BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1223

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004234074.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    210   6e-63   Solanum lycopersicum
ref|XP_009590977.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        209   1e-62   Nicotiana tomentosiformis
ref|XP_009607196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    207   6e-62   Nicotiana tomentosiformis
ref|XP_004233053.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    207   8e-62   Solanum lycopersicum
ref|XP_010316856.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    207   8e-62   Solanum lycopersicum
ref|XP_006358087.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    204   9e-61   Solanum tuberosum [potatoes]
ref|XP_006358089.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    204   1e-60   Solanum tuberosum [potatoes]
ref|XP_009785426.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        203   2e-60   Nicotiana sylvestris
ref|XP_009800423.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    202   4e-60   Nicotiana sylvestris
gb|EYU28126.1|  hypothetical protein MIMGU_mgv1a007967mg                201   1e-59   Erythranthe guttata [common monkey flower]
gb|EYU28125.1|  hypothetical protein MIMGU_mgv1a007967mg                202   4e-59   Erythranthe guttata [common monkey flower]
emb|CDO96875.1|  unnamed protein product                                196   6e-58   Coffea canephora [robusta coffee]
ref|XP_011101448.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        196   1e-57   Sesamum indicum [beniseed]
ref|XP_002305719.1|  hypothetical protein POPTR_0004s06100g             191   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_011033513.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    191   2e-55   Populus euphratica
ref|XP_006377531.1|  hypothetical protein POPTR_0011s06800g             187   8e-55   
ref|XP_002522271.1|  BRASSINAZOLE-RESISTANT 2 protein, putative         188   1e-54   Ricinus communis
ref|XP_011039378.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        187   4e-54   Populus euphratica
ref|XP_012091843.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    187   4e-54   Jatropha curcas
gb|KDO77946.1|  hypothetical protein CISIN_1g020318mg                   183   2e-53   Citrus sinensis [apfelsine]
ref|XP_006449559.1|  hypothetical protein CICLE_v10015910mg             184   5e-53   Citrus clementina [clementine]
ref|XP_007025289.1|  BES1/BZR1                                          183   1e-52   Theobroma cacao [chocolate]
gb|KHG25078.1|  BES1/BZR1 4 -like protein                               180   1e-51   Gossypium arboreum [tree cotton]
ref|XP_008371512.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        179   7e-51   Malus domestica [apple tree]
gb|KJB69668.1|  hypothetical protein B456_011G036300                    178   8e-51   Gossypium raimondii
ref|XP_002267082.1|  PREDICTED: BES1/BZR1 homolog protein 4             179   1e-50   Vitis vinifera
ref|XP_010242162.1|  PREDICTED: BES1/BZR1 homolog protein 4             178   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_007211637.1|  hypothetical protein PRUPE_ppa008675mg             177   2e-50   Prunus persica
ref|XP_008383594.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        177   3e-50   
gb|KJB13026.1|  hypothetical protein B456_002G052400                    176   8e-50   Gossypium raimondii
ref|XP_009352718.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        176   9e-50   Pyrus x bretschneideri [bai li]
gb|KHG15415.1|  BES1/BZR1 4 -like protein                               176   1e-49   Gossypium arboreum [tree cotton]
ref|XP_004309625.1|  PREDICTED: BES1/BZR1 homolog protein 4             171   4e-48   Fragaria vesca subsp. vesca
ref|XP_002317445.1|  brassinosteroid signaling positive regulator...    171   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_007021866.1|  BES1/BZR1                                          171   6e-48   
ref|XP_011044050.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        169   2e-47   Populus euphratica
ref|XP_010644097.1|  PREDICTED: BES1/BZR1 homolog protein 4             170   2e-47   Vitis vinifera
gb|KJB45771.1|  hypothetical protein B456_007G327000                    168   5e-47   Gossypium raimondii
ref|XP_004137229.1|  PREDICTED: BES1/BZR1 homolog protein 4             168   7e-47   Cucumis sativus [cucumbers]
ref|XP_010088009.1|  hypothetical protein L484_004599                   169   7e-47   
ref|XP_008451746.1|  PREDICTED: BES1/BZR1 homolog protein 4             167   2e-46   Cucumis melo [Oriental melon]
ref|XP_006442379.1|  hypothetical protein CICLE_v10021151mg             165   3e-46   
gb|KHG21553.1|  BES1/BZR1 4 -like protein                               165   7e-46   Gossypium arboreum [tree cotton]
ref|XP_004147390.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        166   7e-46   Cucumis sativus [cucumbers]
ref|XP_008443587.1|  PREDICTED: BES1/BZR1 homolog protein 4             166   7e-46   Cucumis melo [Oriental melon]
ref|XP_010093488.1|  hypothetical protein L484_017551                   167   8e-46   
ref|NP_193624.1|  BES1/BZR1-like protein 3                              164   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006477843.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    165   1e-45   Citrus sinensis [apfelsine]
ref|XP_006442380.1|  hypothetical protein CICLE_v10021151mg             165   1e-45   Citrus clementina [clementine]
ref|XP_006284265.1|  hypothetical protein CARUB_v10005431mg             162   3e-45   Capsella rubella
ref|XP_011082785.1|  PREDICTED: BES1/BZR1 homolog protein 4             164   4e-45   
ref|XP_011002765.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    162   4e-45   Populus euphratica
gb|KFK28557.1|  hypothetical protein AALP_AA7G011700                    162   4e-45   Arabis alpina [alpine rockcress]
ref|XP_010434483.1|  PREDICTED: BES1/BZR1 homolog protein 3             162   5e-45   Camelina sativa [gold-of-pleasure]
gb|EPS61611.1|  hypothetical protein M569_13185                         162   6e-45   Genlisea aurea
ref|XP_011002762.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    162   1e-44   Populus euphratica
ref|XP_002870016.1|  hypothetical protein ARALYDRAFT_492971             160   2e-44   
ref|XP_007211588.1|  hypothetical protein PRUPE_ppa008637mg             161   3e-44   Prunus persica
ref|XP_003596274.1|  Brassinosteroid signaling positive regulator...    164   3e-44   
ref|XP_008226380.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        161   4e-44   Prunus mume [ume]
gb|AES66525.2|  brassinazole-resistant 1 protein                        164   5e-44   Medicago truncatula
ref|XP_010518825.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    159   1e-43   Tarenaya hassleriana [spider flower]
gb|KHG20428.1|  BES1/BZR1 4 -like protein                               159   2e-43   Gossypium arboreum [tree cotton]
ref|XP_010518826.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    158   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_006414043.1|  hypothetical protein EUTSA_v10025918mg             157   3e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010052157.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    158   4e-43   Eucalyptus grandis [rose gum]
ref|XP_004489001.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    157   7e-43   Cicer arietinum [garbanzo]
gb|KJB68361.1|  hypothetical protein B456_010G240700                    157   9e-43   Gossypium raimondii
emb|CDX98592.1|  BnaA03g43770D                                          155   1e-42   
emb|CDY01563.1|  BnaC07g35530D                                          155   1e-42   
ref|XP_008386283.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        156   2e-42   
ref|XP_009359371.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        155   4e-42   Pyrus x bretschneideri [bai li]
gb|KEH38594.1|  brassinazole-resistant 1 protein                        152   1e-41   Medicago truncatula
ref|XP_006387974.1|  hypothetical protein POPTR_0439s00200g             152   1e-41   
ref|XP_010537716.1|  PREDICTED: BES1/BZR1 homolog protein 4             154   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_004489003.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    154   3e-41   
ref|XP_004294130.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        153   3e-41   Fragaria vesca subsp. vesca
ref|XP_004489004.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    153   3e-41   Cicer arietinum [garbanzo]
ref|XP_007149549.1|  hypothetical protein PHAVU_005G079400g             153   4e-41   Phaseolus vulgaris [French bean]
ref|XP_003543195.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        153   5e-41   Glycine max [soybeans]
ref|XP_009136969.1|  PREDICTED: BES1/BZR1 homolog protein 3-like        151   5e-41   Brassica rapa
gb|KHN36918.1|  BES1/BZR1 like protein 4                                153   6e-41   Glycine soja [wild soybean]
ref|XP_003596275.1|  Brassinosteroid signaling positive regulator...    152   7e-41   Medicago truncatula
ref|XP_006370100.1|  hypothetical protein POPTR_0001s39520g             152   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_006348323.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        151   1e-40   Solanum tuberosum [potatoes]
ref|XP_009128310.1|  PREDICTED: BES1/BZR1 homolog protein 4             151   1e-40   Brassica rapa
ref|XP_008381083.1|  PREDICTED: BES1/BZR1 homolog protein 4             151   2e-40   
ref|XP_009132289.1|  PREDICTED: BES1/BZR1 homolog protein 3             150   2e-40   Brassica rapa
ref|XP_009334016.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        151   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_009622768.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        150   3e-40   Nicotiana tomentosiformis
emb|CDX99414.1|  BnaC01g11380D                                          150   3e-40   
ref|XP_010062789.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        150   6e-40   Eucalyptus grandis [rose gum]
ref|XP_009768995.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        149   8e-40   Nicotiana sylvestris
ref|XP_003540502.1|  PREDICTED: BES1/BZR1 homolog protein 4             149   8e-40   Glycine max [soybeans]
ref|XP_002887754.1|  hypothetical protein ARALYDRAFT_895772             148   2e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_010665681.1|  PREDICTED: BES1/BZR1 homolog protein 4             148   4e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004244287.1|  PREDICTED: BES1/BZR1 homolog protein 4             147   4e-39   Solanum lycopersicum
ref|XP_010429699.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        147   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006302567.1|  hypothetical protein CARUB_v10020674mg             147   8e-39   Capsella rubella
ref|NP_565187.1|  BES1/BZR1 homolog 4                                   147   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417476.1|  PREDICTED: BES1/BZR1 homolog protein 4             147   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010472705.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        146   2e-38   Camelina sativa [gold-of-pleasure]
gb|KFK42252.1|  hypothetical protein AALP_AA2G231000                    145   5e-38   Arabis alpina [alpine rockcress]
gb|ACE97196.1|  brassinosteroid signaling positive regulator-rela...    139   2e-37   Populus tremula [European aspen]
gb|ACE97214.1|  brassinosteroid signaling positive regulator-rela...    139   2e-37   Populus tremula [European aspen]
gb|ACE97191.1|  brassinosteroid signaling positive regulator-rela...    139   2e-37   Populus tremula [European aspen]
gb|ACE97192.1|  brassinosteroid signaling positive regulator-rela...    139   2e-37   Populus tremula [European aspen]
emb|CDY26877.1|  BnaA02g19020D                                          142   3e-37   Brassica napus [oilseed rape]
emb|CDP06034.1|  unnamed protein product                                142   3e-37   Coffea canephora [robusta coffee]
ref|XP_006389963.1|  hypothetical protein EUTSA_v10018888mg             142   6e-37   Eutrema salsugineum [saltwater cress]
emb|CDX87440.1|  BnaA07g34330D                                          141   9e-37   
ref|XP_009106588.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        141   1e-36   Brassica rapa
emb|CDY66394.1|  BnaC03g78350D                                          135   2e-36   Brassica napus [oilseed rape]
emb|CDY14593.1|  BnaC02g25200D                                          139   3e-36   Brassica napus [oilseed rape]
ref|XP_010916623.1|  PREDICTED: protein BZR1 homolog 3-like             138   2e-35   Elaeis guineensis
emb|CDX88466.1|  BnaC06g39100D                                          135   2e-34   
ref|XP_009415180.1|  PREDICTED: protein BZR1 homolog 3-like             135   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796066.1|  PREDICTED: protein BZR1 homolog 3                  134   8e-34   Phoenix dactylifera
ref|XP_010924706.1|  PREDICTED: protein BZR1 homolog 3-like             131   7e-33   Elaeis guineensis
gb|KJB69670.1|  hypothetical protein B456_011G036300                    130   8e-33   Gossypium raimondii
gb|KHN36917.1|  BES1/BZR1 like protein 4                                129   8e-33   Glycine soja [wild soybean]
ref|XP_008790049.1|  PREDICTED: protein BZR1 homolog 3-like             130   9e-33   Phoenix dactylifera
ref|XP_006592940.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    129   2e-32   Glycine max [soybeans]
ref|XP_008792311.1|  PREDICTED: protein BZR1 homolog 3-like             130   3e-32   Phoenix dactylifera
ref|XP_003543196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    129   4e-32   Glycine max [soybeans]
ref|XP_006594721.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    129   4e-32   Glycine max [soybeans]
gb|EYU29527.1|  hypothetical protein MIMGU_mgv1a010055mg                129   7e-32   Erythranthe guttata [common monkey flower]
ref|XP_003540501.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    129   7e-32   Glycine max [soybeans]
ref|XP_006592939.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    129   7e-32   Glycine max [soybeans]
ref|XP_010915465.1|  PREDICTED: protein BZR1 homolog 3-like             128   1e-31   Elaeis guineensis
ref|XP_009397454.1|  PREDICTED: protein BZR1 homolog 2-like             126   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388695.1|  PREDICTED: protein BZR1 homolog 3-like             126   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE65864.1|  hypothetical protein OsJ_21656                          122   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057840.1|  Os06g0552300                                       122   3e-29   
ref|XP_009381197.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        122   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC80795.1|  hypothetical protein OsI_23332                          121   6e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_002454981.1|  hypothetical protein SORBIDRAFT_03g002480          119   2e-28   Sorghum bicolor [broomcorn]
ref|XP_003563774.1|  PREDICTED: protein BZR1 homolog 3                  119   3e-28   Brachypodium distachyon [annual false brome]
ref|XP_009416433.1|  PREDICTED: protein BZR1 homolog 3                  117   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925590.1|  PREDICTED: protein BZR1 homolog 3-like             117   8e-28   
ref|NP_001136786.1|  BES transcription factor                           117   2e-27   Zea mays [maize]
ref|XP_002437132.1|  hypothetical protein SORBIDRAFT_10g021750          117   2e-27   Sorghum bicolor [broomcorn]
ref|XP_004968562.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        116   2e-27   Setaria italica
ref|XP_004965584.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        115   6e-27   Setaria italica
ref|NP_001132634.1|  uncharacterized protein LOC100194109               113   4e-26   Zea mays [maize]
gb|ACG41016.1|  brassinazole-resistant 1 protein                        113   5e-26   Zea mays [maize]
dbj|BAJ97997.1|  predicted protein                                      110   4e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC70129.1|  hypothetical protein OsI_00807                          106   1e-23   Oryza sativa Indica Group [Indian rice]
gb|EMT29878.1|  hypothetical protein F775_52316                         106   1e-23   
ref|XP_006643883.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        105   1e-23   Oryza brachyantha
gb|EMS63049.1|  hypothetical protein TRIUR3_11319                       105   7e-23   Triticum urartu
gb|EEE54074.1|  hypothetical protein OsJ_00786                          103   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042330.1|  Os01g0203000                                       103   1e-22   
dbj|BAB33003.1|  unknown protein                                        103   1e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CDM82126.1|  unnamed protein product                                102   3e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003571150.2|  PREDICTED: protein BZR1 homolog 3-like             102   4e-22   Brachypodium distachyon [annual false brome]
ref|XP_010675300.1|  PREDICTED: BES1/BZR1 homolog protein 4             100   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003565213.1|  PREDICTED: protein BZR1 homolog 2                  100   2e-21   
ref|XP_006833072.1|  PREDICTED: BES1/BZR1 homolog protein 4           98.2    6e-21   Amborella trichopoda
emb|CBI30731.3|  unnamed protein product                              93.2    6e-20   Vitis vinifera
gb|EMS49339.1|  hypothetical protein TRIUR3_13720                     93.2    2e-19   Triticum urartu
gb|EMT21245.1|  hypothetical protein F775_32777                       92.8    6e-19   
emb|CDY00299.1|  BnaA06g22000D                                        89.4    5e-18   
ref|NP_001172869.1|  Os02g0233200                                     89.0    2e-17   
sp|Q6EUF1.2|BZR4_ORYSJ  RecName: Full=Protein BZR1 homolog 4; Sho...  88.6    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EAY85121.1|  hypothetical protein OsI_06471                        85.9    3e-16   Oryza sativa Indica Group [Indian rice]
gb|ABK21940.1|  unknown                                               84.0    9e-16   Picea sitchensis
gb|EAZ22344.1|  hypothetical protein OsJ_05997                        69.3    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABR18463.1|  unknown                                               68.6    3e-10   Picea sitchensis
ref|XP_011074507.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1 ...  52.8    5e-05   Sesamum indicum [beniseed]
ref|XP_011074506.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1 ...  52.8    5e-05   Sesamum indicum [beniseed]
ref|XP_002510347.1|  BRASSINAZOLE-RESISTANT 1 protein, putative       52.4    7e-05   Ricinus communis
ref|XP_008440681.1|  PREDICTED: BES1/BZR1 homolog protein 2           51.6    1e-04   Cucumis melo [Oriental melon]
gb|EPS60905.1|  hypothetical protein M569_13896                       51.2    2e-04   Genlisea aurea
ref|XP_002273547.1|  PREDICTED: BES1/BZR1 homolog protein 2           50.8    3e-04   Vitis vinifera
ref|XP_004143497.1|  PREDICTED: BES1/BZR1 homolog protein 2           50.4    3e-04   Cucumis sativus [cucumbers]
gb|EYU45114.1|  hypothetical protein MIMGU_mgv1a009718mg              50.4    4e-04   Erythranthe guttata [common monkey flower]
ref|XP_002310201.1|  hypothetical protein POPTR_0007s12370g           50.1    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011083731.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      49.7    6e-04   Sesamum indicum [beniseed]



