
Length=476

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
            VNR+ ELL EGR+FCDMPALADRD+IL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  296  VNRLEELLAEGRIFCDMPALADRDTILLKDTRLENSLICQPQQRNIHGRIFGGFLMLRAF  355

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  P F EVDH++FL+PVDVG+FLRFKSCVLYTE EN  QPLINVEVVA
Sbjct  356  ELAFSTAYAFAGLMPSFLEVDHVNFLRPVDVGDFLRFKSCVLYTEHENTDQPLINVEVVA  415

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRVIERMDAE  334
            HVTRPE RSSEVSN+FYFTF+V  +A       RIR VVPATEEEARRV+ERMDA+
Sbjct  416  HVTRPEQRSSEVSNRFYFTFTVRPEAKATNTQFRIRKVVPATEEEARRVLERMDAD  471



>emb|CDY70798.1| BnaCnng69840D [Brassica napus]
Length=475

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R +  ++++   ++ R+N+LL EGRVF DMPALADRDSILI+DT  +NSLICQPQQRNIH
Sbjct  285  RAQGKEEQEKLKDLERLNDLLAEGRVFLDMPALADRDSILIKDTSHENSLICQPQQRNIH  344

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD +DF+KPVDVGNFLR KS +LYTE  
Sbjct  345  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRLKSRILYTEAT  404

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            + ++PLIN+EVVAHVT PELRSSEVSN+FYFTFSV  +A+++G +IR VVP TEEEARRV
Sbjct  405  SSAEPLINIEVVAHVTSPELRSSEVSNRFYFTFSVRPEAMKDGMKIRNVVPGTEEEARRV  464

Query  354  IERMDAE  334
            IERMDAE
Sbjct  465  IERMDAE  471



>ref|XP_010557161.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Tarenaya 
hassleriana]
Length=448

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R E  +  +   +++R+NELL EGRVF DMPALADRDSILI+DT  +NSLICQPQQRN+H
Sbjct  254  RAETKEDHEKQKDLDRLNELLAEGRVFLDMPALADRDSILIKDTSNENSLICQPQQRNVH  313

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AYAFAG AP F EVD +DF+ PVDVGNFLR KS VLYTE  
Sbjct  314  GRIFGGFLMRKAFELAFSNAYAFAGVAPRFLEVDRVDFITPVDVGNFLRLKSRVLYTEAN  373

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
              ++PLIN+EVVAHVTRPELRSS+VSN FYFTFSV  +A+++G RIR VVP+TEEEARRV
Sbjct  374  TSAEPLINIEVVAHVTRPELRSSQVSNTFYFTFSVRPEAMKHGLRIRNVVPSTEEEARRV  433

Query  354  IERMDAE  334
            +ERMDAE
Sbjct  434  LERMDAE  440



>emb|CDY29648.1| BnaA04g17790D [Brassica napus]
Length=474

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R +  ++++   ++ R+N+LL EGRVF DMPALADRDSILI+DT  +NSLICQPQQRNIH
Sbjct  284  RAQGKEEQEKLKDLERLNDLLAEGRVFLDMPALADRDSILIKDTSHENSLICQPQQRNIH  343

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD +DF+KPVDVGNFLR KS +LYTE  
Sbjct  344  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVDFIKPVDVGNFLRLKSRILYTEAT  403

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            + ++PLIN+EVVAHVT PELRSSEVSN+FYFTFSV  +A+++G +IR VVP TEEEARRV
Sbjct  404  SSAEPLINIEVVAHVTSPELRSSEVSNRFYFTFSVRPEAMKDGMKIRNVVPGTEEEARRV  463

Query  354  IERMDAE  334
            IERMDAE
Sbjct  464  IERMDAE  470



>gb|ABK24531.1| unknown [Picea sitchensis]
Length=396

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+  LL EGRV CDMPALADRDS+LI+DT L+N+LICQPQQRN+HGRIFGGFLM RA E
Sbjct  221  DRLKALLREGRVLCDMPALADRDSMLIKDTRLENALICQPQQRNLHGRIFGGFLMHRASE  280

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA++T YAF G  P F EVDH+DFL+PVDVG+FLRFKSCVL+T++++P +PLI++EVVAH
Sbjct  281  LAFSTCYAFVGHTPLFLEVDHVDFLRPVDVGDFLRFKSCVLFTQVDDPKRPLIDIEVVAH  340

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VTRPELRSSEVSN FYFTF+V   ALE G +IR V+PATEEEAR V+ER+DAE
Sbjct  341  VTRPELRSSEVSNTFYFTFTVHPVALEGGLKIRKVLPATEEEARHVLERIDAE  393



>ref|XP_011470764.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A thioesterase 
9, mitochondrial-like, partial [Fragaria vesca subsp. vesca]
Length=254

 Score =   241 bits (616),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 159/192 (83%), Gaps = 6/192 (3%)
 Frame = -1

Query  894  RTERXQKRK*-YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNI  718
            RT   QKR+    EV+R+  LL EGR+FCDMPALAD DSIL++DT L+NSLICQPQQRNI
Sbjct  54   RTRGGQKREFENGEVHRLESLLAEGRIFCDMPALADGDSILLRDTSLENSLICQPQQRNI  113

Query  717  HGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTEL  538
            HGRIFGGFLM RAFELA++TAYAFAG  PCF EVD +DFL+PVDVG+FLRFKSCVLYTE+
Sbjct  114  HGRIFGGFLMHRAFELAFSTAYAFAGLVPCFLEVDLVDFLRPVDVGDFLRFKSCVLYTEV  173

Query  537  ENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPAT--EE  370
             NP QPLI +EVVAHVTRPELRS EVSN FYFTF+V   + A +NG RIR VVPA   EE
Sbjct  174  -NPDQPLITIEVVAHVTRPELRSGEVSNTFYFTFTVRPEAKATKNGFRIRNVVPANRREE  232

Query  369  EARRVIERMDAE  334
            EARR++ER DA+
Sbjct  233  EARRILERRDAQ  244



>ref|XP_009141094.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A thioesterase 
9, mitochondrial [Brassica rapa]
Length=457

 Score =   248 bits (632),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R +  ++++   ++ R+N+LL EGRVF DMPALADRDSILI+DT  +NSLICQPQQRNIH
Sbjct  267  RAQGKEEQEKLKDLERLNDLLAEGRVFLDMPALADRDSILIKDTSHENSLICQPQQRNIH  326

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMR+AFELA++ AY FAG +P F EVD + F+KPVDVGNFLR KS +LYTE  
Sbjct  327  GRIFGGFLMRKAFELAFSNAYTFAGVSPRFLEVDRVXFIKPVDVGNFLRLKSRILYTEAT  386

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            + ++PLIN+EVVAHVT PELRSSEVSN+FYFTFSV  +A+++G +IR VVP TEEEARRV
Sbjct  387  SSAEPLINIEVVAHVTSPELRSSEVSNRFYFTFSVRPEAMKDGMKIRNVVPGTEEEARRV  446

Query  354  IERMDAE  334
            IERMDAE
Sbjct  447  IERMDAE  453



>gb|EPS68180.1| hypothetical protein M569_06586, partial [Genlisea aurea]
Length=428

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            NR   LL EGR+FCDMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM RAFE
Sbjct  247  NRYEALLREGRIFCDMPALADRESILLRDTRLENSLICQPQQRNIHGRIFGGFLMHRAFE  306

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA+ TAY FAG  P F E DH+DFL+PVDVG+FLRFKSCVLYTE +N  QPLI+VEVVAH
Sbjct  307  LAFTTAYTFAGMMPSFLEGDHVDFLRPVDVGDFLRFKSCVLYTEHQNSDQPLIHVEVVAH  366

Query  492  VTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VTRPE +SSEVSN+FYFTF+V   + A+ N  RIR VVPATEEEARR+IERMDA+
Sbjct  367  VTRPEFKSSEVSNRFYFTFTVRPEAKAMNNCHRIRKVVPATEEEARRIIERMDAD  421



>ref|XP_007139683.1| hypothetical protein PHAVU_008G050200g [Phaseolus vulgaris]
 gb|ESW11677.1| hypothetical protein PHAVU_008G050200g [Phaseolus vulgaris]
Length=465

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E NR+  LL EGR+FCDMPALADR+SIL++DT L+N+LICQPQQRNIHGRIFGGFLM RA
Sbjct  264  EKNRLKALLAEGRIFCDMPALADRNSILLKDTSLENALICQPQQRNIHGRIFGGFLMHRA  323

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++T YAFAG  P F EVDH+DFL+PVDVG+FLR KSCVLYTE+ +P QPLINVEVV
Sbjct  324  FELAFSTTYAFAGLVPYFLEVDHVDFLRPVDVGDFLRLKSCVLYTEVHDPDQPLINVEVV  383

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDA--LENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN F+FTF+V  +A   +NG ++R VVPATEEEA R++ER+DA+
Sbjct  384  AHVTRPELRSSEVSNTFHFTFTVRPEAKVTKNGFKLRNVVPATEEEACRILERIDAD  440



>ref|XP_010551995.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Tarenaya hassleriana]
Length=445

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            +  RI  LL EGR+FCDMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  258  KYKRIESLLSEGRIFCDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMHRA  317

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLRFKSCVLY +L+ P  P+IN+EVV
Sbjct  318  FELAFSTAYAFAGLVPCFLEVDHVDFLRPVDVGDFLRFKSCVLYAQLDQPDHPVINIEVV  377

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDA--LENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPE+RSSEVSN FYF F+V  +A    NG ++RTVVPATEEEAR ++ER+D E
Sbjct  378  AHVTRPEIRSSEVSNTFYFKFTVRPEAKVTNNGFKLRTVVPATEEEARHILERIDLE  434



>ref|XP_010551994.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Tarenaya hassleriana]
Length=446

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            +  RI  LL EGR+FCDMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  259  KYKRIESLLSEGRIFCDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMHRA  318

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  PCF EVDH+DFL+PVDVG+FLRFKSCVLY +L+ P  P+IN+EVV
Sbjct  319  FELAFSTAYAFAGLVPCFLEVDHVDFLRPVDVGDFLRFKSCVLYAQLDQPDHPVINIEVV  378

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDA--LENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPE+RSSEVSN FYF F+V  +A    NG ++RTVVPATEEEAR ++ER+D E
Sbjct  379  AHVTRPEIRSSEVSNTFYFKFTVRPEAKVTNNGFKLRTVVPATEEEARHILERIDLE  435



>ref|XP_010679012.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=435

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E+NR+  LL EGR+FCDMPALADR+SIL++DT L NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  248  EINRLEALLSEGRIFCDMPALADRNSILLRDTRLANSLICQPQQRNIHGRIFGGFLMHRA  307

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFLKPVDVG+FLRFKSCVLYTELE+P  PLINVEV 
Sbjct  308  FELAFSTAYAFAGVRPSFLEVDHVDFLKPVDVGDFLRFKSCVLYTELEDPEHPLINVEVE  367

Query  498  AHVTRPELRSSEVSNKFYFTF-SVCSDAL--ENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPE+RSSEVSN FYFTF ++CS+A   +N   IR VV ATEEEAR ++ER DA+
Sbjct  368  AHVTRPEIRSSEVSNTFYFTFTTICSEAKAEKNKVIIRNVVVATEEEARHILERKDAK  425



>ref|XP_010679013.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=433

 Score =   245 bits (625),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E+NR+  LL EGR+FCDMPALADR+SIL++DT L NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  246  EINRLEALLSEGRIFCDMPALADRNSILLRDTRLANSLICQPQQRNIHGRIFGGFLMHRA  305

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYAFAG  P F EVDH+DFLKPVDVG+FLRFKSCVLYTELE+P  PLINVEV 
Sbjct  306  FELAFSTAYAFAGVRPSFLEVDHVDFLKPVDVGDFLRFKSCVLYTELEDPEHPLINVEVE  365

Query  498  AHVTRPELRSSEVSNKFYFTF-SVCSDAL--ENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPE+RSSEVSN FYFTF ++CS+A   +N   IR VV ATEEEAR ++ER DA+
Sbjct  366  AHVTRPEIRSSEVSNTFYFTFTTICSEAKAEKNKVIIRNVVVATEEEARHILERKDAK  423



>ref|XP_010039359.1| PREDICTED: uncharacterized protein LOC104428051 [Eucalyptus grandis]
Length=279

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  837  LLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayat  658
            LL EGRV CDMPALA +DSILI+DTC +NSLICQPQQRNIHGRIFGGFLM RAFELA+++
Sbjct  106  LLAEGRVVCDMPALAYKDSILIRDTCFENSLICQPQQRNIHGRIFGGFLMHRAFELAFSS  165

Query  657  ayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPE  478
             YAFAG+AP F EVDH+DFL+PVDVGNFL  K CVL TEL+NP +PLINVEVVAHV + E
Sbjct  166  TYAFAGAAPRFVEVDHVDFLRPVDVGNFLCLKCCVLCTELDNPDEPLINVEVVAHVIQLE  225

Query  477  LRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            LRSSEVSNKFYFTF+V  +AL +G RI+ VVP+TEEEA RV+ERMDAE
Sbjct  226  LRSSEVSNKFYFTFTVHPEALNDGLRIQKVVPSTEEEAWRVLERMDAE  273



>gb|ACU18617.1| unknown [Glycine max]
Length=455

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -1

Query  894  RTERXQKRK*YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIH  715
            R ++ QK     +  R+  LL EGR+FCDMPALA+RDS+L++DTCLQNS ICQPQQRNIH
Sbjct  268  RMKQEQKHGESEDPARLKALLAEGRIFCDMPALANRDSVLMKDTCLQNSFICQPQQRNIH  327

Query  714  GRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELE  535
            GRIFGGFLMRRAFELA++TAYAFAG+AP F EVDH+DF KPVDVGNFLR KSCVLYTEL+
Sbjct  328  GRIFGGFLMRRAFELAFSTAYAFAGAAPHFLEVDHVDFFKPVDVGNFLRLKSCVLYTELD  387

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N ++PL+NVEVVAHVT+PE RSSEVSN+FYFTF V   A++NG R+  VVPATEEE  R 
Sbjct  388  NIAEPLVNVEVVAHVTKPEHRSSEVSNRFYFTFGVDPVAIKNGLRLLHVVPATEEEHGRC  447

Query  354  I  352
            +
Sbjct  448  L  448



>ref|XP_009802522.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X2 [Nicotiana sylvestris]
Length=314

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 145/169 (86%), Gaps = 8/169 (5%)
 Frame = -1

Query  846  INELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafela  667
            IN+LL E        AL DRDSILI++TCLQNSLICQP+QRNIHG+IFGGFLMR+AFELA
Sbjct  143  INKLLAE--------ALLDRDSILIKETCLQNSLICQPEQRNIHGQIFGGFLMRKAFELA  194

Query  666  yatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVT  487
            YATAY+FAGS PCF EVD +DFLKPVDVG+FL+ KSCVLYTELEN S PLINVEVVAHVT
Sbjct  195  YATAYSFAGSTPCFVEVDCVDFLKPVDVGDFLQLKSCVLYTELENSSWPLINVEVVAHVT  254

Query  486  RPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMD  340
            +PE  SSEVSN FYFTF+VCSD+L+NG +IR VVP TEEEAR VIE +D
Sbjct  255  QPEHLSSEVSNNFYFTFTVCSDSLKNGLKIRNVVPGTEEEARLVIEHID  303



