BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1181

Length=922
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           486   3e-164   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       477   1e-160   Ipomoea batatas [batate]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             448   3e-149   Nicotiana tomentosiformis
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           444   7e-148   Nicotiana attenuata
dbj|BAF98438.1|  phenylalanine ammonia-lyase                            427   3e-147   Glehnia littoralis
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           442   5e-147   Nicotiana attenuata
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   442   7e-147   Ipomoea nil [qian niu]
gb|AAC33966.1|  phenylalanine ammonia-lyase                             435   1e-146   Capsicum chinense [bonnet pepper]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             441   2e-146   Nicotiana tomentosiformis
gb|AGT63063.1|  phenylalanine ammonia-lyase                             441   2e-146   Solanum tuberosum [potatoes]
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       441   2e-146   Ipomoea batatas [batate]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             441   3e-146   Nicotiana sylvestris
gb|AET41698.1|  phenylalanine ammonia-lyase                             426   6e-146   Prunus salicina [Japanese plum]
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        439   8e-146   
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             439   1e-145   Nicotiana sylvestris
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    439   2e-145   Solanum lycopersicum
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       438   2e-145   Nicotiana tabacum [American tobacco]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             438   3e-145   Solanum lycopersicum
dbj|BAF98439.1|  phenylalanine ammonia-lyase                            421   4e-145   Glehnia littoralis
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    437   9e-145   Capsicum annuum
gb|AFC37247.1|  phenylalanine ammonia-lyase                             422   1e-144   Camellia chekiangoleosa
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       436   1e-144   Nicotiana tabacum [American tobacco]
dbj|BAF98437.1|  phenylalanine ammonia-lyase                            418   7e-144   Glehnia littoralis
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    434   8e-144   Solanum tuberosum [potatoes]
emb|CDP06747.1|  unnamed protein product                                429   1e-143   Coffea canephora [robusta coffee]
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    434   1e-143   
dbj|BAA95629.1|  phenylalanine ammonia lyase                            434   1e-143   Catharanthus roseus [chatas]
gb|AIA66448.1|  PAL1                                                    433   2e-143   Capsicum annuum
gb|ACF94717.1|  phenylalanine ammonia lyase                             419   2e-143   Robinia pseudoacacia [black locust]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             432   3e-143   Scutellaria viscidula [zhan mao huang qin]
ref|XP_006367534.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      423   5e-143   
gb|AEY94464.1|  phenylalanine ammonia-lyase                             419   5e-143   Prunella vulgaris
dbj|BAF36975.1|  phenylalanine ammonia-lyase                            417   1e-142   Lotus japonicus
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        431   1e-142   Solanum tuberosum [potatoes]
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             430   2e-142   Sesamum indicum [beniseed]
gb|AIB08913.1|  phenylalanine ammonia-lyase                             412   4e-142   Angelica sinensis [Chinese angelica]
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           429   6e-142   Coffea canephora [robusta coffee]
gb|AGF50184.1|  phenylalanine ammonia lyase                             414   6e-142   Salvia virgata
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           429   7e-142   Coffea arabica [arabica coffee]
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        429   7e-142   Solanum tuberosum [potatoes]
emb|CDP20698.1|  unnamed protein product                                428   7e-142   Coffea canephora [robusta coffee]
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             429   1e-141   
gb|AFP24940.1|  phenylalanine ammonia lyase                             429   1e-141   Prunus salicina [Japanese plum]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           428   1e-141   
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     428   1e-141   Prunus avium [gean]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       428   2e-141   Camellia sinensis [black tea]
gb|AAU08174.1|  phenylalanine ammonia-lyase                             427   3e-141   Camellia sinensis [black tea]
sp|P35512.1|PALY_MALDO  RecName: Full=Phenylalanine ammonia-lyase       410   3e-141   Malus domestica [apple tree]
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           427   3e-141   Prunus mume [ume]
gb|AAK60273.1|AF383150_1  phenylalanine ammonia-lyase 3                 413   3e-141   Manihot esculenta [manioc]
ref|XP_003625662.1|  Phenylalanine ammonia-lyase                        419   4e-141   
gb|AFG30054.1|  phenylalanine ammonialyase                              427   4e-141   Malus hybrid cultivar
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            427   4e-141   Daucus carota [carrots]
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    427   4e-141   Solanum lycopersicum
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            427   5e-141   Daucus carota [carrots]
gb|AJW77399.1|  phenylalanine ammonia-lyase                             427   7e-141   Angelica sinensis [Chinese angelica]
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     426   8e-141   Petroselinum crispum
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             426   8e-141   Pyrus x bretschneideri [bai li]
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 426   9e-141   Pyrus x bretschneideri [bai li]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             427   9e-141   Morus alba
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            426   9e-141   Melissa officinalis [sweet balm]
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    426   1e-140   Pyrus x bretschneideri [bai li]
gb|AGF50183.1|  phenylalanine ammonia lyase                             410   1e-140   Salvia hypoleuca
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           426   2e-140   Scutellaria baicalensis [Baikal skullcap]
gb|ACF94715.1|  phenylalanine ammonia lyase                             412   2e-140   Robinia pseudoacacia [black locust]
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        426   2e-140   Cicer arietinum [garbanzo]
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           425   2e-140   
gb|AGL50914.1|  phenylalanine ammonia lyase                             425   3e-140   Pyrus communis
gb|ACF94716.1|  phenylalanine ammonia lyase                             425   3e-140   Robinia pseudoacacia [black locust]
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            424   4e-140   Lotus japonicus
emb|CAA34715.1|  unnamed protein product                                420   4e-140   Petroselinum crispum
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    425   4e-140   
ref|XP_003635685.1|  PREDICTED: phenylalanine ammonia-lyase             410   4e-140   Vitis vinifera
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        425   4e-140   Solanum tuberosum [potatoes]
gb|AGL81344.1|  phenylalanine ammonia lyase                             425   4e-140   Pyrus communis
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      424   5e-140   
dbj|BAF36973.1|  phenylalanine ammonia-lyase                            420   5e-140   Lotus japonicus
gb|AEA72280.1|  phenylalanine ammonia-lyase                             424   5e-140   Angelica gigas
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          424   5e-140   Populus euphratica
gb|ABB70117.2|  phenylalanine ammonia lyase                             424   6e-140   Pyrus communis
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             424   7e-140   Prunus persica
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        423   1e-139   Solanum tuberosum [potatoes]
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    424   1e-139   Solanum tuberosum [potatoes]
gb|AHY94892.1|  phenylalanine ammonia lyase                             423   1e-139   Prunella vulgaris
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             423   1e-139   Olea europaea
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             423   2e-139   Perilla frutescens [beefsteak-mint]
ref|XP_004253518.1|  PREDICTED: phenylalanine ammonia-lyase-like        419   2e-139   
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      423   2e-139   
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              423   2e-139   Ricinus communis
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   422   2e-139   Rehmannia glutinosa [Chinese foxglove]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       422   3e-139   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             422   3e-139   Sesamum indicum [beniseed]
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            422   3e-139   Lotus japonicus
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    421   8e-139   Petroselinum crispum
ref|XP_007162755.1|  hypothetical protein PHAVU_001G1777000g            404   9e-139   Phaseolus vulgaris [French bean]
gb|AGF50182.1|  phenylalanine ammonia lyase                             406   1e-138   Salvia officinalis
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     421   1e-138   Petroselinum crispum
gb|ABV44808.1|  phenylalanine ammonia lyase 1                           407   1e-138   Eriobotrya japonica [loquat]
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     421   1e-138   Solanum tuberosum [potatoes]
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   421   1e-138   Populus tremuloides
sp|P45735.1|PALY_VITVI  RecName: Full=Phenylalanine ammonia-lyase       410   1e-138   Vitis vinifera
gb|KHN17149.1|  Phenylalanine ammonia-lyase 2                           417   1e-138   Glycine soja [wild soybean]
gb|AAA34179.2|  phenylalanine ammonia lyase                             420   1e-138   Solanum lycopersicum
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    420   1e-138   Solanum lycopersicum
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             421   2e-138   Populus tomentosa [Chinese white poplar]
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       421   2e-138   Digitalis lanata [Grecian foxglove]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         420   2e-138   Populus trichocarpa [western balsam poplar]
ref|XP_006439143.1|  hypothetical protein CICLE_v10010874mg             406   2e-138   
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           420   2e-138   Manihot esculenta [manioc]
dbj|BAD94354.1|  phenylalanine ammonia lyase                            408   2e-138   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF36969.1|  phenylalanine ammonia-lyase                            410   2e-138   Lotus japonicus
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             419   4e-138   Gossypium arboreum [tree cotton]
emb|CAL91038.1|  phenylalanine ammonia-lyase 4                          406   6e-138   Cynara cardunculus var. scolymus [artichoke]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        419   7e-138   Medicago truncatula
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     418   1e-137   Daucus carota [carrots]
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                419   1e-137   Medicago truncatula
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             418   1e-137   Plectranthus scutellarioides
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            418   1e-137   Lotus japonicus
gb|KHN39030.1|  Phenylalanine ammonia-lyase class 2                     415   1e-137   Glycine soja [wild soybean]
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    418   1e-137   Glycine max [soybeans]
gb|KDO36715.1|  hypothetical protein CISIN_1g016039mg                   407   1e-137   Citrus sinensis [apfelsine]
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     418   2e-137   Petroselinum crispum
pir||JQ1070  phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  ...    408   2e-137
gb|AJO53273.1|  phenylalanine ammonia-lyase                             418   2e-137   Pogostemon cablin
gb|KHN00850.1|  Phenylalanine ammonia-lyase 2                           415   2e-137   Glycine soja [wild soybean]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   418   2e-137   Citrus sinensis [apfelsine]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             418   2e-137   Citrus clementina [clementine]
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             417   2e-137   Vitis vinifera
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             418   2e-137   
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                420   2e-137   Erythranthe guttata [common monkey flower]
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       418   2e-137   Medicago sativa [alfalfa]
gb|ABV71917.1|  PAL                                                     400   3e-137   Plectranthus scutellarioides
gb|ABD73282.1|  phenylalanine ammonia-lyase                             417   3e-137   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007027354.1|  PHE ammonia lyase 1                                417   3e-137   Theobroma cacao [chocolate]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      417   4e-137   
gb|KJB62426.1|  hypothetical protein B456_009G416300                    417   6e-137   Gossypium raimondii
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              416   6e-137   Ricinus communis
gb|KJB36583.1|  hypothetical protein B456_006G166000                    416   6e-137   Gossypium raimondii
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            415   7e-137   Lotus japonicus
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           416   8e-137   Prunus domestica
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       416   8e-137   Citrus limon [lemon]
gb|KJB73539.1|  hypothetical protein B456_011G238400                    416   8e-137   Gossypium raimondii
ref|XP_010107519.1|  Phenylalanine ammonia-lyase                        410   8e-137   
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            417   8e-137   Lotus japonicus
gb|AFN85669.1|  phenylalanine ammonia-lyase                             416   9e-137   Hibiscus cannabinus [bimli-jute]
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            415   1e-136   Lotus japonicus
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    416   1e-136   
gb|KJB46525.1|  hypothetical protein B456_007G373600                    415   2e-136   Gossypium raimondii
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 415   2e-136   Manihot esculenta [manioc]
gb|KJB46526.1|  hypothetical protein B456_007G373700                    414   2e-136   Gossypium raimondii
gb|AEX32790.1|  phenylalanine ammonia-lyase                             415   2e-136   Vitis vinifera
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        414   3e-136   Vitis vinifera
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   414   3e-136   Populus tremuloides
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        414   3e-136   Cicer arietinum [garbanzo]
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 415   4e-136   Rubus idaeus [European raspberry]
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         414   4e-136   Populus trichocarpa [western balsam poplar]
gb|AEX32784.1|  phenylalanine ammonia-lyase                             414   4e-136   Vitis vinifera
gb|AGA84059.1|  phenylalanine ammonia lyase                             414   4e-136   Picrorhiza kurrooa
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       414   5e-136   Populus trichocarpa [western balsam poplar]
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      414   5e-136   Cicer arietinum [garbanzo]
gb|AIY26016.1|  PAL                                                     414   6e-136   Jasminum sambac [Arabian jasmine]
gb|AID16077.1|  phenylalanine ammonium lyase                            414   6e-136   Morus alba
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       414   6e-136   Pisum sativum [garden pea]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             414   6e-136   Phaseolus vulgaris [French bean]
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             414   7e-136   Vitis vinifera
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    414   7e-136   
gb|AJO53274.1|  phenylalanine ammonia-lyase                             414   7e-136   Pogostemon cablin
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           413   8e-136   Scutellaria baicalensis [Baikal skullcap]
gb|AIB06732.1|  phenylalanine ammonia lyase                             413   9e-136   Mangifera indica
gb|AGY49231.1|  phenylalanine ammonia lyase                             413   9e-136   Ricinus communis
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    414   9e-136   
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        413   1e-135   Vitis vinifera
gb|ACC63889.1|  phenylalanine ammonia-lyase                             413   1e-135   Populus trichocarpa [western balsam poplar]
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             413   1e-135   Populus tomentosa [Chinese white poplar]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             413   1e-135   Populus szechuanica
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       413   1e-135   Pisum sativum [garden pea]
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             413   1e-135   Vitis vinifera
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             413   1e-135   Gossypium arboreum [tree cotton]
gb|ABM67591.1|  phenylalanin ammonia-lyase                              413   1e-135   Vitis vinifera
prf||2001451A  Phe ammonia lyase                                        413   1e-135
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             413   1e-135   Vitis vinifera
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        413   1e-135   Vitis vinifera
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      413   2e-135   Glycine max [soybeans]
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        412   2e-135   Vitis vinifera
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             412   2e-135   Capsella rubella
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                413   2e-135   Medicago truncatula
gb|ACA30407.1|  phenylalanine ammonia-lyase                             412   2e-135   Stylosanthes guianensis [stylo]
gb|KHN02334.1|  Phenylalanine ammonia-lyase 1                           409   2e-135   Glycine soja [wild soybean]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             412   2e-135   Gossypium arboreum [tree cotton]
gb|ADR78835.1|  phenylalanine ammonia lyase                             407   2e-135   Ziziphus jujuba [Chinese jujube]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             412   3e-135   Populus tomentosa [Chinese white poplar]
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      412   3e-135   Camelina sativa [gold-of-pleasure]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             412   3e-135   Euphorbia pulcherrima
gb|ACM44926.1|  phenylalanine ammonia-lyase                             412   3e-135   Euphorbia pulcherrima
gb|ABV44807.1|  phenylalanine ammonia lyase 2                           399   3e-135   Eriobotrya japonica [loquat]
gb|AAQ74878.1|  phenylalanine ammonia lyase                             412   3e-135   Populus trichocarpa x Populus deltoides
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   412   3e-135   Trifolium pratense [peavine clover]
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           413   3e-135   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           412   3e-135   Fragaria vesca subsp. vesca
gb|AEW43005.1|  phenylalanine ammonia lyase                             400   3e-135   Leucaena leucocephala [cassie]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             412   4e-135   Vitis vinifera
gb|AGE10589.1|  phenylalanine amononia-lyase                            412   4e-135   Lonicera japonica [Japanese honeysuckle]
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             412   5e-135   Gossypium arboreum [tree cotton]
emb|CAN77065.1|  hypothetical protein VITISV_009233                     411   5e-135   Vitis vinifera
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             412   5e-135   Eutrema salsugineum [saltwater cress]
gb|ABR14606.1|  phenylalanine ammonia-lyase                             411   6e-135   Salvia miltiorrhiza [Chinese salvia]
gb|AAZ29733.1|  phenylalanine ammonia lyase                             411   6e-135   Trifolium pratense [peavine clover]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         411   6e-135   Populus trichocarpa [western balsam poplar]
emb|CAN61378.1|  hypothetical protein VITISV_032212                     410   6e-135   Vitis vinifera
gb|KDO50672.1|  hypothetical protein CISIN_1g037382mg                   406   7e-135   Citrus sinensis [apfelsine]
gb|ACV30588.1|  phenylalanine ammonia-lyase                             395   7e-135   Carica papaya [mamon]
sp|Q40910.1|PAL4_POPKI  RecName: Full=Phenylalanine ammonia-lyase G4    406   7e-135   Populus sieboldii x Populus grandidentata
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        411   8e-135   Populus euphratica
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         411   8e-135   Populus trichocarpa [western balsam poplar]
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             411   8e-135   Populus tomentosa [Chinese white poplar]
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             410   9e-135   Vitis vinifera
gb|AEE81750.1|  phenylalanine ammonia lyase                             411   9e-135   Morus alba var. multicaulis
emb|CDY18464.1|  BnaA04g21230D                                          401   9e-135   Brassica napus [oilseed rape]
gb|AFU90757.1|  phenylalanine ammonia-lyase                             411   1e-134   Epimedium sagittatum
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            411   1e-134   Brassica oleracea var. botrytis [cauliflower]
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           410   1e-134   Camelina sativa [gold-of-pleasure]
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    410   1e-134   Phaseolus vulgaris [French bean]
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           410   1e-134   Glycine soja [wild soybean]
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      410   1e-134   
pir||S60043  phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanes...    406   1e-134
gb|AAC18870.1|  phenylalanine ammonia lyase                             410   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         410   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    410   1e-134   