>ref|XP_004234074.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
 ref|XP_004234075.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
 ref|XP_006356092.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356093.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=323

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP+SNGGSRMWTPGQSG CSPA+A+ +D
Sbjct  212  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPISNGGSRMWTPGQSGACSPAIASGID  271

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++ADVPMSDAI AEFAFGS+ MG+VKPWEGERIHEEC TDDLELTLGNS+TR
Sbjct  272  QTADVPMSDAISAEFAFGSHMMGLVKPWEGERIHEECATDDLELTLGNSSTR  323



>ref|XP_009590977.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=324

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWLSGVQTPQD PSSPTFSLVSPNPFGFKEPLS GGSRMWTPGQSGTCSPA+ A +D
Sbjct  213  PDSGWLSGVQTPQDEPSSPTFSLVSPNPFGFKEPLSYGGSRMWTPGQSGTCSPAIGAGID  272

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            R+AD+PMSDAI AEFAFGSN  G+VKPWEGERIHEEC+TDDLELTLGNS+TR
Sbjct  273  RTADIPMSDAISAEFAFGSNMKGLVKPWEGERIHEECVTDDLELTLGNSSTR  324



>ref|XP_009607196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607197.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=326

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV A +D
Sbjct  215  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGAGMD  274

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PMSD I AEFAFGSN  G+VKPWEGERIHEEC++DDLELTLGNS+TR
Sbjct  275  QTADIPMSDVISAEFAFGSNVKGVVKPWEGERIHEECVSDDLELTLGNSSTR  326



>ref|XP_004233053.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X3 [Solanum lycopersicum]
 ref|XP_010316857.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
Length=324

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV   +D
Sbjct  213  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMD  272

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++ADVPMSDAI AEFAFGSN  G+VKPWEGERIHEECI+DDLELTLGNS+TR
Sbjct  273  QTADVPMSDAISAEFAFGSNMKGVVKPWEGERIHEECISDDLELTLGNSSTR  324



>ref|XP_010316856.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
Length=325

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV   +D
Sbjct  214  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMD  273

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++ADVPMSDAI AEFAFGSN  G+VKPWEGERIHEECI+DDLELTLGNS+TR
Sbjct  274  QTADVPMSDAISAEFAFGSNMKGVVKPWEGERIHEECISDDLELTLGNSSTR  325



>ref|XP_006358087.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006358088.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=326

 Score =   204 bits (519),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV   +D
Sbjct  215  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMD  274

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++ DVPMSD I AEFAFGSN  G+VKPWEGERIHEECI+DDLELTLGNS+TR
Sbjct  275  QTGDVPMSDVISAEFAFGSNMKGVVKPWEGERIHEECISDDLELTLGNSSTR  326



>ref|XP_006358089.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006358090.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X4 [Solanum 
tuberosum]
Length=325

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWLSGVQTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV   +D
Sbjct  214  PDSGWLSGVQTPQDGPSSPTFSLVSSNPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMD  273

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++ DVPMSD I AEFAFGSN  G+VKPWEGERIHEECI+DDLELTLGNS+TR
Sbjct  274  QTGDVPMSDVISAEFAFGSNMKGVVKPWEGERIHEECISDDLELTLGNSSTR  325



>ref|XP_009785426.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=323

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDR  445
            DSGWLSGVQTPQD PSSPTFSLVSPNPFGF+EPLSNGGSRMWTPGQSG CSPA+ A +D+
Sbjct  213  DSGWLSGVQTPQDEPSSPTFSLVSPNPFGFREPLSNGGSRMWTPGQSGVCSPAIGAGIDQ  272

Query  444  SADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +ADVPMSDAI AEFAFGSN  G+VKPWEGERIHEEC+TDDLELTLGNS+T+
Sbjct  273  TADVPMSDAISAEFAFGSNMKGLVKPWEGERIHEECLTDDLELTLGNSSTK  323



>ref|XP_009800423.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800424.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=326

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 1/112 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWLSG+QTPQDGPSSPTFSLVS NPFGFKEPLSNGGSRMWTPGQSGTCSPAV A +D
Sbjct  216  PDSGWLSGIQTPQDGPSSPTFSLVS-NPFGFKEPLSNGGSRMWTPGQSGTCSPAVGAGMD  274

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PMSD I AEFAFGSN  G+VKPWEGERIHEEC++DDLELTLGNS+TR
Sbjct  275  QTADIPMSDVISAEFAFGSNVKGVVKPWEGERIHEECVSDDLELTLGNSSTR  326



>gb|EYU28126.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=328

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDS WLSGVQTPQDG SSPTFSLV+ NPFGFKEPLSNGGSRMWTPGQSGTCSPA+ A +D
Sbjct  217  PDSRWLSGVQTPQDGASSPTFSLVAANPFGFKEPLSNGGSRMWTPGQSGTCSPAITAGVD  276

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PMSDA+ AEFAFGSN MG+VKPWEGERIHEEC  DDLELTLGNSNTR
Sbjct  277  QTADIPMSDAMSAEFAFGSNIMGLVKPWEGERIHEECAPDDLELTLGNSNTR  328



>gb|EYU28125.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=389

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDS WLSGVQTPQDG SSPTFSLV+ NPFGFKEPLSNGGSRMWTPGQSGTCSPA+ A +D
Sbjct  269  PDSRWLSGVQTPQDGASSPTFSLVAANPFGFKEPLSNGGSRMWTPGQSGTCSPAITAGVD  328

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PMSDA+ AEFAFGSN MG+VKPWEGERIHEEC  DDLELTLGNSNTR
Sbjct  329  QTADIPMSDAMSAEFAFGSNIMGLVKPWEGERIHEECAPDDLELTLGNSNTR  380



>emb|CDO96875.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWLSGVQTPQDGPSSPTFSLV+ NPFG KEPLSNGGSRMWTPGQSG CSPA+AA  D
Sbjct  184  PDSGWLSGVQTPQDGPSSPTFSLVASNPFGIKEPLSNGGSRMWTPGQSGACSPAIAAGFD  243

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++ADVPM+DA+ AEFAFG++  G+VKPWEGERIHEE ++DDLELTLGNS TR
Sbjct  244  QTADVPMADAVSAEFAFGNSTKGLVKPWEGERIHEEFVSDDLELTLGNSKTR  295



>ref|XP_011101448.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Sesamum indicum]
Length=325

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGW+SGVQTPQDGPSSPTFSLVS NPFGFKEP+SNGGSRMWTPGQSGTCSPA+A   D
Sbjct  214  PDSGWVSGVQTPQDGPSSPTFSLVSANPFGFKEPISNGGSRMWTPGQSGTCSPAIAPGFD  273

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++ADVPMSDAI +EFAFGSN  G+VKPWEGERIH+EC+ DDLELTLG  +TR
Sbjct  274  QTADVPMSDAISSEFAFGSNTKGLVKPWEGERIHDECVPDDLELTLGIPSTR  325



>ref|XP_002305719.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
 gb|EEE86230.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
Length=331

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGF+E  LS  GSRMWTPGQSGTCSPA+ A +
Sbjct  219  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFREEALSGAGSRMWTPGQSGTCSPAIPAGI  278

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D++ADVPMSD++ AEFAFGSNA G+VKPWEGERIHEEC++DDLELTLGNSNTR
Sbjct  279  DQTADVPMSDSMAAEFAFGSNAAGLVKPWEGERIHEECVSDDLELTLGNSNTR  331



>ref|XP_011033513.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011033514.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
 ref|XP_011010915.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011010916.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
Length=331

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGF+E  LS  GSRMWTPGQSGTCSPA+ A +
Sbjct  219  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFREEALSGAGSRMWTPGQSGTCSPAIPAGI  278

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D++ADVPMSD++ AEFAFGSNA G+VKPWEGERIHEEC++DDLELTLGNSNTR
Sbjct  279  DQTADVPMSDSMAAEFAFGSNAAGLVKPWEGERIHEECVSDDLELTLGNSNTR  331



>ref|XP_006377531.1| hypothetical protein POPTR_0011s06800g [Populus trichocarpa]
 gb|ERP55328.1| hypothetical protein POPTR_0011s06800g [Populus trichocarpa]
Length=254

 Score =   187 bits (474),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +
Sbjct  142  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  201

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D++ADVPM+D++ AEFAFGSN  G+VKPWEGERIHEEC++DDLELTLGNS+TR
Sbjct  202  DQTADVPMADSMAAEFAFGSNTAGLVKPWEGERIHEECVSDDLELTLGNSSTR  254



>ref|XP_002522271.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
 gb|EEF40129.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
Length=331

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGF+ EPLS  GSRMWTPGQSGTCSPAV A +
Sbjct  219  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFRDEPLSGAGSRMWTPGQSGTCSPAVPAGV  278

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +ADVPM+D++ AEFAFGSN  G+VKPWEGERIHEEC++DDLELTLGNS+TR
Sbjct  279  DHTADVPMADSMAAEFAFGSNTTGLVKPWEGERIHEECVSDDLELTLGNSSTR  331



>ref|XP_011039378.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=333

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +
Sbjct  221  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  280

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D++ADVPMSD++ AEFAFGSNA G+VKPWEGERIHEEC++DDLELTLGN +TR
Sbjct  281  DQTADVPMSDSMAAEFAFGSNAAGLVKPWEGERIHEECVSDDLELTLGNPSTR  333



>ref|XP_012091843.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Jatropha curcas]
 ref|XP_012091844.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Jatropha curcas]
 gb|KDP21147.1| hypothetical protein JCGZ_21618 [Jatropha curcas]
Length=331

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGF+ EPLS  GSRMWTPGQSGTCSPAV A +
Sbjct  219  PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFRDEPLSGAGSRMWTPGQSGTCSPAVPAGV  278

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D++ADVPM+D+I +EFAFGSN  G+VKPWEGERIHEEC++DDLELTLGNS TR
Sbjct  279  DQTADVPMADSIASEFAFGSNTGGLVKPWEGERIHEECVSDDLELTLGNSRTR  331



>gb|KDO77946.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
Length=248

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAAL  451
            PDSGWLSG+Q PQ GPSSPTFSLVS NPFGF+E + +GG SRMWTPGQSGTCSPAV A +
Sbjct  136  PDSGWLSGIQIPQSGPSSPTFSLVSRNPFGFREEVLSGGPSRMWTPGQSGTCSPAVPAGV  195

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D ++DVPMSD I  EFAFG NA G+VKPWEGERIHEEC++DDLELTLGNS TR
Sbjct  196  DNTSDVPMSDCIATEFAFGCNATGLVKPWEGERIHEECVSDDLELTLGNSKTR  248



>ref|XP_006449559.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 ref|XP_006467592.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467593.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|ESR62799.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 gb|KDO77944.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
 gb|KDO77945.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
Length=327

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAAL  451
            PDSGWLSG+Q PQ GPSSPTFSLVS NPFGF+E + +GG SRMWTPGQSGTCSPAV A +
Sbjct  215  PDSGWLSGIQIPQSGPSSPTFSLVSRNPFGFREEVLSGGPSRMWTPGQSGTCSPAVPAGV  274

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D ++DVPMSD I  EFAFG NA G+VKPWEGERIHEEC++DDLELTLGNS TR
Sbjct  275  DNTSDVPMSDCIATEFAFGCNATGLVKPWEGERIHEECVSDDLELTLGNSKTR  327



>ref|XP_007025289.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY27911.1| BES1/BZR1 [Theobroma cacao]
Length=327

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWLS ++ PQ GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A +
Sbjct  215  PDSGWLSRLEIPQSGPTSPTFSLVSRNPFGFKDETLSGGGSRMWTPGQSGTCSPAFPAGV  274

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D+++DVPMSDAI AEFAFGSN  G+VKPWEGE+IHEEC+ DDLELTLGNS TR
Sbjct  275  DQTSDVPMSDAIAAEFAFGSNVTGLVKPWEGEKIHEECVADDLELTLGNSKTR  327



>gb|KHG25078.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=319

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD GWLS ++ PQ GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A +
Sbjct  207  PDPGWLSRLEIPQSGPTSPTFSLVSRNPFGFKDEALSRGGSRMWTPGQSGTCSPAFPAGV  266

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D+++DVPMSDAI AEFAFGSN  G+VKPWEGE+IHEEC+ DDLELTLGNS TR
Sbjct  267  DQTSDVPMSDAIAAEFAFGSNMTGLVKPWEGEKIHEECVADDLELTLGNSKTR  319



>ref|XP_008371512.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
 ref|XP_009351745.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWL+G+Q PQ GPSSPTFSLVS NPF  KE LS GGSRMWTPGQSGTCSPAVAA++D
Sbjct  221  PDSGWLAGLQIPQSGPSSPTFSLVSRNPFNLKEALSGGGSRMWTPGQSGTCSPAVAASID  280

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             + DVPMSD + AEFAFGSN  G+VKPWEGERI EEC++DDLELTLG++ TR
Sbjct  281  HTGDVPMSDGMAAEFAFGSNTTGLVKPWEGERI-EECVSDDLELTLGSTRTR  331



>gb|KJB69668.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
 gb|KJB69671.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=319

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD GWLS ++ PQ GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A +
Sbjct  207  PDPGWLSRLEIPQSGPTSPTFSLVSRNPFGFKDEALSGGGSRMWTPGQSGTCSPAFPAGV  266

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D+++DVPMSDAI AEFAFGSN  G+VKPWEGE+IHEEC+ +DLELTLGNS TR
Sbjct  267  DQTSDVPMSDAIAAEFAFGSNMTGLVKPWEGEKIHEECVANDLELTLGNSKTR  319



>ref|XP_002267082.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=341

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGW +G+Q PQ GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPAVAA  
Sbjct  229  PDSGWFAGMQIPQGGPASPTFSLVSANPFGFKEEVLAGGGSRMWTPGQSGTCSPAVAAGS  288

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +ADVPM+D I AEFAFGSN  G+VKPWEGERIHEEC +D+LELTLG+S TR
Sbjct  289  DHTADVPMADGIAAEFAFGSNTTGLVKPWEGERIHEECGSDELELTLGSSRTR  341



>ref|XP_010242162.1| PREDICTED: BES1/BZR1 homolog protein 4 [Nelumbo nucifera]
Length=327

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALD  448
            DSGWL+G++ PQ GPSSPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPAVA   D
Sbjct  216  DSGWLAGIRIPQGGPSSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAVAGGSD  275

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++ADVPMSD I  EFAFGSNA G+VKPWEGERIHEEC +DDLELTLG S TR
Sbjct  276  QTADVPMSDRISDEFAFGSNATGLVKPWEGERIHEECGSDDLELTLGTSRTR  327



>ref|XP_007211637.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
 ref|XP_008225238.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Prunus mume]
 ref|XP_008225239.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Prunus mume]
 gb|EMJ12836.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
Length=323

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWL+G+Q PQ GPSSPTFSLVS NPF  KE LS GGSRMWTPGQSGTCSP VAA++D
Sbjct  213  PDSGWLAGLQIPQSGPSSPTFSLVSRNPFNLKEALSGGGSRMWTPGQSGTCSPVVAASVD  272