>ref|XP_009802521.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X1 [Nicotiana sylvestris]
Length=319

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 145/169 (86%), Gaps = 8/169 (5%)
 Frame = -1

Query  846  INELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafela  667
            IN+LL E        AL DRDSILI++TCLQNSLICQP+QRNIHG+IFGGFLMR+AFELA
Sbjct  148  INKLLAE--------ALLDRDSILIKETCLQNSLICQPEQRNIHGQIFGGFLMRKAFELA  199

Query  666  yatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVT  487
            YATAY+FAGS PCF EVD +DFLKPVDVG+FL+ KSCVLYTELEN S PLINVEVVAHVT
Sbjct  200  YATAYSFAGSTPCFVEVDCVDFLKPVDVGDFLQLKSCVLYTELENSSWPLINVEVVAHVT  259

Query  486  RPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMD  340
            +PE  SSEVSN FYFTF+VCSD+L+NG +IR VVP TEEEAR VIE +D
Sbjct  260  QPEHLSSEVSNNFYFTFTVCSDSLKNGLKIRNVVPGTEEEARLVIEHID  308



>emb|CDY19958.1| BnaA09g02930D [Brassica napus]
Length=428

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E N++  LL EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  251  HGEYNKLGGLLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  310

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  311  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKLDCPLINIE  370

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDA  337
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR +++RMDA
Sbjct  371  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILDRMDA  428



>ref|XP_009111834.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Brassica rapa]
Length=428

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E N++  LL EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  251  HGEYNKLGGLLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  310

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  311  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKLDCPLINIE  370

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDA  337
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR +++RMDA
Sbjct  371  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILDRMDA  428



>emb|CDY00067.1| BnaC09g02340D [Brassica napus]
Length=428

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E N++  LL EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  251  HGEYNKLGGLLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  310

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  311  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKVDCPLINIE  370

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDA  337
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR +++RMDA
Sbjct  371  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILDRMDA  428



>ref|XP_009111835.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Brassica rapa]
Length=427

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E N++  LL EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  250  HGEYNKLGGLLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  309

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  310  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKLDCPLINIE  369

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDA  337
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR +++RMDA
Sbjct  370  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILDRMDA  427



>ref|XP_006395192.1| hypothetical protein EUTSA_v10004228mg [Eutrema salsugineum]
 gb|ESQ32478.1| hypothetical protein EUTSA_v10004228mg [Eutrema salsugineum]
Length=442

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 149/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++  LL EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  255  HREYKKLEALLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  314

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLI++E
Sbjct  315  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKLDCPLISIE  374

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR ++ERMDAE
Sbjct  375  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILERMDAE  433



>ref|NP_199648.1| thioesterase family protein [Arabidopsis thaliana]
 dbj|BAA98194.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU90051.1| At5g48370 [Arabidopsis thaliana]
 gb|AAV59268.1| At5g48370 [Arabidopsis thaliana]
 dbj|BAE99018.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95659.1| thioesterase family protein [Arabidopsis thaliana]
Length=438

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++   L EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  245  HGECKKLEAWLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  304

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  305  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKQDCPLINIE  364

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR ++ERMDAE
Sbjct  365  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILERMDAE  423



>ref|NP_001078736.1| thioesterase family protein [Arabidopsis thaliana]
 gb|AED95660.1| thioesterase family protein [Arabidopsis thaliana]
Length=437

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++   L EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  244  HGECKKLEAWLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  303

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  304  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKQDCPLINIE  363

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR ++ERMDAE
Sbjct  364  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILERMDAE  422



>ref|XP_002865629.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41888.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++   L EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  245  HGECKKLKAWLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  304

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  305  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKLDCPLINIE  364

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR ++ERMDAE
Sbjct  365  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILERMDAE  423



>ref|XP_010493652.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=431

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++   L EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  244  HGECKKLEAWLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  303

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  304  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKLDCPLINIE  363

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR ++ERMDAE
Sbjct  364  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILERMDAE  422



>ref|XP_010493651.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=432

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++   L EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  245  HGECKKLEAWLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  304

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  305  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKLDCPLINIE  364

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR ++ERMDAE
Sbjct  365  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILERMDAE  423



>gb|KCW57955.1| hypothetical protein EUGRSUZ_H00690 [Eucalyptus grandis]
Length=422

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 146/176 (83%), Gaps = 11/176 (6%)
 Frame = -1

Query  855  VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRaf  676
              R+NELL EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM RAF
Sbjct  252  AKRLNELLTEGRIFSDMPALADRNSILLRDTHLENSLICQPQQRNIHGRIFGGFLMHRAF  311

Query  675  elayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            ELA++TAYAFAG  PCF E         VDVG+FLRFKSCVLYTE E P  PLI VEVVA
Sbjct  312  ELAFSTAYAFAGLVPCFLE---------VDVGDFLRFKSCVLYTEPEKPDGPLIFVEVVA  362

Query  495  HVTRPELRSSEVSNKFYFTFSVCSDA--LENGPRIRTVVPATEEEARRVIERMDAE  334
            HVTRPELRSSEVSN FYFTF+V  +A  LENG RIR VVPATEEEARR++ERMDAE
Sbjct  363  HVTRPELRSSEVSNTFYFTFTVRPEAKSLENGFRIRNVVPATEEEARRILERMDAE  418



>ref|XP_006280409.1| hypothetical protein CARUB_v10026342mg, partial [Capsella rubella]
 gb|EOA13307.1| hypothetical protein CARUB_v10026342mg, partial [Capsella rubella]
Length=471

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++   L EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  284  HGECKKLQAWLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  343

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  344  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKLDCPLINIE  403

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR ++ERMDAE
Sbjct  404  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILERMDAE  462



>gb|KFK31304.1| hypothetical protein AALP_AA6G095500 [Arabis alpina]
Length=432

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 149/179 (83%), Gaps = 5/179 (3%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++  LL EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  248  HGECKKLEALLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  307

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L++   PLIN+E
Sbjct  308  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDS---PLINIE  364

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVT PE RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR +IERM+AE
Sbjct  365  VVAHVTSPEFRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHIIERMEAE  423



>ref|XP_010095577.1| hypothetical protein L484_007416 [Morus notabilis]
 gb|EXB61150.1| hypothetical protein L484_007416 [Morus notabilis]
Length=419

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 142/177 (80%), Gaps = 17/177 (10%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E NR+  LL EGR+FCDMPALADR+SIL++DT L+N+LICQPQQRNIHGRIFGGFLM RA
Sbjct  255  EANRLQTLLAEGRIFCDMPALADRNSILMRDTRLENALICQPQQRNIHGRIFGGFLMHRA  314

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAYA               F   VDVG+FLR KSCVLYTE+ENP QPLIN+EVV
Sbjct  315  FELAFSTAYA---------------FAGLVDVGDFLRLKSCVLYTEVENPDQPLINIEVV  359

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSD--ALENGPRIRTVVPATEEEARRVIERMDAE  334
            AHVTRPELRSSEVSN FYFTF+V  +  A  NG RIR VVPATEEEARRV+ERMDAE
Sbjct  360  AHVTRPELRSSEVSNTFYFTFTVRPEVKASNNGFRIRNVVPATEEEARRVLERMDAE  416



>ref|XP_010442257.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Camelina sativa]
Length=607

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++   L EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  420  HGECKKLEAWLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  479

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAY FAG  P F EVDH+DFL+PVDVG+FLRFKSCVLYT+L+    PLIN+E
Sbjct  480  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPVDVGDFLRFKSCVLYTQLDKLDCPLINIE  539

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VVAHVT PE+RSSEVSN FYF F+V   + A  NG ++R VVPATEEEAR ++ERMDAE
Sbjct  540  VVAHVTSPEIRSSEVSNTFYFKFTVRPEAKARNNGFKLRNVVPATEEEARHILERMDAE  598



>ref|XP_009626002.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=515

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 146/173 (84%), Gaps = 9/173 (5%)
 Frame = -1

Query  855  VNR-INELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            VNR IN LL E        AL DRDSILI++TCLQNSL+CQP+QRN+HG+IFGGFLMR+A
Sbjct  337  VNRLINRLLAE--------ALLDRDSILIKETCLQNSLVCQPEQRNMHGQIFGGFLMRKA  388

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELAYATAY+FAGS PCF EVD++DFLKPVDVG+FL+ KSCVLYTELEN S+PLINVEVV
Sbjct  389  FELAYATAYSFAGSIPCFVEVDYVDFLKPVDVGDFLQLKSCVLYTELENMSRPLINVEVV  448

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMD  340
            AHVT P+  SSEVSN FYFTF+V SD+L NG +IR VVP TEEEA RVIE +D
Sbjct  449  AHVTHPKHISSEVSNNFYFTFTVSSDSLRNGLKIRNVVPGTEEEAWRVIEHID  501



>ref|XP_001784039.1| predicted protein [Physcomitrella patens]
 gb|EDQ51145.1| predicted protein [Physcomitrella patens]
Length=407

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 144/174 (83%), Gaps = 1/174 (1%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
             R+ ++L EGR+ CDMPALADRD++LI+ T L+N+LICQPQQRN+HGRIFGGFLMRRA+E
Sbjct  224  KRLKDILAEGRILCDMPALADRDTVLIRQTKLENALICQPQQRNMHGRIFGGFLMRRAYE  283

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA+AT Y FAG+ P F+EVDH+DF KPVDVGN LRFK+CVLYTE++   +PLI+VEVVA+
Sbjct  284  LAFATCYVFAGARPIFREVDHVDFRKPVDVGNLLRFKACVLYTEVDRVDRPLIHVEVVAN  343

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENGPR-IRTVVPATEEEARRVIERMDAE  334
            VT+PE R+SEVSN FYFTFSV S+  + G   +R V+P TEEEAR  + R DA+
Sbjct  344  VTQPEARTSEVSNTFYFTFSVDSEISKTGIMPVRRVLPETEEEARGYLARYDAD  397



>ref|XP_006365945.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=451

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+NELL E R+FCDMPALAD+DSILI+DTCLQNSLICQPQQRNIHGRIFGGFLMRRA
Sbjct  311  EVNRLNELLAESRIFCDMPALADKDSILIKDTCLQNSLICQPQQRNIHGRIFGGFLMRRA  370

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELAYATAYAFAGSAPCF EVDH+DFLKPVDVGNFLR KSCVLYTELE+ S+PLINVEVV
Sbjct  371  FELAYATAYAFAGSAPCFVEVDHVDFLKPVDVGNFLRLKSCVLYTELESLSKPLINVEVV  430

Query  498  AHVTRPELRSSE  463
            AHV RPELRSSE
Sbjct  431  AHVMRPELRSSE  442



>ref|XP_001770748.1| predicted protein [Physcomitrella patens]
 gb|EDQ64430.1| predicted protein, partial [Physcomitrella patens]
Length=399

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+ +LL EGRV C+MPALADR+SIL++DT L+N++ICQPQQRN+HGRIFGGFLMRRAFE
Sbjct  225  DRLAQLLREGRVLCEMPALADRNSILMRDTRLENAIICQPQQRNMHGRIFGGFLMRRAFE  284

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            +A++TAY F G  P F EVDH+DF +PVDVG+FLR KSCVLYTE EN  QP I+VEV+AH
Sbjct  285  IAFSTAYVFGGIRPLFLEVDHVDFRRPVDVGDFLRLKSCVLYTETENLEQPRIHVEVIAH  344

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENG--PRIRTVVPATEEEARRVIERMDAE  334
            VT+PEL+SSEVSN FYFTFS+  +    G    +R V+PATEEEAR  + R +A+
Sbjct  345  VTQPELKSSEVSNTFYFTFSLDPEIKAPGVDWNVRRVLPATEEEARTYLARYEAD  399



>gb|KJB71601.1| hypothetical protein B456_011G132500 [Gossypium raimondii]
Length=500

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+N LL EGRVFCDMPALADRDSILI+DT  +NSL+CQPQQRNIHGRIFGGFLMR+A E
Sbjct  353  DRLNTLLAEGRVFCDMPALADRDSILIRDTRHENSLMCQPQQRNIHGRIFGGFLMRKASE  412

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            LA++ AYAFAG+APCF EVDH+DF KPVDVGNFLRFKSCVLYTELENP +PLINVEVVAH
Sbjct  413  LAFSNAYAFAGAAPCFMEVDHVDFFKPVDVGNFLRFKSCVLYTELENPMKPLINVEVVAH  472

Query  492  VTRPELRSSEVSNKFY  445
            VTRPELR SEVS + Y
Sbjct  473  VTRPELRCSEVSTRNY  488



>ref|XP_001777944.1| predicted protein [Physcomitrella patens]
 gb|EDQ57268.1| predicted protein [Physcomitrella patens]
Length=429

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+ ++L EGRV C+MPAL DR+SIL++DT L+N++ICQPQQRNIHGRIFGGFLMRRAFE
Sbjct  246  DRLTQILREGRVLCEMPALGDRNSILMRDTRLENAIICQPQQRNIHGRIFGGFLMRRAFE  305

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAH  493
            +A++TAY F G  P F EVDH+DF +PVDVG+F+R KSCVLYTE EN  QP I+VEV+AH
Sbjct  306  IAFSTAYVFGGIRPLFLEVDHVDFRRPVDVGDFVRLKSCVLYTETENVEQPRIHVEVIAH  365

Query  492  VTRPELRSSEVSNKFYFTFSVCSDALENG--PRIRTVVPATEEEARRVIERMDAE  334
            VT+PEL+SSEVSN FYFTFS+  +    G    +R V+PATEEEAR  + R  A+
Sbjct  366  VTQPELKSSEVSNTFYFTFSLDPECQAPGVDRTVRRVLPATEEEARTYLARYKAD  420



>ref|XP_002971360.1| hypothetical protein SELMODRAFT_94987 [Selaginella moellendorffii]
 gb|EFJ27958.1| hypothetical protein SELMODRAFT_94987 [Selaginella moellendorffii]
Length=419

 Score =   210 bits (535),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            R+ +LL E RV  DMPALAD++SILIQ T L+N++ICQPQQRN+HGRIFGGFLMRRAFEL
Sbjct  246  RVQQLLAEARVLTDMPALADKNSILIQHTKLENAIICQPQQRNLHGRIFGGFLMRRAFEL  305

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHV  490
            A++T Y F G  P F EVDH+DFL+PVDVG+FLRF+SCVLYTE EN ++P I+VEV A V
Sbjct  306  AFSTCYVFGGHRPVFLEVDHVDFLRPVDVGDFLRFRSCVLYTEEENSARPKIHVEVKAIV  365

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPR-IRTVVPATEEEARRVIERMDAE  334
            T+PE RSS+VSN F+FTF++ + + ++G   +R V+P+TEEEARR + R DA+
Sbjct  366  TQPESRSSQVSNTFHFTFTLDTSSSKSGDMVVRRVLPSTEEEARRCVSRYDAD  418



>ref|XP_002961453.1| hypothetical protein SELMODRAFT_76096 [Selaginella moellendorffii]
 gb|EFJ36713.1| hypothetical protein SELMODRAFT_76096 [Selaginella moellendorffii]
Length=432

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafel  670
            R+ +LL E RV  DMPALAD++SILIQ T L+N++ICQPQQRN+HGRIFGGFLMRRAFEL
Sbjct  259  RVQQLLAEARVLTDMPALADKNSILIQHTKLENAIICQPQQRNLHGRIFGGFLMRRAFEL  318