gb|AIZ76770.1|  PAL2                                                    398   2e-134   Pyrus pyrifolia [sha li]
gb|AAX84839.1|  phenylalanine ammonia-lyase                             410   2e-134   Astragalus mongholicus
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      410   2e-134   Citrus sinensis [apfelsine]
gb|AIZ76768.1|  PAL2                                                    398   2e-134   Pyrus pyrifolia [sha li]
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   410   2e-134   Agastache rugosa
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             410   3e-134   Capsella rubella
dbj|BAM28965.1|  phenylalanine ammonia lyase                            395   3e-134   Lilium hybrid division I
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      409   4e-134   Brassica rapa
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    408   4e-134   Populus sieboldii x Populus grandidentata
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             409   4e-134   Citrus clementina [clementine]
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          409   4e-134   Cynara cardunculus var. scolymus [artichoke]
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        409   4e-134   Citrus sinensis [apfelsine]
emb|CAB42793.1|  phenylalanine-ammonia lyase                            409   4e-134   Citrus clementina x Citrus reticulata
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           409   4e-134   Camelina sativa [gold-of-pleasure]
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             409   4e-134   Citrus clementina [clementine]
gb|ACM62741.1|  phenylalanine ammonia-lyase                             409   5e-134   Garcinia mangostana [mangosteen]
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             409   5e-134   
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             409   5e-134   Nelumbo nucifera [Indian lotus]
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            409   5e-134   Populus sieboldii x Populus grandidentata
gb|ABD42947.1|  phenylalanine ammonia lyase                             409   6e-134   Acacia auriculiformis x Acacia mangium
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             409   6e-134   Gossypium arboreum [tree cotton]
gb|AGH13333.1|  phenylalanine ammonia-lyase                             409   6e-134   Rhus chinensis
gb|KJB16792.1|  hypothetical protein B456_002G248000                    409   6e-134   Gossypium raimondii
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      409   6e-134   Cucumis melo [Oriental melon]
dbj|BAH20339.1|  AT3G53260                                              404   6e-134   Arabidopsis thaliana [mouse-ear cress]
gb|AAY82485.1|  phenylalanine ammonia-lyase                             402   6e-134   Ulmus americana
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      409   7e-134   Camelina sativa [gold-of-pleasure]
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     409   7e-134   Glycine max [soybeans]
ref|XP_010107516.1|  Phenylalanine ammonia-lyase 1                      403   7e-134   
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           408   9e-134   Populus tomentosa [Chinese white poplar]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          409   9e-134   Vitis vinifera
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      408   9e-134   
gb|AER12109.1|  PAL                                                     408   1e-133   Gossypium hirsutum [American cotton]
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             408   1e-133   
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 408   1e-133   Pyrus x bretschneideri [bai li]
prf||2006271A  Phe ammonia lyase                                        408   1e-133
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            408   1e-133   Vigna radiata [mung bean]
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       408   2e-133   Trifolium subterraneum
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             409   2e-133   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           407   2e-133   Malus domestica [apple tree]
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            407   2e-133   Gynura bicolor
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             407   2e-133   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        407   2e-133   Medicago truncatula
ref|XP_012082374.1|  PREDICTED: phenylalanine ammonia-lyase             407   2e-133   Jatropha curcas
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             407   2e-133   Astragalus membranaceus
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             407   2e-133   Nelumbo nucifera [Indian lotus]
gb|ABC69916.1|  phenylalanine ammonia-lyase                             407   3e-133   Brassica napus [oilseed rape]
gb|AFQ92048.1|  phenylalanine ammonia-lyase                             390   3e-133   Pyrus pyrifolia [sha li]
gb|ABF50788.1|  phenylalanine ammonia-lyase                             407   3e-133   Isatis tinctoria [woad]
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           407   3e-133   Brassica rapa
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             407   3e-133   Populus euphratica
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             407   3e-133   
gb|ACT32033.1|  phenylalanine ammonia-lyase                             407   3e-133   
gb|AAZ29732.1|  phenylalanine ammonia lyase                             407   3e-133   
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    407   4e-133   
gb|ABN79671.2|  phenylalanine ammonia-lyase                             407   4e-133   
gb|AAX22053.1|  phenylalanine ammonia-lyase                             407   5e-133   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            407   5e-133   
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       401   5e-133   
gb|AAR31107.1|  phenylalanine ammonia-lyase                             406   5e-133   
gb|AAX22055.1|  phenylalanine ammonia-lyase                             406   5e-133   
sp|P07218.2|PAL1_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    399   6e-133   
pir||A24727  phenylalanine ammonia-lyase (EC 4.3.1.5) - kidney be...    399   6e-133
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    406   6e-133   
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      406   7e-133   
ref|XP_011658466.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      401   7e-133   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    405   8e-133   
gb|AIZ76769.1|  PAL2                                                    399   1e-132   
gb|AAM12956.1|  phenylalanine ammonia-lyase                             405   1e-132   
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           405   1e-132   
gb|AKA60049.1|  phenylalanine ammonia-lyase                             405   1e-132   
gb|AAC18871.1|  phenylalanine ammonia lyase                             405   1e-132   
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         405   1e-132   
gb|AAZ29734.1|  phenylalanine ammonia lyase                             405   1e-132   
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           405   1e-132   
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             405   1e-132   
gb|ADO64252.1|  PAL                                                     405   2e-132   
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     405   2e-132   
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                405   2e-132   
gb|AAZ29735.1|  phenylalanine ammonia lyase                             405   2e-132   
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        405   2e-132   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    405   2e-132   
gb|AAN32867.1|AF460204_1  phenylalanine ammonia-lyase 2                 402   2e-132   
gb|KGN52971.1|  hypothetical protein Csa_4G008250                       389   2e-132   
gb|ADA81868.1|  phenylalanine ammonia-lyase                             405   2e-132   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      404   3e-132   
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      405   3e-132   
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    404   3e-132   
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    404   3e-132   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             404   4e-132   
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   404   4e-132   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             401   5e-132   
gb|ACR15762.1|  phenylalanine ammonia-lyase                             404   5e-132   
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1           404   5e-132   
gb|ADY02660.1|  phenylalanine ammonia lyase                             403   6e-132   
gb|AAY82486.1|  phenylalanine ammonia-lyase                             400   6e-132   
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   404   7e-132   
gb|AIZ76767.1|  PAL2                                                    399   7e-132   
gb|ACZ36441.1|  phenylalanine ammonialyase                              403   7e-132   
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             403   8e-132   
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        405   8e-132   
gb|ABE03772.1|  phenylalanine ammonia-lyase                             403   8e-132   
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        403   9e-132   
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         403   1e-131   
ref|XP_012082376.1|  PREDICTED: phenylalanine ammonia-lyase-like        403   1e-131   
gb|ABC69917.1|  phenylalanine ammonia-lyase                             402   2e-131   
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        402   2e-131   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             402   2e-131   
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             402   2e-131   
gb|ADY02661.1|  phenylalanine ammonia lyase                             401   2e-131   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             402   2e-131   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             401   2e-131   
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             402   3e-131   
gb|AEH02821.1|  phenylalanine ammonia lyase                             402   3e-131   
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    402   3e-131   
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      402   3e-131   
gb|AAM28276.1|  phenylalanine ammonia-lyase                             387   4e-131   
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         401   5e-131   
gb|AGU91428.1|  phenylalanine ammonia-lyase                             401   5e-131   
gb|ADD82537.1|  phenylalanine ammonia-lyase                             397   5e-131   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           401   6e-131   
sp|P45727.1|PALY_PERAE  RecName: Full=Phenylalanine ammonia-lyase       398   6e-131   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           401   7e-131   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             401   7e-131   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           400   1e-130   
gb|AEJ88223.1|  phenylalanine ammonia lyase                             400   1e-130   
gb|AFP49806.1|  phenylalanine ammonialyase 1                            400   1e-130   
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 400   1e-130   
gb|AAD45384.1|  phenylalanine ammonia-lyase                             398   1e-130   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             401   1e-130   
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    401   2e-130   
gb|ADY02662.1|  phenylalanine ammonia lyase                             399   2e-130   
gb|ADD12041.1|  phenylalanine ammonia lyase                             400   2e-130   
ref|XP_007016787.1|  PHE ammonia lyase 1                                400   2e-130   
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             399   2e-130   
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          399   2e-130   
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           400   2e-130   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             398   5e-130   
gb|AIA24411.1|  phenylalanine ammonia-lyase                             398   6e-130   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            399   6e-130   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            398   7e-130   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             398   8e-130   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             397   1e-129   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        397   1e-129   
gb|ACG56648.1|  phenylalanine ammonia lyase                             397   1e-129   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            397   1e-129   
gb|AGV54597.1|  phenylalanine ammonia-lyase                             397   2e-129   
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           397   2e-129   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              397   2e-129   
gb|ACT21093.1|  phenylalanine ammonia-lyase                             397   2e-129   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       396   2e-129   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            397   3e-129   
gb|ACG56647.1|  phenylalanine ammonia lyase                             396   3e-129   
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    396   4e-129   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             396   6e-129   
ref|XP_012093279.1|  PREDICTED: phenylalanine ammonia-lyase G2B         395   7e-129   
gb|AGE10605.1|  phenylalanine amononia-lyase                            380   1e-128   
gb|AIL23235.1|  phenylalanine ammonia-lyase                             395   1e-128   
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             395   1e-128   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             395   1e-128   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        394   2e-128   
gb|AGE10591.1|  phenylalanine amononia-lyase                            394   2e-128   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             394   3e-128   
gb|AGC23439.1|  phenylalanine ammonia-lyase                             394   3e-128   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          394   3e-128   
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    393   5e-128   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             393   9e-128   
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    392   1e-127   
gb|AIC66437.1|  phenylalanine ammonia lyase                             392   2e-127   
gb|ACG80829.1|  phenylalanine ammonia lyase                             387   2e-127   
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        391   3e-127   
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      392   3e-127   
gb|ACG80828.1|  phenylalanine ammonia lyase                             387   4e-127   
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           391   4e-127   
gb|AID69536.1|  phenylalanine ammonia-lyase                             385   4e-127   
gb|AFS28702.1|  putative phenylalanine ammonia-lyase                    385   4e-127   
gb|AAW78932.1|  phenylalanine-ammonia lyase                             391   5e-127   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        390   7e-127   
gb|KGN48165.1|  hypothetical protein Csa_6G445780                       380   7e-127   
gb|AFP49807.1|  phenylalanine ammonialyase 4                            390   1e-126   
ref|XP_011657651.1|  PREDICTED: phenylalanine ammonia-lyase             389   2e-126   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        389   2e-126   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        389   2e-126   
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        389   3e-126   
gb|AIE16710.1|  phenylalanine ammonia-lyase                             371   6e-126   
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        388   6e-126   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        387   2e-125   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            386   3e-125   
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        386   3e-125   
gb|AGE10617.1|  phenylalanine amononia-lyase                            382   3e-125   
gb|AIE16718.1|  phenylalanine ammonia-lyase                             369   4e-125   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        386   4e-125   
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             386   4e-125   
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        385   4e-125   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            385   5e-125   
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            385   5e-125   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             385   6e-125   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             385   8e-125   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        385   8e-125   
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     385   9e-125   
ref|XP_004143356.2|  PREDICTED: phenylalanine ammonia-lyase-like        385   1e-124   
gb|AJO53272.1|  phenylalanine ammonia-lyase                             385   1e-124   
gb|AAV98199.1|  phenylalanine ammonialyase 1                            385   1e-124   
gb|AEC11891.1|  PAL1                                                    385   1e-124   
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           384   2e-124   
dbj|BAM05604.1|  phenylalanine ammonia lyase                            374   3e-124   
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           384   3e-124   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        383   4e-124   
gb|AHF20178.1|  phenylalanine ammonia lyase                             380   5e-124   
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           383   5e-124   
ref|XP_011658467.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      380   6e-124   
gb|AJT59582.1|  phenylalanine ammonia lyase                             383   9e-124   
dbj|BAB19128.1|  phenylalanine ammonia-lyase                            379   1e-123   
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    382   1e-123   
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        382   1e-123   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           382   1e-123   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             382   1e-123   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           382   1e-123   
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     382   1e-123   
gb|AGE10590.1|  phenylalanine amononia-lyase                            382   2e-123   
emb|CDY08611.1|  BnaA05g28470D                                          381   2e-123   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             381   3e-123   
emb|CAA53733.1|  phenylanaline ammonia-lyase                            377   6e-123   
gb|AGZ95690.1|  phenylalanine ammonia-lyase                             380   6e-123   
gb|AAS48415.1|  phenylalanine lyase                                     380   6e-123   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             380   8e-123   
gb|AHA42443.1|  phenylalanine ammonia lyase                             380   9e-123   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             379   1e-122   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             379   1e-122   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           380   1e-122   
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 379   1e-122   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             379   2e-122   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           379   2e-122   
emb|CDY00922.1|  BnaC05g42780D                                          379   2e-122   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        379   2e-122   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        378   6e-122   
dbj|BAC10907.1|  phenylalanine ammonia-lyase 1                          365   8e-122   
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           377   8e-122   
gb|ACX31148.1|  phenylalanine ammonialyase                              374   2e-121   
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            377   2e-121   
gb|ACT22906.1|  phenylalanine ammonia-lyase                             372   2e-121   
gb|ADT63058.1|  phenylalanine ammonia-lyase                             376   2e-121   
ref|XP_009421282.1|  PREDICTED: phenylalanine ammonia-lyase-like        376   3e-121   
emb|CDX74991.1|  BnaA05g07370D                                          364   6e-121   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             375   6e-121   
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    374   8e-121   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         374   9e-121   
gb|AAD47085.1|AF167487_1  phenylalanine ammonia lyase                   364   1e-120   
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    374   1e-120   
dbj|BAF93189.1|  putative phenylalanine ammonia-lyase                   368   1e-120   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      374   1e-120   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             374   2e-120   
gb|ADO24189.1|  phenylalanine ammonia-lyase                             374   2e-120   
emb|CAA68064.1|  phenylalanine ammonia-lyase                            361   3e-120   
gb|AER58180.1|  phenylalanine ammonia lyase                             373   3e-120   
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    373   3e-120   
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             373   5e-120   
gb|AII00960.1|  phenylalanine ammonia lyase                             362   6e-120   
emb|CDX91331.1|  BnaC04g08190D                                          361   8e-120   
ref|XP_002862326.1|  predicted protein                                  355   1e-119   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           372   1e-119   
dbj|BAJ85028.1|  predicted protein                                      369   2e-119   
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        371   2e-119   
gb|AEW25950.1|  phenylalanine ammonia-lyase                             360   4e-119   
ref|XP_003580144.1|  PREDICTED: phenylalanine ammonia-lyase             370   4e-119   
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase G4          369   9e-119   
gb|EMS57329.1|  Phenylalanine ammonia-lyase                             360   1e-118   
emb|CAA89005.1|  phenylalanine ammonia-lyase                            362   1e-118   
gb|EMT29668.1|  Phenylalanine ammonia-lyase                             367   2e-118   
gb|EMT29669.1|  Phenylalanine ammonia-lyase                             365   2e-118   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             368   3e-118   
gb|ADB97626.1|  phenylalanine ammonia-lyase                             368   4e-118   