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             S DVPMSD + AEFAFGSN  G+VKPWEGERI EEC++DDLELTLG++ TR
Sbjct  273  HSGDVPMSDGMAAEFAFGSNTSGLVKPWEGERI-EECVSDDLELTLGSARTR  323



>ref|XP_008383594.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=331

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWL+G+Q PQ GPSSPTFSLVS NPF  KE LS  GSRMWTPGQSGTCSPAVAA++D
Sbjct  221  PDSGWLAGLQIPQSGPSSPTFSLVSKNPFNLKEALSGAGSRMWTPGQSGTCSPAVAASID  280

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             + D+PMSD + AEFAFGSN  G+VKPWEGERI EEC++DDLELTLG++ TR
Sbjct  281  HTGDIPMSDGMAAEFAFGSNTTGLVKPWEGERI-EECVSDDLELTLGSTRTR  331



>gb|KJB13026.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13027.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13028.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13029.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
Length=325

 Score =   176 bits (445),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W SG+QTP   P+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA L
Sbjct  213  PDPEWFSGLQTPHSRPTSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGL  272

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D++ADVPMS+ I  EFAFGSNA G+VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  273  DQTADVPMSEVISDEFAFGSNATGLVKPWEGERIHEECGSDDLELTLGSSKTR  325



>ref|XP_009352718.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWL+G+Q PQ GPSSPTFSLVS NPF  KE LS  GSRMWTPGQSGTCSP VAA++D
Sbjct  221  PDSGWLAGLQIPQSGPSSPTFSLVSKNPFNLKEALSGAGSRMWTPGQSGTCSPVVAASID  280

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             + D+PMSD + AEFAFGSN  G+VKPWEGERI EEC++DDLELTLG++ TR
Sbjct  281  HTGDIPMSDGMAAEFAFGSNTTGLVKPWEGERI-EECVSDDLELTLGSTRTR  331



>gb|KHG15415.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=325

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W SG+QTP   P+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA L
Sbjct  213  PDPEWFSGLQTPHSRPTSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGL  272

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D++ADVPMS+ I  EFAFGSNA G+VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  273  DQTADVPMSEVISDEFAFGSNATGLVKPWEGERIHEECGSDDLELTLGSSKTR  325



>ref|XP_004309625.1| PREDICTED: BES1/BZR1 homolog protein 4 [Fragaria vesca subsp. 
vesca]
Length=329

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 4/112 (4%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDSGWL+G+Q+   GPSSPTFSLVS NPFGFKE LS GGSRMWTPGQSGTCSP VAA LD
Sbjct  222  PDSGWLAGLQS---GPSSPTFSLVSRNPFGFKEALSGGGSRMWTPGQSGTCSPVVAAGLD  278

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             + DV MSD + AEFAFGSNA G+VKPWEGERI EEC++DDLELTLG++ TR
Sbjct  279  HTGDVAMSDGMAAEFAFGSNATGLVKPWEGERI-EECVSDDLELTLGSTKTR  329



>ref|XP_002317445.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|EEE98057.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=319

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD GW +G++ PQ GP+SPTFSLV+ NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  207  PDPGWFAGIRLPQGGPTSPTFSLVASNPFGFKEEALAGGGSRMWTPGQSGTCSPAIAAGS  266

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D++AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  267  DQTADIPMAEVISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  319



>ref|XP_007021866.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY13391.1| BES1/BZR1 [Theobroma cacao]
Length=325

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G++ P  GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGLRIPHSGPTSPTFSLVSTNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGS  272

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +ADVPMS+ I  EFAFGSNA G+VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  273  DHTADVPMSEVISDEFAFGSNATGLVKPWEGERIHEECGSDDLELTLGSSRTR  325



>ref|XP_011044050.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=319

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD GW +G++ PQ GP+SPTFSLV+PN FGFKE   + GGSRMWTPGQSGTCSPA+AA  
Sbjct  207  PDPGWFAGIRLPQGGPTSPTFSLVAPNSFGFKEEAFAGGGSRMWTPGQSGTCSPAIAAGS  266

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  267  DHTADIPMAEVISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  319



>ref|XP_010644097.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=326

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL--SNGGSRMWTPGQSGTCSPAVAAA  454
            PDS W +G++ PQ GP+SPTFSLVS NPFGFKE +  S  GSRMWTPGQSGTCSPA+AA 
Sbjct  213  PDSEWFAGIRIPQGGPTSPTFSLVSSNPFGFKEEMLASASGSRMWTPGQSGTCSPAIAAG  272

Query  453  LDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             D +ADVPMS+ I  EFAFG N +G+VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  273  SDHTADVPMSEVISDEFAFGCNTVGLVKPWEGERIHEECGSDDLELTLGSSRTR  326



>gb|KJB45771.1| hypothetical protein B456_007G327000 [Gossypium raimondii]
Length=317

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G++ P  GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  205  PDPEWFAGLRIPLSGPTSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGS  264

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +ADVPMS+ I  EFAFGSNA G+VKPWEGERIHE+C +DDLELTLG+S TR
Sbjct  265  DHTADVPMSEVISDEFAFGSNATGLVKPWEGERIHEDCGSDDLELTLGSSRTR  317



>ref|XP_004137229.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis sativus]
 gb|KGN53574.1| hypothetical protein Csa_4G083490 [Cucumis sativus]
Length=325

 Score =   168 bits (425),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            P   W +G++ PQ GP+SPTFSLVS NPFGFKE  ++ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PTPEWFAGLRIPQGGPNSPTFSLVSTNPFGFKEAAITGGGSRMWTPGQSGTCSPAIAAGS  272

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PMS+ I  EFAFGSNA GIVKPWEGE IHEEC +DDLELTLGNS TR
Sbjct  273  DHTADIPMSEVISDEFAFGSNAAGIVKPWEGEIIHEECGSDDLELTLGNSRTR  325



>ref|XP_010088009.1| hypothetical protein L484_004599 [Morus notabilis]
 gb|EXB31125.1| hypothetical protein L484_004599 [Morus notabilis]
Length=368

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 98/117 (84%), Gaps = 6/117 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFK E +S GGSRMWTPGQSGTCSPAVAA  
Sbjct  236  PDSGWLAGLQIPQSGPSSPTFSLVSRNPFGFKEEAMSGGGSRMWTPGQSGTCSPAVAAGA  295

Query  450  DRSADVPMSDA-IQAEFAFGSNAM---GIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +ADVPM D  + AEFAFG NA+   G+VKPWEGERI EEC++DDLELTLGNS TR
Sbjct  296  DNTADVPMCDGNMAAEFAFGCNAIATGGLVKPWEGERI-EECVSDDLELTLGNSRTR  351



>ref|XP_008451746.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
 ref|XP_008451748.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=325

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            P   W +G++ PQ GP+SPTFSLVS NPFGFKE  ++ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PTPEWFAGLRIPQGGPNSPTFSLVSTNPFGFKEAAITGGGSRMWTPGQSGTCSPAIAAGS  272

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PMS+ I  EFAFGSNA G+VKPWEGE IHEEC +DDLELTLGNS TR
Sbjct  273  DHTADIPMSEVISDEFAFGSNAAGLVKPWEGEIIHEECGSDDLELTLGNSRTR  325



>ref|XP_006442379.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
 gb|ESR55619.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
Length=278

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G++ P   P+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  166  PDPEWFAGIRLPHGAPTSPTFSLVASNPFGFKDETLAGGGSRMWTPGQSGTCSPAIAAGS  225

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +ADVPMS+ +  EFAFGSNA G+VK WEGERIHEEC +DDLELTLG+S TR
Sbjct  226  DHTADVPMSEVVTDEFAFGSNATGLVKAWEGERIHEECGSDDLELTLGSSRTR  278



>gb|KHG21553.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=317

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G++ P  GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  205  PDPEWFAGLRIPLSGPTSPTFSLVSSNPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGS  264

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +ADVPMS+ I  EFAFGSNA G++KPWEGERIHE+C +DDLELTLG+S  R
Sbjct  265  DHTADVPMSEVISDEFAFGSNATGLMKPWEGERIHEDCGSDDLELTLGSSRIR  317



>ref|XP_004147390.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 gb|KGN65601.1| hypothetical protein Csa_1G467200 [Cucumis sativus]
Length=327

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDR  445
            D  WL  ++ PQ GPSSPTFSLV+ NPFGFKE +S G SR WTP QSGTCSP VAA +D 
Sbjct  217  DPAWLDSIRIPQSGPSSPTFSLVARNPFGFKEAMSAGVSRNWTPTQSGTCSPTVAAGIDH  276

Query  444  SADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++DVPM+D    +FAFGS ++G+VKPWEGERIHEECI+DDLELTLGNS+TR
Sbjct  277  TSDVPMTDGTATDFAFGSCSIGLVKPWEGERIHEECISDDLELTLGNSSTR  327



>ref|XP_008443587.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=327

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDR  445
            D  WL  ++ PQ GPSSPTFSLV+ NPFGFKE +S G SR WTP QSGTCSP VAA +D 
Sbjct  217  DPAWLDSIRIPQSGPSSPTFSLVARNPFGFKEAMSAGVSRNWTPTQSGTCSPTVAAGIDH  276

Query  444  SADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++DVPM+D    +FAFGS ++G+VKPWEGERIHEECI+DDLELTLGNS+TR
Sbjct  277  TSDVPMTDGTATDFAFGSCSIGLVKPWEGERIHEECISDDLELTLGNSSTR  327



>ref|XP_010093488.1| hypothetical protein L484_017551 [Morus notabilis]
 gb|EXB54112.1| hypothetical protein L484_017551 [Morus notabilis]
Length=391

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ PQ GP+SPTFSLVS NPFGFK E ++ GGSRMWTPGQSGTCSPA+AA  D
Sbjct  280  DPEWFAGIRLPQTGPTSPTFSLVSANPFGFKDEVMAGGGSRMWTPGQSGTCSPAIAAGSD  339

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             +AD+PM++ I  EFAFGS+A G+VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  340  HTADIPMAEVISDEFAFGSHATGLVKPWEGERIHEECGSDDLELTLGSSRTR  391



>ref|NP_193624.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
 sp|O49404.1|BEH3_ARATH RecName: Full=BES1/BZR1 homolog protein 3 [Arabidopsis thaliana]
 emb|CAA16746.1| putative protein [Arabidopsis thaliana]
 emb|CAB78891.1| putative protein [Arabidopsis thaliana]
 gb|AAM65918.1| unknown [Arabidopsis thaliana]
 dbj|BAC43438.1| unknown protein [Arabidopsis thaliana]
 gb|ABD19693.1| At4g18890 [Arabidopsis thaliana]
 gb|AEE84102.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
Length=284

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 94/117 (80%), Gaps = 5/117 (4%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAA  454
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G   S MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAG  227

Query  453  LDRSADVPMSDAIQAEFAFGSNAM---GIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +D+++DVPM+D + AEFAFG NAM   G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  228  VDQNSDVPMADGMTAEFAFGCNAMAANGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>ref|XP_006477843.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477844.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|KDO43794.1| hypothetical protein CISIN_1g020567mg [Citrus sinensis]
Length=324

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G++ P   P+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  212  PDPEWFAGIRLPHGAPTSPTFSLVASNPFGFKDETLAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +ADVPMS+ +  EFAFGSNA G+VK WEGERIHEEC +DDLELTLG+S TR
Sbjct  272  DHTADVPMSEVVTDEFAFGSNATGLVKAWEGERIHEECGSDDLELTLGSSRTR  324



>ref|XP_006442380.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
 gb|ESR55620.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
Length=324

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G++ P   P+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  212  PDPEWFAGIRLPHGAPTSPTFSLVASNPFGFKDETLAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +ADVPMS+ +  EFAFGSNA G+VK WEGERIHEEC +DDLELTLG+S TR
Sbjct  272  DHTADVPMSEVVTDEFAFGSNATGLVKAWEGERIHEECGSDDLELTLGSSRTR  324



>ref|XP_006284265.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
 gb|EOA17163.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
Length=284

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 93/117 (79%), Gaps = 5/117 (4%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR--MWTPGQSGTCSPAVAAA  454
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G S   MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDSNSPMWTPGQSGNCSPAIPAG  227

Query  453  LDRSADVPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             D+++DVPMSD + AEFAFG NA   +G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  228  ADQNSDVPMSDGMAAEFAFGCNATAVIGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>ref|XP_011082785.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
 ref|XP_011082786.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
Length=325

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            DS W +GVQ PQ GP+SPTFSLVS NPFGF+ E LS GGS M TPGQSGTCSPAVAAA +
Sbjct  214  DSKWFAGVQIPQSGPTSPTFSLVSSNPFGFRVEDLSRGGSLMCTPGQSGTCSPAVAAASE  273

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PM++ I  +FAFGSN  G+VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  274  QNADIPMAEVISNDFAFGSNIAGLVKPWEGERIHEECGSDDLELTLGSSKTR  325



>ref|XP_011002765.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X3 [Populus euphratica]
Length=272

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL-----SNGGSRMWTPGQSGTCSPAV  463
            PD  W  G++ PQ GP+SPTFSLV+ NPFGFKE       SNGGSRMWTPGQSGTCSPA+
Sbjct  157  PDPEWFRGIRMPQGGPTSPTFSLVASNPFGFKEEALAGGGSNGGSRMWTPGQSGTCSPAI  216

Query  462  AAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            AA  D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  217  AAGSDHTADIPMAE-ISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  272



>gb|KFK28557.1| hypothetical protein AALP_AA7G011700 [Arabis alpina]
Length=284

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 93/117 (79%), Gaps = 5/117 (4%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAA  454
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF   +    G   S MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDNQAFKMGDCNSPMWTPGQSGNCSPAIPAG  227

Query  453  LDRSADVPMSDAIQAEFAFGSN---AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            LD++ADVPMSD + AEFAFG N   A+G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  228  LDQTADVPMSDGMAAEFAFGCNAIAAIGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>ref|XP_010434483.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010439796.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010449452.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
Length=284

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 94/117 (80%), Gaps = 5/117 (4%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAA  454
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G   S MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAG  227

Query  453  LDRSADVPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +D+++DVPM+D + AEFAFG NA   +G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  228  VDQNSDVPMADGMAAEFAFGCNATTVIGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>gb|EPS61611.1| hypothetical protein M569_13185 [Genlisea aurea]
Length=307

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 94/119 (79%), Gaps = 8/119 (7%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPF-------GFKEPLSNGGSRMWTPGQSGTCSP  469
            PDSG +SGVQTPQD PSSPTFSLVS  PF         KEPLSNGGSRMWTPGQSGTCSP
Sbjct  187  PDSGLVSGVQTPQDMPSSPTFSLVSAGPFGGGGGGSSIKEPLSNGGSRMWTPGQSGTCSP  246

Query  468  AVAAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECIT-DDLELTLGNSNT  295
            AVA   D++ADVPM+D +  EFAFG+NA  +VKPWEGE IH+ECI  DDLEL LGNS+T
Sbjct  247  AVAPGSDQTADVPMADVMSTEFAFGNNAKRLVKPWEGEIIHDECIIPDDLELKLGNSST  305



>ref|XP_011002762.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Populus euphratica]
 ref|XP_011002763.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Populus euphratica]
Length=328

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL-----SNGGSRMWTPGQSGTCSPAV  463
            PD  W  G++ PQ GP+SPTFSLV+ NPFGFKE       SNGGSRMWTPGQSGTCSPA+
Sbjct  213  PDPEWFRGIRMPQGGPTSPTFSLVASNPFGFKEEALAGGGSNGGSRMWTPGQSGTCSPAI  272

Query  462  AAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            AA  D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  273  AAGSDHTADIPMAE-ISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  328



>ref|XP_002870016.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46275.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 5/117 (4%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAA  454
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G   S MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAG  227

Query  453  LDRSADVPMSDAIQAEFAFGSN---AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +D+++DVPM+D + AEFAFG N   A+G+VKPWEGERIH EC++DDLELTLGNS T+
Sbjct  228  VDQNSDVPMADGMAAEFAFGCNAIAAIGMVKPWEGERIHGECVSDDLELTLGNSRTK  284



>ref|XP_007211588.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
 gb|EMJ12787.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
Length=324

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G++ P  GP+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGLRIPH-GPTSPTFSLVALNPFGFKDEALAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PMS+ I  EFAFG N  G+VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  272  DHTADIPMSEVISDEFAFGCNTAGLVKPWEGERIHEECGSDDLELTLGSSRTR  324