Query  669  ayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHV  490
            A++T Y F G  P F EVDH+DFL+PVDVG+FLRF+SCVLYTE EN ++P I+VEV A V
Sbjct  319  AFSTCYVFGGHRPVFLEVDHVDFLRPVDVGDFLRFRSCVLYTEEENSARPKIHVEVKAIV  378

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPR-IRTVVPATEEEARRVIERMDAE  334
            T+PE RSS+VSN F+FTF++ + + ++G   +R V+P+TEEEARR + R DA+
Sbjct  379  TQPESRSSQVSNTFHFTFTLDTSSSKSGDMVVRRVLPSTEEEARRCVSRYDAD  431



>gb|KJB42645.1| hypothetical protein B456_007G161500 [Gossypium raimondii]
Length=397

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVN++  LL EGR+FCDMPALADRDSIL++DT L+N+LICQPQQRNIHGRIFGGFLM RA
Sbjct  249  EVNQLEPLLAEGRIFCDMPALADRDSILLRDTRLENALICQPQQRNIHGRIFGGFLMHRA  308

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG  PCF EVDH+DFL+PVDVG+FLR  SCVLYT+LENP QPLINVEVV
Sbjct  309  FELAFSTAYVFAGLVPCFLEVDHVDFLRPVDVGDFLRLTSCVLYTKLENPDQPLINVEVV  368

Query  498  AHVTRPELRSSEV  460
            AHVTRPE+RSSEV
Sbjct  369  AHVTRPEIRSSEV  381



>ref|XP_010672468.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=439

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            ++ RINELL EGRVF D+PALADRDSILI+DTCLQ+S+ICQPQQRNIHGRIFGGFLMR+A
Sbjct  308  DIIRINELLAEGRVFVDLPALADRDSILIRDTCLQSSIICQPQQRNIHGRIFGGFLMRKA  367

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            FELA++TAY FAG++P F EVDH+DF+KPVDVGNFLR KS VLYTE++NP +PLINVEVV
Sbjct  368  FELAFSTAYTFAGASPRFVEVDHVDFVKPVDVGNFLRMKSSVLYTEVQNPDRPLINVEVV  427

Query  498  AHVTRPELRSSE  463
            AHVTRPELR+SE
Sbjct  428  AHVTRPELRTSE  439



>ref|XP_006342415.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Solanum tuberosum]
Length=435

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 134/157 (85%), Gaps = 3/157 (2%)
 Frame = -1

Query  798  LADRDS---ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPC  628
            LA++D+   ILI++TCLQNSL+CQP++ NIHG+IFGG+LMR+A+ELAYATAY+FA S PC
Sbjct  276  LANKDNNNNILIKETCLQNSLVCQPEKNNIHGQIFGGYLMRKAYELAYATAYSFARSPPC  335

Query  627  FKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKF  448
            F EVDH+DFLKPV+ G+FL  KSCV+YT +EN S+PLINVEVV+HVT+P+  SSEVSN F
Sbjct  336  FVEVDHVDFLKPVNAGDFLHLKSCVIYTRVENSSRPLINVEVVSHVTQPQDLSSEVSNNF  395

Query  447  YFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDA  337
            YFTF+V SD+L NG +IR VVP TEEEA RV++  D+
Sbjct  396  YFTFTVPSDSLRNGLKIRNVVPGTEEEAWRVMDVRDS  432



>ref|XP_004253025.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial [Solanum 
lycopersicum]
Length=441

 Score =   198 bits (503),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  792  DRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVD  613
            + ++ILI +TCLQN L+CQP++ NIHG+IFGG+LMR+A+ELAYATAY+FA + PCF EVD
Sbjct  281  NNNNILINETCLQNYLVCQPEKNNIHGQIFGGYLMRKAYELAYATAYSFARTPPCFVEVD  340

Query  612  HIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFS  433
            H++FLKPVD G+FL  KSCV+YT+ EN S+PLINVEV+AHVT+P+  SSEVSN FYFTF+
Sbjct  341  HVNFLKPVDAGDFLHLKSCVIYTQFENSSRPLINVEVLAHVTQPQDLSSEVSNNFYFTFT  400

Query  432  VCSDALENGPRIRTVVPATEEEARRVIE  349
            V SD+L NG +IR VVP T+EEARRVI+
Sbjct  401  VPSDSLRNGLKIRNVVPGTKEEARRVID  428



>gb|KCW46047.1| hypothetical protein EUGRSUZ_L00021 [Eucalyptus grandis]
Length=147

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 126/158 (80%), Gaps = 17/158 (11%)
 Frame = -1

Query  807  MPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPC  628
            MPALA +DSILI+DTC +NSLICQPQQRNIHGRIFGGFLM RAFELA+++ YAFAG+AP 
Sbjct  1    MPALAYKDSILIRDTCFENSLICQPQQRNIHGRIFGGFLMHRAFELAFSSTYAFAGAAPR  60

Query  627  FKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKF  448
            F EVDH+DFL+P+D                 NP +PLINVEVVAHV + ELRSSEVSNKF
Sbjct  61   FVEVDHVDFLRPLD-----------------NPDEPLINVEVVAHVIQLELRSSEVSNKF  103

Query  447  YFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            YFTF+V  +AL +G RI+ VVP+TEEEA RV+ERMDAE
Sbjct  104  YFTFTVHPEALNDGLRIQKVVPSTEEEAWRVLERMDAE  141



>ref|XP_009358934.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
[Pyrus x bretschneideri]
Length=142

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = -1

Query  720  IHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTE  541
            +HGRIFGGFLM RAFELA++TAYAFAG  PCF EVDHIDFLKPVDVG+FLRF+SCVLY E
Sbjct  1    MHGRIFGGFLMHRAFELAFSTAYAFAGLVPCFLEVDHIDFLKPVDVGDFLRFRSCVLYAE  60

Query  540  LENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC--SDALENGPRIRTVVPATEEE  367
            ++NP QPLIN+EVVAHVTR ELRSSEVSN FYFTF+V   + A ++G R+  VVPATEEE
Sbjct  61   VQNPDQPLINIEVVAHVTRHELRSSEVSNTFYFTFTVRPEAKATKDGFRLLNVVPATEEE  120

Query  366  ARRVIERMDAE  334
            AR ++ERMDA+
Sbjct  121  ARHIVERMDAQ  131



>emb|CBI25686.3| unnamed protein product [Vitis vinifera]
Length=115

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 2/102 (2%)
 Frame = -1

Query  633  PCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSN  454
            PCF EVDH+DFL+PVDVG+FLRFKSCVL+T+LENP QPLIN+EVVAHVTRPELRSSEVSN
Sbjct  3    PCFLEVDHVDFLRPVDVGDFLRFKSCVLFTQLENPEQPLINIEVVAHVTRPELRSSEVSN  62

Query  453  KFYFTFSVC--SDALENGPRIRTVVPATEEEARRVIERMDAE  334
             FYFTF+V   + A +NG RIR VVPATEEEARR++ERMDAE
Sbjct  63   TFYFTFTVRPEAKATKNGFRIRNVVPATEEEARRILERMDAE  104



>gb|KJB10811.1| hypothetical protein B456_001G226300 [Gossypium raimondii]
Length=397

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 101/143 (71%), Gaps = 10/143 (7%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E+NR+  LL EGR+FCDMPALADRDSIL++DT L+N+LICQPQQRNIHGRIFGGFLM 
Sbjct  255  HGEINRLEALLAEGRIFCDMPALADRDSILLKDTHLENALICQPQQRNIHGRIFGGFLMH  314

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
            RAFELA++TAYAFAG  PCF EVDH+DFL+PV +  FL F        +E  +   I++ 
Sbjct  315  RAFELAFSTAYAFAGLVPCFLEVDHVDFLRPVSI--FLLF--------VELLASTCISIY  364

Query  504  VVAHVTRPELRSSEVSNKFYFTF  436
            +     R   R  E S  FY  F
Sbjct  365  IFIFHARCCSRLFEHSTSFYLAF  387



>ref|XP_002176416.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42652.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=475

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 115/179 (64%), Gaps = 17/179 (9%)
 Frame = -1

Query  837  LLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayat  658
            LL E     +MPALA+  SIL+  T +QN++I QPQ +N+H R+FGGFLMRRAFELAY+ 
Sbjct  295  LLQEAGPLLNMPALANPHSILMNATRMQNAMIAQPQTQNLHNRVFGGFLMRRAFELAYSN  354

Query  657  ayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTEL-----------ENPSQPLIN  511
            AY F G+ P F EVD + F  PVDVG+ L F S VLYT+            ++   PLI 
Sbjct  355  AYVFGGARPIFLEVDDVSFANPVDVGDLLVFNSRVLYTDHGRLGDYYASSNDHRELPLIY  414

Query  510  VEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDAE  334
            VEV A VT PE  S+ +SN+FYFTF+       + P +R V+P++ +EA R+  RM+A+
Sbjct  415  VEVEAWVTEPERVSARLSNQFYFTFAA------DQPMVRRVLPSSMDEASRMATRMEAD  467



>ref|XP_002288240.1| hypothetical protein THAPSDRAFT_14923 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED93676.1| hypothetical protein THAPSDRAFT_14923, partial [Thalassiosira 
pseudonana CCMP1335]
Length=367

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 111/180 (62%), Gaps = 15/180 (8%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R  +LL E      MP+LAD  +IL+  T   N+++ QPQ RN+H RIFGGFLMRRAFE
Sbjct  193  SRAAKLLEEAGTLLRMPSLADPHTILMDQTAQSNAMVAQPQARNLHDRIFGGFLMRRAFE  252

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQ----------  523
            LA+AT Y F G  P F EVD I F KPVDVG+ L FKS VLYT  E  +           
Sbjct  253  LAFATCYMFGGDKPRFLEVDDISFDKPVDVGDLLVFKSRVLYTMPEGGNLGSYVDKHEGF  312

Query  522  PLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERM  343
            PL+NVEV   VT PE + +EVSN FYFTF     AL      R V+PA  ++ARR+ +RM
Sbjct  313  PLVNVEVECWVTCPESKRAEVSNHFYFTF-----ALPAKDTCRRVLPANIDQARRMAQRM  367



>gb|EWM27653.1| Thioesterase superfamily [Nannochloropsis gaditana]
Length=430

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 110/171 (64%), Gaps = 6/171 (4%)
 Frame = -1

Query  846  INELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafela  667
            I  LL + R   +MP LAD   +L+ +T   NS I QPQQRN+  R+FGGFLMRRA+E+A
Sbjct  260  IKLLLSQARPLMEMPCLADPTCVLVDNTRASNSSIMQPQQRNMLNRVFGGFLMRRAYEIA  319

Query  666  yatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTEL-ENPSQPLINVEVVAHV  490
            Y+T Y FAGS P F +V H+DF  PVDVG+ +RF + VLYT   +    P ++V+VVA +
Sbjct  320  YSTCYLFAGSRPEFFQVAHVDFTSPVDVGDLMRFDAAVLYTHTGQQTGSPHVHVQVVASI  379

Query  489  TRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIERMDA  337
             RPE   S +SN F F F V        P +R V+PA  ++A+R+IERM A
Sbjct  380  CRPETVHSTISNTFNFVFRV-----PGRPTVRKVLPANLDQAKRMIERMTA  425



>ref|XP_010242488.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X4 [Nelumbo nucifera]
Length=475

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EV+R+  LL EGR+FCDMPALA+RDSIL++DT LQNSLICQPQQRN+HGRIFGGFLM RA
Sbjct  360  EVDRLEALLAEGRIFCDMPALANRDSILMRDTRLQNSLICQPQQRNMHGRIFGGFLMNRA  419

Query  678  felayatayafagsAPCFKEVDHIDFLKPV  589
            FELA++TAYAFAG  PCF EVDH+DFLKPV
Sbjct  420  FELAFSTAYAFAGMVPCFLEVDHVDFLKPV  449



>gb|KJB71602.1| hypothetical protein B456_011G132500 [Gossypium raimondii]
Length=449

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
            +R+N LL EGRVFCDMPALADRDSILI+DT  +NSL+CQPQQRNIHGRIFGGFLMR+A E
Sbjct  353  DRLNTLLAEGRVFCDMPALADRDSILIRDTRHENSLMCQPQQRNIHGRIFGGFLMRKASE  412

Query  672  layatayafagsAPCFKEVDHIDFLKPV  589
            LA++ AYAFAG+APCF EVDH+DF KPV
Sbjct  413  LAFSNAYAFAGAAPCFMEVDHVDFFKPV  440



>gb|KJB42643.1| hypothetical protein B456_007G161500 [Gossypium raimondii]
 gb|KJB42644.1| hypothetical protein B456_007G161500 [Gossypium raimondii]
Length=356

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVN++  LL EGR+FCDMPALADRDSIL++DT L+N+LICQPQQRNIHGRIFGGFLM RA
Sbjct  249  EVNQLEPLLAEGRIFCDMPALADRDSILLRDTRLENALICQPQQRNIHGRIFGGFLMHRA  308

Query  678  felayatayafagsAPCFKEVDHIDFLKPV  589
            FELA++TAY FAG  PCF EVDH+DFL+PV
Sbjct  309  FELAFSTAYVFAGLVPCFLEVDHVDFLRPV  338



>ref|XP_012084425.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Jatropha curcas]
Length=381

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 88/104 (85%), Gaps = 2/104 (2%)
 Frame = -1

Query  894  RTERXQKRK*YXE--VNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRN  721
            + +R ++RK Y    VNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRN
Sbjct  246  KRKRVEERKDYENGGVNRLEALLAEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRN  305

Query  720  IHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPV  589
            IHGRIFGGFLM RAFELA++TAYAFAG  P F EVDH+DFL+P+
Sbjct  306  IHGRIFGGFLMHRAFELAFSTAYAFAGLVPYFLEVDHVDFLRPI  349



>ref|XP_010242487.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X3 [Nelumbo nucifera]
Length=493

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EV+R+  LL EGR+FCDMPALA+RDSIL++DT LQNSLICQPQQRN+HGRIFGGFLM RA
Sbjct  360  EVDRLEALLAEGRIFCDMPALANRDSILMRDTRLQNSLICQPQQRNMHGRIFGGFLMNRA  419

Query  678  felayatayafagsAPCFKEVDHIDFLKPV  589
            FELA++TAYAFAG  PCF EVDH+DFLKP 
Sbjct  420  FELAFSTAYAFAGMVPCFLEVDHVDFLKPA  449



>ref|XP_007199838.1| hypothetical protein PRUPE_ppa005627mg [Prunus persica]
 gb|EMJ01037.1| hypothetical protein PRUPE_ppa005627mg [Prunus persica]
Length=370

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            EVNR+  LL EGR+FCDMPALADRDSIL++DT L+NSLICQPQQRNIHGRIFGGFLM RA
Sbjct  265  EVNRLETLLAEGRIFCDMPALADRDSILLRDTRLENSLICQPQQRNIHGRIFGGFLMHRA  324

Query  678  felayatayafagsAPCFKEVDHIDFLKPV  589
            FELA++TAYAFAG  P F EVDH+DFL+PV
Sbjct  325  FELAFSTAYAFAGLVPYFLEVDHVDFLRPV  354



>ref|XP_003056867.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58512.1| predicted protein [Micromonas pusilla CCMP1545]
Length=409