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   486 bits (1251),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 233/240 (97%), Positives = 235/240 (98%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV VLKLMSST+LVALCQAIDLRHLEENLRNAV
Sbjct  468  TNHVQSAEQHNQDVNSLGLISARKTAEAVDVLKLMSSTFLVALCQAIDLRHLEENLRNAV  527

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCS NYPLMQKLRQV
Sbjct  528  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLMQKLRQV  587

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR
Sbjct  588  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  647

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREELGTE+LTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC
Sbjct  648  SYPLYKFIREELGTEMLTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  707



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   477 bits (1228),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 235/240 (98%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV VLKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  469  TNHVQSAEQHNQDVNSLGLISARKTAEAVDVLKLMSSTYLVALCQAIDLRHLEENLKNAV  528

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            +NTV+QVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPL QKLRQV
Sbjct  529  RNTVNQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLFQKLRQV  588

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNGEHEKNVSTSIFQKIAAFEDELKA+LPKEVEGARSA+ENGNPAIPNRITECR
Sbjct  589  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKAVLPKEVEGARSAIENGNPAIPNRITECR  648

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEKV+SPGEVCDKVFTAVCDGGIIDPLLECLKSW+GAPLPIC
Sbjct  649  SYPLYKFVREELGTEMLTGEKVKSPGEVCDKVFTAVCDGGIIDPLLECLKSWDGAPLPIC  708



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   448 bits (1152),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 208/240 (87%), Positives = 228/240 (95%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  476  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLR+VDREY+FAYADDPCS NYPLMQKLRQV
Sbjct  536  KNTVSQVAKRTLTMGANGELHPARFCEKELLRIVDREYLFAYADDPCSCNYPLMQKLRQV  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAIPNRITECR
Sbjct  596  LVDHAMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALESGNPAIPNRITECR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+R+ELGTE+LTGEKV+SPGE CDKVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  656  SYPLYRFVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  715



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   444 bits (1143),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 228/240 (95%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  478  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLMQKLRQV
Sbjct  538  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI NRITECR
Sbjct  598  LVDHAMKNGESEKNVNSSIFQKIGAFEDELKAVLPKEVENARAALESGNPAIANRITECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+R+ELGTE+LTGE+V+SPGE CDKVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  658  SYPLYRFVRKELGTELLTGERVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>dbj|BAF98438.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   427 bits (1098),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  28   TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  87

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ 
Sbjct  88   KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRET  147

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+ALE+GNPAIPNRI ECR
Sbjct  148  LVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAALESGNPAIPNRIKECR  207

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE LTGEKV+SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  208  SYPLYKFVREELGTEYLTGEKVRSPGEEFDKVFTAMSRGEIIDPLLECLESWNGAPLPIC  267



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   442 bits (1137),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 211/240 (88%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRNAV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR ALE+GNPAI NRI ECR
Sbjct  593  LVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARIALESGNPAIANRIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  653  SYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   442 bits (1136),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 210/240 (88%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV VLKLMSSTYLVALCQAIDLR LEENLRNAV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVDVLKLMSSTYLVALCQAIDLRFLEENLRNAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN V+QVAKRTLTMG NGELHP+RFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQ 
Sbjct  532  KNAVTQVAKRTLTMGANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQA  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNGE EKN  TSIF K+AAFEDELKA+LPKEVE AR A+E+GNPAIPNRI ECR
Sbjct  592  LVDHALQNGESEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G IIDPLLECLKSW+GAPLPIC
Sbjct  652  SYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  711



>gb|AAC33966.1| phenylalanine ammonia-lyase [Capsicum chinense]
Length=532

 Score =   435 bits (1119),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  293  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  352

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+ YPLMQKLRQV
Sbjct  353  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLMQKLRQV  412

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPNRITECR
Sbjct  413  LVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECR  472

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G +IDPLLECLKSWNGAPLPIC
Sbjct  473  SYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQVIDPLLECLKSWNGAPLPIC  532



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   441 bits (1134),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 210/240 (88%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRNAV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTMGTNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI NRI ECR
Sbjct  593  LVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  653  SYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   441 bits (1134),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRNAV
Sbjct  483  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  542

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS+ YPLMQKLRQV
Sbjct  543  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQV  602

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ LE+GNP+IPNRITECR
Sbjct  603  LVDHAMNNGESEKNVNSSIFQKIVAFEDELKAMLPKEVESARAVLESGNPSIPNRITECR  662

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYK +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECL+SWNGAPLPIC
Sbjct  663  SYPLYKLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLQSWNGAPLPIC  722



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   441 bits (1133),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 209/240 (87%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV VLKLMSSTYLVALCQAIDLR LEENLRNAV
Sbjct  468  TNHVQSAEQHNQDVNSLGLISARKTAEAVDVLKLMSSTYLVALCQAIDLRFLEENLRNAV  527

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN V+QVAKRTLT+G NGELHP+RFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQ 
Sbjct  528  KNAVTQVAKRTLTVGANGELHPARFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQA  587

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNGE+EKN  TSIF K+AAFEDELKA+LPKEVE AR A+E+GNPAIPNRI ECR
Sbjct  588  LVDHALQNGENEKNTGTSIFLKVAAFEDELKAVLPKEVEAARIAVESGNPAIPNRIKECR  647

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGTE+LTGEKV+SPGE CDKVFTA+C+G IIDPLLECLKSW+GAPLPIC
Sbjct  648  SYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPIC  707



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   441 bits (1133),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 226/240 (94%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  478  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS NYPLMQKLRQV
Sbjct  538  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSCNYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA+ NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ALE GNPAI NRITECR
Sbjct  598  LVDHAMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALECGNPAIANRITECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+R+ELGTE+LTGE+V+SPGE C+KVFTA+C+G IIDP+LECLKSWNGAPLPIC
Sbjct  658  SYPLYRFVRKELGTELLTGERVRSPGEECEKVFTAMCNGQIIDPMLECLKSWNGAPLPIC  717



>gb|AET41698.1| phenylalanine ammonia-lyase [Prunus salicina]
Length=317

 Score =   426 bits (1094),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENLRN V
Sbjct  78   TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  137

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  138  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  197

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECR
Sbjct  198  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  257

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNGAPLPIC
Sbjct  258  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPIC  317



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   439 bits (1130),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 226/240 (94%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLR+AV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRSAV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS+ YPLMQKLRQV
Sbjct  542  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECR
Sbjct  602  LVDHAMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  662  SYPLYRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   439 bits (1128),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/240 (87%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRNAV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NGE+EKN ++SIFQKI AFE ELKA+LPKEVE AR +LENGNPAI NRI ECR
Sbjct  593  LVDHALENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  653  SYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   439 bits (1128),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLR+AV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRSAV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREYVFAYADDPCS+ YPLMQKLRQV
Sbjct  542  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYVFAYADDPCSSTYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++NGE EKNV++SIFQKI AFEDELKA LPKEVE AR+ +E+GNPAIPNRITECR
Sbjct  602  LVDHAMKNGESEKNVNSSIFQKIVAFEDELKAALPKEVESARAVVESGNPAIPNRITECR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELG+E+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  662  SYPLYRLVRQELGSELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  721



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   438 bits (1126),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/240 (87%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSL LISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRNAV
Sbjct  473  TNHVQSAEQHNQDVNSLDLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAYADD CSANYPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTMGTNGELHPSRFCEKDLLRVVDREYVFAYADDACSANYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNGE+EKN ++SIFQKI AFEDELKA+LPKEVE AR+ALE+GNPAI NRI ECR
Sbjct  593  LVDHALQNGENEKNANSSIFQKILAFEDELKAVLPKEVESARAALESGNPAIANRIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+R ELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  653  SYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRNAV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTV QVAKRTLTMG NGELHPSRFCEKDLLR+VDREY+FAYADDPCSANYPLMQKLRQV
Sbjct  532  KNTVCQVAKRTLTMGANGELHPSRFCEKDLLRIVDREYLFAYADDPCSANYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HALQNGE+EKN S+SIFQKI AFE+ELK++LP+EVE AR ALE+GNPAI NRI ECR
Sbjct  592  LVEHALQNGENEKNASSSIFQKIVAFEEELKSVLPREVESARVALESGNPAIANRINECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGE+V+SPGE CDKVFTA+C+G IID LLECLK WNGAPLP+C
Sbjct  652  SYPLYKFVREELGTELLTGERVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPVC  711



>dbj|BAF98439.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   421 bits (1083),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  28   TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  87

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ 
Sbjct  88   KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  147

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECR
Sbjct  148  LVEHALTNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  207

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REEL T+ LTGEKV+SPGE  DKVFTA+  G IIDPLL CL+SWNGAPLPIC
Sbjct  208  SYPLYKFVREELATDYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPIC  267



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   437 bits (1123),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+ YPLMQKLRQV
Sbjct  538  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSTYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPNRITECR
Sbjct  598  LVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  658  SYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>gb|AFC37247.1| phenylalanine ammonia-lyase [Camellia chekiangoleosa]
Length=308

 Score =   422 bits (1085),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLEENLRN V
Sbjct  69   TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRHLEENLRNTV  128

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN+VSQVAKRTLTMGVNGELHPSRFCEK+LLRVVDRE+VF Y DDPCSA YPLMQKLRQV
Sbjct  129  KNSVSQVAKRTLTMGVNGELHPSRFCEKELLRVVDREHVFEYIDDPCSATYPLMQKLRQV  188

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NG+ EKNVSTSIFQKI AFE+EL ALLPKEVE AR A+E+GNP IPNRI ECR
Sbjct  189  LVEHALKNGDAEKNVSTSIFQKIRAFEEELMALLPKEVESARRAVESGNPGIPNRIKECR  248

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT  LTGEK  SPGE  DKVFTA+C+G +IDPLL+CLKSWNGAPLPIC
Sbjct  249  SYPLYKFVREELGTGFLTGEKALSPGEEFDKVFTAMCEGQVIDPLLDCLKSWNGAPLPIC  308



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   436 bits (1121),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 208/240 (87%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRNAV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVF YADD CSANYPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFRYADDACSANYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NGE+EKN ++SIFQKI AFE ELKA+LPKEVE AR +LENGNPAI NRI ECR
Sbjct  593  LVDHALENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG E+LTGEKV+SPGE CDKVFTA+C+G IID LLECLK WNGAPLPIC
Sbjct  653  SYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPIC  712



>dbj|BAF98437.1| phenylalanine ammonia-lyase [Glehnia littoralis]
Length=267

 Score =   418 bits (1075),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 216/239 (90%), Gaps = 0/239 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGL+S+RKT EAV +LKLMS+T+L  L QA+DLRHLEENL++ V
Sbjct  28   TNHVQSAEQHNQDVNSLGLVSSRKTAEAVEILKLMSTTFLAGLLQAVDLRHLEENLKSTV  87

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQV
Sbjct  88   KNTVSQVAKKVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQV  147

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE EKN+STSIFQKIAAFEDELK LLPKEVE AR+ LE+GNPA+PNRI ECR
Sbjct  148  LVEHALKNGETEKNLSTSIFQKIAAFEDELKTLLPKEVESARAVLESGNPAVPNRIKECR  207