>ref|XP_003596274.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
Length=447

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ P   P+SPTF+LVS +PF FKE   S GGSRMWTPGQSG CSPA+AA  D
Sbjct  205  DPEWFAGIKLPHASPTSPTFNLVSRSPFAFKEDGFSGGGSRMWTPGQSGACSPAIAAGFD  264

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PMS+AI  EFAFGSN  GIVKPWEGERIHEE + DDLELTLGNS TR
Sbjct  265  QTADIPMSEAISDEFAFGSNTFGIVKPWEGERIHEEFVADDLELTLGNSKTR  316



>ref|XP_008226380.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Prunus mume]
Length=324

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G++ P +GP+SPTFSLV+ NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGLRIP-NGPTSPTFSLVALNPFGFKDEALAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PMS+ I  EFAFG N  G+VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  272  DHTADIPMSEVISDEFAFGCNTAGLVKPWEGERIHEECGSDDLELTLGSSRTR  324



>gb|AES66525.2| brassinazole-resistant 1 protein [Medicago truncatula]
Length=517

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ P   P+SPTF+LVS +PF FKE   S GGSRMWTPGQSG CSPA+AA  D
Sbjct  205  DPEWFAGIKLPHASPTSPTFNLVSRSPFAFKEDGFSGGGSRMWTPGQSGACSPAIAAGFD  264

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PMS+AI  EFAFGSN  GIVKPWEGERIHEE + DDLELTLGNS TR
Sbjct  265  QTADIPMSEAISDEFAFGSNTFGIVKPWEGERIHEEFVADDLELTLGNSKTR  316



>ref|XP_010518825.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X1 [Tarenaya hassleriana]
Length=311

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 96/130 (74%), Gaps = 5/130 (4%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL-SNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE   +   S MWTPGQSG CSPA+ A  
Sbjct  180  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFEKEAFKARDCSPMWTPGQSGNCSPAIPAGA  239

Query  450  DRSADVPMSDAIQAEFAFGSN--AMGIVKPWEGERIHEECITDDLELTLGNSNTR*GVEG  277
            D++ADVPM+D +  EFAFG N    G+VKPWEGERIHEEC  DDLELTLGNS TR   E 
Sbjct  240  DQTADVPMADGMAVEFAFGCNPRTTGLVKPWEGERIHEECAPDDLELTLGNSRTR--CER  297

Query  276  RVKIQSRSIS  247
            R K +  +++
Sbjct  298  REKEKGENVA  307



>gb|KHG20428.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=322

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 91/114 (80%), Gaps = 8/114 (7%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  WLS       GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A +
Sbjct  215  PDPEWLS------SGPTSPTFSLVSRNPFGFKDEALSAGGSRMWTPGQSGTCSPAFPAGV  268

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECIT-DDLELTLGNSNTR  292
            D+++DVPMSD I AEFAFGSN  G+VKPWEGE+IHEEC+  DDLELTLGNS TR
Sbjct  269  DQTSDVPMSDVIAAEFAFGSNFTGLVKPWEGEKIHEECVADDDLELTLGNSKTR  322



>ref|XP_010518826.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X2 [Tarenaya hassleriana]
Length=294

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPL-SNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE   +   S MWTPGQSG CSPA+ A  
Sbjct  180  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFEKEAFKARDCSPMWTPGQSGNCSPAIPAGA  239

Query  450  DRSADVPMSDAIQAEFAFGSN--AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D++ADVPM+D +  EFAFG N    G+VKPWEGERIHEEC  DDLELTLGNS TR
Sbjct  240  DQTADVPMADGMAVEFAFGCNPRTTGLVKPWEGERIHEECAPDDLELTLGNSRTR  294



>ref|XP_006414043.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
 gb|ESQ55496.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
Length=285

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 92/116 (79%), Gaps = 5/116 (4%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAAL  451
            DSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G   S MWTPGQSG CSPA+ A +
Sbjct  170  DSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAGV  229

Query  450  DRSADVPMSDAIQAEFAFGSNAM---GIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D+++DVPM+D + AEFAFG NA+   G+VKPWEGERIH EC++DDLELTLG S TR
Sbjct  230  DQNSDVPMADGMAAEFAFGCNAIAAVGMVKPWEGERIHGECVSDDLELTLGTSRTR  285



>ref|XP_010052157.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052158.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76060.1| hypothetical protein EUGRSUZ_D00428 [Eucalyptus grandis]
Length=320

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 93/113 (82%), Gaps = 8/113 (7%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G      GPSSPTFSLV+ NPFGFKE   S GGSRMWTPGQSGTCSPA+AA  
Sbjct  215  PDSGWLTG------GPSSPTFSLVARNPFGFKEEAFSGGGSRMWTPGQSGTCSPAIAAGA  268

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D ++D+PMSD++  EFAFGSNA G+VKPWEGERIHE+  +DDLELTLGN+ TR
Sbjct  269  DLTSDIPMSDSMATEFAFGSNATGLVKPWEGERIHEDA-SDDLELTLGNARTR  320



>ref|XP_004489001.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
 ref|XP_004489002.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=321

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ P   P+SPTF+LVSPNPF FKE   S  GSRMWTPG SGTCSPA+AA  D
Sbjct  209  DPEWFAGIKLPHTSPTSPTFNLVSPNPFAFKEDGFSGSGSRMWTPGPSGTCSPAIAAGSD  268

Query  447  RSADVPMSDA-IQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             +AD+PMS+A I  EFAFGSN  GIVKPWEGERIHEE + DDLELTLGNS TR
Sbjct  269  HNADIPMSEAAISDEFAFGSNTFGIVKPWEGERIHEEFVADDLELTLGNSKTR  321



>gb|KJB68361.1| hypothetical protein B456_010G240700 [Gossypium raimondii]
Length=322

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 90/114 (79%), Gaps = 8/114 (7%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  WLS       GP+SPTFSLVS NPFGFK E LS GGSRMWTPGQSGTCSPA  A +
Sbjct  215  PDPEWLS------SGPTSPTFSLVSRNPFGFKDEALSAGGSRMWTPGQSGTCSPAFPAGV  268

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECIT-DDLELTLGNSNTR  292
            D+++DVPMSD I AEFAFGSN  G+VKPWEGE IHEEC+  DDLELTLGNS TR
Sbjct  269  DQTSDVPMSDVIAAEFAFGSNFTGLVKPWEGEMIHEECVADDDLELTLGNSKTR  322



>emb|CDX98592.1| BnaA03g43770D [Brassica napus]
Length=276

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR--MWTPGQSGTCSPAVAAA  454
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G S   MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDSNSPMWTPGQSGNCSPAIPAG  227

Query  453  LDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +D+++DVPM+D + AEFAF     G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  228  VDQNSDVPMADGMAAEFAF-----GMVKPWEGERIHGECVSDDLELTLGNSRTR  276



>emb|CDY01563.1| BnaC07g35530D [Brassica napus]
Length=276

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR--MWTPGQSGTCSPAVAAA  454
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G S   MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDSSSPMWTPGQSGNCSPAIPAG  227

Query  453  LDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +D+++DVPM+D + AEFAF     G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  228  VDQNSDVPMADGMAAEFAF-----GMVKPWEGERIHGECVSDDLELTLGNSRTR  276



>ref|XP_008386283.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=324

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G+  P+ GP+SPTFSLVS NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGIPVPR-GPNSPTFSLVSLNPFGFKDEVLAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PMS+ I  EFAFG N  G+VK WEGE+IHEEC +DDLELTLG+S TR
Sbjct  272  DHTADIPMSEVISDEFAFGCNTTGLVKAWEGEKIHEECGSDDLELTLGSSRTR  324



>ref|XP_009359371.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G+  P+ GP+SPTFSLVS NPFGFK E L+  GSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGIPVPR-GPNSPTFSLVSSNPFGFKDEVLAGAGSRMWTPGQSGTCSPAIAAGS  271

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PMS+ I  EFAFG N  G+VK WEGE+IHEEC +DDLELTLG+S TR
Sbjct  272  DHTADIPMSEVISDEFAFGCNTTGLVKAWEGEKIHEECGSDDLELTLGSSRTR  324



>gb|KEH38594.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=236

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ P  G +SPTFSLV+ NPFGF+E +  G  SRMWTPGQSGTCSPA+AA  D
Sbjct  125  DPDWFAGIRMPHSGQTSPTFSLVATNPFGFREEVFCGSDSRMWTPGQSGTCSPALAAGSD  184

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             +AD+PMS+AI  EFAFGS+A+G+VKPWEGERIHE+  +DDLELTLG S TR
Sbjct  185  HNADIPMSEAISDEFAFGSSAVGLVKPWEGERIHEDSGSDDLELTLGTSKTR  236



>ref|XP_006387974.1| hypothetical protein POPTR_0439s00200g [Populus trichocarpa]
 gb|ERP46888.1| hypothetical protein POPTR_0439s00200g [Populus trichocarpa]
Length=249

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            PD  W  GV+ PQ GP+SPTFSLV+ NPFGFKE       SNGGSRMWTPGQSGTCSPA+
Sbjct  134  PDPEWFRGVRMPQGGPTSPTFSLVASNPFGFKEEAFGGGGSNGGSRMWTPGQSGTCSPAI  193

Query  462  AAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            AA  D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  194  AAGSDHTADIPMAE-ISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  249



>ref|XP_010537716.1| PREDICTED: BES1/BZR1 homolog protein 4 [Tarenaya hassleriana]
Length=309

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 89/116 (77%), Gaps = 4/116 (3%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSN---GGSRMWTPGQSGTCSPA-VA  460
            PD  W SG+Q PQ  P+SPTFSLVS NPFGFKE   N   GGS MWTPGQSGTCSPA + 
Sbjct  193  PDPEWFSGIQIPQSVPTSPTFSLVSANPFGFKEASGNNGSGGSMMWTPGQSGTCSPAAIP  252

Query  459  AALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               D++ADVPMS+A+ AEFAFG N  G+VK WEGERIHEE  +DDLELTLGNS TR
Sbjct  253  PGSDQTADVPMSEAVPAEFAFGGNENGLVKAWEGERIHEESGSDDLELTLGNSTTR  308



>ref|XP_004489003.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
Length=342

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ PQ GP+SPTFSLV+ NPFGF+E +  G  SRMWTPGQSGTCSPAVAA  D
Sbjct  213  DPDWFAGIRMPQGGPTSPTFSLVASNPFGFREEVFCGSDSRMWTPGQSGTCSPAVAAGSD  272

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDLELTLGNSNTR  292
             +AD+PM++A+  EFAFGS+  G+VKPWEGERIHE+C  +DDLELTLG S TR
Sbjct  273  HTADIPMAEAVSDEFAFGSHTAGLVKPWEGERIHEDCDGSDDLELTLGCSKTR  325



>ref|XP_004294130.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Fragaria vesca subsp. 
vesca]
Length=324

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAAL  451
            P   W SG+Q P  GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  
Sbjct  212  PSPEWFSGIQIPH-GPTSPTFSLVSSNPFGFKEEALAGGGSRMWTPGQSGTCSPAIAAGS  270

Query  450  DRSADVPMSDAIQAEFAFGS-NAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PMS+ I  EFAFGS N  G+VK WEGERIHEE  +DDLELTLG S TR
Sbjct  271  DHTADIPMSEVISDEFAFGSCNTAGLVKAWEGERIHEESGSDDLELTLGCSKTR  324



>ref|XP_004489004.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=325

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ PQ GP+SPTFSLV+ NPFGF+E +  G  SRMWTPGQSGTCSPAVAA  D
Sbjct  213  DPDWFAGIRMPQGGPTSPTFSLVASNPFGFREEVFCGSDSRMWTPGQSGTCSPAVAAGSD  272

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDLELTLGNSNTR  292
             +AD+PM++A+  EFAFGS+  G+VKPWEGERIHE+C  +DDLELTLG S TR
Sbjct  273  HTADIPMAEAVSDEFAFGSHTAGLVKPWEGERIHEDCDGSDDLELTLGCSKTR  325



>ref|XP_007149549.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
 gb|ESW21543.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
Length=325

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ P   P+SPTFSL+S NPF FKE  L   GSRMWTP  SGTCSPA+A   D
Sbjct  214  DPEWFAGIKLPHVNPTSPTFSLISSNPFAFKEDGLVGSGSRMWTPAHSGTCSPAIAPGTD  273

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             +AD+PMS+A+  EFAFGSN +G+VKPWEGERIHEE  +DDLELTLGNS TR
Sbjct  274  HNADIPMSEAVSDEFAFGSNMLGLVKPWEGERIHEEFGSDDLELTLGNSKTR  325



>ref|XP_003543195.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Glycine max]
Length=325

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ P   P+SPTFSLVS NPF FKE  L   GSRMWTP QSGTCSPA+    D
Sbjct  214  DPEWFAGIKLPHVSPTSPTFSLVSSNPFAFKEDGLPGSGSRMWTPAQSGTCSPAIPPGSD  273

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PMS+A+  EFAFGSN +G+VKPWEGERIHEE  +DDLELTLGNS TR
Sbjct  274  QNADIPMSEAVSDEFAFGSNTLGLVKPWEGERIHEEFGSDDLELTLGNSKTR  325



>ref|XP_009136969.1| PREDICTED: BES1/BZR1 homolog protein 3-like [Brassica rapa]
Length=276

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR--MWTPGQSGTCSPAVAAA  454
            PDSGWLSG+QTPQ GPSSPTFSLVS NPF  KE    G S   MWTPGQSG CSPA+ A 
Sbjct  168  PDSGWLSGMQTPQSGPSSPTFSLVSRNPFFDKEAFKMGDSSSPMWTPGQSGNCSPAIPAG  227

Query  453  LDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +D+++D+ M+D + AEFAF     G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  228  VDQNSDLTMADGMAAEFAF-----GMVKPWEGERIHGECVSDDLELTLGNSRTR  276



>gb|KHN36918.1| BES1/BZR1 like protein 4 [Glycine soja]
Length=331

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ P   P+SPTFSLVS NPF FKE  L   GSRMWTP QSGTCSPA+    D
Sbjct  214  DPEWFAGIKLPHVSPTSPTFSLVSSNPFAFKEDGLPGSGSRMWTPAQSGTCSPAIPPGSD  273

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PMS+A+  EFAFGSN +G+VKPWEGERIHEE  +DDLELTLGNS TR
Sbjct  274  QNADIPMSEAVSDEFAFGSNMLGLVKPWEGERIHEEFGSDDLELTLGNSKTR  325



>ref|XP_003596275.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
 gb|AES66526.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=323

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ P  G +SPTFSLV+ NPFGF+E +  G  SRMWTPGQSGTCSPA+AA  D
Sbjct  212  DPDWFAGIRMPHSGQTSPTFSLVATNPFGFREEVFCGSDSRMWTPGQSGTCSPALAAGSD  271

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             +AD+PMS+AI  EFAFGS+A+G+VKPWEGERIHE+  +DDLELTLG S TR
Sbjct  272  HNADIPMSEAISDEFAFGSSAVGLVKPWEGERIHEDSGSDDLELTLGTSKTR  323



>ref|XP_006370100.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 ref|XP_006370101.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|ABK93591.1| unknown [Populus trichocarpa]
 gb|ERP66669.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 gb|ERP66670.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=328

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            PD  W  G++ PQ GP+SPTFSLV+ NPFGFKE       SNGGSRMWTPGQSGTCSPA+
Sbjct  213  PDPEWFRGIRIPQGGPTSPTFSLVASNPFGFKEEAFGGGGSNGGSRMWTPGQSGTCSPAI  272

Query  462  AAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            AA  D +AD+PM++ I  EFAF  NA G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  273  AAGSDHTADIPMAE-ISDEFAFRCNATGLVKPWEGERIHEECGSDDLELTLGNSRTR  328



>ref|XP_006348323.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Solanum tuberosum]
Length=315

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 2/100 (2%)
 Frame = -2

Query  585  GPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDA-IQ  412
            GP SPT+SLVSPNPFGFK + LS GGSRM TPGQSGTCSPA+AA LDR+ADVPM++  I 
Sbjct  216  GPPSPTYSLVSPNPFGFKMDSLSRGGSRMCTPGQSGTCSPAIAAGLDRNADVPMAEVMIS  275