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 101/162 (62%), Gaps = 3/162 (2%)
 Frame = -1

Query  822  RVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafa  643
            R   ++PALA RD +    T  +N  + QPQQRN+ GRIFGGFL+RRAFELA+AT Y F 
Sbjct  230  RTLAELPALAPRDVVPSSATRTENIFVAQPQQRNLSGRIFGGFLLRRAFELAFATTYVFG  289

Query  642  gsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQ---PLINVEVVAHVTRPELR  472
            G  P FK+V  +DFL+PVDVG+ LR KS VL+  + +  +     ++VEV A VT+PE  
Sbjct  290  GDRPVFKQVSDMDFLRPVDVGDLLRLKSRVLHASVSDEDEHKRSCVDVEVEAFVTKPERA  349

Query  471  SSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIER  346
            +SEVSN F F F V +         R V P + E+A  V ER
Sbjct  350  ASEVSNTFLFKFYVGAGGEGGATVTRRVAPMSREDAEHVWER  391



>ref|XP_004492893.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=399

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E  R+++LL EGR+FCDMPALADRDSIL++DT L+NSL+CQPQQRNIHGRIFGGFLM RA
Sbjct  267  EQKRLHDLLAEGRIFCDMPALADRDSILLRDTSLENSLLCQPQQRNIHGRIFGGFLMNRA  326

Query  678  felayatayafagsAPCFKEVDHIDFLKP  592
            FELA++TAYAFAG  P F EVDH+DFL+P
Sbjct  327  FELAFSTAYAFAGLVPYFLEVDHVDFLRP  355



>ref|XP_010095578.1| hypothetical protein L484_007417 [Morus notabilis]
 gb|EXB61151.1| hypothetical protein L484_007417 [Morus notabilis]
Length=212

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 9/125 (7%)
 Frame = -1

Query  783  SILIQD--TCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDH  610
            ++LI+D  T L++ L CQPQ R +HG +F GFLM  AFELA++TAYAFA S PCF +VD 
Sbjct  83   ALLIRDGATGLESWLRCQPQHRKMHGNVFVGFLMHTAFELAFSTAYAFAASVPCFLQVDQ  142

Query  609  IDFLKPVDVGNFLRFKSCVLYTELENPS-QPLINVEVVAHVTRPELRSSEVSNKFYFTFS  433
                  VDVG+F+RFKSCVLYT+ EN + QPLIN+EVVAHVTRPE + +EVSN FYFTF+
Sbjct  143  ------VDVGDFVRFKSCVLYTKHENNTDQPLINIEVVAHVTRPEEKFAEVSNTFYFTFT  196

Query  432  VCSDA  418
            V  +A
Sbjct  197  VPPEA  201



>ref|XP_005848127.1| hypothetical protein CHLNCDRAFT_145453 [Chlorella variabilis]
 gb|EFN56025.1| hypothetical protein CHLNCDRAFT_145453 [Chlorella variabilis]
Length=393

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 113/178 (63%), Gaps = 10/178 (6%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            E     +LL   +   D+PALAD + +L+ DT L+N+  CQPQ RN+HGR+FGGFLMRRA
Sbjct  205  EARWAEQLLAVAKTKMDLPALADSNLLLMDDTSLENTFTCQPQMRNVHGRVFGGFLMRRA  264

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTEL--ENPSQPLI---  514
            FELA++T Y FAG  P   EV+ + F +PV++G+ +R KS V +T +   NP Q L+   
Sbjct  265  FELAHSTTYLFAGCRPRAVEVEQVTFRRPVNIGDLMRLKSWVTHTWVSPHNPEQVLVVLD  324

Query  513  ---NVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRI--RTVVPATEEEARRV  355
                ++V A VT+PE RSS V+N F+  FS      E G  +  + V+P+TE++A +V
Sbjct  325  GMAQLQVEASVTQPERRSSVVTNTFHCVFSFELQRDEEGAPVPPKRVLPSTEQQALKV  382



>ref|XP_009036439.1| hypothetical protein AURANDRAFT_3016, partial [Aureococcus anophagefferens]
 gb|EGB08804.1| hypothetical protein AURANDRAFT_3016, partial [Aureococcus anophagefferens]
Length=317

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 105/160 (66%), Gaps = 12/160 (8%)
 Frame = -1

Query  837  LLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayat  658
            LLG GRV  D P  AD   + +  T L+N+L+C PQ+RN  GR+FGG LMRRA ELA+AT
Sbjct  166  LLGPGRVARDFPGQADDGCVPMASTSLRNALMCHPQERNTAGRVFGGVLMRRALELAFAT  225

Query  657  ayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPE  478
            A+++ G+AP  K +D +DF++PVDVG+ L  KS V++ E        ++V+V A V RP+
Sbjct  226  AFSYGGAAPLTKALDRVDFVRPVDVGSLLALKSHVVFAEGTT-----MHVDVSAAVWRPD  280

Query  477  LRSSEVSNKFYFTFSVCSDALENGPR-IRTVVPATEEEAR  361
             R S ++N F F F+V      +GPR ++ V+P+T  EAR
Sbjct  281  KRESTLTNTFSFVFTV------DGPRPLKRVLPSTRAEAR  314



>ref|XP_006395191.1| hypothetical protein EUTSA_v10004228mg [Eutrema salsugineum]
 gb|ESQ32477.1| hypothetical protein EUTSA_v10004228mg [Eutrema salsugineum]
Length=367

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  864  YXEVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            + E  ++  LL EGR+F DMPALADR+SIL++DT L+NSLICQPQQRNIHGRIFGGFLM 
Sbjct  255  HREYKKLEALLAEGRIFSDMPALADRNSILLKDTRLENSLICQPQQRNIHGRIFGGFLMH  314

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPV  589
            RAFELA++TAY FAG  P F EVDH+DFL+PV
Sbjct  315  RAFELAFSTAYTFAGLVPYFLEVDHVDFLRPV  346



>emb|CBJ27056.1| acyl-CoA thioesterase, putative [Ectocarpus siliculosus]
Length=555

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 105/179 (59%), Gaps = 17/179 (9%)
 Frame = -1

Query  837  LLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayat  658
            L+  G     +PALA+  ++L+  T   ++LIC PQ RN   RIFGGFLM RA+E+A+  
Sbjct  342  LVAAGFPLLHLPALANPHAVLMSQTLTSSTLICMPQHRNTANRIFGGFLMHRAYEVAFCA  401

Query  657  ayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTE--LENPSQPLINVEVVAHVTR  484
            A+ F GS P F E+D + FL+PVDVG+ ++  +C+LYT+   E  S P   VEV+A V R
Sbjct  402  AFTFGGSRPRFSEIDEVVFLQPVDVGDLVKMDACILYTKEGKEAGSSPQACVEVLASVVR  461

Query  483  PELRSSEVSNKFYFTFSV-------------CSDALENGPR--IRTVVPATEEEARRVI  352
            PE   S+VSN+F  TFS              C+D     P   +RTV+PA   EA R++
Sbjct  462  PETVDSKVSNRFNLTFSFPELASGVEEGNRPCADGFSQSPAALLRTVLPANATEASRIV  520



>gb|KIZ02063.1| Acyl-coenzyme A thioesterase 10 [Monoraphidium neglectum]
Length=246

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 105/166 (63%), Gaps = 11/166 (7%)
 Frame = -1

Query  846  INELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafela  667
            + EL+    +  DMPALA    +L+  T L+N+  CQPQQRN HGR+FGGFL+RRAFELA
Sbjct  83   LAELVAAASIVRDMPALAPPHDMLMGQTSLENTFTCQPQQRNPHGRVFGGFLLRRAFELA  142

Query  666  yatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVT  487
            +AT Y FAGS P F  VD + F KPVDVG+ LR +SCVL+TE +      + V V A V 
Sbjct  143  FATCYVFAGSRPIFDCVDDVQFKKPVDVGDLLRLRSCVLHTEGDR-----VVVVVEASVI  197

Query  486  RPELRSSEVSNKFYFTFSVCSDALENGP--RIRTVVPATEEEARRV  355
             PE  +S  +N F FTF     A  +GP  R+R V+P  E + RR+
Sbjct  198  APERLASSPTNAFTFTFR----AAPSGPQQRLRRVLPGDEGDLRRL  239



>ref|XP_002953988.1| hypothetical protein VOLCADRAFT_106173 [Volvox carteri f. nagariensis]
 gb|EFJ45017.1| hypothetical protein VOLCADRAFT_106173 [Volvox carteri f. nagariensis]
Length=436

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 98/163 (60%), Gaps = 2/163 (1%)
 Frame = -1

Query  840  ELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelaya  661
            E +   R   ++PALA  D++L+  TC  N+ ICQPQ RN  GR+FGGFLMRRA+ELA+A
Sbjct  265  EWIRAARRLQELPALASLDAVLMPFTCQHNTFICQPQHRNTSGRVFGGFLMRRAYELAFA  324

Query  660  tayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTE--LENPSQPLINVEVVAHVT  487
            T Y F G  P F++VD I F +PVDVG+ LR  S V +     E   +  + +EV A VT
Sbjct  325  TTYMFGGVRPTFQKVDEITFTRPVDVGDLLRLTSTVAHAAPLGEQQDRGRVVIEVEARVT  384

Query  486  RPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARR  358
            +PE   S VSN F F + + S       R++ V+P  EEE  R
Sbjct  385  KPEAVDSFVSNTFTFVYELRSRPGGQPLRLKRVLPTCEEEGLR  427



>ref|XP_002501004.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62262.1| predicted protein [Micromonas sp. RCC299]
Length=381

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 107/167 (64%), Gaps = 2/167 (1%)
 Frame = -1

Query  846  INELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafela  667
            + ++    R   ++PALA    + +  T  +N  + QPQQRN+ GRIFGGFL+RRAFELA
Sbjct  200  VEDVTRAARALRELPALAPAQDVAMDATRTENMFVAQPQQRNLSGRIFGGFLLRRAFELA  259

Query  666  yatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVT  487
            +AT Y F G+ P F  V  ++FL+PV+VG+ +R ++ VL+    +  +P ++VEV A VT
Sbjct  260  FATTYVFGGAKPKFHSVADMNFLRPVEVGDLMRIRARVLHATRTSCGRPSVDVEVEALVT  319

Query  486  RPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIER  346
            +PE   SEVSN F F F V  DA E G  +R V+P++ EEA  V E+
Sbjct  320  KPESLRSEVSNTFMFKFDV-GDANE-GRVVRRVLPSSREEAAHVWEK  364



>gb|AGM37972.1| acyl-coenzyme A thioesterase, partial [Caragana korshinskii]
Length=68

 Score =   107 bits (267),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  849  RINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRR  682
            R++ LL EGR+F DMPALADRDSIL++DTCLQNS ICQPQQRNIHGRIFGGFLMRR
Sbjct  5    RLSALLAEGRIFSDMPALADRDSILMKDTCLQNSFICQPQQRNIHGRIFGGFLMRR  60



>ref|XP_005848128.1| hypothetical protein CHLNCDRAFT_145454 [Chlorella variabilis]
 gb|EFN56026.1| hypothetical protein CHLNCDRAFT_145454 [Chlorella variabilis]
Length=478

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 113/181 (62%), Gaps = 14/181 (8%)
 Frame = -1

Query  858  EVNRINE-LLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRR  682
            E  R  E LL   +   D+PALAD + +L+ DT L+N+  CQPQQRN+HGRIFGGFLMRR
Sbjct  274  EAERWAEQLLAAAKTKRDLPALADANLLLMDDTSLENTFTCQPQQRNMHGRIFGGFLMRR  333

Query  681  afelayatayafagsAPCFKE-------VDHIDFLKPVDVGNFLRFKSCVL--YTELENP  529
            AFELA++TAY FAG  P   +       VD I F + V+VG+ ++FKS V   +   + P
Sbjct  334  AFELAHSTAYLFAGCRPRTGKRGRPPSPVDQITFQRAVNVGDLIKFKSRVTRAWALPDQP  393

Query  528  SQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV---CSDALENGPRIRTVVPATEEEARR  358
             Q +++++V A VT+PE  SSEV+N   F F V   C  A    P  + V+P+TE++A  
Sbjct  394  GQGVVHLQVEASVTQPERLSSEVTNTMNFLFQVDLRCDAAGHFIP-PKQVLPSTEQQALE  452

Query  357  V  355
            V
Sbjct  453  V  453



>gb|KCW63909.1| hypothetical protein EUGRSUZ_G01592 [Eucalyptus grandis]
Length=333

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            + +R+  LL EGRVFCDMPALADRDSILI+DT  +NSLIC+PQQRNIHGRIF GF MR+A
Sbjct  223  DSSRLQALLAEGRVFCDMPALADRDSILIRDTSFENSLICRPQQRNIHGRIFRGFFMRKA  282

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDV  583
            FELA++T+YAFAG AP   EVD +DFL+PV  
Sbjct  283  FELAFSTSYAFAGVAPRSLEVDPVDFLRPVST  314



>ref|XP_006442142.1| hypothetical protein CICLE_v10019655mg [Citrus clementina]
 gb|ESR55382.1| hypothetical protein CICLE_v10019655mg [Citrus clementina]
Length=443

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRR  682
            +R+N LL EGR+FCDMPALADRDSILI+DTC +NSL+CQPQQRNIHGRIFGGFLMR+
Sbjct  356  DRLNALLAEGRIFCDMPALADRDSILIKDTCHENSLMCQPQQRNIHGRIFGGFLMRK  412



>ref|XP_001418113.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96406.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=368

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 10/159 (6%)
 Frame = -1

Query  810  DMPAL-ADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsA  634
            +MPAL A  + ++   T  +N  + QPQQRN+ GR+FGGFL+RRA+ELA+A    F+G  
Sbjct  181  EMPALTAGYNEVMTTQTMAENMFVAQPQQRNLSGRVFGGFLLRRAYELAFANCQLFSGGH  240

Query  633  PCFKEVDHIDFLKPVDVGNFLRFKSCVLYT---ELENPSQPLINVEVVAHVTRPELRSSE  463
            P F E+  IDF  PV++G+ +RFK  VL+T   E     +P + +EV A VT P   +S 
Sbjct  241  PMFVEMSDIDFTLPVNIGDLVRFKCKVLHTVNAEEARCGKPSVYLEVRAIVTNPHKVTSA  300

Query  462  VSNKFYFTFSVCSDALENGP------RIRTVVPATEEEA  364
            V+NKF+F F+V   A  +G       R+R V+P + +EA
Sbjct  301  VANKFFFKFNVAEFAEADGTTTGEPVRLRRVLPESNDEA  339



>gb|KCW46070.1| hypothetical protein EUGRSUZ_L00044 [Eucalyptus grandis]
Length=118

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 68/106 (64%), Gaps = 10/106 (9%)
 Frame = -1

Query  609  IDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
            I F    DVGN L  K CVLY EL+NP++ L+NVEVVA V  PELRS EVSN+FYFT ++
Sbjct  4    IIFGMKADVGNLLCLKCCVLYAELDNPAELLVNVEVVADVMLPELRSREVSNEFYFTLTI  63

Query  429  CSDALENGPRIRTVVPATEEEARRVIERMDAEkcc*c*KLRHCRTS  292
              ++L NG    + VP+ EEEA  V+ERMD E          CRTS
Sbjct  64   HPESLNNGFE-DSEVPSMEEEAWHVLERMDVES---------CRTS  99