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            SYPLYKFIREELGT  LTGEKV SPGE  DKVFTA+C G IIDPL+ECL+SWNGAPLPI
Sbjct  208  SYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMCKGQIIDPLMECLQSWNGAPLPI  266



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   434 bits (1117),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRNAV
Sbjct  484  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  543

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFC+K+LL+VVD+EY+FAY DDPC++NYPLMQKLRQV
Sbjct  544  KNTVSQVAKRTLTMGANGELHPARFCKKELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQV  603

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA+ NGE EKNV++SIFQKI AFEDELK +LPKEVE AR  +E+GNPAIPNRITECR
Sbjct  604  LVDHAMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPNRITECR  663

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  664  SYPLYRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  723



>emb|CDP06747.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   429 bits (1102),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLR LEENL+NAV
Sbjct  318  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRFLEENLKNAV  377

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLTMG NGELHPSRFC+KDLLRVVDREY FAY DDPCSA YPLMQKLRQV
Sbjct  378  KNIVSQVAKRTLTMGANGELHPSRFCDKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQV  437

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPNRI ECR
Sbjct  438  LVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECR  497

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGTE+L+GEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  498  SYPLYKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  557



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRNAV
Sbjct  480  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAV  539

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFC+K+LL+VVD+EY+FAY DDPC++NYPLMQKLRQV
Sbjct  540  KNTVSQVAKRTLTMGANGELHPARFCKKELLQVVDKEYLFAYVDDPCNSNYPLMQKLRQV  599

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA+ NGE EKNV++SIFQKI AFEDELK +LPKEVE AR  +E+GNPAIPNRITECR
Sbjct  600  LVDHAMNNGESEKNVNSSIFQKIVAFEDELKVVLPKEVESARVVVESGNPAIPNRITECR  659

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  660  SYPLYRLVREELGTEVLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  719



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  477  TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTYLVALCQAIDLRHLEENLKNAV  536

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT+GVNGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLM+KLRQV
Sbjct  537  KNTVSQVAKRTLTVGVNGELHPSRFCEKDLIRVVDREYVFAYVDDPCSGTYPLMEKLRQV  596

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHALQNGE EKNV+TSIFQKIAAFEDELK +LPKEVE AR+ALENGNPAIPNRI ECR
Sbjct  597  IVDHALQNGESEKNVNTSIFQKIAAFEDELKTVLPKEVESARTALENGNPAIPNRIKECR  656

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE++G E LTGEK +SPGE  DKVFTA+C+  IIDPLLECLK WNGAPLPIC
Sbjct  657  SYPLYKFVREDVGAEFLTGEKDRSPGEEFDKVFTAMCNEKIIDPLLECLKEWNGAPLPIC  716



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADD CS+ YPLMQKLRQV
Sbjct  538  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDTCSSTYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKNV++SIFQKIAAFEDELKA+LPKEVE AR  LE+GNP+IPNRITECR
Sbjct  598  LVDHALNNGESEKNVNSSIFQKIAAFEDELKAVLPKEVESARITLESGNPSIPNRITECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  658  SYPLYRLVRKELGTELLTGERVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  717



>gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=311

 Score =   419 bits (1077),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+++ 
Sbjct  72   TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKSSA  131

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQKLRQV
Sbjct  132  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQV  191

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EKN++TSIFQKIA FE+ELKALLPKEVE AR+A E+GN AIPN+I ECR
Sbjct  192  LVDHALVNGENEKNLNTSIFQKIATFEEELKALLPKEVESARAAYESGNAAIPNKINECR  251

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  252  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  311



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQA+DLRHLEENLR AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAVDLRHLEENLRLAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCSANYPLMQKLRQV
Sbjct  532  KNTVSQLAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NGE+EKN STSIFQKI AFE+ELKALLPKEVE AR ALE GNPA+PNRITECR
Sbjct  592  LVDHALKNGENEKNASTSIFQKIEAFEEELKALLPKEVESARMALEAGNPAVPNRITECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREE GTE LTGEKV SPGE CDKVFTA+ +G IID LL CL++WNGAPLPIC
Sbjct  652  SYPLYKFIREEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDSLLTCLEAWNGAPLPIC  711



>ref|XP_006367534.1| PREDICTED: phenylalanine ammonia-lyase 1-like, partial [Solanum 
tuberosum]
Length=441

 Score =   423 bits (1087),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL++ V
Sbjct  202  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKSVV  261

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT+G  GELHP+RFCEK+LLRVVDREY+F YADDPCS+ YPLMQKLRQV
Sbjct  262  KNTVSQVAKRTLTIGAIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLMQKLRQV  321

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++NGE EKN+++SIFQKI AFEDEL A+LPKEVE AR+ LE+GNP+IPNRITECR
Sbjct  322  LVDHAMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECR  381

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  382  SYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  441



>gb|AEY94464.1| phenylalanine ammonia-lyase, partial [Prunella vulgaris]
Length=349

 Score =   419 bits (1078),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLEENL+ AV
Sbjct  110  TNHVQSAEQHNQDVNSLGLISSRKTVEAMDILKLMSSTYLVALCQAIDLRHLEENLKLAV  169

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEK+L+RVVDREYVFAYADDPCSA YPLMQKLRQV
Sbjct  170  KNTVSQVAKRTLTMGANGELHPSRFCEKELIRVVDREYVFAYADDPCSATYPLMQKLRQV  229

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G PA+ NRI ECR
Sbjct  230  LVDHALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVANRIAECR  289

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIRE LGT  LTGEK  SPGE CDKVFTA+CDG I+DPLLECL+ WNG PLPIC
Sbjct  290  SYPLYKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNGEPLPIC  349



>dbj|BAF36975.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=311

 Score =   417 bits (1072),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+ +V
Sbjct  72   TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKYSV  131

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLMQKLRQV
Sbjct  132  KSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQV  191

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPA+PN+I ECR
Sbjct  192  LVDHALVNGEYEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAMPNKINECR  251

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+R+ELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  252  SYPLYKFVRKELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  311



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   431 bits (1109),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL++AV
Sbjct  484  TNHVQSAEQHNQDVNSLGLISARKTVEAVDILKLMSSTYLVALCQAIDLRHLEENLKSAV  543

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+NYPLMQKLRQV
Sbjct  544  KNTVSQVAKRTLTMGANGELHPARFCEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQV  603

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP+IPNRITECR
Sbjct  604  LVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPNRITECR  663

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  664  SYPLYRLVRQELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKSWNGAPLPIC  723



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   430 bits (1106),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQAIDLRHLEENLR AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTIEALDILKLMSSTYLIALCQAIDLRHLEENLRLAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EK++STSIFQKI AFEDELKALLPKEVE AR ALE+GNPAI NRITECR
Sbjct  592  LVDHALKNGDGEKSLSTSIFQKIEAFEDELKALLPKEVESARIALESGNPAIANRITECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREELGT  LTGEKV SPGE CDKVFTA+  G I+DPLL+CL  WNGAPLPIC
Sbjct  652  SYPLYKFIREELGTNFLTGEKVTSPGEECDKVFTALSKGLIVDPLLKCLDGWNGAPLPIC  711



>gb|AIB08913.1| phenylalanine ammonia-lyase, partial [Angelica sinensis]
Length=233

 Score =   412 bits (1060),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 195/233 (84%), Positives = 213/233 (91%), Gaps = 0/233 (0%)
 Frame = -2

Query  903  AEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVSQ  724
            AEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ VKNTVSQ
Sbjct  1    AEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTVKNTVSQ  60

Query  723  VAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHAL  544
            VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ LV+HAL
Sbjct  61   VAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHAL  120

Query  543  QNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYK  364
             NG+ E+N+STSIFQKIAAFEDELK LLPKEVE AR+ALE+GNPAIPNRI ECRSYPLYK
Sbjct  121  NNGDKERNLSTSIFQKIAAFEDELKTLLPKEVESARAALESGNPAIPNRIKECRSYPLYK  180

Query  363  FIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            F+REELGTE LTGEKV+SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPI
Sbjct  181  FVREELGTEYLTGEKVRSPGEEFDKVFTAMSKGEIIDPLLECLESWNGAPLPI  233



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   429 bits (1104),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLR LEENL+NAV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRVLEENLKNAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCSA YPLMQKLRQV
Sbjct  532  KNIVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPNRI ECR
Sbjct  592  LVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGTE+L+GEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  652  SYPLYKFVREVLGTELLSGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  711



>gb|AGF50184.1| phenylalanine ammonia lyase, partial [Salvia virgata]
Length=282

 Score =   414 bits (1064),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLEENL++AV
Sbjct  43   TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAIDLRHLEENLKHAV  102

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC A YPLMQKLRQV
Sbjct  103  KNTVSQVAKRALTMGANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLMQKLRQV  162

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE EKN STSIFQKI  FE+ELKALLPKEVE AR ALE+G+PA+PNRI ECR
Sbjct  163  LVEHALKNGEGEKNASTSIFQKIEQFEEELKALLPKEVEAARLALESGSPAVPNRIAECR  222

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG   LTGEK  SPGE CDKVFTA+C+G I+DPLL+CLK WNG PLPIC
Sbjct  223  SYPLYKFVREELGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   429 bits (1103),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLR LEENL+NAV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRFLEENLKNAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCSA YPLMQKLRQV
Sbjct  532  KNIVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+E+GNPAIPNRI ECR
Sbjct  592  LVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVESGNPAIPNRIRECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  652  SYPLYKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMSKGQIVDPLLECLQEWNGAPLPIC  711



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   429 bits (1104),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  483  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  542

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+TLTMG NGELHP+RFCEK+LL+VV+REY+F YADDPCS  YPLMQKLRQV
Sbjct  543  KNTVSQVAKKTLTMGANGELHPARFCEKELLQVVEREYLFTYADDPCSCTYPLMQKLRQV  602

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++NGE E NV++SIFQKI AFEDELKA+LPKEVE AR  LE+GNP IPNRITECR
Sbjct  603  LVDHAMKNGESESNVNSSIFQKIVAFEDELKAVLPKEVESARVVLESGNPVIPNRITECR  662

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  663  SYPLYRFVRKELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  722



>emb|CDP20698.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   428 bits (1100),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLR LEENL+NAV
Sbjct  435  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTYLVALCQAIDLRFLEENLKNAV  494

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREY FAY DDPCSA YPLMQKLRQV
Sbjct  495  KNIVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYAFAYVDDPCSATYPLMQKLRQV  554

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKNV+TSIFQKIAAFEDELKA+LPKEVE ARSA+ENGNPAIPNRI +CR
Sbjct  555  LVDHALKNGDQEKNVNTSIFQKIAAFEDELKAVLPKEVESARSAVENGNPAIPNRIRKCR  614

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEK QSPGEV D+VFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  615  SYPLYKFVREVLGTGLLTGEKAQSPGEVFDQVFTAMNKGQIVDPLLECLQEWNGAPLPIC  674



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+TL MG NGELHP+RFCEK+LL+VV+REY+F YADDPCS+ YPLMQKLRQV
Sbjct  542  KNTVSQVAKKTLAMGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++NGE EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECR
Sbjct  602  LVDHAMKNGESEKNVNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G IIDPLLECLKSWNGAP+PIC
Sbjct  662  SYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC  721



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   429 bits (1102),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENLRN V
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  538  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECR
Sbjct  598  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNGAPLPIC
Sbjct  658  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPLPIC  717



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   428 bits (1101),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLEENLRN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   428 bits (1101),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENLRN V
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  538  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECR
Sbjct  598  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  658  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  717



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   428 bits (1100),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQA+DLRH EENLRN V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHFEENLRNTV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQV
Sbjct  535  KSTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE EKN+STSIFQKI AFE+E+K LLPKEVE  R+A+ENGN AIPNRI ECR
Sbjct  595  LVEHALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPL++CLK WNGAPLPIC
Sbjct  655  SYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>gb|AAU08174.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   427 bits (1099),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQA+DLRH EENLRN V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHFEENLRNTV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQV
Sbjct  535  KSTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE EKN+STSIFQKI AFE+E+K LLPKEVE  R+A+ENGN AIPNRI ECR
Sbjct  595  LVEHALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C G +IDPL++CLK WNGAPLPIC
Sbjct  655  SYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPIC  714



>sp|P35512.1|PALY_MALDO RecName: Full=Phenylalanine ammonia-lyase, partial [Malus domestica]
 emb|CAA48231.1| phenylalanine ammonia-lyase [Malus sp.]
Length=235

 Score =   410 bits (1054),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 194/233 (83%), Positives = 210/233 (90%), Gaps = 0/233 (0%)
 Frame = -2

Query  900  EQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVSQV  721
            EQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN VKNTVSQV
Sbjct  3    EQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTVKNTVSQV  62

Query  720  AKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHALQ  541
            AKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+VL++HAL 
Sbjct  63   AKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREVLIEHALT  122

Query  540  NGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLYKF  361
            NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E GN A+PNRI ECRSYPLYKF
Sbjct  123  NGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIEGGNAAVPNRIAECRSYPLYKF  182

Query  360  IREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            +REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  183  VREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  235



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   427 bits (1099),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENLRN V
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  538  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECR
Sbjct  598  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  658  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta]
Length=315

 Score =   413 bits (1062),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EAV +LKLMS+T+LVALCQAIDLRHLEENL++AV
Sbjct  76   TSHVQSAEQHNQDVNSLGLISSRKTEEAVDILKLMSTTFLVALCQAIDLRHLEENLKHAV  135

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT G +GELHPSRFCEKDLL+VVDRE VF+Y DD CSA YPLMQKLRQV
Sbjct  136  KNTVSQVAKRILTTGASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLMQKLRQV  195

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN STSIFQKI AFE+ELKALLPKEVE AR A ENGNPAI N+I ECR
Sbjct  196  LVDHALANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECR  255

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REE+GT +LTGEKV+SPGE  DKVFTA+C G IIDP+L+CLK WNGAPLPIC
Sbjct  256  SYPLYKFVREEIGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  315



>ref|XP_003625662.1| Phenylalanine ammonia-lyase [Medicago truncatula]
Length=456

 Score =   419 bits (1076),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  217  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  276

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+TLTMGVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPL QKLRQV
Sbjct  277  KNTVSQVAKKTLTMGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQV  336

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN+I  CR
Sbjct  337  LVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCR  396

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  397  SYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  456