Query  411  AEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             EFAFGSN  G+VKPWEGERIHE+C+ DDLELTLG+S TR
Sbjct  276  DEFAFGSNIAGMVKPWEGERIHEDCVPDDLELTLGSSKTR  315



>ref|XP_009128310.1| PREDICTED: BES1/BZR1 homolog protein 4 [Brassica rapa]
Length=292

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 91/114 (80%), Gaps = 6/114 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PDS W SG+Q PQ  P+SPTFSLVS NPFGFKE    GGSRMWTPGQSGTCSPA+     
Sbjct  183  PDSEWFSGIQLPQSVPASPTFSLVSQNPFGFKEGGGGGGSRMWTPGQSGTCSPAIP----  238

Query  447  RSADVPMSDAIQA--EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++ADVPMS+A+ A  EFAFGSNA G+VK WEGERIHE   +DDLELTLGNS+TR
Sbjct  239  QTADVPMSEAVVAPPEFAFGSNANGLVKAWEGERIHEVSGSDDLELTLGNSSTR  292



>ref|XP_008381083.1| PREDICTED: BES1/BZR1 homolog protein 4 [Malus domestica]
Length=324

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLS-NGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G+  P  GP+SPTFSLVS NPFGFK+ +S  GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGIPIPH-GPTSPTFSLVSSNPFGFKDEVSAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PMS+ I  EFAFG N  G+VK WEGE+IHE+  +DDLELTLG+S TR
Sbjct  272  DHAADIPMSEVISDEFAFGCNTTGLVKAWEGEKIHEDSGSDDLELTLGSSRTR  324



>ref|XP_009132289.1| PREDICTED: BES1/BZR1 homolog protein 3 [Brassica rapa]
 emb|CDX78903.1| BnaA01g09700D [Brassica napus]
Length=276

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAA  454
            P+SGWLSG+QTPQ GPSSPTFSLVS NPF  K   + G   S MWTPGQSG CSPA+ A 
Sbjct  168  PESGWLSGMQTPQSGPSSPTFSLVSRNPFFDKAAFTMGDCSSPMWTPGQSGNCSPAIPAG  227

Query  453  LDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +D+++DVPM+D + AEFAF     G+VKPWEGERIH EC+++DLELTLGNS TR
Sbjct  228  VDQNSDVPMADGMAAEFAF-----GMVKPWEGERIHGECVSEDLELTLGNSRTR  276



>ref|XP_009334016.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLS-NGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W +G+  P  GP+SPTFSLVS NPFGFK+ +S  GGSRMWTPGQSGTCSPA+AA  
Sbjct  213  PDPEWFAGIPIPH-GPTSPTFSLVSSNPFGFKDEVSAGGGSRMWTPGQSGTCSPAIAAGS  271

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PMS+ I  EFAFG N  G+VK WEGE+IHE+  +DDLELTLG+S TR
Sbjct  272  DHAADIPMSEVISDEFAFGCNTTGLVKAWEGEKIHEDSGSDDLELTLGSSRTR  324



>ref|XP_009622768.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=316

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = -2

Query  621  SGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP---LSNGGSRMWTPGQSGTCSPAVAAAL  451
            S WL+G+     GP SPT+SLVS NPFGFK     LS+GGSRM TPGQSGTCSPA+AA L
Sbjct  208  SEWLAGIS----GPPSPTYSLVSSNPFGFKMDGLVLSHGGSRMCTPGQSGTCSPAIAAGL  263

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PM++ I  EFAFGSNA G+VKPWEGERIHE+C  DDLELTLG+S TR
Sbjct  264  DNTADIPMAEVISDEFAFGSNAGGMVKPWEGERIHEDCGPDDLELTLGSSKTR  316



>emb|CDX99414.1| BnaC01g11380D [Brassica napus]
Length=308

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAA  454
            P+SGWLSG+QTPQ GPSSPTFSLVS NPF  K     G   S MWTPGQSG CSPA+ A 
Sbjct  200  PESGWLSGMQTPQSGPSSPTFSLVSRNPFFDKAAFKMGDCSSPMWTPGQSGNCSPAIPAG  259

Query  453  LDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +D+++DVPM+D + AEFAF     G+VKPWEGERIH EC+++DLELTLGNS TR
Sbjct  260  VDQNSDVPMADGMAAEFAF-----GMVKPWEGERIHGECVSEDLELTLGNSRTR  308



>ref|XP_010062789.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Eucalyptus grandis]
 gb|KCW69907.1| hypothetical protein EUGRSUZ_F03236 [Eucalyptus grandis]
Length=320

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  W+S +Q PQ GP SPTF+LVS NPFG K E L+ GGSR WTPGQSGTCSPA+AAA 
Sbjct  208  PDPEWISRIQIPQGGPVSPTFTLVSSNPFGSKQEVLAVGGSRTWTPGQSGTCSPAIAAAA  267

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D + D+PMS+ +  EFAFG +  G+VKPWEGERIH+E  +DDLELTLG S  R
Sbjct  268  DHTGDIPMSEVMSNEFAFGVSGKGLVKPWEGERIHDEPGSDDLELTLGGSKCR  320



>ref|XP_009768995.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=316

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 89/113 (79%), Gaps = 7/113 (6%)
 Frame = -2

Query  621  SGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE---PLSNGGSRMWTPGQSGTCSPAVAAAL  451
            S WL+G+     GP SPT+SLVS NPFGFK     LS+GGSRM TPGQSGTCSPA+ A L
Sbjct  208  SEWLTGIS----GPPSPTYSLVSSNPFGFKMDGLALSHGGSRMCTPGQSGTCSPAITAGL  263

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            D +AD+PM++ I  EFAFGSNA G+VKPWEGERIHE+C  DDLELTLG+S TR
Sbjct  264  DNTADIPMAEVISDEFAFGSNAGGMVKPWEGERIHEDCGPDDLELTLGSSKTR  316



>ref|XP_003540502.1| PREDICTED: BES1/BZR1 homolog protein 4 [Glycine max]
Length=322

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALD  448
            D  W +G++ P   P+SPTFSLVS NPF FKE  L + GS MWTP QSGTCSPAV     
Sbjct  211  DPEWFAGIKLPHVSPTSPTFSLVSSNPFAFKEHALPSSGSPMWTPAQSGTCSPAVPPGSY  270

Query  447  RSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            ++AD+PMSDA+  EFAFGSN +G+VKPWEGERIHEE  +DDLELTLGNS TR
Sbjct  271  QNADIPMSDAVSDEFAFGSNVLGLVKPWEGERIHEEFGSDDLELTLGNSKTR  322



>ref|XP_002887754.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64013.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 91/118 (77%), Gaps = 6/118 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  207  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  266

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              A D++ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  267  PPAADQTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  324



>ref|XP_010665681.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=329

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 2/114 (2%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            P+ GWL+ +Q  Q  P+SPTFSLVS NPF  +E  ++ GGSRMWTPGQSGTCSP +AA  
Sbjct  216  PEPGWLANIQITQGAPASPTFSLVSTNPFASREEVMAGGGSRMWTPGQSGTCSPIIAAGP  275

Query  450  DRSADVPMSDAIQAEFAFGSNAM-GIVKPWEGERIHEECITDDLELTLGNSNTR  292
             R+ADV MSD I AEFAFG+  M G+VK WEGE IHEEC+ DDLELTLG+S TR
Sbjct  276  ARTADVHMSDGIAAEFAFGNGMMGGLVKAWEGEIIHEECVPDDLELTLGSSRTR  329



>ref|XP_004244287.1| PREDICTED: BES1/BZR1 homolog protein 4 [Solanum lycopersicum]
Length=315

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 84/100 (84%), Gaps = 2/100 (2%)
 Frame = -2

Query  585  GPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDA-IQ  412
            GP SPT+SLVSPNPFGFK + LS GGSRM TPGQSG CSPA+AA LD +ADVPM++  I 
Sbjct  216  GPPSPTYSLVSPNPFGFKMDGLSRGGSRMCTPGQSGACSPAIAAGLDHNADVPMAEVMIS  275

Query  411  AEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             EFAFGSN  G+VKPWEGERIHE+C+ DDLELTLG+S TR
Sbjct  276  DEFAFGSNVAGMVKPWEGERIHEDCVPDDLELTLGSSKTR  315



>ref|XP_010429699.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGCGGGSRMWTPGQSGTCSPAI  267

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             +  D +ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  268  PSGADHTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_006302567.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
 gb|EOA35465.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
Length=317

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  200  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  259

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                D++ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  260  PPGADQTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  317



>ref|NP_565187.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
 sp|Q9ZV88.1|BEH4_ARATH RecName: Full=BES1/BZR1 homolog protein 4 [Arabidopsis thaliana]
 gb|AAC83038.1| EST gb|R30300 comes from this gene [Arabidopsis thaliana]
 gb|AAK91446.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AAL90992.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AEE36140.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
Length=325

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  267

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                D++ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  268  PPGADQTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_010417476.1| PREDICTED: BES1/BZR1 homolog protein 4 [Camelina sativa]
Length=325

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 89/118 (75%), Gaps = 6/118 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  267

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                D +ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  268  PPGADHTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_010472705.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 89/118 (75%), Gaps = 6/118 (5%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE         GGSRMWTPGQSGTCSPA+
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAI  267

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                D +ADVPMS+A+   EFAFGSN  G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  268  PPGADHTADVPMSEAVAPPEFAFGSNTDGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>gb|KFK42252.1| hypothetical protein AALP_AA2G231000 [Arabis alpina]
Length=317

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 88/115 (77%), Gaps = 8/115 (7%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDS W SG+Q  Q  P+SPTFSLVS  PFGFK E  S GGSRMWTPGQSGTCSPA+    
Sbjct  208  PDSEWFSGIQLAQSVPASPTFSLVSQKPFGFKDEVASAGGSRMWTPGQSGTCSPALP---  264

Query  450  DRSADVPMSDAIQA--EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              + DVPMS+A+ A  EFAFGSN  G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  265  --TGDVPMSEAVVAPPEFAFGSNINGLVKAWEGERIHEESGSDDLELTLGNSSTR  317



>gb|ACE97196.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +
Sbjct  85   PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  144

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWE  361
            D++ADVPM+D++ AEFAFGSN  G+VKPWE
Sbjct  145  DQTADVPMADSMAAEFAFGSNTAGLVKPWE  174



>gb|ACE97214.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +
Sbjct  85   PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  144

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWE  361
            D++ADVPM+D++ AEFAFGSN  G+VKPWE
Sbjct  145  DQTADVPMADSMAAEFAFGSNTAGLVKPWE  174



>gb|ACE97191.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97193.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97194.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97195.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97199.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97200.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97201.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97202.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97203.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97204.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97205.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97206.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97207.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97209.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97210.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97211.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97212.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97213.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97215.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97216.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97217.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97218.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97219.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97220.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97221.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97222.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97223.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97224.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97225.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97226.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97227.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97228.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +
Sbjct  85   PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  144

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWE  361
            D++ADVPM+D++ AEFAFGSN  G+VKPWE
Sbjct  145  DQTADVPMADSMAAEFAFGSNTAGLVKPWE  174



>gb|ACE97192.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97197.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97198.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97208.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDSGWL+G+Q PQ GPSSPTFSLVS NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +
Sbjct  85   PDSGWLAGIQIPQSGPSSPTFSLVSRNPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGI  144

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWE  361
            D++ADVPM+D++ AEFAFGSN  G+VKPWE
Sbjct  145  DQTADVPMADSMAAEFAFGSNTAGLVKPWE  174



>emb|CDY26877.1| BnaA02g19020D [Brassica napus]
Length=293

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 7/115 (6%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSR-MWTPGQSGTCSPAVAAAL  451
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE    GGSR +WTPGQSGTCSPA+    
Sbjct  183  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEGGGGGGSRILWTPGQSGTCSPAIP---  239

Query  450  DRSADVPMSDAIQA--EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             ++ADVPMS+A+ A  EFAFGSNA G+VK WEGERIHE   +DDLELTLGNS+TR
Sbjct  240  -QTADVPMSEAVVAPPEFAFGSNANGLVKAWEGERIHEVSGSDDLELTLGNSSTR  293



>emb|CDP06034.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 86/113 (76%), Gaps = 5/113 (4%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PDS W +G+Q PQ GP+SPTFSLVS NPF FK E L + GS M TPGQSGTCSPA+ A  
Sbjct  211  PDSEWFAGMQIPQGGPTSPTFSLVSANPFAFKFESLRHTGSHMCTPGQSGTCSPAIPAG-  269

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               +DVPM++ I  EFAF S   G+VKPWEGERIHE+C +DDLELTLG+S TR
Sbjct  270  ---SDVPMAEVISDEFAFRSIKGGLVKPWEGERIHEDCGSDDLELTLGSSKTR  319



>ref|XP_006389963.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
 gb|ESQ27249.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
Length=319

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 91/117 (78%), Gaps = 9/117 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSN---GGSRMWTPGQSGTCSPAVAA  457
            PDS W SG+Q  Q  P+SPTFSLVS NPFGFKE +++   GGSRMWTP QSGTCSPA+  
Sbjct  207  PDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKEEVASARGGGSRMWTPSQSGTCSPAIP-  265

Query  456  ALDRSADVPMSDAIQA-EFAFGS-NAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               ++ADVPMS+A+   EFAFGS N  G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  266  ---QTADVPMSEAVAPPEFAFGSSNTNGLVKAWEGERIHEESGSDDLELTLGNSSTR  319



>emb|CDX87440.1| BnaA07g34330D [Brassica napus]
Length=307

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 91/118 (77%), Gaps = 10/118 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGG----SRMWTPGQSGTCSPAV  463
            PDS W +G+Q  Q  P+SPTFSLVS NPFGF+E  L++ G    SRMWTPGQSGTCSPA+
Sbjct  192  PDSEWFAGIQLAQSVPASPTFSLVSRNPFGFREDQLASAGGGDGSRMWTPGQSGTCSPAI  251

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                 ++ DVPMS+A+   EFAFGSNA G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  252  P----QTGDVPMSEAVAPPEFAFGSNANGLVKAWEGERIHEESGSDDLELTLGNSSTR  305



>ref|XP_009106588.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Brassica rapa]
Length=307

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 91/118 (77%), Gaps = 10/118 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-PLSNGG----SRMWTPGQSGTCSPAV  463
            PDS W +G+Q  Q  P+SPTFSLVS NPFGF+E  L++ G    SRMWTPGQSGTCSPA+
Sbjct  192  PDSEWFAGIQLAQSVPASPTFSLVSRNPFGFREDQLASAGGGDGSRMWTPGQSGTCSPAI  251

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                 ++ DVPMS+A+   EFAFGSNA G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  252  P----QTGDVPMSEAVAPPEFAFGSNANGLVKAWEGERIHEESGSDDLELTLGNSSTR  305



>emb|CDY66394.1| BnaC03g78350D [Brassica napus]
Length=139

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 88/118 (75%), Gaps = 10/118 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            PDS W +G+Q  Q  P+SPTFSLVS NPFGF+E         GGSRMWT GQSGTCSPA+
Sbjct  24   PDSEWFAGIQLAQSVPASPTFSLVSRNPFGFREDQLASAGGGGGSRMWTLGQSGTCSPAI  83

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                 ++ DVPMS+A+   EFAFGSNA G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  84   T----QTGDVPMSEAVAPPEFAFGSNANGLVKAWEGERIHEESGSDDLELTLGNSSTR  137



>emb|CDY14593.1| BnaC02g25200D [Brassica napus]
Length=293

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 89/115 (77%), Gaps = 7/115 (6%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAAL  451
            PD  W SG+Q  Q  P+SPTFSLVS NPFGFKE    GG SRMWTPGQSGTCSPA+    
Sbjct  183  PDCEWFSGIQLAQSVPASPTFSLVSQNPFGFKEAGGGGGGSRMWTPGQSGTCSPAIP---  239

Query  450  DRSADVPMSDAIQA--EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             ++ADVPMS+A+ A  EFAFGS+A G+VK WEGERIHE   +DDLELTLGNS+TR
Sbjct  240  -QTADVPMSEAVVAPPEFAFGSSANGLVKAWEGERIHEVSGSDDLELTLGNSSTR  293