>emb|CEF98163.1| Thioesterase superfamily [Ostreococcus tauri]
Length=494

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 100/162 (62%), Gaps = 10/162 (6%)
 Frame = -1

Query  819  VFCDMPAL-ADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafa  643
            +  +MPAL A  + +L   T ++N  + QPQQRN+ GR+FGGFL+RRA+ELA+A    F+
Sbjct  305  LIMEMPALTAGYNEVLTSQTEVENMFVAQPQQRNLSGRVFGGFLLRRAYELAFANCQLFS  364

Query  642  gsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYT---ELENPSQPLINVEVVAHVTRPELR  472
            G  P F E+  IDF  PV VG+ +RFK  VL+T   E     +P + +EV A VT P   
Sbjct  365  GGQPMFVEMSDIDFKLPVSVGDLVRFKCKVLHTVNAEDARCGKPSVYIEVRAIVTNPHKV  424

Query  471  SSEVSNKFYFTFS----VCSDALENGP--RIRTVVPATEEEA  364
            +S V+N+F+F F+    V +D ++ G   R+R V+P + +E 
Sbjct  425  TSAVANRFFFKFNVEEFVDTDGVKTGEPVRLRRVLPQSNDEG  466



>gb|KDD73141.1| hypothetical protein H632_c2492p0 [Helicosporidium sp. ATCC 50920]
Length=409

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 99/166 (60%), Gaps = 5/166 (3%)
 Frame = -1

Query  837  LLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayat  658
            LL        +PAL  + ++L   T ++++ +CQPQQRNIHGR+FGG LMRRA+ELA+  
Sbjct  240  LLERANTLATLPALCGQRALLSPATEVRSAFVCQPQQRNIHGRVFGGLLMRRAYELAFVA  299

Query  657  ayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTEL--ENPSQPLINVEVVAHVTR  484
            AY +AG+ P    +D + F  PV+VG+ + F + +L+      +P +   +V+V A V +
Sbjct  300  AYQYAGAVPRSLGIDEVQFKHPVNVGDLIHFNARLLWGAASDSDPGRGCCHVQVQALVVQ  359

Query  483  PELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIER  346
            PE  +S V+N F F F      L  G   +TV+P TEEEA  V ++
Sbjct  360  PEKVTSRVTNTFDFAFDF---ELGEGGGPKTVLPVTEEEALHVAKK  402



>ref|XP_003079589.1| acyl-CoA thioester hydrolase-like (ISS) [Ostreococcus tauri]
Length=1155

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 100/162 (62%), Gaps = 10/162 (6%)
 Frame = -1

Query  819  VFCDMPAL-ADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafa  643
            +  +MPAL A  + +L   T ++N  + QPQQRN+ GR+FGGFL+RRA+ELA+A    F+
Sbjct  374  LIMEMPALTAGYNEVLTSQTEVENMFVAQPQQRNLSGRVFGGFLLRRAYELAFANCQLFS  433

Query  642  gsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYT---ELENPSQPLINVEVVAHVTRPELR  472
            G  P F E+  IDF  PV VG+ +RFK  VL+T   E     +P + +EV A VT P   
Sbjct  434  GGQPMFVEMSDIDFKLPVSVGDLVRFKCKVLHTVNAEDARCGKPSVYIEVRAIVTNPHKV  493

Query  471  SSEVSNKFYFTFS----VCSDALENGP--RIRTVVPATEEEA  364
            +S V+N+F+F F+    V +D ++ G   R+R V+P + +E 
Sbjct  494  TSAVANRFFFKFNVEEFVDTDGVKTGEPVRLRRVLPQSNDEG  535



>gb|KCW59196.1| hypothetical protein EUGRSUZ_H01859 [Eucalyptus grandis]
Length=83

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = -1

Query  588  DVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALEN  409
            DVGNFL  K C+LY EL+NP++PL+NVEVVA V +PELRS +VSN+FYFT ++  +AL N
Sbjct  4    DVGNFLCLKCCLLYAELDNPAEPLVNVEVVADVMQPELRSRKVSNEFYFTLTIHPEAL-N  62

Query  408  GPRIRTVVPATEEEARRVIER  346
                 + VP+ EEEA  V+ER
Sbjct  63   DEFEDSEVPSMEEEAWHVLER  83



>gb|EFA78510.1| RNA-binding region RNP-1 domain-containing protein [Polysphondylium 
pallidum PN500]
Length=588

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 84/146 (58%), Gaps = 4/146 (3%)
 Frame = -1

Query  780  ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa-felayatayafagsAPCFKEVDHID  604
            I ++DT LQ  ++CQPQ+RN+HG IFGG+LMR+            F  S P F  +D I 
Sbjct  422  IPMKDTSLQTVILCQPQERNMHGNIFGGYLMRKGFEIAFTTAFLQFNESIPTFFGMDDIT  481

Query  603  FLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSE--VSNKFYFTFSV  430
            F+ PVD+GN L   + V+YTE  +     + VEVVAHV+ P   SSE  +SN F FTF  
Sbjct  482  FVLPVDIGNILTLDATVVYTESVD-RLTYVQVEVVAHVSNPVSGSSEKHLSNVFNFTFLC  540

Query  429  CSDALENGPRIRTVVPATEEEARRVI  352
             ++   +  + + ++P +  EA R +
Sbjct  541  RNNKDADTVKPKRILPQSYSEAMRYL  566



>dbj|GAM22806.1| hypothetical protein SAMD00019534_059810 [Acytostelium subglobosum 
LB1]
Length=577

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 92/143 (64%), Gaps = 9/143 (6%)
 Frame = -1

Query  774  IQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayat-ayafagsAPCFKEVDHIDFL  598
            +Q T LQ  ++CQPQ+RN+HG IFGG+LMR+ FE+A+ T    F  S P F  +D I FL
Sbjct  417  MQSTSLQTVILCQPQERNMHGNIFGGYLMRKGFEIAFTTCFLQFNSSIPQFLGMDDITFL  476

Query  597  KPVDVGNFLRFKSCVLYTE-LENPSQPLINVEVVAHVTRPELRSSE--VSNKFYFTFSVC  427
             PVD+GN L  ++ ++YTE +E+ S   + VEV A+V+ P     E  +SN F FTF +C
Sbjct  477  LPVDIGNILTLEATIVYTETVEDIS--YVQVEVFAYVSVPLQGGPEKKLSNTFNFTF-IC  533

Query  426  SDALENGPRIRTVVPATEEEARR  358
             +++++ P  + V+P +  EA R
Sbjct  534  KESVQDKP--KRVLPQSYAEAMR  554



>gb|EJK72824.1| hypothetical protein THAOC_05606 [Thalassiosira oceanica]
Length=689

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = -1

Query  852  NRINELLGEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafe  673
             R   LL E      MP+LAD+D++LI  T   N+++ QPQ RN+H RIFGGFLMRR+FE
Sbjct  484  TRAARLLEEAGTLLRMPSLADQDTMLISQTAQSNAMVAQPQARNLHDRIFGGFLMRRSFE  543

Query  672  layatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKS  559
            LA+ATAY F G  P F EVD I F KPVDVG+ L FK+
Sbjct  544  LAFATAYLFGGDKPRFLEVDDISFDKPVDVGDLLVFKT  581



>ref|XP_004353154.1| acylCoA thioester hydrolase [Acanthamoeba castellanii str. Neff]
 gb|ELR23626.1| acylCoA thioester hydrolase [Acanthamoeba castellanii str. Neff]
Length=388

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 88/142 (62%), Gaps = 10/142 (7%)
 Frame = -1

Query  759  LQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLKPVDVG  580
            +Q+ L+CQPQ+RN H +IFGGFLM++A ELA+  A+ F G  P F  +D + F KPV++G
Sbjct  236  IQSVLLCQPQERNRHNKIFGGFLMQKAHELAWTNAHTFTGVRPWFLALDQVSFHKPVNIG  295

Query  579  NFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPR  400
            + + F S V+YT+        + V V+A V  P  R+ + +N F+FTF+ C +   + P 
Sbjct  296  SIIFFNSEVVYTQ-----SKAVGVRVIAEVLNPVERTRDKTNSFHFTFT-CPEGHGDAP-  348

Query  399  IRTVVPATEEEARRVIERMDAE  334
            +  V+P T EEA   I+ +D +
Sbjct  349  LPAVIPDTYEEA---IQYLDGK  367



>ref|XP_637683.1| RNA-binding region RNP-1 domain-containing protein [Dictyostelium 
discoideum AX4]
 gb|EAL64180.1| RNA-binding region RNP-1 domain-containing protein [Dictyostelium 
discoideum AX4]
Length=632

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 93/159 (58%), Gaps = 17/159 (11%)
 Frame = -1

Query  780  ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayat-ayafagsAPCFKEVDHID  604
            I + DT  Q+ ++CQPQ+RNI+G IFGG+L+R+ FE A+ T    F  S P F  +D I 
Sbjct  446  IQMSDTTCQSVILCQPQERNINGNIFGGYLLRKGFETAFTTCFMKFNSSLPRFCAMDDIT  505

Query  603  FLKPVDVGNFLRFKSCVLYTE-LEN-PSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
            FL PV++G+ L  +S ++Y++ + N P      VEV+A+VT P +   ++SN F FTF  
Sbjct  506  FLLPVEIGDILTLESTIVYSQSIPNLPQNYYAQVEVLAYVTNPYIGKKKLSNIFNFTF-Y  564

Query  429  CSDALEN-------------GPRIRTVVPATEEEARRVI  352
            CS + EN               +I+ ++P+T  EA R I
Sbjct  565  CSPSGENTKPPTSPDSSINFNSKIKQILPSTYSEAMRFI  603



>ref|XP_009494172.1| hypothetical protein H696_01998, partial [Fonticula alba]
 gb|KCV71049.1| hypothetical protein H696_01998, partial [Fonticula alba]
Length=360

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 79/137 (58%), Gaps = 10/137 (7%)
 Frame = -1

Query  765  TCLQNSLICQPQQRNIHGRIFGGFLMRRafelay-atayafagsAPCFKEVDHIDFLKPV  589
            TCL  ++ C  Q+RN+HG++FGG+LMR AFELA+        G+ P F   D I F KPV
Sbjct  34   TCLDTTIFCHRQERNVHGKLFGGYLMRHAFELAFCTALTYTGGAMPIFLGQDEIQFKKPV  93

Query  588  DVGNFLRFKSCVLYTE---LENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDA  418
            ++G+ L FKS +   E    +NP+     VEV+A V  P     + +N F++TF V    
Sbjct  94   EIGSLLSFKSRIELAEGSTGDNPNASQFQVEVMADVIDPATGDRDTTNVFHYTFQV----  149

Query  417  LENGPRIRTVVPATEEE  367
              N P +RTVVP T EE
Sbjct  150  -PNKP-LRTVVPQTYEE  164



>ref|XP_007387043.1| Thioesterase/thiol ester dehydrase-isomerase [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN05854.1| Thioesterase/thiol ester dehydrase-isomerase [Punctularia strigosozonata 
HHB-11173 SS5]
Length=364

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 84/146 (58%), Gaps = 4/146 (3%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            + + + DT ++  L+  PQ+RNIH +IFGG+LMR A+EL +A A  F  +   F  +D I
Sbjct  206  ERVWMGDTTIEKCLLMFPQERNIHQKIFGGYLMRLAYELGFANARLFTRAPVRFLSLDKI  265

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC  427
             F  PV +G+ LR +S VLY+E       L+++ V A+V  PE  S   +N F FT+  C
Sbjct  266  AFAAPVPIGSILRLRSRVLYSESSERWPALVHIGVQANVVEPETGSETTTNDFRFTW--C  323

Query  426  SDALENGPRIRTVVPATEEEARRVIE  349
             DA    P  R VVP T ++A   +E
Sbjct  324  RDA--GPPLTRKVVPQTYKDAMLWLE  347



>ref|XP_011401303.1| Acyl-coenzyme A thioesterase 9, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM28289.1| Acyl-coenzyme A thioesterase 9, mitochondrial [Auxenochlorella 
protothecoides]
Length=410

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 84/155 (54%), Gaps = 29/155 (19%)
 Frame = -1

Query  804  PALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCF  625
            PALAD  ++L   T L +S IC PQQRN +GR+FGGFLMRRAFELA  +AY  +G+ P  
Sbjct  263  PALADPQALLASATRLDSSFICMPQQRNTYGRVFGGFLMRRAFELATCSAYMLSGTRPKL  322

Query  624  KEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFY  445
             EVD I F KPVD                      + +V+V A VTRPE   + ++N F 
Sbjct  323  VEVDEILFRKPVD---------------------GMAHVQVEASVTRPEHALTTITNTFN  361

Query  444  FTFSVCSDALENGPR-----IRTVVPATEEEARRV  355
            F F+     L  GP       R V+P TEE+A  V
Sbjct  362  FQFTF---DLRKGPGGACLPPRVVLPTTEEQALEV  393



>ref|XP_009062950.1| hypothetical protein LOTGIDRAFT_195153 [Lottia gigantea]
 gb|ESO86416.1| hypothetical protein LOTGIDRAFT_195153 [Lottia gigantea]
Length=423

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 85/142 (60%), Gaps = 13/142 (9%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            +S+ ++ T L+N  IC P+ RN++ +IFGG++MR AFELA+A A  ++ S P  + VD I
Sbjct  282  NSVWMESTILKNLFICHPENRNLYNKIFGGYIMRIAFELAWANAALYSKSRPLVRIVDDI  341

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTF-SV  430
             F KPV++G+ L   S V+YTE     Q  + V+V A V  PE  S E +N F+FTF S 
Sbjct  342  AFRKPVEIGSLLFLSSQVVYTE-----QSKMQVKVHAEVVVPESGSRETTNDFHFTFDSK  396

Query  429  CSDALENGPRIRTVVPATEEEA  364
            C D       +  V+P T  E+
Sbjct  397  CDD-------LPQVIPKTYAES  411



>gb|KJA15154.1| hypothetical protein HYPSUDRAFT_149535 [Hypholoma sublateritium 
FD-334 SS-4]
Length=366

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 85/151 (56%), Gaps = 2/151 (1%)
 Frame = -1

Query  801  ALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFK  622
            A+A  D + + DT ++  ++  PQ+RN+H +IFGG+LMR A+EL +  A  F      F 
Sbjct  200  AVAGADHVFMADTVVEKCMLMFPQERNVHQKIFGGYLMRLAYELGFTNASMFTQGHTKFL  259

Query  621  EVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYF  442
             +D I F +PV +G+ LR +S +++T   +    L++V V A+V        + +N F F
Sbjct  260  SLDGISFARPVPIGSILRLRSQIVHTATSSQYPILVHVGVKANVVDVTTGLEQTTNDFRF  319

Query  441  TFSVCSDALENGPRIRTVVPATEEEARRVIE  349
            T+  C +   + P +R VVP T +EA   +E
Sbjct  320  TW--CQEHGSSSPNLRHVVPKTYKEAMLWLE  348



>ref|XP_007436715.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X3 [Python bivittatus]
Length=392

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            +S+ ++DT L++  IC PQ+RNI  RIFGGFLMR+A+EL +ATAY++  S P    VD I
Sbjct  245  NSVWMEDTALKSLEICHPQERNIFNRIFGGFLMRKAYELGWATAYSYGNSRPYVVAVDDI  304