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   427 bits (1099),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLEENLRN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   427 bits (1098),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  476  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ 
Sbjct  536  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRET  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+A+E+GNPAIPNRI ECR
Sbjct  596  LVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPNRIKECR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE LTGEKV SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  656  SYPLYKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNGAPLPIC  715



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   427 bits (1098),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+TL MG NGELHP+RFCEK+LL+VV+REY+F YADDPCS+ YPLMQKLRQV
Sbjct  542  KNTVSQVAKKTLAMGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++NGE EKN+++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECR
Sbjct  602  LVDHAMKNGESEKNLNSSIFQKIVAFEDELKAVLPKEVESARAVVESGNPAIPNRITECR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+E+GTE+LTGEKV+SPGE  DKVFTA C+G IIDPLLECLKSWNGAP+PIC
Sbjct  662  SYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPIC  721



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   427 bits (1097),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEEN+++ V
Sbjct  476  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENMKSTV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ 
Sbjct  536  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRET  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+A+E+GNPAIPNRI ECR
Sbjct  596  LVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVESARAAVESGNPAIPNRIKECR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE LTGEKV SPGE  DKVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  656  SYPLYKFVREELGTEYLTGEKVTSPGEEFDKVFTAMTKGEIIDPLLECLQSWNGAPLPIC  715



>gb|AJW77399.1| phenylalanine ammonia-lyase [Angelica sinensis]
Length=718

 Score =   427 bits (1097),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  479  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ 
Sbjct  539  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRET  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG+ E+N+STSIFQKIAAFEDELK LLPKEVE AR+ALE+GNPAIPNRI ECR
Sbjct  599  LVEHALNNGDKERNLSTSIFQKIAAFEDELKTLLPKEVESARAALESGNPAIPNRIKECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE LTGEKV+SPGE  DKVFTA+  G I+DPLLECL+SWNGAPLPIC
Sbjct  659  SYPLYKFVREELGTEYLTGEKVRSPGEEFDKVFTAMSKGEIVDPLLECLESWNGAPLPIC  718



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   426 bits (1096),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  479  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLR+ 
Sbjct  539  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRET  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG+ E+N+STSIFQKIAAFEDELKALLPKEVE AR+ALE+GNPAIPNRI ECR
Sbjct  599  LVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVETARAALESGNPAIPNRIKECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE LTGEKV+SPGE  +KVFTA+  G IIDPLLECL+SWNGAPLPIC
Sbjct  659  SYPLYKFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNGAPLPIC  718



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   426 bits (1096),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  539

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+V
Sbjct  540  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  599

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  600  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  659

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  660  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   426 bits (1096),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  539

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+V
Sbjct  540  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  599

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  600  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  659

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  660  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   427 bits (1097),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMS+T+LVALCQAIDLRHLEENLRN V
Sbjct  487  TSHVQSAEQHNQDVNSLGLISSRKTAESIDILKLMSTTFLVALCQAIDLRHLEENLRNTV  546

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  547  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  606

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G+  +PNRITECR
Sbjct  607  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECR  666

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  667  SYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPIC  726



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   426 bits (1095),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLV LCQAIDLRHLEENL++AV
Sbjct  470  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVGLCQAIDLRHLEENLKHAV  529

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  530  KNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQV  589

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE EKN STSIFQKI AFE+ELK LLPKEVE AR+ALE+GNPAI NRI ECR
Sbjct  590  LVEHALKNGEGEKNASTSIFQKIEAFEEELKTLLPKEVESARTALESGNPAIANRIAECR  649

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREELG + LTGEKV SPGE CDKVFTA+ +G IIDPLLECL+ WNGAPLPIC
Sbjct  650  SYPLYKFIREELGADFLTGEKVVSPGEECDKVFTALSNGLIIDPLLECLQGWNGAPLPIC  709



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   426 bits (1095),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  539

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+V
Sbjct  540  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  599

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  600  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  659

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  660  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  719



>gb|AGF50183.1| phenylalanine ammonia lyase, partial [Salvia hypoleuca]
Length=282

 Score =   410 bits (1055),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLM STYLVALCQAIDLRHLEENL++AV
Sbjct  43   TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMFSTYLVALCQAIDLRHLEENLKHAV  102

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC A YPLMQKLRQV
Sbjct  103  KNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFSYVDDPCLATYPLMQKLRQV  162

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE EKN STSIF KI  FE+ELKALLPKEVE AR ALE+G+PA+PNRI ECR
Sbjct  163  LVEHALKNGEGEKNASTSIFHKIEQFEEELKALLPKEVEAARMALESGSPAVPNRIAECR  222

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE+LG   LTGEK  SPGE CDKVFTA+C+G I+DPLL+CLK WNG PLPIC
Sbjct  223  SYPLYKFVREQLGAGFLTGEKAVSPGEECDKVFTALCNGLIVDPLLDCLKGWNGQPLPIC  282



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   426 bits (1094),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQA+DLRHLEENLR AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAVDLRHLEENLRLAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCSANYPLMQKLRQV
Sbjct  532  KNTVSQLAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NGE+EKN STSI Q+I AFE+ELKALLPKEVE AR ALE GNPA+PNRITECR
Sbjct  592  LVDHALKNGENEKNASTSILQEIEAFEEELKALLPKEVESARMALEAGNPAVPNRITECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIR E GTE LTGEKV SPGE CDKVFTA+ +G IID LL CL++WNGAPLPIC
Sbjct  652  SYPLYKFIRGEAGTEFLTGEKVTSPGEECDKVFTALTNGFIIDQLLTCLEAWNGAPLPIC  711



>gb|ACF94715.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=332

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+N V
Sbjct  93   TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTV  152

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DD CSA YPLMQKLRQV
Sbjct  153  KNTVSQIAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYVDDACSATYPLMQKLRQV  212

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N + EKN++TSIFQKI  FE+ELK LLPKEVE AR A ENG  AIPN+I ECR
Sbjct  213  LVDHALANADGEKNLNTSIFQKITTFEEELKTLLPKEVESARVAYENGQCAIPNKIEECR  272

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  273  SYPLYKFVREELGTGLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  332



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   426 bits (1094),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  484  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  543

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQKLRQV
Sbjct  544  KNIVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQV  603

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EKN++TSIFQKIA FEDELK LLPKEVE AR+A E+GNPAIPN+I  CR
Sbjct  604  LVDHALVNGENEKNLNTSIFQKIATFEDELKTLLPKEVESARAAYESGNPAIPNKINGCR  663

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNGAPLP+C
Sbjct  664  SYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAMCQGKIIDPLLECLGEWNGAPLPVC  723



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   425 bits (1093),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLEENLRN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   425 bits (1092),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+++ 
Sbjct  480  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKSSA  539

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  540  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  599

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EKN++TSIFQKIA FEDELKALLPKEVE AR+A E+GNPAIPN+I ECR
Sbjct  600  LVDHALVNGEYEKNLNTSIFQKIATFEDELKALLPKEVESARAAYESGNPAIPNKIKECR  659

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPG   DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  660  SYPLYKFVREELGTGLLTGEKVRSPGGEFDKLFTAMCRGKIIDPLLECLGEWNGAPLPIC  719



>dbj|BAF36972.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=688

 Score =   424 bits (1090),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLEENL+ +V
Sbjct  449  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILKLMSSTFLIALCQAIDLRHLEENLKYSV  508

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE VFAY DDPCSA YPLMQKLRQV
Sbjct  509  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETVFAYIDDPCSATYPLMQKLRQV  568

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E+EKN++TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECR
Sbjct  569  LVDHALVNEENEKNMNTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECR  628

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGTE+LTGEKV+SPGE CDK+FTA+C+G IIDPLLECL  WNGAPLPIC
Sbjct  629  SYPLYKFVREGLGTELLTGEKVRSPGEECDKLFTAICEGKIIDPLLECLGEWNGAPLPIC  688



>emb|CAA34715.1| unnamed protein product [Petroselinum crispum]
Length=580

 Score =   420 bits (1080),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  341  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  400

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ 
Sbjct  401  KNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  460

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECR
Sbjct  461  LVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  520

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  521  SYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  580



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   425 bits (1092),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            L +HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  601  LXEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=308

 Score =   410 bits (1054),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  69   TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  128

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  129  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  188

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  189  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  248

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  249  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  308



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   425 bits (1092),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL++AV
Sbjct  484  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKSAV  543

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT+G NGELHP+RFCEK+LLRVVDREY+FAYADDPCS+NYPLMQKLRQV
Sbjct  544  KNTVSQVAKRTLTVGANGELHPARFCEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQV  603

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD A++NGE EK+ ++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP+IPNRITECR
Sbjct  604  LVDQAMKNGESEKHFNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPSIPNRITECR  663

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  664  SYPLYRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  723



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   425 bits (1092),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLEENLRN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   424 bits (1091),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+V
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            L +HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  601  LXEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>dbj|BAF36973.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=569

 Score =   420 bits (1079),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENLR +V
Sbjct  330  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLRYSV  389

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT  V+GELHPSRFCEKDLL+VVDRE VFAY DDPCSA YPLMQKLRQV
Sbjct  390  KNTVSQVAKRTLTTSVSGELHPSRFCEKDLLKVVDREVVFAYIDDPCSATYPLMQKLRQV  449

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E+EKN +TSIFQKI+ FEDELK+LLPKEVE AR+A E+GNP IPN+I ECR
Sbjct  450  LVDHALVNAENEKNQNTSIFQKISTFEDELKSLLPKEVESARNAYESGNPVIPNKINECR  509

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  510  SYPLYKFVREELGTELLTGEKVRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  569



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   424 bits (1090),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++AV
Sbjct  460  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSAV  519

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT GVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ 
Sbjct  520  KNTVSQVAKRVLTTGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  579

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECR
Sbjct  580  LVEHALTNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  639

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE LTGEK +SPGE  DKVFTA+  G IIDPLL CL+SWNGAPLPIC
Sbjct  640  SYPLYKFVREELGTEYLTGEKARSPGEEFDKVFTAMSRGEIIDPLLACLESWNGAPLPIC  699



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   424 bits (1090),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS+T+LVALCQAIDLRH+EENL+N V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF Y DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFTYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE E N STSIFQKI AFE+ELKALLPKEVE AR  LENGNPAIPNRITECR
Sbjct  592  LVDHALMNGEKEHNSSTSIFQKIGAFEEELKALLPKEVESARHELENGNPAIPNRITECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  652  SYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   424 bits (1091),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ++DLRHLEENLRN V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSVDLRHLEENLRNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  541  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  601  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L CL+ WNGAPLPIC
Sbjct  661  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGCLEGWNGAPLPIC  720



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   424 bits (1090),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENLRN V
Sbjct  478  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPC+A YPLMQKLRQV
Sbjct  538  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCNATYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+ AR+AL++G   +PNRITECR
Sbjct  598  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGTAGVPNRITECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGE+V+SPGE CDKVF+A+C+G IIDP+L+CL+ WNGAPLPIC
Sbjct  658  SYPLYKFVREELGAEYLTGEEVRSPGEECDKVFSAICEGKIIDPILDCLEGWNGAPLPIC  717



>ref|XP_006358655.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=709

 Score =   423 bits (1088),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTY+VALCQ+IDLRHLEENL+NAV
Sbjct  470  TTHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYIVALCQSIDLRHLEENLKNAV  529

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVS+VAKRTLTM  NGELHP+RFCEK+LL VVDREY+FAYADDPCS+NYPLMQKLRQV
Sbjct  530  KDTVSRVAKRTLTMDANGELHPARFCEKELLLVVDREYLFAYADDPCSSNYPLMQKLRQV  589

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD+A++NGE EKNV++SIFQKI AFEDELK +LP EVE AR  LE+GNP+IPNRITECR
Sbjct  590  LVDYAMKNGESEKNVNSSIFQKIGAFEDELKVVLPNEVENARVILESGNPSIPNRITECR  649

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  650  SYPLYRFVRKELGTELLTGERVRSPGEDIDKVFTALCNGQIIDPLLECLKSWNGAPLPIC  709



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   424 bits (1089),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+NAV
Sbjct  480  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAV  539

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+TLT+G NGELHP+RFCEK+LL+VV+REY+F YADDPCS+ YPLMQKLRQV
Sbjct  540  KNTVSQVAKKTLTIGANGELHPARFCEKELLQVVEREYLFTYADDPCSSTYPLMQKLRQV  599

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++NG  E NV++SIFQKI AFE+ELKA+LPKEVE AR+ LE+GNP+IPNRITECR
Sbjct  600  LVDHAMKNGVSETNVNSSIFQKIVAFEEELKAVLPKEVESARAMLESGNPSIPNRITECR  659

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELGTE+LTGEK++SPGE  DKVFTA C+G IIDPLLECLKSWNGAPLPIC
Sbjct  660  SYPLYRLVRQELGTEVLTGEKIRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPLPIC  719



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   423 bits (1088),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLEENL+ AV
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTVEAMDILKLMSSTYLVALCQAIDLRHLEENLKLAV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEK+L+RVVDREYVFAYADDPCSA YPLMQKLRQV
Sbjct  531  KNTVSQVAKRTLTMGANGELHPSRFCEKELIRVVDREYVFAYADDPCSATYPLMQKLRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G PA+ NRI ECR
Sbjct  591  LVDHALKNGDGEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGAPAVANRIAECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIRE LGT  LTGEK  SPGE CDKVFTA+CDG I+DPLLECL+ WNG PLPIC
Sbjct  651  SYPLYKFIREGLGTGFLTGEKAVSPGEECDKVFTALCDGLIVDPLLECLQGWNGEPLPIC  710



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   423 bits (1088),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLEENLRNAV
Sbjct  474  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTFLIALCQAIDLRHLEENLRNAV  533

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS VAK+TLT+GVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  534  KNTVSLVAKKTLTVGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLRQV  593

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE EK  +TSIFQKI AFEDEL A LPKEVE AR ALE+GNPAIPN+I ECR
Sbjct  594  LVEHALKNGETEKEANTSIFQKIGAFEDELIANLPKEVESARIALESGNPAIPNKINECR  653

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEKV+SPGE CDKVFTA+  G IIDPLLECL  WNG PLPIC
Sbjct  654  SYPLYKFVREELGTELLTGEKVRSPGEECDKVFTAMSKGLIIDPLLECLNGWNGEPLPIC  713



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   423 bits (1087),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQA+DLRHLEENL+ AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAVDLRHLEENLKQAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMGVNGELHPSRFCEKDL+ VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLISVVDREYVFAYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NGE EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE GNPAI NRI+ECR
Sbjct  592  LVDHALKNGETEKNVSTSIFHKIEAFEEELKALLPKEVESARIALEGGNPAIANRISECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREELG   LTGEK  SPGE CD+VFTA+ +G I+DPLL CL+ WNGAPLPIC
Sbjct  652  SYPLYKFIREELGASFLTGEKTTSPGEECDRVFTALSNGLIVDPLLNCLQGWNGAPLPIC  711