>ref|XP_010916623.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=340

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 86/123 (70%), Gaps = 11/123 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG--SRMWTPGQSGTCSPAVAAA  454
            PD  WL+G++ P  GPSSPT+SLVS NPFGF +  S G   SRMWTPGQSGTCSP     
Sbjct  221  PDPAWLAGLRLPSGGPSSPTYSLVSSNPFGFFKEASAGAGSSRMWTPGQSGTCSPVPGGG  280

Query  453  LDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                ADV MSD I  EFAFGS+      A G+VKPWEGERIHEEC +D+LELTLG+S TR
Sbjct  281  ---HADVQMSDGISDEFAFGSSSNGNLPANGLVKPWEGERIHEECASDELELTLGSSRTR  337

Query  291  *GV  283
             G 
Sbjct  338  SGA  340



>emb|CDX88466.1| BnaC06g39100D [Brassica napus]
Length=307

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 88/118 (75%), Gaps = 10/118 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAV  463
            P S W +G+Q  Q  P+SPTFSLVS NPFGF+E         GGSRMWTPGQSGTCSPA+
Sbjct  192  PGSEWFAGIQLAQSVPASPTFSLVSRNPFGFREDQLASAGGGGGSRMWTPGQSGTCSPAI  251

Query  462  AAALDRSADVPMSDAIQA-EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                 ++ DVPMS+A+   EFAFGSNA G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  252  P----QTGDVPMSEAVAPPEFAFGSNANGLVKAWEGERIHEESGSDDLELTLGNSSTR  305



>ref|XP_009415180.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 10/118 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PD+ WL+G++ P  GPSSPTFSLVSPNPFG  +  S  GSRMWTPGQSGTCSP       
Sbjct  221  PDAAWLAGLRLPSGGPSSPTFSLVSPNPFGLYKEAS--GSRMWTPGQSGTCSPVPGG--H  276

Query  447  RSADVPMSDAIQAEFAFGSNA------MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               +V MSD    EFAFGS++      +G+VKPWEGERIHEE ++D+LELTLG+SNTR
Sbjct  277  SHGNVQMSDVGSDEFAFGSSSNHIPTTVGLVKPWEGERIHEEFVSDELELTLGSSNTR  334



>ref|XP_008796066.1| PREDICTED: protein BZR1 homolog 3 [Phoenix dactylifera]
Length=338

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 85/123 (69%), Gaps = 11/123 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG--SRMWTPGQSGTCSPAVAAA  454
            PD  WL+G++ P  GPSSPT+SLVS NPFGF +  S G   SRM TPGQSGTCSP     
Sbjct  219  PDPAWLAGLRLPSGGPSSPTYSLVSSNPFGFFKEASAGAGSSRMLTPGQSGTCSPVPGGG  278

Query  453  LDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                ADV MSD I  EFAFGS+      A G+VKPWEGERIHEEC +D+LELTLG+S TR
Sbjct  279  ---HADVQMSDGISDEFAFGSSSNGDLPANGLVKPWEGERIHEECASDELELTLGSSRTR  335

Query  291  *GV  283
             G 
Sbjct  336  SGA  338



>ref|XP_010924706.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=339

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 83/120 (69%), Gaps = 12/120 (10%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGG--SRMWTPGQSGTCSPAVAAA  454
            PD+ WL+G++ P  GPSSPT+SLVS NPFGF    S G   SRMWTPGQSG CSP     
Sbjct  221  PDAAWLAGLRLPSGGPSSPTYSLVSSNPFGFCNEASAGAGSSRMWTPGQSGACSPVPGG-  279

Query  453  LDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                ADV M + I  EFAFGS+      + G+VKPWEGERIHEEC +D+LELTLG+S TR
Sbjct  280  ---HADVRMCNGISDEFAFGSSCNGNLQSNGLVKPWEGERIHEECASDELELTLGSSRTR  336



>gb|KJB69670.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=285

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 73/88 (83%), Gaps = 2/88 (2%)
 Frame = -2

Query  555  SPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            SP+   F +P   GGSRMWTPGQSGTCSPA  A +D+++DVPMSDAI AEFAFGSN  G+
Sbjct  200  SPSRQVFPDP--GGGSRMWTPGQSGTCSPAFPAGVDQTSDVPMSDAIAAEFAFGSNMTGL  257

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VKPWEGE+IHEEC+ +DLELTLGNS TR
Sbjct  258  VKPWEGEKIHEECVANDLELTLGNSKTR  285



>gb|KHN36917.1| BES1/BZR1 like protein 4 [Glycine soja]
Length=254

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = -2

Query  624  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKE-PLSNGGSRMWT-PGQSGTCSPAVAA  457
            ++ W S ++ PQ G  P+SPTFSLVS NPFG KE  +   GSRMWT PG SGTCSPAVAA
Sbjct  135  ETDWFSKIRIPQGGLAPTSPTFSLVSSNPFGLKEDAMVGSGSRMWTTPGASGTCSPAVAA  194

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDLELTLGNSNTR  292
              + ++D+PM++A+  EFAFGS++ G+V  W+GERIHE    TDDLELTLG+S TR
Sbjct  195  GSENTSDIPMAEAVSDEFAFGSSSSGLVNAWKGERIHEASFGTDDLELTLGSSKTR  250



>ref|XP_008790049.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=315

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 85/120 (71%), Gaps = 9/120 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG-SRMWTPGQSGTCSPAVAAA  454
            PD  WL+G+  P  GPSSPTFSLVS NPFG FKE ++ GG SRM TPGQSGTCSP +   
Sbjct  194  PDPAWLAGIHLPTGGPSSPTFSLVSSNPFGFFKEVIAGGGSSRMMTPGQSGTCSPVMPGG  253

Query  453  LDRSADVPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDLELTLGNSNTR  292
                 DV MSD +  EFAFGS++       G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  254  AGH-VDVQMSDGMSDEFAFGSSSNGNHPPPGLVKAWEGERIHEECGSDELELTLGSSRTR  312



>ref|XP_006592940.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X3 [Glycine 
max]
Length=278

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = -2

Query  624  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKEPLSNG-GSRMWT-PGQSGTCSPAVAA  457
            ++ W S ++ PQ G  P+SPTFSLVS NPFGFKE    G GSRMWT PG SGTCSPAVAA
Sbjct  159  ETDWFSKIRIPQVGLTPTSPTFSLVSSNPFGFKEDAMGGSGSRMWTTPGASGTCSPAVAA  218

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDLELTLGNSNTR  292
              + ++D+PM++A+  EFAFGS++  +V  W+GERIHE    TDDLELTLG+S TR
Sbjct  219  GSENTSDIPMAEAVSDEFAFGSSSSVLVNAWKGERIHEASFGTDDLELTLGSSKTR  274



>ref|XP_008792311.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=339

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 85/121 (70%), Gaps = 13/121 (11%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGF--KEPLSNGGS-RMWTPGQSGTCSPAVAA  457
            PD  WL+G++ P  GPSSPT+SLVS NPFGF  KE  +  GS RMWTPGQSGTCSP    
Sbjct  220  PDPAWLAGLRLPSGGPSSPTYSLVSSNPFGFFCKEASAGAGSSRMWTPGQSGTCSPVPGG  279

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMG------IVKPWEGERIHEECITDDLELTLGNSNT  295
                 A V +SD I  EFAFGS++ G      +VKPWEGERIHEEC +D+LELTLG+S T
Sbjct  280  ----HAGVRVSDGISDEFAFGSSSNGNLQSNGLVKPWEGERIHEECGSDELELTLGSSRT  335

Query  294  R  292
            R
Sbjct  336  R  336



>ref|XP_003543196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=334

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = -2

Query  624  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKE-PLSNGGSRMWT-PGQSGTCSPAVAA  457
            ++ W S ++ PQ G  P+SPTFSLVS NPFG KE  +   GSRMWT PG SGTCSPAVAA
Sbjct  215  ETDWFSKIRIPQGGLAPTSPTFSLVSSNPFGLKEDAMVGSGSRMWTTPGASGTCSPAVAA  274

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDLELTLGNSNTR  292
              + ++D+PM++A+  EFAFGS++ G+V  W+GERIHE    TDDLELTLG+S TR
Sbjct  275  GSENTSDIPMAEAVSDEFAFGSSSSGLVNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_006594721.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=330

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = -2

Query  624  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKE-PLSNGGSRMWT-PGQSGTCSPAVAA  457
            ++ W S ++ PQ G  P+SPTFSLVS NPFG KE  +   GSRMWT PG SGTCSPAVAA
Sbjct  215  ETDWFSKIRIPQGGLAPTSPTFSLVSSNPFGLKEDAMVGSGSRMWTTPGASGTCSPAVAA  274

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDLELTLGNSNTR  292
              + ++D+PM++A+  EFAFGS++ G+V  W+GERIHE    TDDLELTLG+S TR
Sbjct  275  GSENTSDIPMAEAVSDEFAFGSSSSGLVNAWKGERIHEASFGTDDLELTLGSSKTR  330



>gb|EYU29527.1| hypothetical protein MIMGU_mgv1a010055mg [Erythranthe guttata]
Length=324

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 76/101 (75%), Gaps = 6/101 (6%)
 Frame = -2

Query  591  QDGPSSPTFSLVSPNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAI  415
            Q GP+SPTFSLVS NPFGF+ E LS  GS M TPGQSGTCSP + A+     D+PM++ I
Sbjct  229  QSGPTSPTFSLVSSNPFGFRVEDLSRSGSLMCTPGQSGTCSPVIGAS-----DIPMAEVI  283

Query  414  QAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              EFAFGSN  G+VK WEGERIHE C +D+LELTLG S TR
Sbjct  284  PNEFAFGSNTKGLVKAWEGERIHEVCGSDELELTLGTSKTR  324



>ref|XP_003540501.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=330

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = -2

Query  624  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKEPLSNG-GSRMWT-PGQSGTCSPAVAA  457
            ++ W S ++ PQ G  P+SPTFSLVS NPFGFKE    G GSRMWT PG SGTCSPAVAA
Sbjct  215  ETDWFSKIRIPQVGLTPTSPTFSLVSSNPFGFKEDAMGGSGSRMWTTPGASGTCSPAVAA  274

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDLELTLGNSNTR  292
              + ++D+PM++A+  EFAFGS++  +V  W+GERIHE    TDDLELTLG+S TR
Sbjct  275  GSENTSDIPMAEAVSDEFAFGSSSSVLVNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_006592939.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=334

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = -2

Query  624  DSGWLSGVQTPQDG--PSSPTFSLVSPNPFGFKEPLSNG-GSRMWT-PGQSGTCSPAVAA  457
            ++ W S ++ PQ G  P+SPTFSLVS NPFGFKE    G GSRMWT PG SGTCSPAVAA
Sbjct  215  ETDWFSKIRIPQVGLTPTSPTFSLVSSNPFGFKEDAMGGSGSRMWTTPGASGTCSPAVAA  274

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECI-TDDLELTLGNSNTR  292
              + ++D+PM++A+  EFAFGS++  +V  W+GERIHE    TDDLELTLG+S TR
Sbjct  275  GSENTSDIPMAEAVSDEFAFGSSSSVLVNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_010915465.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=343

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 84/120 (70%), Gaps = 10/120 (8%)
 Frame = -2

Query  624  DSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG-SRMWTPGQSGTCSPAVAAAL  451
            D  WL+G+  P  GPSSPTFSLVS NPFG FKE ++ GG SRM TPGQSGTCSP +    
Sbjct  222  DPAWLAGIHLPTGGPSSPTFSLVSSNPFGFFKEVIAGGGSSRMLTPGQSGTCSPVMPGGS  281

Query  450  DRSADVPMSDAIQAEFAFGSNA-------MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                DV MSD +  EFAFGS++        G+V+ WEGERIHEEC +D+LELTLG+S TR
Sbjct  282  GH-VDVQMSDGVSDEFAFGSSSSNRHHPPAGLVRAWEGERIHEECGSDELELTLGSSRTR  340



>ref|XP_009397454.1| PREDICTED: protein BZR1 homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 80/118 (68%), Gaps = 10/118 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PD  W++G+Q     PSSPTFSLVS NPF F      G SRMWTPGQSGT SPA+   + 
Sbjct  221  PDPAWIAGLQIETVSPSSPTFSLVSSNPFSFS---GGGSSRMWTPGQSGTSSPALPG-MP  276

Query  447  RSADVPMSDAIQAEFAFGSNAMG------IVKPWEGERIHEECITDDLELTLGNSNTR  292
             +  + MSD I  EFAFGS+A        +VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  277  HNVGIQMSDGISQEFAFGSSATDDNPIATLVKPWEGERIHEECGSDDLELTLGSSRTR  334



>ref|XP_009388695.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 80/118 (68%), Gaps = 10/118 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PD GW++G+Q     PSSPTFSLVS NP GF      G SRMWTPGQSGT SP V   + 
Sbjct  221  PDPGWIAGLQIDTGPPSSPTFSLVSSNPQGFS---GGGSSRMWTPGQSGTSSP-VMPGMP  276

Query  447  RSADVPMSDAIQAEFAFGSNAMG------IVKPWEGERIHEECITDDLELTLGNSNTR  292
               D+ MSD I  EFAFGS++ G      +VKPWEGERIHEEC +DDLELTLG S TR
Sbjct  277  CCVDIQMSDGISDEFAFGSSSNGGHLQAVLVKPWEGERIHEECGSDDLELTLGGSRTR  334



>gb|EEE65864.1| hypothetical protein OsJ_21656 [Oryza sativa Japonica Group]
Length=369

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 83/119 (70%), Gaps = 9/119 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  WLSG Q    GPSSPT++LVSPNPFG FKE +++  SR+ TPGQSGTCSP V   +
Sbjct  249  PDPAWLSGFQISSAGPSSPTYNLVSPNPFGIFKEAIAST-SRVCTPGQSGTCSP-VMGGM  306

Query  450  DRSADVPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDLELTLGNSNTR  292
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  307  PAHHDVQMVDGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDELELTLGSSKTR  365



>ref|NP_001057840.1| Os06g0552300 [Oryza sativa Japonica Group]
 sp|Q5Z9E5.1|BZR3_ORYSJ RecName: Full=Protein BZR1 homolog 3; Short=OsBZR3; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 3 [Oryza sativa 
Japonica Group]
 dbj|BAD53662.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 dbj|BAF19754.1| Os06g0552300 [Oryza sativa Japonica Group]
 dbj|BAG94965.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 83/119 (70%), Gaps = 9/119 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  WLSG Q    GPSSPT++LVSPNPFG FKE +++  SR+ TPGQSGTCSP V   +
Sbjct  235  PDPAWLSGFQISSAGPSSPTYNLVSPNPFGIFKEAIAST-SRVCTPGQSGTCSP-VMGGM  292

Query  450  DRSADVPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDLELTLGNSNTR  292
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  293  PAHHDVQMVDGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDELELTLGSSKTR  351



>ref|XP_009381197.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=411

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 81/133 (61%), Gaps = 24/133 (18%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPA------  466
            PD  W++G+Q     PSSPTFSLVS NPFGF      G SRMWTPGQSGT SP       
Sbjct  279  PDPAWIAGLQIETTSPSSPTFSLVSSNPFGFS---GGGSSRMWTPGQSGTSSPVMPGIIW  335

Query  465  ----------VAAALDRSADVPMSDAIQAEFAFGSNA-----MGIVKPWEGERIHEECIT  331
                      V   +  + DV MS+ I  EFAFGS++      G+VKPWEGERIHEEC  
Sbjct  336  MPGQSGTRSPVMPGISHNIDVQMSNGITDEFAFGSSSNGNSLRGLVKPWEGERIHEECGP  395

Query  330  DDLELTLGNSNTR  292
            DDL+LTLG+S TR
Sbjct  396  DDLQLTLGSSRTR  408



>gb|EEC80795.1| hypothetical protein OsI_23332 [Oryza sativa Indica Group]
Length=354

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 9/119 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  WL+G Q    GPSSPT++LVSPNPFG FKE +++  SR+ TPGQSGTCSP V   +
Sbjct  234  PDPAWLAGFQISSAGPSSPTYNLVSPNPFGIFKEAIAST-SRVCTPGQSGTCSP-VMGGM  291

Query  450  DRSADVPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDLELTLGNSNTR  292
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  292  PAHHDVQMVDGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDELELTLGSSKTR  350



>ref|XP_002454981.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
 gb|EES00101.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
Length=348