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTF  436
             F KPVD+G+ L   S V YTE  N     I V V + V  P  R    +N F+FTF
Sbjct  305  MFQKPVDIGSLLLLSSKVCYTEKNN-----IQVRVHSEVYDPNTRVHHTTNVFHFTF  356



>gb|ETE71179.1| Acyl-coenzyme A thioesterase 10, mitochondrial, partial [Ophiophagus 
hannah]
Length=233

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            +S+ ++DT L+   IC PQ+RNI  RIFGGFLMR+A+EL +ATAY++  S P    VD I
Sbjct  107  NSVWMEDTKLKGLEICHPQERNIFNRIFGGFLMRKAYELGWATAYSYGNSRPYVVAVDDI  166

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
             F KPV++G+ L   S V YTE  N     I V V + V  P+ R    +N F+FTF +
Sbjct  167  MFQKPVEIGSLLLLSSQVCYTEKNN-----IQVRVHSEVYDPDTRVHHTTNVFHFTFMI  220



>ref|XP_007436714.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Python bivittatus]
Length=427

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            +S+ ++DT L++  IC PQ+RNI  RIFGGFLMR+A+EL +ATAY++  S P    VD I
Sbjct  280  NSVWMEDTALKSLEICHPQERNIFNRIFGGFLMRKAYELGWATAYSYGNSRPYVVAVDDI  339

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTF  436
             F KPVD+G+ L   S V YTE  N     I V V + V  P  R    +N F+FTF
Sbjct  340  MFQKPVDIGSLLLLSSKVCYTEKNN-----IQVRVHSEVYDPNTRVHHTTNVFHFTF  391



>ref|XP_007314761.1| hypothetical protein SERLADRAFT_459130 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO02868.1| hypothetical protein SERLA73DRAFT_176304 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO28562.1| hypothetical protein SERLADRAFT_459130 [Serpula lacrymans var. 
lacrymans S7.9]
Length=320

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 86/146 (59%), Gaps = 4/146 (3%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            + + + DT L+ +++  PQ+RN+H ++FGG+LMR A+EL +A A  F  S   F  +D I
Sbjct  157  EKVWMGDTKLEKTMLMFPQERNVHQKVFGGYLMRLAYELGFANASLFTRSHVRFLSLDGI  216

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC  427
             F +PV +G+ LR +S VL+++    + P ++V V+A+V        + +N+F FT+  C
Sbjct  217  SFARPVPIGSILRLRSLVLHSDTSGDAPPAVHVAVLANVVDVGTGQEQTTNEFRFTW--C  274

Query  426  SDALENGPRIRTVVPATEEEARRVIE  349
             D  +  P  R +VP T  EA   +E
Sbjct  275  RD--DGKPTSRKIVPKTYREAMLWLE  298



>ref|XP_007436713.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Python bivittatus]
Length=436

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            +S+ ++DT L++  IC PQ+RNI  RIFGGFLMR+A+EL +ATAY++  S P    VD I
Sbjct  289  NSVWMEDTALKSLEICHPQERNIFNRIFGGFLMRKAYELGWATAYSYGNSRPYVVAVDDI  348

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTF  436
             F KPVD+G+ L   S V YTE  N     I V V + V  P  R    +N F+FTF
Sbjct  349  MFQKPVDIGSLLLLSSKVCYTEKNN-----IQVRVHSEVYDPNTRVHHTTNVFHFTF  400



>emb|CEG78250.1| Putative Acyl-CoA thioester hydrolase [Rhizopus microsporus]
Length=286

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 84/147 (57%), Gaps = 7/147 (5%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafags-APCFKEVDH  610
            D + + DT ++++ I QPQ RNIH  IFGG+LMRRA+ELAYA    F  S +P    +D 
Sbjct  122  DKVWMSDTRIESNFIMQPQDRNIHNNIFGGYLMRRAYELAYANTALFMKSPSPTLLSMDE  181

Query  609  IDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
            + F KPV VG  L  KSC++ +  E      + V VVA V   E  + EV+N F+FT + 
Sbjct  182  VAFRKPVHVGTLLNLKSCIVLS--EGFPHRTVQVRVVAEVINIEKDTREVTNVFHFTLTT  239

Query  429  CSDALENGPRIRTVVPATEEEARRVIE  349
             +  +    R+R ++P T  E+   I+
Sbjct  240  GNPNI----RLRRILPRTYAESMLWID  262



>ref|XP_629631.1| hypothetical protein DDB_G0292458 [Dictyostelium discoideum AX4]
 gb|EAL61208.1| hypothetical protein DDB_G0292458 [Dictyostelium discoideum AX4]
Length=588

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 91/164 (55%), Gaps = 15/164 (9%)
 Frame = -1

Query  798  LADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayat-ayafagsAPCFK  622
            + DR+ I +  T L+  ++CQPQ++NI+G+IFGG+LMR AFE AY T    F  S P F+
Sbjct  400  VVDRNFIPMNSTSLETVILCQPQEKNINGQIFGGYLMRMAFETAYTTCFMKFPESLPRFR  459

Query  621  EVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLIN------VEVVAHVTRPELRSSEV  460
             +  + FLKPV++G+ L  +S + Y++  N      N      VEV+A+VT P +   ++
Sbjct  460  SISGLKFLKPVEIGDILNMESTITYSKPMNSEDDCENQTYYTQVEVLAYVTDPSIGEKKL  519

Query  459  SNKFYFTFSVCSDALE--------NGPRIRTVVPATEEEARRVI  352
            SN F FTF       +           +++ ++P T  EA R +
Sbjct  520  SNVFNFTFYCAPSKSQKEKLQQQNTNKKLKQILPQTYSEAMRYL  563



>ref|WP_019307666.1| hypothetical protein [SAR324 cluster bacterium SCGC AAA240-J09]
Length=371

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 87/146 (60%), Gaps = 6/146 (4%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            + + +Q++  Q++L+  PQ RN+H  IFGG+LMR AFELA+   Y F    P F  +DH+
Sbjct  215  EGVPMQESIRQSTLLMHPQSRNVHNNIFGGYLMREAFELAWNITYLFCRKRPQFVSMDHM  274

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC  427
             F KPV++G+ + F   V+YT  ++     + VEVV  V RP+   ++++N  YFTF+  
Sbjct  275  YFYKPVEIGSIISFTGRVVYTVDKS-----LMVEVVTEVIRPKSGETQLTNVCYFTFNAL  329

Query  426  SDALENGPRIRTVVPATEEEARRVIE  349
             D+     +I  ++P T EE  + ++
Sbjct  330  DDS-RKLQQIPVILPETYEEGLKYLD  354



>ref|XP_004998419.1| hypothetical protein PTSG_11662 [Salpingoeca rosetta]
 gb|EGD76244.1| hypothetical protein PTSG_11662 [Salpingoeca rosetta]
Length=407

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 78/141 (55%), Gaps = 8/141 (6%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            D++ + DT  Q+  +C P +RNIH  IFGGF+MR AFE+ + TA       P    VD I
Sbjct  247  DTLWMVDTQRQSMRMCHPIERNIHNSIFGGFIMREAFEIGWMTAVLAVKDHPFLLAVDDI  306

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC  427
             F  PV++G+ L F S + Y    N S+ L  V+V A V  P    S+V+N F+FTFS  
Sbjct  307  SFQHPVEIGSLLTFSSMITYAP-GNDSRAL-QVDVRAEVISPTTGQSKVTNTFHFTFSAP  364

Query  426  SDALENGPRIRTVVPATEEEA  364
                   P + TV+P T EE+
Sbjct  365  H------PTVPTVLPRTYEES  379



>ref|XP_004347353.2| acyl-CoA Thioesterase [Capsaspora owczarzaki ATCC 30864]
Length=545

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 85/146 (58%), Gaps = 9/146 (6%)
 Frame = -1

Query  780  ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDF  601
            ++++DT + ++ +CQPQ RNIH RIFGG+LMR A+ELA+A ++ +A + P F  +D I F
Sbjct  382  VMMRDTIMSSTTVCQPQDRNIHHRIFGGWLMRNAYELAWAASHFYARAPPVFVALDDISF  441

Query  600  LKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSD  421
             KPV++G+ L + S V +           +V V A +  P     E +N F+F F VC  
Sbjct  442  QKPVEIGSILSYTSQVTFA--RGFPHKSFHVSVRADIIDPVTGRQETTNVFHFVF-VCEK  498

Query  420  ALENGPRIRTVVPATEEEARRVIERM  343
                   I+ ++P T EE+ + +E M
Sbjct  499  P------IKPLLPETYEESMKYLESM  518



>gb|KJE93888.1| acyl-CoA Thioesterase [Capsaspora owczarzaki ATCC 30864]
Length=542

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 85/146 (58%), Gaps = 9/146 (6%)
 Frame = -1

Query  780  ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDF  601
            ++++DT + ++ +CQPQ RNIH RIFGG+LMR A+ELA+A ++ +A + P F  +D I F
Sbjct  379  VMMRDTIMSSTTVCQPQDRNIHHRIFGGWLMRNAYELAWAASHFYARAPPVFVALDDISF  438

Query  600  LKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSD  421
             KPV++G+ L + S V +           +V V A +  P     E +N F+F F VC  
Sbjct  439  QKPVEIGSILSYTSQVTFA--RGFPHKSFHVSVRADIIDPVTGRQETTNVFHFVF-VCEK  495

Query  420  ALENGPRIRTVVPATEEEARRVIERM  343
                   I+ ++P T EE+ + +E M
Sbjct  496  P------IKPLLPETYEESMKYLESM  515



>emb|CEI87287.1| Putative Acyl-CoA thioester hydrolase [Rhizopus microsporus]
Length=452

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 84/147 (57%), Gaps = 7/147 (5%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafags-APCFKEVDH  610
            D + + DT ++++ I QPQ RNIH  IFGG+LMRRA+ELAYA    F  S +P    +D 
Sbjct  288  DKVWMSDTRIESNFIMQPQDRNIHNNIFGGYLMRRAYELAYANTALFMKSPSPILLSMDE  347

Query  609  IDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
            + F KPV VG  L  KSC++ +  E      + V VVA V   E  + EV+N F+FT + 
Sbjct  348  VAFRKPVHVGTLLNLKSCIVLS--EGFPHRTVQVRVVAEVINIEKDTREVTNVFHFTLTT  405

Query  429  CSDALENGPRIRTVVPATEEEARRVIE  349
             +  +    R+R ++P T  E+   I+
Sbjct  406  GNPNI----RLRRILPRTYAESMLWID  428



>emb|CEG74895.1| Putative Acyl-CoA thioester hydrolase [Rhizopus microsporus]
 emb|CEI88856.1| Putative Acyl-CoA thioester hydrolase [Rhizopus microsporus]
Length=452

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 83/147 (56%), Gaps = 7/147 (5%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafags-APCFKEVDH  610
            D + + DT ++++ I QPQ RNIH  IFGG+LMRRA+ELAYA    F  S +P    +D 
Sbjct  288  DKVWMSDTRIESNFIMQPQDRNIHNNIFGGYLMRRAYELAYANTALFMKSPSPTLLSMDE  347

Query  609  IDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
            + F KPV VG  L  KSC++ +  E      + V VVA V   E  + EV+N F+FT + 
Sbjct  348  VAFRKPVHVGTLLNLKSCIVLS--EGFPHRTVQVRVVAEVINIEKDTREVTNVFHFTLTT  405

Query  429  CSDALENGPRIRTVVPATEEEARRVIE  349
             +       R+R ++P T  E+   I+
Sbjct  406  GNP----NTRLRRILPRTYAESMLWID  428



>ref|XP_003286177.1| hypothetical protein DICPUDRAFT_30493 [Dictyostelium purpureum]
 gb|EGC37289.1| hypothetical protein DICPUDRAFT_30493 [Dictyostelium purpureum]
Length=609

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 96/168 (57%), Gaps = 19/168 (11%)
 Frame = -1

Query  795  ADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelaya-tayafagsAPCFKE  619
            +D + I ++DT   + L+CQPQ+RNI+G+IFGG+LMR+ FELA++     F  S P F  
Sbjct  427  SDLELIPMKDTTCTSVLLCQPQERNINGQIFGGYLMRKGFELAFSCIFLKFNESLPLFVA  486

Query  618  VDHIDFLKPVDVGNFLRFKSCVLYTE-LENPSQPLI-NVEVVAHVTRPELRSSEVSNKFY  445
            +D + F  PV++G+ L  +S ++Y+  + N  Q     VEV A+VT P +   ++SN F 
Sbjct  487  MDDVTFYLPVEIGDILTLESTIVYSHPVPNEVQTYYAQVEVCAYVTNPYIGKKKLSNVFN  546

Query  444  FTFSVCSDALENG---------PRIRTVVPATEEEA------RRVIER  346
            FTF  CS   E           P+ + ++P T  +A      RR+++R
Sbjct  547  FTF-YCSPKGEGSKPMDPSAPQPKTKQILPQTYSQAMSYLAGRRIVDR  593



>ref|XP_007880412.1| hypothetical protein PFL1_04692 [Pseudozyma flocculosa PF-1]
 gb|EPQ27554.1| hypothetical protein PFL1_04692 [Pseudozyma flocculosa PF-1]
Length=486

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 78/152 (51%), Gaps = 11/152 (7%)
 Frame = -1

Query  792  DRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVD  613
            D+  + +  T L  ++   PQQRN+HG++FGGFLMR A+ELA+  A +F      F  +D
Sbjct  323  DQHLVPVSKTALSATMHLHPQQRNVHGKVFGGFLMRSAYELAWMVAASFVHRQVQFLSLD  382

Query  612  HIDFLKPVDVGNFLRFKSCVLYT----ELENPSQPLINVEVVAHVTRPELRSSEVSNKFY  445
             + F  PV +G  LR  S V Y+    +  N    +  V V+A V   E      SN F+
Sbjct  383  ALSFHAPVPIGAILRLSSQVTYSDESGDAANGKHAVAGVSVLAEVVNLETGVGSRSNTFH  442

Query  444  FTFSVCSDALENGPRIRTVVPATEEEARRVIE  349
            F+F V       GP  R V+P T +EA   IE
Sbjct  443  FSFDV-------GPPTRRVMPQTYKEAMEWIE  467



>gb|EPS97299.1| hypothetical protein FOMPIDRAFT_1128775 [Fomitopsis pinicola 
FP-58527 SS1]
Length=382

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 81/144 (56%), Gaps = 4/144 (3%)
 Frame = -1

Query  780  ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDF  601
            + + DT L+  ++  PQ+RN+H +IFGG+LMR A+EL +  A  F G    F  +D I F
Sbjct  214  VWMGDTHLEKCMMMFPQERNVHQKIFGGYLMRLAYELGFTNAELFTGCHVLFVSLDGISF  273

Query  600  LKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSD  421
             KPV +G+ LR  S +L+T        LI+V V A+V        + +N F FT+  C+D
Sbjct  274  AKPVPIGSILRLTSHILHTTSSEQFPGLIHVGVQANVVDVATGKEQTTNDFRFTW--CTD  331

Query  420  ALENGPRIRTVVPATEEEARRVIE  349
               N P  R VVP T +EA + +E
Sbjct  332  --HNIPLTRKVVPKTYKEAMQWLE  353



>ref|XP_007398945.1| hypothetical protein PHACADRAFT_149409 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM52604.1| hypothetical protein PHACADRAFT_149409 [Phanerochaete carnosa 
HHB-10118-sp]
Length=404