>ref|XP_004253518.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Solanum 
lycopersicum]
Length=582

 Score =   419 bits (1076),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQ+IDLRHLEENL+NAV
Sbjct  343  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQSIDLRHLEENLKNAV  402

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAKRTLTM  NGELHP+RFCEK+LL VVDREY+FAYADDPCS+NYPLMQKLRQV
Sbjct  403  KDTVSQVAKRTLTMDANGELHPARFCEKELLLVVDREYLFAYADDPCSSNYPLMQKLRQV  462

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD+A++NGE EKNV++SIFQKI AFEDELK +LP EVE AR  LE G+P IPNRITECR
Sbjct  463  LVDYAMKNGESEKNVNSSIFQKIGAFEDELKVVLPDEVENARVVLEGGSPLIPNRITECR  522

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            SYPLY+F+R+ELGTE+LTGE+V+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPI
Sbjct  523  SYPLYRFVRKELGTELLTGERVRSPGEDVDKVFTALCNGQIIDPLLECLKSWNGAPLPI  581



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   423 bits (1087),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSST+L+ALCQAIDLRHLEENL+N V
Sbjct  474  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTFLIALCQAIDLRHLEENLKNTV  533

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLLRVVDREY++AY DDPCSA YPLMQKLRQV
Sbjct  534  KNTVSQVAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYVDDPCSATYPLMQKLRQV  593

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NG+ EKN +TSIFQKI AFE+ELK LLPKEVEGAR   ENGN AIPNRI ECR
Sbjct  594  LVDHALMNGDREKNSTTSIFQKIGAFEEELKTLLPKEVEGARIEFENGNAAIPNRIEECR  653

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEKV SPGE CDKVF+A+C G +IDPLLECLK WNGAPLPIC
Sbjct  654  SYPLYKFVREVLGTSLLTGEKVISPGEECDKVFSAMCAGKLIDPLLECLKEWNGAPLPIC  713



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   423 bits (1087),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSST+LVALCQAIDLRHLEENL++ V
Sbjct  480  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTV  539

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREY+FAY DDPCSA YPLMQKLRQV
Sbjct  540  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSATYPLMQKLRQV  599

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN STSIFQKI AFE+ELKALLPKEVE AR+  +NGNPAIPN+I ECR
Sbjct  600  LVDHALLNGEKEKNSSTSIFQKIGAFEEELKALLPKEVENARTEYDNGNPAIPNKIKECR  659

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEK++SPGE  DKVF+A+C G +IDP+LECLK WNGAPLPIC
Sbjct  660  SYPLYKFVREELGTGLLTGEKIRSPGEEFDKVFSAMCAGKLIDPMLECLKEWNGAPLPIC  719



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   422 bits (1086),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQA+DLRHLEENLR +V
Sbjct  469  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAVDLRHLEENLRLSV  528

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQKLRQV
Sbjct  529  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYIDDPCSGTYPLMQKLRQV  588

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKNVSTSIFQKI AFE ELKA+LPKEVE AR ALE+GNPAI NRITECR
Sbjct  589  LVDHALNNGESEKNVSTSIFQKIEAFEVELKAILPKEVESARIALESGNPAIGNRITECR  648

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREELGT  LTGEKV SPGE CDKVFTA+  G I+DPLL+CL+ WNGAP PIC
Sbjct  649  SYPLYKFIREELGTNYLTGEKVVSPGEECDKVFTALSKGLIVDPLLKCLEGWNGAPPPIC  708



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   422 bits (1086),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT+EAV +LKLMS TYL+ALCQAIDLRHLEENL+N V
Sbjct  476  TSHVQSAEQHNQDVNSLGLISARKTNEAVEILKLMSPTYLIALCQAIDLRHLEENLKNTV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL++VDREY FAY DDPCSA YPLMQKLRQV
Sbjct  536  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKIVDREYCFAYIDDPCSATYPLMQKLRQV  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL N E+EKNV+TSIFQKI  FE+ELK LLPKEVEGAR A ENG  AIPN+I ECR
Sbjct  596  LVEHALANAENEKNVNTSIFQKITTFEEELKTLLPKEVEGARIAYENGQSAIPNKIKECR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLEC+  WNGAPLP+C
Sbjct  656  SYPLYKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNGAPLPLC  715



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   422 bits (1085),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQAIDLRHLEENLR AV
Sbjct  473  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLRLAV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCS NYPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYVDDPCSENYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NG++EKN+STSIFQKI AFEDELKALLPKEVE AR ALE+GNPAI NRI ECR
Sbjct  593  LVEHALKNGDNEKNLSTSIFQKIGAFEDELKALLPKEVESARIALESGNPAIANRIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+FIREELGT  LTGEKV SPGE  DKVFTA+  G I+DPLL+CL+ W+G+PLPIC
Sbjct  653  SYPLYRFIREELGTGFLTGEKVTSPGEEGDKVFTALSKGLIVDPLLKCLEGWSGSPLPIC  712



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   422 bits (1085),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+++V
Sbjct  478  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKHSV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAKRTLT  VNGELHPSRFCEKDLL+VVDRE +FAY DDPCSA YPLMQKLRQV
Sbjct  538  KSTVSQVAKRTLTTSVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCSATYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EKN  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP IPN+I ECR
Sbjct  598  LVDHALVNGENEKNSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPNKINECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  658  SYPLYKFVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  717



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   421 bits (1083),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ 
Sbjct  535  KNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECR
Sbjct  595  LVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  655  SYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  714



>ref|XP_007162755.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
 gb|ESW34749.1| hypothetical protein PHAVU_001G1777000g, partial [Phaseolus vulgaris]
Length=240

 Score =   404 bits (1039),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT+E++ +LKLMSST+L+ LCQAIDLRHLEENL+++V
Sbjct  1    TSHVQSAEQHNQDVNSLGLISARKTNESIEILKLMSSTFLMGLCQAIDLRHLEENLKSSV  60

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQV+KRTLT G NGELHPSRFCEKDLL+VVDREYVF+Y DDPCS  YPLMQKLRQV
Sbjct  61   KNTVSQVSKRTLTTGGNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSGTYPLMQKLRQV  120

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E+EK+V+TSIFQKIA FE+ELK +LPKEVE  R+A E+G  AIPN+I ECR
Sbjct  121  LVDHALINAENEKDVNTSIFQKIATFEEELKTILPKEVESTRAAYESGKAAIPNKIKECR  180

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  181  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  240



>gb|AGF50182.1| phenylalanine ammonia lyase, partial [Salvia officinalis]
Length=282

 Score =   406 bits (1043),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLEENL++AV
Sbjct  43   TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAIDLRHLEENLKHAV  102

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVF+Y DDPC A YPLMQKLRQV
Sbjct  103  KNTVSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFSYIDDPCLATYPLMQKLRQV  162

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE EK+VSTSIF KI  FE+EL ALLPKEVE AR ALE+G+PA+PNRI ECR
Sbjct  163  LVEHALKNGEGEKSVSTSIFHKIEQFEEELMALLPKEVESARIALESGSPAVPNRIAECR  222

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIRE+LG   LTGEK  SPGE CD VFTA+ +G I+DPLL+CLK+WNG PLPIC
Sbjct  223  SYPLYKFIREDLGAGFLTGEKAVSPGEECDMVFTALSNGLIVDPLLDCLKAWNGQPLPIC  282



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   421 bits (1082),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  477  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  536

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS VAKR LTMGVNGELHPSRFCEKDLLRVVDREY+FAY DDPCSA YPLMQKLRQ 
Sbjct  537  KNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQT  596

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NG++E+N+STSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECR
Sbjct  597  LVEHALKNGDNERNLSTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  656

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+R+ELGTE LTGEKV SPGE  +KVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  657  SYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPIC  716



>gb|ABV44808.1| phenylalanine ammonia lyase 1 [Eriobotrya japonica]
Length=330

 Score =   407 bits (1047),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 212/239 (89%), Gaps = 0/239 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LK MSST+LVALCQAIDLRHLEENL++ V
Sbjct  91   TNHVQSAEQHNQDVNSLGLISSRKTTEAVDILKPMSSTFLVALCQAIDLRHLEENLKSTV  150

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCSA YPLMQKLR V
Sbjct  151  KTTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRHV  210

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG+ E++ STSIFQKIAAFE+ELKALLPKEVE  R+  ENG  AIPNRI ECR
Sbjct  211  LVEHALSNGDKERSTSTSIFQKIAAFEEELKALLPKEVETTRAEYENGKTAIPNRIKECR  270

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            SYPLYKF+REELGT++LTGEKV+SPGE CDKVF+A+C G +IDPLL+CLK WNGAPLPI
Sbjct  271  SYPLYKFVREELGTDLLTGEKVRSPGEECDKVFSAMCAGKLIDPLLDCLKEWNGAPLPI  329



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   421 bits (1082),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL++ V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKSVV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT+G  GELHP+RFCEK+LLRVVDREY+F YADDPCS+ YPLMQKLRQV
Sbjct  541  KNTVSQVAKRTLTIGAIGELHPARFCEKELLRVVDREYLFTYADDPCSSTYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++NGE EKN+++SIFQKI AFEDEL A+LPKEVE AR+ LE+GNP+IPNRITECR
Sbjct  601  LVDHAMKNGESEKNINSSIFQKIGAFEDELNAVLPKEVESARALLESGNPSIPNRITECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +R+ELGTE+LTGEKV+SPGE  +KVFTA+C+G I DPLLECLKSWNGAPLPIC
Sbjct  661  SYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQINDPLLECLKSWNGAPLPIC  720



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   421 bits (1081),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS+T+LVALCQAIDLRH+EENL+N V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSR CEKDLL+VVDRE+VF Y DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRICEKDLLKVVDREHVFTYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE E N STSIFQKI  FEDELKALLPKEVE AR  LENGNPAIPNRITECR
Sbjct  592  LVDHALMNGEKEHNSSTSIFQKIGVFEDELKALLPKEVESARLELENGNPAIPNRITECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  652  SYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase, partial [Vitis vinifera]
 emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera]
Length=416

 Score =   410 bits (1055),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  177  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  236

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT+G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  237  KKTVSHVAKKTLTIGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  296

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  297  LVEHALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  356

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  357  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  416



>gb|KHN17149.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   417 bits (1073),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ VLKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  380  TTHVQSAEQHNQDVNSLGLISSRKTAEAIDVLKLMSSTFLVALCQAIDLRHLEENLKNTV  439

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLMQKLR V
Sbjct  440  KNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLV  499

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNG+ E + STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPNRI ECR
Sbjct  500  LVDHALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECR  559

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G  IDPLL+CLK WNGAPLPIC
Sbjct  560  SYPLYKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  619



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   420 bits (1080),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT +AV +LK+MSSTYLVALCQAIDLRHLEENL++ V
Sbjct  465  TNHVQSAEQHNQDVNSLGLISARKTAKAVDILKIMSSTYLVALCQAIDLRHLEENLKSVV  524

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAYADDPCS+NYPLMQKLRQV
Sbjct  525  KNTVSQVAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQV  584

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+  E+GNP I NRITECR
Sbjct  585  LVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRNRITECR  644

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  645  SYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPIC  704



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   420 bits (1080),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT +AV +LK+MSSTYLVALCQAIDLRHLEENL++ V
Sbjct  465  TNHVQSAEQHNQDVNSLGLISARKTAKAVDILKIMSSTYLVALCQAIDLRHLEENLKSVV  524

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAYADDPCS+NYPLMQKLRQV
Sbjct  525  KNTVSQVAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYADDPCSSNYPLMQKLRQV  584

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+  E+GNP I NRITECR
Sbjct  585  LVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVFESGNPLIRNRITECR  644

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLKSWNGAPLPIC
Sbjct  645  SYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPIC  704



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS+T+LVALCQAIDLRH+EENL+N V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+ F Y DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE E N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRITECR
Sbjct  592  LVDHALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  652  SYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLEENLR +V
Sbjct  474  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAIDLRHLEENLRLSV  533

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNT+SQVAKRTLT GVNGELHPSRFCE DLLRVVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  534  KNTISQVAKRTLTTGVNGELHPSRFCELDLLRVVDREYVFAYVDDPCSATYPLMQKLRQV  593

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE+EKN STSIFQKI AFE ELKA+LPKEVE AR ALE+G PAI NRITECR
Sbjct  594  LVEHALKNGENEKNASTSIFQKIEAFEAELKAVLPKEVESARVALEDGKPAIANRITECR  653

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREELGT  LTGEKV SPGE CD+VFTA+  G I+DPLL+CL+ WNGAPLPIC
Sbjct  654  SYPLYKFIREELGTNFLTGEKVMSPGEECDRVFTAMSKGLIVDPLLKCLEGWNGAPLPIC  713



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   420 bits (1080),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS+T+LVALCQAIDLRH+EENL+N V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILKLMSTTWLVALCQAIDLRHIEENLKNTV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+ F Y DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHAFTYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE E N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRITECR
Sbjct  592  LVDHALMNGEKEHNSSTSIFQKIGAFEEELKTLLPKEVENARLELENGNPAIPNRITECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP+LECLK WNGAPLP+C
Sbjct  652  SYPLYKFVREELGTILLTGEKVGSPGEEFDKVFTAICAGKLIDPMLECLKEWNGAPLPLC  711



>ref|XP_006439143.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
 gb|ESR52383.1| hypothetical protein CICLE_v10010874mg [Citrus clementina]
Length=308

 Score =   406 bits (1044),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 209/240 (87%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLEENL++ V
Sbjct  69   TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  128

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNT+SQ AK+ LTMGVNGELHPSRFCEKDLL+VVDREYVF+YADDPCSA YPLM+KLRQV
Sbjct  129  KNTISQAAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQV  188

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E  KN + SIF KI AFE+ELK LLPKEVE ARSA E+GN  IPNRI ECR
Sbjct  189  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  248

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG   LTGEK  SPGE CDKVFTA+C G IIDPLLECLK W+G+PLPIC
Sbjct  249  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  308