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 79/115 (69%), Gaps = 10/115 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKE--PLSNGGSRMWTPGQSGTCSPAVAA  457
            PD  WL+G+Q     P+SPTFSLVS NPF  FKE  P+ N  SRM TPGQSGTCSPA+  
Sbjct  233  PDPAWLAGIQISSTSPNSPTFSLVSTNPFSVFKESIPVGNSSSRMCTPGQSGTCSPAIPG  292

Query  456  ALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTL  310
             L  S DV M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DDLELTL
Sbjct  293  MLQHS-DVHMMDAVSDEFAFGSSTNGAQQAAGLVRAWEGERIHEDSGSDDLELTL  346



>ref|XP_003563774.1| PREDICTED: protein BZR1 homolog 3 [Brachypodium distachyon]
Length=355

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 9/119 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  WL+G Q    GPSSPT++LVS NPFG FKE L++  SR+ TPGQSGTCSP +  A 
Sbjct  235  PDPAWLAGFQISSAGPSSPTYNLVSHNPFGIFKEALAST-SRVCTPGQSGTCSPVMGGAP  293

Query  450  DRSADVPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDLELTLGNSNTR  292
                DV M+D    +FAFGS++       G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  294  THH-DVQMADGATDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDELELTLGSSMTR  351



>ref|XP_009416433.1| PREDICTED: protein BZR1 homolog 3 [Musa acuminata subsp. malaccensis]
Length=337

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 77/118 (65%), Gaps = 10/118 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            P S WL+ ++ P  GPSSPTFSL+S NP  F +  S  GSRM TPGQSGTCSP       
Sbjct  221  PQSAWLASLRLPSGGPSSPTFSLISSNPLVFYKEAS--GSRMLTPGQSGTCSPIPGG--H  276

Query  447  RSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               DV MSD    EF FGS+      A G+VKPWEGE IHEEC +D+L+LTLG+S TR
Sbjct  277  SHGDVQMSDGGSDEFEFGSSSNGTDTATGLVKPWEGEMIHEECASDELDLTLGSSKTR  334



>ref|XP_010925590.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=337

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 79/116 (68%), Gaps = 9/116 (8%)
 Frame = -2

Query  615  WLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG-SRMWTPGQSGTCSPAVAAALDRS  442
            WL+G+Q P  GPSSPTF LVS NPFG FKE ++ GG SR+  PGQSGTCSP +       
Sbjct  219  WLAGIQLPTGGPSSPTFRLVSSNPFGFFKEAMAGGGSSRVVRPGQSGTCSPVMPGGPGH-  277

Query  441  ADVPMSDAIQAEFAFGSNA------MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             DVPM D    EFAFGS +       G+VK WEGERIHEEC +D+L+LTLG+S  R
Sbjct  278  IDVPMPDGTSDEFAFGSGSNSNHPPAGLVKAWEGERIHEECGSDELDLTLGSSWAR  333



>ref|NP_001136786.1| BES transcription factor [Zea mays]
 gb|ACF82630.1| unknown [Zea mays]
 gb|ACG34754.1| brassinazole-resistant 1 protein [Zea mays]
 gb|ACR37890.1| unknown [Zea mays]
 gb|ADX60154.1| BES transcription factor [Zea mays]
 gb|ADX60163.1| MYBGA transcription factor, partial [Zea mays]
 gb|AFW86961.1| brassinazole-resistant 1 protein [Zea mays]
Length=355

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 83/121 (69%), Gaps = 11/121 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  WL+G Q    GPSSPT+SLV+PNPFG FKE + +  SRM TPGQSGTCSP +  A 
Sbjct  233  PDPAWLAGFQISSAGPSSPTYSLVAPNPFGIFKETIVST-SRMCTPGQSGTCSPVMGGAP  291

Query  450  DRSADVPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITD--DLELTLGNSNT  295
                DV M+D    +FAFGS++       G+VK WEGERIHEEC +D  +LELTLG+S T
Sbjct  292  IHH-DVQMADGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDEHELELTLGSSKT  350

Query  294  R  292
            R
Sbjct  351  R  351



>ref|XP_002437132.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
 gb|EER88499.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
Length=356

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 83/121 (69%), Gaps = 11/121 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  WL+G Q    GPSSPT+SLV+PNPFG FKE +++  SRM TPGQSGTCSP V   +
Sbjct  234  PDPAWLAGFQISSAGPSSPTYSLVAPNPFGIFKETIAST-SRMCTPGQSGTCSP-VMGGV  291

Query  450  DRSADVPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITD--DLELTLGNSNT  295
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D  +LELTLG+S T
Sbjct  292  PIHHDVQMVDGAPDDFAFGSSSNGNNESPGLVKAWEGERIHEECASDEHELELTLGSSKT  351

Query  294  R  292
            R
Sbjct  352  R  352



>ref|XP_004968562.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=347

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 80/115 (70%), Gaps = 10/115 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGG--SRMWTPGQSGTCSPAVAA  457
            PD  WL+ +Q     P+SPTFSLVS NPF  FKE +S GG  SRM TPGQSGTCSPA+  
Sbjct  232  PDPAWLASIQISSTSPNSPTFSLVSTNPFSVFKESISVGGNSSRMCTPGQSGTCSPAI-P  290

Query  456  ALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTL  310
             + R +DV M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DDLELTL
Sbjct  291  GMPRPSDVHMMDAVSDEFAFGSSTNGAQQAAGLVRAWEGERIHEDSGSDDLELTL  345



>ref|XP_004965584.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=356

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 83/121 (69%), Gaps = 11/121 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            PD  WLSG +    GPSSPT+SLV+PNPFG FKE +++  SRM TPGQSGTCSP V   +
Sbjct  234  PDPTWLSGFRISSAGPSSPTYSLVAPNPFGIFKETVAST-SRMCTPGQSGTCSP-VMGGV  291

Query  450  DRSADVPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITD--DLELTLGNSNT  295
                DV M D    +FAFGS++       G+VK WEGERIHEEC +D  +LELTLG+S T
Sbjct  292  PIHHDVQMVDGTPDDFAFGSSSNGNNQSPGLVKAWEGERIHEECASDEHELELTLGSSKT  351

Query  294  R  292
            R
Sbjct  352  R  352



>ref|NP_001132634.1| uncharacterized protein LOC100194109 [Zea mays]
 gb|ACF81562.1| unknown [Zea mays]
 gb|ACG40609.1| brassinazole-resistant 1 protein [Zea mays]
Length=345

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 78/117 (67%), Gaps = 12/117 (10%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGS----RMWTPGQSGTCSPAV  463
            PD  WL+G+Q     P+SPTFSLVS NPFG FKE +  GG     RM TPGQSG CSPA+
Sbjct  228  PDPAWLAGIQISSTSPNSPTFSLVSTNPFGVFKESIPVGGGDSSMRMCTPGQSGACSPAI  287

Query  462  AAALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTL  310
               + R +DV M D +  EFAFGS+      A G+V+ WEGERIHE+  +DDLELTL
Sbjct  288  -PGMPRHSDVHMMDVVSDEFAFGSSTNGAQQAAGLVRAWEGERIHEDSGSDDLELTL  343



>gb|ACG41016.1| brassinazole-resistant 1 protein [Zea mays]
Length=346

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 78/118 (66%), Gaps = 13/118 (11%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGS-----RMWTPGQSGTCSPA  466
            PD  WL+G+Q     P+SPTFSLVS NPFG FKE +  GG      RM TPGQSG CSPA
Sbjct  228  PDPAWLAGIQISSTSPNSPTFSLVSTNPFGVFKESIPVGGGGDSSMRMCTPGQSGACSPA  287

Query  465  VAAALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTL  310
            +   + R +DV M D +  EFAFGS+      A G+V+ WEGERIHE+  +DDLELTL
Sbjct  288  I-PGMPRHSDVHMMDVVSDEFAFGSSTNGAQQAAGLVRAWEGERIHEDSGSDDLELTL  344



>dbj|BAJ97997.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91390.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 75/121 (62%), Gaps = 12/121 (10%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PD  WL+G Q    GPSSPT++LVS NPFG     S   SR  TPGQSGTCSP +     
Sbjct  235  PDPAWLAGFQISSAGPSSPTYNLVSHNPFGIALASS---SRACTPGQSGTCSPVMGDHPP  291

Query  447  RSADVPMS--DAIQAEFAFGSNAM-------GIVKPWEGERIHEECITDDLELTLGNSNT  295
               DV M   D    +FAFGSN+        G+VK WEGERIHEEC +D+LELTLG+S T
Sbjct  292  VHHDVQMEMVDGAADDFAFGSNSNDNNGSPPGLVKAWEGERIHEECASDELELTLGSSRT  351

Query  294  R  292
            R
Sbjct  352  R  352



>gb|EEC70129.1| hypothetical protein OsI_00807 [Oryza sativa Indica Group]
Length=334

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 83/121 (69%), Gaps = 10/121 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKE--PLSNGGSRMWTPGQSGTCSPAVAA  457
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+  P+ N  SRM TPGQSGTCSPA+  
Sbjct  212  PDPAWLAGIQISSTSPSSPTFSLVSSNPFSVFKDAIPVGNNSSRMCTPGQSGTCSPAIPG  271

Query  456  ALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSNT  295
             +    D+ M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DDLELTLG+S T
Sbjct  272  -MAPHPDIHMMDAVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  330

Query  294  R  292
            R
Sbjct  331  R  331



>gb|EMT29878.1| hypothetical protein F775_52316 [Aegilops tauschii]
Length=355

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 77/120 (64%), Gaps = 11/120 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            PD  WL+G Q    GPSSPT++LVS NPFG     S   SR+ TPGQSGTCSPA+     
Sbjct  234  PDPAWLAGFQISSAGPSSPTYNLVSHNPFGIALASS---SRVCTPGQSGTCSPAMGDHAP  290

Query  447  RSADVPMS--DAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDLELTLGNSNTR  292
               DV M   +    +FAFGSN+       G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  291  AHHDVQMEMVEGAADDFAFGSNSNGNNGSPGLVKAWEGERIHEECASDELELTLGSSRTR  350



>ref|XP_006643883.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Oryza brachyantha]
Length=261

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 82/121 (68%), Gaps = 10/121 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKE--PLSNGGSRMWTPGQSGTCSPAVAA  457
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+  P+ N  SRM TPGQSGTCSPA+  
Sbjct  139  PDPAWLAGIQISSTSPSSPTFSLVSTNPFSVFKDAIPVGNSSSRMCTPGQSGTCSPAIPG  198

Query  456  ALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSNT  295
             +    D+ M D +  EFAFGS+      A G+V+ WEGERIHE+  +DDLELTLG+S T
Sbjct  199  -MAPHPDIHMMDVVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  257

Query  294  R  292
            R
Sbjct  258  R  258



>gb|EMS63049.1| hypothetical protein TRIUR3_11319 [Triticum urartu]
Length=544

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 76/120 (63%), Gaps = 11/120 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVA--AA  454
            PD  WL+G Q    GPSSPT++LVS NPFG     S   SR  TPGQSGTCSP +   A 
Sbjct  423  PDPAWLAGFQISSAGPSSPTYNLVSHNPFGIALASS---SRACTPGQSGTCSPVMGDHAP  479

Query  453  LDRSADVPMSDAIQAEFAFGSNAM------GIVKPWEGERIHEECITDDLELTLGNSNTR  292
                  + M+D    +FAFGSN+       G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  480  AHHDVQMEMADGAPDDFAFGSNSNGNNGSPGLVKAWEGERIHEECASDELELTLGSSRTR  539



>gb|EEE54074.1| hypothetical protein OsJ_00786 [Oryza sativa Japonica Group]
Length=334

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 82/121 (68%), Gaps = 10/121 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPL--SNGGSRMWTPGQSGTCSPAVAA  457
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+ +   N  SRM TPGQSGTCSPA+  
Sbjct  212  PDPAWLAGIQISSTSPSSPTFSLVSSNPFSVFKDAILVGNNSSRMCTPGQSGTCSPAIPG  271

Query  456  ALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSNT  295
             +    D+ M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DDLELTLG+S T
Sbjct  272  -MAPHPDIHMMDAVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  330

Query  294  R  292
            R
Sbjct  331  R  331



>ref|NP_001042330.1| Os01g0203000 [Oryza sativa Japonica Group]
 sp|Q0JPT4.1|BZR2_ORYSJ RecName: Full=Protein BZR1 homolog 2; Short=OsBZR2; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 2 [Oryza sativa 
Japonica Group]
 dbj|BAF04244.1| Os01g0203000, partial [Oryza sativa Japonica Group]
Length=365

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 82/121 (68%), Gaps = 10/121 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPL--SNGGSRMWTPGQSGTCSPAVAA  457
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+ +   N  SRM TPGQSGTCSPA+  
Sbjct  243  PDPAWLAGIQISSTSPSSPTFSLVSSNPFSVFKDAILVGNNSSRMCTPGQSGTCSPAIPG  302

Query  456  ALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSNT  295
             +    D+ M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DDLELTLG+S T
Sbjct  303  -MAPHPDIHMMDAVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  361

Query  294  R  292
            R
Sbjct  362  R  362



>dbj|BAB33003.1| unknown protein [Oryza sativa Japonica Group]
Length=354

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 82/121 (68%), Gaps = 10/121 (8%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPL--SNGGSRMWTPGQSGTCSPAVAA  457
            PD  WL+G+Q     PSSPTFSLVS NPF  FK+ +   N  SRM TPGQSGTCSPA+  
Sbjct  232  PDPAWLAGIQISSTSPSSPTFSLVSSNPFSVFKDAILVGNNSSRMCTPGQSGTCSPAIPG  291

Query  456  ALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSNT  295
             +    D+ M DA+  EFAFGS+      A G+V+ WEGERIHE+  +DDLELTLG+S T
Sbjct  292  -MAPHPDIHMMDAVSDEFAFGSSTNGGHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRT  350

Query  294  R  292
            R
Sbjct  351  R  351



>emb|CDM82126.1| unnamed protein product [Triticum aestivum]
Length=333

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 81/122 (66%), Gaps = 11/122 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGS-RMWTPGQSGTCSPAVAAA  454
            PD  WL+G+Q     PSSPTFSL+S NPF  FKE +  GGS RM TPGQSGTCSP V   
Sbjct  212  PDPAWLAGIQISSTSPSSPTFSLMSSNPFSVFKEAIPGGGSSRMCTPGQSGTCSP-VIPG  270

Query  453  LDRSADVPMSDAIQAEFAFGSNA--------MGIVKPWEGERIHEECITDDLELTLGNSN  298
            + R  DV M D +  EFAFGS+          G+V+ WEGERIHE+  +D+LELTLG+S 
Sbjct  271  MARHPDVHMMDVVSDEFAFGSSTNGGAQQATAGLVRAWEGERIHEDSGSDELELTLGSSR  330

Query  297  TR  292
            TR
Sbjct  331  TR  332



>ref|XP_003571150.2| PREDICTED: protein BZR1 homolog 3-like [Brachypodium distachyon]
Length=378

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 80/129 (62%), Gaps = 14/129 (11%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLV-SPNPF-GFKEPLSN---GGSRMWTPGQSGTCSPAV  463
            PD  WL+G Q    GPSSPT++L+ S NPF   +E  +    G SRM+TPGQSG CSP V
Sbjct  247  PDPAWLAGFQISSAGPSSPTYNLMASQNPFVAVREAAAAATAGSSRMYTPGQSGACSPVV  306

Query  462  AAA-LDRSADVPMSDAIQAE-FAFGSNAM-------GIVKPWEGERIHEECITDDLELTL  310
              A L    D  M+D   AE FAFG+          G++K WEGERIHEE  +D+LELTL
Sbjct  307  GGAGLVIRGDTHMADRAAAEDFAFGNGGGGGNGRVPGLLKAWEGERIHEESASDELELTL  366

Query  309  GNSNTR*GV  283
            GNS+TR G 
Sbjct  367  GNSSTRAGA  375



>ref|XP_010675300.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=286

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 8/98 (8%)
 Frame = -2

Query  561  LVSPN-PFG--FKEPLS-----NGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAE  406
            LVSP+ PFG  F E  +     +G SRM +P QSGTCSPA+ A  D +A++PM   I  E
Sbjct  184  LVSPHHPFGGFFTENATARGGGDGFSRMLSPLQSGTCSPAIPAGSDHTANIPMFGVICDE  243