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 86/152 (57%), Gaps = 4/152 (3%)
 Frame = -1

Query  804  PALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCF  625
            P +AD + + +  T L+ +L   PQ+RNIH +IFGG+LMR A+EL Y+++  F      F
Sbjct  237  PRVADDERVPMGTTRLEKTLTMYPQERNIHQKIFGGYLMRLAYELGYSSSMLFTRGPVRF  296

Query  624  KEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFY  445
              +D I F +PV +G+ LR KS VL+T        LI+V V A+V      S +++N F 
Sbjct  297  LSLDSISFARPVPIGSVLRLKSHVLHTTSTKEFPALIHVGVEANVVDIRTGSEQMTNDFR  356

Query  444  FTFSVCSDALENGPRIRTVVPATEEEARRVIE  349
             T+  C +  E  P  R VVP T +EA   +E
Sbjct  357  LTW--CREDGE--PLKRVVVPMTYQEAMWWVE  384



>dbj|GAN04625.1| thioesterase/thiol ester dehydrase-isomerase [Mucor ambiguus]
Length=468

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -1

Query  783  SILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHID  604
            S+ ++DT LQ+  + QPQ RNIH ++FGG+LMRRA+ELA+AT   +A S      +D I 
Sbjct  307  SVWMEDTKLQSVFLMQPQDRNIHNKVFGGYLMRRAYELAHATGSVYAKSPVNLLSLDEII  366

Query  603  FLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
            F KPV VG+ L   S V+Y +  +P +    V V A VT PE  +++++N F+FT + 
Sbjct  367  FKKPVPVGSLLNLSSQVIYAQ-GDPHKSF-QVSVTAEVTDPEAGTTDLTNTFHFTLAA  422



>gb|EPB91441.1| hypothetical protein HMPREF1544_01763 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=446

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -1

Query  783  SILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHID  604
            S+ ++DT LQ+  + QPQ RNIH ++FGG+LMRRA+ELA+AT   +A S      +D I 
Sbjct  306  SVWMEDTKLQSVFLMQPQDRNIHNKVFGGYLMRRAYELAHATGSVYAKSPVNLLSLDEIV  365

Query  603  FLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
            F KPV VG+ L   S V+Y +  +P +    V V A VT PE  +++++N F+FT + 
Sbjct  366  FKKPVPVGSLLNLSSQVIYAQ-GDPHKSF-QVSVTAEVTDPEAGTTDLTNTFHFTLAA  421



>ref|XP_007908784.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Callorhinchus milii]
Length=448

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 78/141 (55%), Gaps = 12/141 (9%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            +S+ I +T L+   IC PQ+RNIH +IFGGFLMR+AFEL +A A  +  S P    VD I
Sbjct  291  NSVWIAETKLKGLEICHPQERNIHNKIFGGFLMRKAFELGWANACIYGNSRPHVVAVDDI  350

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC  427
             F KPV++G+ L   S V YT+     Q  I V V + V  P  +    +N F+FTF  C
Sbjct  351  IFQKPVEIGSLLYLSSQVCYTQ-----QNHIQVRVHSEVVNPYTKEHSTTNVFHFTF--C  403

Query  426  SDALENGPRIRTVVPATEEEA  364
            SD       +  V P T  E+
Sbjct  404  SDK-----EVARVTPKTYGES  419



>ref|XP_007908783.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Callorhinchus milii]
Length=451

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 78/141 (55%), Gaps = 12/141 (9%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            +S+ I +T L+   IC PQ+RNIH +IFGGFLMR+AFEL +A A  +  S P    VD I
Sbjct  294  NSVWIAETKLKGLEICHPQERNIHNKIFGGFLMRKAFELGWANACIYGNSRPHVVAVDDI  353

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC  427
             F KPV++G+ L   S V YT+     Q  I V V + V  P  +    +N F+FTF  C
Sbjct  354  IFQKPVEIGSLLYLSSQVCYTQ-----QNHIQVRVHSEVVNPYTKEHSTTNVFHFTF--C  406

Query  426  SDALENGPRIRTVVPATEEEA  364
            SD       +  V P T  E+
Sbjct  407  SDK-----EVARVTPKTYGES  422



>ref|XP_007514166.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15603.1| predicted protein [Bathycoccus prasinos]
Length=511

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 97/184 (53%), Gaps = 30/184 (16%)
 Frame = -1

Query  822  RVFCDMPALADRDS-----ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayat  658
            RV  +MP+ A  D      +L   T  +N  + QPQQ N+ GRIFGGFL+RR FELA A 
Sbjct  325  RVAKEMPSRAVLDEKLSKIVLTSQTVHENLFVAQPQQVNLSGRIFGGFLLRRGFELALAN  384

Query  657  ayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYT-------------------ELE  535
            AY FAG+ P F  +  +DF  PV+VG+ LRF++ +++                    E  
Sbjct  385  AYTFAGTFPLFVNMSDVDFRAPVEVGDLLRFRAHIIHVGEPGEFDKKTLELKETNVFESG  444

Query  534  NPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRV  355
            N  +  I ++V A V  P+  S+ V+N F  TF V      NG  + TV+P + +EA  V
Sbjct  445  NDIERDIVMQVEAIVVNPKTVSATVTNSFLITFRV------NGGLLPTVLPESTDEAFGV  498

Query  354  IERM  343
             E++
Sbjct  499  FEKV  502



>gb|KIO25285.1| hypothetical protein M407DRAFT_75957 [Tulasnella calospora MUT 
4182]
Length=401

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 94/171 (55%), Gaps = 16/171 (9%)
 Frame = -1

Query  831  GEGRVFC---------DMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRa  679
            GEG VF          D+P +   + + ++DT +++  +  PQ RNIH +IFGG+LMR A
Sbjct  219  GEGSVFVSDTQSEESFDIP-VNGVERVWMEDTKVESLTLMYPQSRNIHSKIFGGYLMRLA  277

Query  678  felayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVV  499
            +EL YA A  F      F  +D + F  PV +G+ LR  S + +T  +   + L+NV V 
Sbjct  278  YELGYANASLFTQCPLRFLSLDGLTFRLPVPIGSALRLTSTICHTATDEQHRALVNVWVQ  337

Query  498  AHVTRPELRSSEVSNKFYFTFSVCSDALENGPRI-RTVVPATEEEARRVIE  349
            A+V   +    + +N FYFT+  C    E+G  + RTVVP T +EA + +E
Sbjct  338  ANVIDSQTGDEQTTNNFYFTW--CR---EDGEGLKRTVVPKTYQEAMQWLE  383



>gb|KCW45309.1| hypothetical protein EUGRSUZ_L01023 [Eucalyptus grandis]
Length=110

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -1

Query  561  SCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVP  382
            SCV+  EL+NP++PLINVEVVAHV + +LRSSEVSNKFYFT ++  +AL +G RI+   P
Sbjct  12   SCVMCMELDNPAEPLINVEVVAHVMQRDLRSSEVSNKFYFTLTIHPEALNDGLRIQNSHP  71



>ref|XP_005108973.1| PREDICTED: acyl-coenzyme A thioesterase 10, mitochondrial-like 
[Aplysia californica]
Length=214

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 85/143 (59%), Gaps = 12/143 (8%)
 Frame = -1

Query  789  RDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCF-KEVD  613
            ++++ + +T L++ ++C P+QRN++ +IFGGFLMR+A+ELA+  A  +  + P   K VD
Sbjct  71   KNTVWMDETILKSLIVCHPEQRNLYNKIFGGFLMRKAYELAWTNASLYTNTRPRMCKIVD  130

Query  612  HIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFS  433
             I FLKPV++G+ L   S ++Y++ ++     + V V A V  P+    + +N F+FTF 
Sbjct  131  DILFLKPVEIGDLLFLSSQIVYSKGQD-----LQVHVHAEVVNPDTDVRQTTNDFHFTFD  185

Query  432  VCSDALENGPRIRTVVPATEEEA  364
                     P +  V+P T  E+
Sbjct  186  T------GLPDLPQVLPKTYAES  202



>ref|XP_008040130.1| Thioesterase/thiol ester dehydrase-isomerase [Trametes versicolor 
FP-101664 SS1]
 gb|EIW56678.1| Thioesterase/thiol ester dehydrase-isomerase [Trametes versicolor 
FP-101664 SS1]
Length=402

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 86/155 (55%), Gaps = 6/155 (4%)
 Frame = -1

Query  810  DMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAP  631
            D P   D++ + + DT L+ +LI  PQ+RN+H +IFGG+LMR A+EL +A +  F     
Sbjct  235  DSPTAPDQERVWMGDTRLEKTLIMFPQERNVHQKIFGGYLMRLAYELGFANSCLFTRDHV  294

Query  630  CFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNK  451
             F  +D I F +PV +G+ LR  S V+ +   +    L++V V A V      + + +N 
Sbjct  295  TFVSLDGISFARPVPIGSLLRLTSYVVNSASSDNYPTLVHVWVHADVVNLATGAEQRTND  354

Query  450  FYFTFSVCSDALENGPRI-RTVVPATEEEARRVIE  349
            F FT+       E+GP + R +VP T  EA + +E
Sbjct  355  FRFTW-----GRESGPPLKRMIVPKTYGEAMQWLE  384



>ref|XP_007773074.1| thioesterase thiol ester dehydrase-isomerase [Coniophora puteana 
RWD-64-598 SS2]
 gb|EIW76698.1| thioesterase thiol ester dehydrase-isomerase [Coniophora puteana 
RWD-64-598 SS2]
Length=364

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 83/149 (56%), Gaps = 4/149 (3%)
 Frame = -1

Query  795  ADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEV  616
            AD++ + + DT L+ +++  PQ+RN+H ++FGG+LMR A+EL ++ A  F  S   F  +
Sbjct  200  ADKEKLWMGDTRLEKTMLMFPQERNVHSKVFGGYLMRLAYELGFSNASLFTRSHVTFLSL  259

Query  615  DHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTF  436
            D I F +PV +G  LR  S ++Y+      +  ++V V A+V        E++N F FT+
Sbjct  260  DRISFARPVPIGCILRLTSQIIYSTPPEAGKGAVHVAVQAYVVDVSTGKEEMTNDFRFTW  319

Query  435  SVCSDALENGPRIRTVVPATEEEARRVIE  349
                   +  P  R VVP T +EA   +E
Sbjct  320  RRD----DGKPASRRVVPRTYKEAMLWLE  344



>ref|XP_007855068.1| acyl- thioester [Moniliophthora roreri MCA 2997]
 gb|ESK85636.1| acyl- thioester [Moniliophthora roreri MCA 2997]
Length=478

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 91/175 (52%), Gaps = 6/175 (3%)
 Frame = -1

Query  816  FCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafags  637
            +     + D D + + DT ++  ++  PQ+RN+H +IFGG+LMR A+EL ++ A  F+  
Sbjct  309  YGQQNGILDPDLVYMSDTRVEKCMLMFPQERNVHQKIFGGYLMRLAYELGFSNASMFSKG  368

Query  636  APCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVS  457
               F  +D I F KPV +G+ LR  S +L++        LI+V V A+V   +    + +
Sbjct  369  HVRFLSLDGISFAKPVPIGSILRLTSYILHSTSSAEYPMLIHVGVTANVVDIKTGLEQTT  428

Query  456  NKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIE-RMDAEkcc*c*KLRHCRT  295
            N+F FT+  C    E G   R VVP T +EA   +E R   E       LR  RT
Sbjct  429  NEFRFTW--CK---EEGEETRKVVPKTYQEAMLWLEGRRALEIGEAFRGLRTSRT  478



>ref|XP_007353554.1| Thioesterase/thiol ester dehydrase-isomerase [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD38364.1| Thioesterase/thiol ester dehydrase-isomerase [Auricularia delicata 
TFB-10046 SS5]
Length=361

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 83/142 (58%), Gaps = 4/142 (3%)
 Frame = -1

Query  774  IQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDFLK  595
            ++ T LQN  +  PQ+RN+HG++FGG+LMR A+ELAYA +  FA     F  +D I F +
Sbjct  207  MEGTRLQNCFMMFPQERNVHGKVFGGYLMRLAYELAYANSSLFARRPMRFLSLDDISFRR  266

Query  594  PVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSDAL  415
            PV++G+ +R  S + +T        +I+V V A V      S++++N F FT+  C D  
Sbjct  267  PVNIGSIVRLTSLISHTTSNEVYPVVIHVRVQADVLDITTGSAQMTNDFRFTW--CVDG-  323

Query  414  ENGPRIRTVVPATEEEARRVIE  349
               P  RTVVP T +EA   +E
Sbjct  324  -GDPIARTVVPQTYQEAMMWLE  344



>gb|KIL57624.1| hypothetical protein M378DRAFT_171567 [Amanita muscaria Koide 
BX008]
Length=407

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 83/150 (55%), Gaps = 4/150 (3%)
 Frame = -1

Query  795  ADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEV  616
            A  + + + DT ++ +++  PQ+RN+H +IFGG+LMR A+EL  + A  F      F  +
Sbjct  244  AHEERVWMGDTKVEKTMLMFPQERNVHQKIFGGYLMRLAYELGVSNAIMFTRGPVQFISL  303

Query  615  DHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTF  436
            D I F +PV +G+ LR  S +LYT   +    +++V V A+V   +  S   +N F FT+
Sbjct  304  DGISFSRPVPIGSILRLTSHILYTTSSDDLSSVVHVGVKANVADVQTGSEHTTNDFRFTW  363

Query  435  SVCSDALENGPRI-RTVVPATEEEARRVIE  349
                   E G +I R VVP T +EA   +E
Sbjct  364  ---YQEHEKGAKIPRKVVPKTYQEAMLWLE  390



>gb|KIK80861.1| hypothetical protein PAXRUDRAFT_36067 [Paxillus rubicundulus 
Ve08.2h10]
Length=362

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 85/148 (57%), Gaps = 5/148 (3%)
 Frame = -1

Query  792  DRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVD  613
            + D + + DT L+ +++  PQ+RN+H ++FGG+LMR A+EL +A +  F  S   F+ +D
Sbjct  201  ESDKVWLGDTKLEKTMLMFPQERNVHQKVFGGYLMRLAYELGFANSCLFTRSHVAFRSLD  260

Query  612  HIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFS  433
             I F KPV++G+ LR +S +L +         ++V V A+V   +    E +N F FT+ 
Sbjct  261  GISFRKPVNIGSILRLESQILNSTPPGELPAAVHVRVQANVVDVKTGREETTNDFRFTW-  319

Query  432  VCSDALENGPRIRTVVPATEEEARRVIE  349
                A ++G  I  +VP T +EA   +E
Sbjct  320  ----AKDDGHTIARIVPRTYQEAMLWLE  343



>emb|CEL60619.1| hypothetical protein RSOLAG1IB_03857 [Rhizoctonia solani AG-1 
IB]
Length=486

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 83/145 (57%), Gaps = 6/145 (4%)
 Frame = -1

Query  780  ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDF  601
            + ++DT L+ +L+  PQ+RN+H ++FGG+LMR A+E+ Y  AY F  +   F  +D I F
Sbjct  330  VWMEDTRLEKTLMMFPQKRNVHSKVFGGYLMRLAYEIGYTDAYMFTRAPLRFLSLDGIAF  389