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   420 bits (1080),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+  V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKQTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG+NGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQKLRQV
Sbjct  531  KNTVSQVAKRVLTMGINGELHPSRFCEKDLLKVVDREYVYAYVDDPCSATYPLMQKLRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA+ NGE EKN STSIFQKI AFE+ELK LLPKEVE AR+  ENGNPAI N+I ECR
Sbjct  591  LVDHAMMNGEKEKNSSTSIFQKIGAFEEELKTLLPKEVESARTEYENGNPAISNKIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG  +LTGEK++SPGE  DKVF+A+C G +IDP+LECLK WNGAPLPIC
Sbjct  651  SYPLYKFVREELGCSLLTGEKIRSPGEEFDKVFSAICAGKLIDPMLECLKEWNGAPLPIC  710



>dbj|BAD94354.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=357

 Score =   408 bits (1048),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLEENLR  V
Sbjct  118  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTV  177

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV
Sbjct  178  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  237

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECR
Sbjct  238  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  297

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  298  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  357



>dbj|BAF36969.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=437

 Score =   410 bits (1055),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLEENL+++V
Sbjct  198  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILKLMSSTFLIALCQAIDLRHLEENLKHSV  257

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAKRTLT GV+GELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLMQKLRQV
Sbjct  258  KSTVSQVAKRTLTTGVSGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQV  317

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EK+  TSIFQKI +FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECR
Sbjct  318  LVDHALVNGENEKDSKTSIFQKIGSFEDELKSLLPKEVESARAAYESGNPAIPNKINECR  377

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  378  SYPLYKFVREELGTELLTGEKSRSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  437



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   419 bits (1077),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EA+ +LKLMSST++VALCQAIDLRHLEENL+N V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISARKTAEAIDILKLMSSTFMVALCQAIDLRHLEENLKNTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLLRVVDREY++AYADDPCSANYPL+QKLRQV
Sbjct  531  KNTVSQVAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLIQKLRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NG+ EK+ +TSIFQKI  FE+ELK  LPKEVE AR+  ENGNPAIPN+I ECR
Sbjct  591  LVDHALMNGDREKDSTTSIFQKIGVFEEELKTHLPKEVESARTEFENGNPAIPNKIEECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEKV SPGE CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  651  SYPLYKFVREVLGTNLLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNGAPLPIC  710



>emb|CAL91038.1| phenylalanine ammonia-lyase 4 [Cynara cardunculus var. scolymus]
Length=339

 Score =   406 bits (1043),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQ++DLRHLEEN+++ V
Sbjct  100  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQSVDLRHLEENMKSTV  159

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLMQ+LRQV
Sbjct  160  KNTVSQVAKKVLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQRLRQV  219

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN +TSIFQKIA FEDELKA+LPKEVE  R+A E  + +IPNRI  CR
Sbjct  220  LVDHALNNGETEKNTNTSIFQKIATFEDELKAILPKEVESVRTAYETDSLSIPNRIKACR  279

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG   LTGEKV SPGE  DKVFTA+C G +IDPLLEC++ WNGAPLPIC
Sbjct  280  SYPLYRFVREELGGGFLTGEKVTSPGEEFDKVFTAMCKGELIDPLLECVEGWNGAPLPIC  339



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   419 bits (1076),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENLRN V
Sbjct  473  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLRNTV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAYADDPC A YPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E EKN +TSIFQKIA FEDELKA+LPKEVE AR+A ENG   I N+I ECR
Sbjct  593  LVDHALVNTEGEKNSNTSIFQKIATFEDELKAILPKEVESARTAYENGQSGISNKIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G I+DPL+ECL  WNGAPLPIC
Sbjct  653  SYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLMECLGEWNGAPLPIC  712



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   418 bits (1075),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRHLEENL++ V
Sbjct  469  TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSTTFLVGLCQAVDLRHLEENLKSTV  528

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LTMGVNGELHPSRFCE DLLRVVDREY+FAY DDPCSA YPLMQKLRQV
Sbjct  529  KNTVSQVAKKVLTMGVNGELHPSRFCELDLLRVVDREYIFAYIDDPCSATYPLMQKLRQV  588

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NGE EKN+STSIFQKIAAFEDELKALLPKEVE AR+ +E+GNPAIPNRI ECR
Sbjct  589  LVEHALKNGETEKNLSTSIFQKIAAFEDELKALLPKEVESARAVVESGNPAIPNRIKECR  648

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREELGT  LTGEKV SPGE  DKVFTA+  G IIDPLL CL+SWNGAPLPI 
Sbjct  649  SYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPIA  708



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  485  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  544

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+TLT+GVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPL QKLRQV
Sbjct  545  KNTVSQVAKKTLTIGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQV  604

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN+I  CR
Sbjct  605  LVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCR  664

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  665  SYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  724



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   418 bits (1075),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLEENLR AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTFLIALCQAIDLRHLEENLRLAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG+NGELHPSRFCEKDLLRVVDREYVFAY DDPCSANYPLMQKLRQV
Sbjct  532  KNTVSQVAKRTLTMGINGELHPSRFCEKDLLRVVDREYVFAYIDDPCSANYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKNV TSIFQKI  FE+EL A+LPKEVE AR ALE GNPAIPNRI ECR
Sbjct  592  LVDHALKNGDSEKNVGTSIFQKIQVFEEELTAVLPKEVEAARIALEAGNPAIPNRIKECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY FIREELGTE LTGEK  SPGE  +KVFTA+ +G I+DPLL+CL++WNG PLPIC
Sbjct  652  SYPLYSFIREELGTEFLTGEKTVSPGEEGEKVFTALSNGLIVDPLLKCLEAWNGEPLPIC  711



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   418 bits (1074),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+ +V
Sbjct  465  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKYSV  524

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQV KRTLT GVNGELHPSRFCEKDLL+VVDRE +F+Y DDPCSA YPLMQKLRQV
Sbjct  525  KSTVSQVVKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFSYIDDPCSATYPLMQKLRQV  584

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP IPN+I ECR
Sbjct  585  LVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTIPNKINECR  644

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  645  SYPLYKFVREELGTELLTGEKTRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  704



>gb|KHN39030.1| Phenylalanine ammonia-lyase class 2 [Glycine soja]
Length=619

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  380  TSHVQSAEQHNQDVNSLGLISSRKTHEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTV  439

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLRQV
Sbjct  440  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQV  499

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD+AL NGE+EKN +TSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN+I ECR
Sbjct  500  LVDYALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECR  559

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  560  SYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  619



>ref|XP_006589419.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X1 [Glycine 
max]
 ref|XP_006589420.1| PREDICTED: phenylalanine ammonia-lyase 2-like isoform X2 [Glycine 
max]
Length=717

 Score =   418 bits (1075),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ VLKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  478  TTHVQSAEQHNQDVNSLGLISSRKTAEAIDVLKLMSSTFLVALCQAIDLRHLEENLKNTV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLMQKLR V
Sbjct  538  KNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNG+ E + STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPNRI ECR
Sbjct  598  LVDHALQNGDKEASSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G  IDPLL+CLK WNGAPLPIC
Sbjct  658  SYPLYKFVRENLGTTLLTGEKVKSPGEESDKVFTALCEGKFIDPLLDCLKEWNGAPLPIC  717



>gb|KDO36715.1| hypothetical protein CISIN_1g016039mg [Citrus sinensis]
Length=396

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 210/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLEENL++ V
Sbjct  157  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  216

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNT+SQVAK+ LTMGVNGELHPSRFCEKDLL+VVDREYVF+YADDPCSA YPLM+KLRQV
Sbjct  217  KNTISQVAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQV  276

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E  KN + SIF KI AFE+ELK LLPKEVE ARSA E+GN  IPNRI ECR
Sbjct  277  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  336

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG   LTGEK  SPGE CDKVFTA+C G IIDPLLECLK W+G+PLPIC
Sbjct  337  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  396



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   418 bits (1074),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  477  TNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTV  536

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS VAKR LTMGVNGELHPSRFCEKDLLR VDREY+FAY DDPCSA YPLMQKLRQ 
Sbjct  537  KNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRFVDREYIFAYIDDPCSATYPLMQKLRQT  596

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NG++E+N++TSIFQKIA FEDELKALLPKEVE AR+ALE+GNPAIPNRI ECR
Sbjct  597  LVEHALKNGDNERNMNTSIFQKIATFEDELKALLPKEVESARAALESGNPAIPNRIEECR  656

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+R+ELG E LTGEKV SPGE  DKVF A+  G IIDPLLECL+SWNGAPLPIC
Sbjct  657  SYPLYKFVRKELGIEYLTGEKVTSPGEEFDKVFIAMSKGEIIDPLLECLESWNGAPLPIC  716



>pir||JQ1070 phenylalanine ammonia-lyase (EC 4.3.1.5) - soybean  (fragment)
Length=416

 Score =   408 bits (1048),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LV L QAIDLRHLE+NL+N V
Sbjct  177  TSHVQSAEQHNQDVNSLGLISSRKTHEAIEILKLMSSTFLVGLWQAIDLRHLEDNLKNTV  236

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLRQV
Sbjct  237  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQV  296

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD+AL NGE+EKN +TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN+I ECR
Sbjct  297  LVDYALANGENEKNTNTSIFQKIASFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECR  356

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  357  SYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGNIIDPLLECLGEWNGAPLPIC  416



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   418 bits (1074),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLEENLR AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTFLIALCQAIDLRHLEENLRLAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCS NYPLMQKLRQV
Sbjct  532  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSENYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NG+ EKN STSIFQKI AFE+ELKA+LPKEVEGAR A+E G   I NRI ECR
Sbjct  592  LVDHALNNGDKEKNASTSIFQKIQAFEEELKAVLPKEVEGARLAVEGGKEVIGNRIKECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREE+GTE LTGEKV SPGE CDKVF A+ +G ++DPL +CL++WNGAPLPIC
Sbjct  652  SYPLYKFIREEVGTEFLTGEKVTSPGEECDKVFKALTNGLMVDPLFKCLEAWNGAPLPIC  711



>gb|KHN00850.1| Phenylalanine ammonia-lyase 2 [Glycine soja]
Length=619

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  380  TNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNTV  439

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            +NTVSQVAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLMQKLR V
Sbjct  440  RNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLV  499

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNG+ E N STSIFQKI AFE+EL ALLPKEVE AR  +ENGNPAIPNRI ECR
Sbjct  500  LVDHALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESARIEVENGNPAIPNRIKECR  559

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK W GAPLPIC
Sbjct  560  SYPLYKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  619



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   418 bits (1074),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDL++VVDREYVFAY DDPCSA+YPLMQKLRQV
Sbjct  541  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AI NRI ECR
Sbjct  601  LVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIANRIKECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYK +REE+GT +LTGEKV+SPGE  DKVF A+C+G +IDP+LECLK WNGAPLPIC
Sbjct  661  SYPLYKIVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNGAPLPIC  720



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   418 bits (1074),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDL++VVDREYVFAY DDPCSA+YPLMQKLRQV
Sbjct  541  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AI NRI ECR
Sbjct  601  LVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIANRIKECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYK +REE+GT +LTGEKV+SPGE  DKVF A+C+G +IDP+LECLK WNGAPLPIC
Sbjct  661  SYPLYKIVREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNGAPLPIC  720



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   417 bits (1073),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+  V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKITV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNT+S +AK+TLT GVNGELHPSRFCEKDLL+VVDREY+FAY DDPCS  YPLMQK+RQV
Sbjct  531  KNTISHIAKKTLTTGVNGELHPSRFCEKDLLKVVDREYIFAYIDDPCSETYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKNVSTSIFQKI AFE+ELKALLPKEVE  R+ LE+GNP IPNRI +CR
Sbjct  591  LVEHALNNGENEKNVSTSIFQKIVAFEEELKALLPKEVESTRAGLESGNPFIPNRIKDCR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL  WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSGWNGAPLPIC  710



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   418 bits (1074),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LK+MSSTYLVALCQAIDLRHLEENL++ V
Sbjct  481  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKIMSSTYLVALCQAIDLRHLEENLKSVV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHP+RF EK+LLRVVDREY+FAY DDPCS+NYPLMQKLRQV
Sbjct  541  KNTVSQVAKRTLTMGANGELHPARFSEKELLRVVDREYLFAYVDDPCSSNYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD A++NGE EKNV++SIFQKI AFEDEL A+LPKEVE  R+ +E+GNP I NRITECR
Sbjct  601  LVDQAMKNGESEKNVNSSIFQKIGAFEDELIAVLPKEVESVRAVVESGNPLIRNRITECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLLECLK WNGAPLPIC
Sbjct  661  SYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAMCNGQIIDPLLECLKRWNGAPLPIC  720



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   420 bits (1079),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQAIDLRHLEENLR AV
Sbjct  551  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLRLAV  610

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ AK+TLTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCS  YPLMQKLR+V
Sbjct  611  KNTVSQAAKKTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSGTYPLMQKLREV  670

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+++KN +TSIFQKI AFE+ELKA+LPKEVE ARSA+ENGN A+ NRI ECR
Sbjct  671  LVDHALKNGDNQKNAATSIFQKIEAFEEELKAVLPKEVESARSAVENGNAAVGNRIKECR  730

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE LTGEK+ SPGE CDKVFTA+  G I+DPLLECL+ WNGAPLPIC
Sbjct  731  SYPLYKFMREELGTEFLTGEKLTSPGEECDKVFTALSKGLIVDPLLECLEGWNGAPLPIC  790



>sp|P27990.1|PALY_MEDSA RecName: Full=Phenylalanine ammonia-lyase [Medicago sativa]
 emb|CAA41169.1| phenylalanine ammonia-lyase [Medicago sativa]
Length=725

 Score =   418 bits (1074),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT+EA+ +L+LMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  486  TTHVQSAEQHNQDVNSLGLISARKTNEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  545

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+TLTMGVNGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPL QKLRQV
Sbjct  546  KNTVSQVAKKTLTMGVNGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQV  605

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN +TSIFQKIA FE+ELK LLPKEVE AR+A E+GNP IPN+I  CR
Sbjct  606  LVDHALVNGESEKNFNTSIFQKIATFEEELKTLLPKEVESARTAYESGNPTIPNKINGCR  665

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE V SPGE CDK+F+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  666  SYPLYKFVREELGTGLLTGENVISPGEECDKLFSAMCQGKIIDPLLECLGEWNGAPLPIC  725



>gb|ABV71917.1| PAL [Solenostemon scutellarioides]
Length=233

 Score =   400 bits (1029),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/233 (82%), Positives = 207/233 (89%), Gaps = 0/233 (0%)
 Frame = -2

Query  906  SAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVS  727
            SAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQAIDLRHLEENL+ AV+NTVS
Sbjct  1    SAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLKQAVRNTVS  60