Query  405  FAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            FAFGS+A G+VK WEGERIHEE  +DDL+LTLG+S TR
Sbjct  244  FAFGSSANGLVKAWEGERIHEEYGSDDLDLTLGSSMTR  281



>ref|XP_003565213.1| PREDICTED: protein BZR1 homolog 2 [Brachypodium distachyon]
Length=355

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 81/122 (66%), Gaps = 11/122 (9%)
 Frame = -2

Query  627  PDSGWLSGVQTPQDGPSSPTFSLVSPNPFG-FKEPLSNGGS---RMWTPGQSGTCSPAVA  460
            PD  WL+G+Q     PSSPTFSL+S NPF  FKE +   GS   RM TPGQSGTCSP V 
Sbjct  234  PDPAWLAGIQISSTSPSSPTFSLMSSNPFSVFKEAIPVPGSNSSRMCTPGQSGTCSP-VI  292

Query  459  AALDRSADVPMSDAIQAEFAFGSN------AMGIVKPWEGERIHEECITDDLELTLGNSN  298
              + R  DV M D +  EFAFGS+      A G+V+ WEGERIHE+  +D+LELTLG+S 
Sbjct  293  PGMARHPDVHMMDVVSDEFAFGSSSNDAQQAPGLVRAWEGERIHEDSGSDELELTLGSSR  352

Query  297  TR  292
            TR
Sbjct  353  TR  354



>ref|XP_006833072.1| PREDICTED: BES1/BZR1 homolog protein 4 [Amborella trichopoda]
 gb|ERM98350.1| hypothetical protein AMTR_s00170p00061300 [Amborella trichopoda]
Length=293

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 70/113 (62%), Gaps = 23/113 (20%)
 Frame = -2

Query  621  SGWLSGVQTPQDGPSSPTFSLVSP---NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            S WLSG++ P  GP SPTFSLVSP   NPFG           +W P  SGTCSP      
Sbjct  199  SDWLSGIRLPAGGPMSPTFSLVSPASSNPFG----------GLWAPAGSGTCSPCNV---  245

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              S DV M +A   EFAFG     +VKPW+GE+IH+EC +DDLELTLG+S TR
Sbjct  246  -ESGDVRMVEA-SDEFAFG-----VVKPWQGEKIHDECGSDDLELTLGSSRTR  291



>emb|CBI30731.3| unnamed protein product [Vitis vinifera]
Length=169

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = -2

Query  585  GPSSPTFSLVSPNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA  409
            GP+SPTFSLVS NPFGFKE  L+ GGSRMWTPGQSGTCSPAVAA  D +ADVPM+D I A
Sbjct  85   GPASPTFSLVSANPFGFKEEVLAGGGSRMWTPGQSGTCSPAVAAGSDHTADVPMADGIAA  144

Query  408  EFAFGS  391
            +   G+
Sbjct  145  DSPLGA  150



>gb|EMS49339.1| hypothetical protein TRIUR3_13720 [Triticum urartu]
Length=245

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 66/100 (66%), Gaps = 11/100 (11%)
 Frame = -2

Query  561  LVSPNPFG-FKEPLSNGGS-RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN  388
            L+S NPF  FKE +  GGS RM TPGQSGTCSP V   + R  DV M D +  EFAFGS+
Sbjct  146  LMSSNPFSVFKEAIPGGGSSRMCTPGQSGTCSP-VIPGMARHPDVHMMDVVSDEFAFGSS  204

Query  387  A--------MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                      G+V+ WEGERIHE+  +D+LELTLG+S TR
Sbjct  205  TNGGAQQATAGLVRAWEGERIHEDSGSDELELTLGSSRTR  244



>gb|EMT21245.1| hypothetical protein F775_32777 [Aegilops tauschii]
Length=335

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 75/127 (59%), Gaps = 22/127 (17%)
 Frame = -2

Query  609  SGVQTPQDGPSSPTF-----------SLVSPNPFG-FKEPLSNGGS-RMWTPGQSGTCSP  469
            S +Q P  G +SP             SL+S NPF  FKE +  GGS RM TPGQSGTCSP
Sbjct  209  SVIQPPWHGSNSPCVISSTSPSSPTFSLMSSNPFSVFKEAIPGGGSSRMCTPGQSGTCSP  268

Query  468  AVAAALDRSADVPMSDAIQAEFAFGSNA--------MGIVKPWEGERIHEECITDDLELT  313
             V   + R  DV M D +  EFAFGS+          G+V+ WEGERIHE+  +D+LELT
Sbjct  269  -VIPGMARHPDVHMMDVVSDEFAFGSSTNGGAQQATAGLVRAWEGERIHEDSGSDELELT  327

Query  312  LGNSNTR  292
            LG+S TR
Sbjct  328  LGSSRTR  334



>emb|CDY00299.1| BnaA06g22000D [Brassica napus]
Length=224

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 60/83 (72%), Gaps = 11/83 (13%)
 Frame = -2

Query  579  SSPTFSLVSPNPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAI  415
            S+PTFSLVS NPFGF+E         GGSRMWTPGQSGTCSPA+     ++ DVPMS+A+
Sbjct  103  STPTFSLVSRNPFGFREDQLASAGGGGGSRMWTPGQSGTCSPAIT----QTGDVPMSEAV  158

Query  414  Q--AEFAFGSNAMGIVKPWEGER  352
                EFAFGSNA G+ K WEGER
Sbjct  159  APPPEFAFGSNANGLAKAWEGER  181



>ref|NP_001172869.1| Os02g0233200 [Oryza sativa Japonica Group]
 dbj|BAD27718.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 dbj|BAH91598.1| Os02g0233200 [Oryza sativa Japonica Group]
Length=376

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 66/111 (59%), Gaps = 11/111 (10%)
 Frame = -2

Query  615  WLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSAD  436
            WL+G Q    GPSSPT+SLV+P P  F    +  GS       SG CSP          D
Sbjct  271  WLAGFQISSAGPSSPTYSLVAPPPNPFGAAAAAAGSSSRV--MSGACSPVAGG------D  322

Query  435  VPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            V M+DA + EFAFG       G+VK WEGERIHEEC +DDLELTLG+S TR
Sbjct  323  VQMADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLELTLGSSMTR  373



>sp|Q6EUF1.2|BZR4_ORYSJ RecName: Full=Protein BZR1 homolog 4; Short=OsBZR4; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 4 [Oryza sativa 
Japonica Group]
Length=351

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 66/111 (59%), Gaps = 11/111 (10%)
 Frame = -2

Query  615  WLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSAD  436
            WL+G Q    GPSSPT+SLV+P P  F    +  GS       SG CSP          D
Sbjct  246  WLAGFQISSAGPSSPTYSLVAPPPNPFGAAAAAAGSSSRV--MSGACSPVAGG------D  297

Query  435  VPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            V M+DA + EFAFG       G+VK WEGERIHEEC +DDLELTLG+S TR
Sbjct  298  VQMADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLELTLGSSMTR  348



>gb|EAY85121.1| hypothetical protein OsI_06471 [Oryza sativa Indica Group]
Length=377

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 67/114 (59%), Gaps = 16/114 (14%)
 Frame = -2

Query  615  WLSGVQTPQDGPSSPTFSLVSPNPFGFKEPLS---NGGSRMWTPGQSGTCSPAVAAALDR  445
            WL+G Q    GPSSPT+SLV+P P  F    +      SR+     SG CSP        
Sbjct  271  WLAGFQISSAGPSSPTYSLVAPPPNPFGAAAAAAAGSSSRV----MSGACSPVAGG----  322

Query  444  SADVPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              DV M+DA + EFAFG       G+VK WEGERIHEEC +DDLELTLG+S TR
Sbjct  323  --DVQMADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLELTLGSSMTR  374



>gb|ABK21940.1| unknown [Picea sitchensis]
Length=367

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 69/113 (61%), Gaps = 14/113 (12%)
 Frame = -2

Query  615  WLSGVQT---PQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDR  445
            W+ G++    P  GPSSPTF+L++P     +  L+  G R+WTPGQSG  SP    A + 
Sbjct  238  WMGGIRMMAFPSAGPSSPTFNLLTPAA-QLQHGLATEGGRLWTPGQSGVSSPCNNRAGEE  296

Query  444  SADVP-MSDAIQA--EFAFGSNAMGIVKPWEGERIHEEC----ITDDLELTLG  307
               +P   + + A  EFAFGS A   VKPW+GERIHEEC     +DDLELTLG
Sbjct  297  ERLLPPFQEGMDASDEFAFGSVA---VKPWQGERIHEECGGEIGSDDLELTLG  346



>gb|EAZ22344.1| hypothetical protein OsJ_05997 [Oryza sativa Japonica Group]
Length=246

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 3/54 (6%)
 Frame = -2

Query  444  SADVPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            S   PM+DA + EFAFG       G+VK WEGERIHEEC +DDLELTLG+S TR
Sbjct  190  SISAPMADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLELTLGSSMTR  243



>gb|ABR18463.1| unknown [Picea sitchensis]
Length=407

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 66/129 (51%), Gaps = 30/129 (23%)
 Frame = -2

Query  615  WLSGVQTPQD-----GPSSPTFSLVSPNPFGFKEPLSNGG----------SRMWTPGQSG  481
            WL GV+         GPSSPTFSL+SP     +   S GG          SR+WTP  S 
Sbjct  276  WLGGVRVSASASASMGPSSPTFSLLSP---AAQLEHSLGGERSHFFVPADSRLWTPVGSA  332

Query  480  TCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEEC------ITDDLE  319
              SP    A    A V ++ A + +F  GS     VKPW+GERIHEEC       +DDLE
Sbjct  333  MSSPCRTPATG-GAVVRVAAADEFQFECGS-----VKPWQGERIHEECGGDMDIASDDLE  386

Query  318  LTLGNSNTR  292
            LTLG+S  R
Sbjct  387  LTLGSSKRR  395



>ref|XP_011074507.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 isoform X2 [Sesamum 
indicum]
Length=328

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 45/97 (46%), Gaps = 33/97 (34%)
 Frame = -2

Query  582  PSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEF  403
            P+SPTF+LV P                              A L  S D P+      EF
Sbjct  264  PTSPTFNLVKP-----------------------------VAQLVPSKDAPVDKGKGTEF  294

Query  402  AFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             F + A   VKPWEGERIHE  + DDLELTLG+ NTR
Sbjct  295  DFENMA---VKPWEGERIHEVGM-DDLELTLGSGNTR  327



>ref|XP_011074506.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 isoform X1 [Sesamum 
indicum]
Length=329

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 45/97 (46%), Gaps = 33/97 (34%)
 Frame = -2

Query  582  PSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEF  403
            P+SPTF+LV P                              A L  S D P+      EF
Sbjct  265  PTSPTFNLVKP-----------------------------VAQLVPSKDAPVDKGKGTEF  295

Query  402  AFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             F + A   VKPWEGERIHE  + DDLELTLG+ NTR
Sbjct  296  DFENMA---VKPWEGERIHEVGM-DDLELTLGSGNTR  328



>ref|XP_002510347.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
 gb|EEF52534.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
Length=321

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = -2

Query  444  SADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            S++V   +    EF FG N  G VKPWEGERIHE  + DDLELTLGN   R
Sbjct  272  SSNVIKENGRSMEFEFG-NGNGQVKPWEGERIHEVGL-DDLELTLGNGKAR  320



>ref|XP_008440681.1| PREDICTED: BES1/BZR1 homolog protein 2 [Cucumis melo]
Length=319

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 51/113 (45%), Gaps = 21/113 (19%)
 Frame = -2

Query  624  DSGWLSGVQT--PQDGPSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAAL  451
            DSG     QT  P   P SPTF+L+   P   +  L +   R  T G   T         
Sbjct  225  DSGRWVSFQTVAPSVAPPSPTFNLM--KPVSQQNSLQDAVDRHGTMGWGATS--------  274

Query  450  DRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            DR+          +EF F     G VKPWEGERIHE  + DDLELTLG    R
Sbjct  275  DRTRG--------SEFEFEKFESGTVKPWEGERIHEVGV-DDLELTLGGGKAR  318



>gb|EPS60905.1| hypothetical protein M569_13896, partial [Genlisea aurea]
Length=325

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 56/113 (50%), Gaps = 24/113 (21%)
 Frame = -2

Query  624  DSGWLSGVQTPQDG-PSSPTFSLVSPNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALD  448
            DSG     QT  +  P+SPTF+L+ P             +R+  P  S         A+D
Sbjct  234  DSGQWINFQTYANAIPTSPTFNLIRPM------------ARVVLPSSSQE-----PMAID  276

Query  447  RSADVPMSDAIQAEFAFGSNAMGI-VKPWEGERIHEECITDDLELTLGNSNTR  292
              +    S     EF   +N+  + VKPWEGERIH+  + DDLELTLGN NTR
Sbjct  277  NDS----SKGKGKEFELDNNSSDLAVKPWEGERIHDVGM-DDLELTLGNGNTR  324



>ref|XP_002273547.1| PREDICTED: BES1/BZR1 homolog protein 2 [Vitis vinifera]
Length=316

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 53/115 (46%), Gaps = 29/115 (25%)
 Frame = -2

Query  624  DSGWLSGVQT--PQDGPSSPTFSLVSPNPFGFKEP--LSNGGSRMWTPGQSGTCSPAVAA  457
            DSG     QT  PQ  PSSPTF+LV P       P  +   G   W             A
Sbjct  226  DSGRWVSFQTVAPQAAPSSPTFNLVKPVAMECSIPNAVDEHGGLGW------------GA  273

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            A +R          + EF F S   G VK WEGERIHE  + D+LELTLG+  TR
Sbjct  274  AAERG---------RPEFEFES---GRVKAWEGERIHEVGV-DELELTLGSGKTR  315



>ref|XP_004143497.1| PREDICTED: BES1/BZR1 homolog protein 2 [Cucumis sativus]
 gb|KGN48804.1| hypothetical protein Csa_6G501930 [Cucumis sativus]
Length=319

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 50/115 (43%), Gaps = 25/115 (22%)
 Frame = -2

Query  624  DSGWLSGVQT--PQDGPSSPTFSLVSP--NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAA  457
            DSG     QT  P   P SPTF+L+ P       ++ +   G+  W             A
Sbjct  225  DSGRWVSFQTVAPSVAPPSPTFNLMKPVSQQNSLQDAVDRHGAMGW------------GA  272

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              DR           +EF F     G VKPWEGERIHE  + DDLELTLG    R
Sbjct  273  TSDRGRG--------SEFEFEKFESGTVKPWEGERIHEVGV-DDLELTLGGGKAR  318



>gb|EYU45114.1| hypothetical protein MIMGU_mgv1a009718mg [Erythranthe guttata]
Length=333

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = -2

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            A  +S D  MSD  + +  F   +M  VKPW+GE+IHE  + DDLELTLGN N R
Sbjct  281  AAAKSKDAIMSDKGKGKELFDFESMA-VKPWQGEKIHEMGV-DDLELTLGNGNNR  333



>ref|XP_002310201.1| hypothetical protein POPTR_0007s12370g [Populus trichocarpa]
 gb|ABK92480.1| unknown [Populus trichocarpa]
 gb|EEE90651.1| hypothetical protein POPTR_0007s12370g [Populus trichocarpa]
Length=317

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 54/115 (47%), Gaps = 28/115 (24%)
 Frame = -2

Query  624  DSG-WLSGVQ-TPQDGPSSPTFSLVSP--NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAA  457
            DSG W+S +   P   P SPTF+LV P     GF++ +   G   W             A
Sbjct  226  DSGRWVSFLAGAPHVAPPSPTFNLVKPVAQQSGFQDGVDRHGGLSW------------GA  273

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            A +R           AEF F +     VKPWEGERIHE  + DDLELTLG    R
Sbjct  274  AAERGRG--------AEFEFENCR---VKPWEGERIHEIGV-DDLELTLGGGKAR  316



>ref|XP_011083731.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 [Sesamum indicum]
Length=324

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 10/55 (18%)
 Frame = -2

Query  438  DVPMSDAIQA------EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +VP  DAI +      EF F + A   VKPWEGERIHE  + DDLELTLG+ NTR
Sbjct  274  EVPPKDAIMSDKGKGTEFDFENMA---VKPWEGERIHEVGM-DDLELTLGSGNTR  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 927830764608