Query  600  LKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSD  421
             KPV +G+ LR  S + +T        + +V+V A V  P    S ++N F FT+     
Sbjct  390  KKPVPIGSILRLTSHISHTTSNAEFSAVAHVQVEAEVIDPATGESNLTNTFRFTW-----  444

Query  420  ALENGPRI-RTVVPATEEEARRVIE  349
              ENGP + R V+P T  EA + +E
Sbjct  445  VRENGPPLQRLVIPRTYSEAMQWLE  469



>gb|KIK35365.1| hypothetical protein CY34DRAFT_96218 [Suillus luteus UH-Slu-Lm8-n1]
Length=363

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 83/151 (55%), Gaps = 5/151 (3%)
 Frame = -1

Query  801  ALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFK  622
             L+D +   + +T L+ +++  PQ+RN+H ++FGG+LMR A+EL +A A  F  S   F 
Sbjct  197  GLSDYEREWMGETHLEKTMLMFPQERNVHQKVFGGYLMRLAYELGFANASLFTRSHVTFM  256

Query  621  EVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYF  442
             +D I F KPV +G+ LR  S VL+T         ++V V A+V   +    + +N F F
Sbjct  257  SLDSISFAKPVPIGSILRLTSQVLHTTPPGELPAAVHVGVQANVVEVQTGREQTTNDFRF  316

Query  441  TFSVCSDALENGPRIRTVVPATEEEARRVIE  349
            T+    DA      +R VVP T +EA   +E
Sbjct  317  TWYPDDDA-----SVRQVVPKTYQEAMLWLE  342



>ref|XP_007249045.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X2 [Astyanax mexicanus]
Length=424

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 71/119 (60%), Gaps = 5/119 (4%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            +S+ ++D  L+   IC PQ+RNI  RIFGGFLMR+A+EL +A A AFAG  P    VD I
Sbjct  279  NSVWMEDAKLKGLEICHPQERNIFNRIFGGFLMRKAYELGWANACAFAGCRPSLVAVDDI  338

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
             F KPV++G+ L   S V YTE E+     + V V   V  P  R    +N F+FTF V
Sbjct  339  LFQKPVEIGSLLMLSSQVCYTEGEH-----VQVRVHTEVLDPLTRQHSTTNVFHFTFRV  392



>ref|XP_007249044.1| PREDICTED: acyl-coenzyme A thioesterase 9, mitochondrial isoform 
X1 [Astyanax mexicanus]
Length=433

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 71/119 (60%), Gaps = 5/119 (4%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            +S+ ++D  L+   IC PQ+RNI  RIFGGFLMR+A+EL +A A AFAG  P    VD I
Sbjct  288  NSVWMEDAKLKGLEICHPQERNIFNRIFGGFLMRKAYELGWANACAFAGCRPSLVAVDDI  347

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSV  430
             F KPV++G+ L   S V YTE E+     + V V   V  P  R    +N F+FTF V
Sbjct  348  LFQKPVEIGSLLMLSSQVCYTEGEH-----VQVRVHTEVLDPLTRQHSTTNVFHFTFRV  401



>gb|EFX89579.1| hypothetical protein DAPPUDRAFT_303215 [Daphnia pulex]
Length=424

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 79/139 (57%), Gaps = 12/139 (9%)
 Frame = -1

Query  780  ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDF  601
            + + D  L+N ++CQP+ RN   +IFGGFLMR A ELA+A  Y +  S P    VD I F
Sbjct  273  VWMADAKLKNMILCQPENRNRFNKIFGGFLMRLAVELAWANGYVYCKSLPTLVHVDDILF  332

Query  600  LKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSD  421
             KPV++G+ L F S V+YT+        + V V A V +PE  + +++N F+FT    S 
Sbjct  333  RKPVEIGSLLYFSSQVVYTQGH-----YVMVRVSAEVVQPEDGTHDLTNVFHFTLKTDSL  387

Query  420  ALENGPRIRTVVPATEEEA  364
            A E       V+P T +EA
Sbjct  388  APE-------VIPRTYQEA  399



>gb|KIY51616.1| Thioesterase/thiol ester dehydrase-isomerase [Fistulina hepatica 
ATCC 64428]
Length=371

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 86/156 (55%), Gaps = 10/156 (6%)
 Frame = -1

Query  813  CDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsA  634
             D+PA    + + + DT L+  ++  PQ+RN H +IFGG+LMR A+EL +A A  F    
Sbjct  202  TDLPA----ERVWMGDTQLEKCMLMFPQERNTHNQIFGGYLMRLAYELGFANASLFTRGH  257

Query  633  PCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQP-LINVEVVAHVTRPELRSSEVS  457
              F  +D I F +PV +G+ LR  S VL++   +P  P L+++ V A V   E  S + +
Sbjct  258  VNFLSLDGISFARPVPIGSILRLTSYVLHSS-SSPEYPTLVHIGVTAAVVDVETGSEQTT  316

Query  456  NKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIE  349
            N+F FT+  C    +  P  R VVP T  EA   +E
Sbjct  317  NEFRFTW--CRG--DGQPLARVVVPKTYREAMLWLE  348



>ref|XP_007304618.1| Thioesterase/thiol ester dehydrase-isomerase [Stereum hirsutum 
FP-91666 SS1]
 gb|EIM85904.1| Thioesterase/thiol ester dehydrase-isomerase [Stereum hirsutum 
FP-91666 SS1]
Length=367

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 6/150 (4%)
 Frame = -1

Query  792  DRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelaya-tayafagsAPC-FKE  619
            +R+ + + DT L+ + I  PQ+RN+H +IFGG+LMR A+E     T        P  F  
Sbjct  199  NRERVWMGDTKLERTTIMFPQERNLHQKIFGGYLMRLAYEALLGFTNSRLFTREPVRFLS  258

Query  618  VDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFT  439
            +D+I F +PV +G+ LR  S +L+T        +++V V+A V   E    E++N F FT
Sbjct  259  LDNISFARPVSIGSLLRLTSHILHTSSSEQFPAIVHVRVLATVVDVETGKEEMTNDFRFT  318

Query  438  FSVCSDALENGPRIRTVVPATEEEARRVIE  349
            +  C +  E  P  R VVP T  EA   +E
Sbjct  319  W--CRE--EGPPLPRKVVPKTYSEAMLWLE  344



>gb|KIY62154.1| Thioesterase/thiol ester dehydrase-isomerase [Cylindrobasidium 
torrendii FP15055 ss-10]
Length=368

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 84/154 (55%), Gaps = 3/154 (2%)
 Frame = -1

Query  807  MPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPC  628
            +P  AD + + + DT  +  ++  PQ+RN+HG++FGG+LMR A+EL +A    F      
Sbjct  197  LPRDADWERVWMGDTKAEKCMLMFPQERNVHGKVFGGYLMRMAYELGFANGSMFVQGPMS  256

Query  627  FKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPL-INVEVVAHVTRPELRSSEVSNK  451
            F  +D I F  PV +G+ LR  S +L+T+    + P  ++V V A+V   +  S   +N+
Sbjct  257  FLSLDSISFAAPVPIGSILRLSSHILHTKEATDNHPTRVHVGVTANVVDVKTGSELTTNE  316

Query  450  FYFTFSVCSDALENGPRIRTVVPATEEEARRVIE  349
            F FT+   +   +     R VVP T +E+   +E
Sbjct  317  FRFTWRKST--ADKSWTDRVVVPETYQESMSWLE  348



>ref|XP_001637295.1| predicted protein [Nematostella vectensis]
 gb|EDO45232.1| predicted protein [Nematostella vectensis]
Length=443

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 82/144 (57%), Gaps = 9/144 (6%)
 Frame = -1

Query  780  ILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHIDF  601
            +++ DT L +  IC PQQRN H ++FGG+L+R+AF LA+A+A  F  + P F  +D I F
Sbjct  292  VMMGDTELSSLSICNPQQRNSHNKVFGGYLLRKAFGLAWASACLFCRTKPQFVAMDDIWF  351

Query  600  LKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVCSD  421
             + V++G+ + F S V+YT  E  ++    +  VA V  P     E +N FY+TF     
Sbjct  352  RRGVEIGSLIEFTSQVVYTPPEQTNR--FQIMTVADVLDPGTGKRETTNVFYYTF-----  404

Query  420  ALENGPRIRTVVPATEEEARRVIE  349
              E+   +R V P T  EA R ++
Sbjct  405  --ESEMEVRPVAPRTYAEAMRYLD  426



>gb|KIP09446.1| hypothetical protein PHLGIDRAFT_22940 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=367

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 92/172 (53%), Gaps = 6/172 (3%)
 Frame = -1

Query  858  EVNRINELLGEGRVFCDM--PALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMR  685
            E   ++ L  +  V  D   P  A  + + + +T L+ +L   PQ+RNIH ++FGG+LMR
Sbjct  180  EAEALHSLYLQSTVVSDTSNPRPAGDERVPMGETRLEKTLTMYPQERNIHQKVFGGYLMR  239

Query  684  RafelayatayafagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVE  505
             A+EL Y+ +  F      F  +D I F +PV +G+ LR KS +L+T+       LI+V 
Sbjct  240  LAYELGYSNSMLFTRGPVRFLSLDSISFARPVPIGSVLRLKSYILHTDSTEEFPVLIHVG  299

Query  504  VVAHVTRPELRSSEVSNKFYFTFSVCSDALENGPRIRTVVPATEEEARRVIE  349
            V A+V      + +++N F  T+  C    E  P  RTVVP T +EA   +E
Sbjct  300  VKANVVDIRTGTEQMTNDFRLTW--CRQDGE--PLKRTVVPMTYQEAMWWVE  347



>ref|XP_003027876.1| hypothetical protein SCHCODRAFT_79337 [Schizophyllum commune 
H4-8]
 gb|EFI92973.1| hypothetical protein SCHCODRAFT_79337 [Schizophyllum commune 
H4-8]
Length=371

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 81/146 (55%), Gaps = 4/146 (3%)
 Frame = -1

Query  786  DSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVDHI  607
            D + + D+ L+ + +  PQ RN+H ++FGG+LMR A+EL +A+A  F      F  +D I
Sbjct  208  DCVWMSDSRLEKTQLMFPQVRNLHNKVFGGYLMRLAYELGFASASLFCRGPIRFFSLDGI  267

Query  606  DFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFSVC  427
             F KPV +G+ LR KS VL++        L++V V A+V        E +N+F FT+S  
Sbjct  268  SFAKPVPIGSILRLKSWVLHSATTAEHPVLVHVGVTANVVDVRTGKEETTNEFRFTWSRE  327

Query  426  SDALENGPRIRTVVPATEEEARRVIE  349
              A    P  RTVVP T  EA   +E
Sbjct  328  DGA----PLNRTVVPRTYGEAMLWLE  349



>gb|EMD35049.1| hypothetical protein CERSUDRAFT_116551 [Ceriporiopsis subvermispora 
B]
Length=430

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 86/162 (53%), Gaps = 5/162 (3%)
 Frame = -1

Query  831  GEGRVFCDMPALADRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatay  652
            G+   + D       + + + DT L+  ++  PQ+RN+H +IFGG+LMR A+EL +  A 
Sbjct  252  GQHETWKDYATSDAVERVWMGDTHLEKCMMMFPQERNVHQKIFGGYLMRLAYELGFTNAS  311

Query  651  afagsAPCFKEVDHIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELR  472
             F      F  +D I F +PV +G+ LR  S VL+T        +++V V A+V      
Sbjct  312  LFTRGHVRFLSLDGIAFTRPVPIGSILRLTSHVLHTSSSEQYPAIVHVGVQANVVDTATG  371

Query  471  SSEVSNKFYFTFSVCSDALENGPRI-RTVVPATEEEARRVIE  349
            + + +N F FT+  CSD  E  P + R VVP T +EA   +E
Sbjct  372  AEQTTNDFRFTW--CSD--EGAPPLTRKVVPKTYKEAMLWLE  409



>gb|KIJ18171.1| hypothetical protein PAXINDRAFT_161655 [Paxillus involutus ATCC 
200175]
Length=362

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 84/148 (57%), Gaps = 5/148 (3%)
 Frame = -1

Query  792  DRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelayatayafagsAPCFKEVD  613
            + D + + DT L+ +++  PQ+RN+H ++FGG+LMR A+EL +A +  F  S   F+ +D
Sbjct  201  ENDRVWLGDTKLEKTMLMFPQERNVHQKVFGGYLMRLAYELGFANSCLFTRSHVTFRSLD  260

Query  612  HIDFLKPVDVGNFLRFKSCVLYTELENPSQPLINVEVVAHVTRPELRSSEVSNKFYFTFS  433
             I F KPV++G+ LR +S +L           ++V V A+V   +    E +N F FT+ 
Sbjct  261  GISFRKPVNIGSILRLESQILNATPPGELPAAVHVRVQANVVDVKTGQEETTNDFRFTW-  319

Query  432  VCSDALENGPRIRTVVPATEEEARRVIE  349
                A ++G  I  +VP T +EA   +E
Sbjct  320  ----AKDDGHTIARIVPRTYQEAMLWLE  343



>ref|XP_010039372.1| PREDICTED: uncharacterized protein LOC104428071 [Eucalyptus grandis]
Length=140

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 14/76 (18%)
 Frame = -1

Query  633  PCFKEVDHIDFLKPV--------------DVGNFLRFKSCVLYTELENPSQPLINVEVVA  496
            P F EV+H++FL+PV              DVGNFL  K C+LY EL+NP++PL+NVEVVA
Sbjct  18   PGFFEVEHVEFLRPVEDHNMKDIIFGMKADVGNFLCLKCCLLYAELDNPAEPLVNVEVVA  77

Query  495  HVTRPELRSSEVSNKF  448
             V +PELRS + S ++
Sbjct  78   DVMQPELRSRKASLRW  93



>ref|XP_003287278.1| hypothetical protein DICPUDRAFT_151354 [Dictyostelium purpureum]
 gb|EGC36211.1| hypothetical protein DICPUDRAFT_151354 [Dictyostelium purpureum]
Length=586

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 101/169 (60%), Gaps = 21/169 (12%)
 Frame = -1

Query  792  DRDSILIQDTCLQNSLICQPQQRNIHGRIFGGFLMRRafelaya-tayafagsAPCFKEV  616
            D   I ++ T + + ++CQPQ++NI+G IFGG+LMR+ F++AY+  +  F  S P F  +
Sbjct  401  DLHLIPMKSTVIHSVILCQPQEKNINGSIFGGYLMRQGFQIAYSCVSLKFNESLPRFIAM  460

Query  615  DHIDFLKPVDVGNFLRFKSCVLYT-ELENPSQPLI-NVEVVAHVTRPELRSSEVSNKFYF  442
            D I FL PV++G+ L  +S ++Y+  +++ ++     VEV A+VT P +   ++SN F F
Sbjct  461  DDISFLLPVEIGDILSLESMIVYSCPIQSQTKAYYAQVEVKAYVTNPLIGEKKLSNIFNF  520

Query  441  TFSVCS---DALEN--------GPRIRTVVPATEEEA------RRVIER  346
            TF +CS    AL++          + + ++P T EEA      +R+++R
Sbjct  521  TF-LCSPSKKALQDDNATNNNIATKTKQILPQTYEEAMIFLSGKRIVDR  568



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2059730854950