Query  726  QVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLVDHA  547
            QVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLMQKLRQVLVDHA
Sbjct  61   QVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHA  120

Query  546  LQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSYPLY  367
            LQNGE+EKNV TSIF KI +FE+ELKALLPKE E AR +LE+GNPAI NRI ECRSYPLY
Sbjct  121  LQNGENEKNVGTSIFHKIESFEEELKALLPKEDESARISLESGNPAIANRIAECRSYPLY  180

Query  366  KFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLP  208
            KFIR ELG   LTGEK  SPGE C+KVFTA+  G I+DPLLECL+ WNGAPLP
Sbjct  181  KFIRGELGASFLTGEKATSPGEECEKVFTALSKGLIVDPLLECLQGWNGAPLP  233



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   417 bits (1072),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQA+DLRHLEENL++AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAVDLRHLEENLKHAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMGVNGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKN STSIFQKI AFE+ELKALLPKEVE AR ALE+G+P + NRI ECR
Sbjct  592  LVDHALKNGDLEKNASTSIFQKIEAFEEELKALLPKEVESARMALESGSPTVANRIAECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIRE+LG   LTGEK  SPGE C+KVFTA+ +G IIDPLLECL+ WNG PLPIC
Sbjct  652  SYPLYKFIREQLGAGFLTGEKAVSPGEECEKVFTALSNGLIIDPLLECLQGWNGQPLPIC  711



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   417 bits (1072),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRN V
Sbjct  483  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNTV  542

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AK+ LT G NGELHPSRF EKDLL+ VD EYVFAY DDPCSA YPLMQKLRQV
Sbjct  543  KNTVSQIAKKILTTGANGELHPSRFSEKDLLKAVDSEYVFAYIDDPCSATYPLMQKLRQV  602

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQK+AAFE+ELKA+LPKEVE AR +LENGN  IPNRI ECR
Sbjct  603  LVEHALANGENEKNASTSIFQKVAAFEEELKAILPKEVESARLSLENGNAGIPNRIQECR  662

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  663  SYPLYKFVREELGTGLLTGENVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  722



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   417 bits (1072),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  478  TSHVQSAEQHNQDVNSLGLISSRKTHEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLRQV
Sbjct  538  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD+AL NGE+EKN STSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN+I ECR
Sbjct  598  LVDYALANGENEKNTSTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  658  SYPLYKFVREELGTALLTGERVISPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  717



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   417 bits (1071),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRH+EENLRN V
Sbjct  482  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHVEENLRNTV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AK+TLT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  542  KNTVSQIAKKTLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI  FE+EL+A+LPKEVE AR  LENGN AIPN I +CR
Sbjct  602  LVEHALTNGESEKNTSTSIFQKITDFEEELQAVLPKEVESARVTLENGNAAIPNMIKDCR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  662  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   416 bits (1070),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENLR AV
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLRQAV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCSA YPLMQKLRQ+
Sbjct  535  KNTVSQVAKRVLTTGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQI  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN  TS+FQKI+AFE+ELK LLPKEVE  R A E+GNPA  NRI ECR
Sbjct  595  LVEHALANGENEKNAGTSVFQKISAFEEELKTLLPKEVESVRIAYESGNPATANRIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTG+KV SPGE  DKVFTA+C G IIDP+++CLK WNGAPLPIC
Sbjct  655  SYPLYKFVREELGTGLLTGDKVMSPGEEFDKVFTAMCQGKIIDPMMDCLKEWNGAPLPIC  714



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   416 bits (1070),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYL ALCQAIDLRHLEENLR+ V
Sbjct  481  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLAALCQAIDLRHLEENLRSTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AK+ LT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  541  KNTVSQIAKKVLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR+++ENGN AIPN+I ECR
Sbjct  601  LVEHALTNGENEKNASTSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPNKIKECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            S+PLYKF+REELGT +LTGE V SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  661  SFPLYKFVREELGTGLLTGENVMSPGEEFDKVFTAMCQGRIIDPMLECLEEWNGAPLPIC  720



>dbj|BAF36974.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=684

 Score =   415 bits (1067),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLEENL+++V
Sbjct  445  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILKLMSSTFLIALCQAIDLRHLEENLKHSV  504

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLMQKLRQV
Sbjct  505  KSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQV  564

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECR
Sbjct  565  LVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECR  624

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPL+ECL  WNGAPLPIC
Sbjct  625  SYPLYKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNGAPLPIC  684



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   416 bits (1068),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSA+QHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENLRN V
Sbjct  465  TNHVQSAQQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTV  524

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  525  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  584

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELK LLPKEV+  R+AL++G+  +PNRITECR
Sbjct  585  LVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSXRAALDSGSAGVPNRITECR  644

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPL  211
             YPLYKF+REELG E LTGEKV+SPGE CDKVF+A+C+G IIDP+LECL+ WNGAPL
Sbjct  645  FYPLYKFVREELGAEYLTGEKVRSPGEECDKVFSAICEGKIIDPILECLEGWNGAPL  701



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   416 bits (1070),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGL S+RKT EAV +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  481  TNHVQSAEQHNQDVNSLGLNSSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDL++VVDREYVFAY DDPCSA+ PLMQKLRQV
Sbjct  541  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASSPLMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NG+ EKN +TSIFQKI AFEDELK LLPKEVE AR+ LE+GN AIPNRI ECR
Sbjct  601  LVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIPNRIKECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYK +RE++GT +LTGEKV+SPGE  DKVFTA+C+G +IDP+LECLK WNGAPLPIC
Sbjct  661  SYPLYKIVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGAPLPIC  720



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   416 bits (1069),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EA+ +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISARKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLLRVVDREY++AYADDPCSANYPL+QKLRQV
Sbjct  531  KNTVSQVAKRVLTMGSNGELHPSRFCEKDLLRVVDREYLYAYADDPCSANYPLIQKLRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NG+ EK+ +TSIFQKI  FE+ELK  LPKEVE AR+  ENG+PAI N+I ECR
Sbjct  591  LVDHALMNGDREKDSTTSIFQKIGVFEEELKTQLPKEVESARTEFENGSPAIANKIEECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEKV SPGE CDKVFTA+C G +IDPLL+CLK WNGAPLPIC
Sbjct  651  SYPLYKFVREVLGTHLLTGEKVISPGEECDKVFTAMCAGKLIDPLLDCLKDWNGAPLPIC  710



>ref|XP_010107519.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16201.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=535

 Score =   410 bits (1054),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMS+T+LV LCQAIDLRHLEENL+  V
Sbjct  296  TSHVQSAEQHNQDVNSLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKQTV  355

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT GVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQ LRQV
Sbjct  356  KNTVSQVAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQV  415

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKIAAFE+ELK+LLPKEVE AR A ENGN AI N+ITECR
Sbjct  416  LVEHALTNGESEKNTSTSIFQKIAAFEEELKSLLPKEVESARIAYENGNAAISNKITECR  475

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL  WNG PLPIC
Sbjct  476  SYPLYKFVREELGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLSGWNGEPLPIC  535



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   417 bits (1071),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EAV +LKLMSST+L+ALCQAIDLRHLEENL+ +V
Sbjct  491  TTHVQSAEQHNQDVNSLGLISSRKTNEAVEILKLMSSTFLIALCQAIDLRHLEENLKYSV  550

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE VFAY DDPC A YPLMQKLRQV
Sbjct  551  KSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREAVFAYIDDPCLATYPLMQKLRQV  610

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNP I N+I ECR
Sbjct  611  LVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPTISNKINECR  670

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEK +SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  671  SYPLYKFVREELGTELLTGEKSRSPGEECDKLFTAICQGKIIDPLLECLGEWNGAPLPIC  730



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   416 bits (1069),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRH+EENLRN V
Sbjct  476  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHIEENLRNTV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+ K+TLT G NGELHPSRF EKDLL+VVD EYVFAY DDPCSA YPLMQKLRQV
Sbjct  536  KNTVSQIVKKTLTTGANGELHPSRFSEKDLLKVVDCEYVFAYVDDPCSATYPLMQKLRQV  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKIAAFE+ELK +LPKEVE AR +LENGN AIPNRI +CR
Sbjct  596  LVEHALTNGENEKNTSTSIFQKIAAFEEELKVVLPKEVESARVSLENGNAAIPNRIKDCR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REE+GT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  656  SYPLYKFVREEIGTGLLTGEKVKSPGEEFDKVFTAICQGKIIDPMLECLKEWNGAPLPIC  715



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   415 bits (1067),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLEENL+++V
Sbjct  451  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILKLMSSTFLIALCQAIDLRHLEENLKHSV  510

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDRE +FAY DDPC A YPLMQKLRQV
Sbjct  511  KSTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDRETLFAYIDDPCLATYPLMQKLRQV  570

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EK+  TSIFQKIA FEDELK+LLPKEVE AR+A E+GNPAIPN+I ECR
Sbjct  571  LVDHALVNGENEKDSKTSIFQKIATFEDELKSLLPKEVESARAAYESGNPAIPNKINECR  630

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEK +SPGE  DK+FTA+C G IIDPL+ECL  WNGAPLPIC
Sbjct  631  SYPLYKFVREELGTELLTGEKTRSPGEEFDKLFTAICQGKIIDPLMECLGEWNGAPLPIC  690



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   416 bits (1068),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L+ALCQAIDLRHLEENL+N V
Sbjct  477  TSHVQSAEQHNQDVNSLGLISSRKTHEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTV  536

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREY FAY DDPCS  YPLMQKLRQV
Sbjct  537  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYTFAYIDDPCSGTYPLMQKLRQV  596

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD+AL NGE+EKN +TSIFQKIA FE+ELK LLPKEVEGAR A EN   AIPN+I ECR
Sbjct  597  LVDYALANGENEKNTNTSIFQKIATFEEELKTLLPKEVEGARVAYENDQCAIPNKIKECR  656

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE+V SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  657  SYPLYKFVREELGTALLTGERVVSPGEECDKVFTAMCQGKIIDPLLECLGEWNGAPLPIC  716



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   415 bits (1067),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+N V
Sbjct  479  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNTV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCSA YPLMQKLRQV
Sbjct  539  KNIVSQVAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQV  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG +E N STSIFQKIAAFE+ELK LLPKEVE +R +++NGNPAIPN+ITECR
Sbjct  599  LVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIQNGNPAIPNKITECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  659  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  718



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   415 bits (1066),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EAV +LKLMS+T+LVALCQAIDLRHLEENL++AV
Sbjct  473  TSHVQSAEQHNQDVNSLGLISSRKTEEAVDILKLMSTTFLVALCQAIDLRHLEENLKHAV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT G +GELHPSRFCEKDLL+VVDRE VF+Y DD CSA YPLMQKLRQV
Sbjct  533  KNTVSQVAKRILTTGASGELHPSRFCEKDLLKVVDREQVFSYVDDACSATYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN STSIFQKI AFE+ELKALLPKEVE AR A ENGNPAI N+I ECR
Sbjct  593  LVDHALANGESEKNASTSIFQKIRAFEEELKALLPKEVESAREAYENGNPAIANKIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REE+GT +LTGEK++SPGE  DKVFTA+C G IIDP+L+CLK WNGAPLPIC
Sbjct  653  SYPLYKFVREEIGTGLLTGEKIRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC  712



>gb|KJB46526.1| hypothetical protein B456_007G373700 [Gossypium raimondii]
Length=670

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV ++KLMSSTYLVALCQAIDLRHLEENL+N V
Sbjct  431  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDIIKLMSSTYLVALCQAIDLRHLEENLKNTV  490

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCSA YPLMQKLRQV
Sbjct  491  KNIVSQVAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQV  550

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG +E N STSIFQKIAAFE+ELK LLPKEVE +R ++ENGNPAIPN+IT+CR
Sbjct  551  LVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSIENGNPAIPNKITKCR  610

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  611  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAMCQGKVIDPMLECLKEWNGAPLPIC  670



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   415 bits (1066),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++AV
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSAV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAICEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   414 bits (1065),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   414 bits (1065),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLEENLR+AV
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLRSAV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQV
Sbjct  535  KNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EKN STS+FQKIAAFEDELKALLPKEVE AR+A ++GN AI N+I ECR
Sbjct  595  LVDHALANGENEKNASTSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIENKIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C+G IIDP+LECL  WNGAPLPIC
Sbjct  655  SYPLYKFVREELGTGLLTGENVRSPGEEFDKVFTAMCEGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   414 bits (1065),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+N V
Sbjct  476  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPC + YPLMQKLRQV
Sbjct  536  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYVDDPCLSTYPLMQKLRQV  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N + EKN++TSIFQKIA FEDELK LLPKEVE AR A ENG   IPN+I ECR
Sbjct  596  LVDHALVNVDGEKNLNTSIFQKIATFEDELKTLLPKEVESARIAYENGQCGIPNKIKECR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEKV SPGE CDK+FTA+C G I+DPLLECL  WNG+PLPIC
Sbjct  656  SYPLYKFVREELGTELLTGEKVISPGEECDKLFTAMCQGKIVDPLLECLGEWNGSPLPIC  715



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENL++ V
Sbjct  491  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTV  550

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AKR LT GVNGELHPSRFCEKDLL VV+REY+FAY DDPCSA YPLMQ+LRQV
Sbjct  551  KNTVSQLAKRVLTTGVNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLMQRLRQV  610

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELK +LPKEVE AR+A E+GN AIPNRI ECR
Sbjct  611  LVEHALTNGENEKNASTSIFQKITAFEEELKTILPKEVESARAAYESGNAAIPNRIVECR  670

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C G IIDP+L+CL  WNG PLPIC
Sbjct  671  SYPLYKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGNIIDPILDCLSGWNGEPLPIC  730



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   414 bits (1065),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLEENL++AV
Sbjct  476  TTHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQV+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  536  KNTVSQVSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLMQKLRQV  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
             VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECR
Sbjct  596  FVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNG+PLPIC
Sbjct  656  SYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   414 bits (1064),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 218/240 (91%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIAAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AGA84059.1| phenylalanine ammonia lyase [Picrorhiza kurrooa]
Length=713

 Score =   414 bits (1064),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYL+ALCQAIDLRHLEENLR AV
Sbjct  474  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLLALCQAIDLRHLEENLRLAV  533

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNT+SQVAKRTLTMG NGELHPSRF E DLLRVVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  534  KNTLSQVAKRTLTMGANGELHPSRFSELDLLRVVDREYVFAYVDDPCSATYPLMQKLRQV  593

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD+AL+NGE EKN STSIF KI AFE+ELK+LLPKEVE AR ALE GNPAI NRI ECR
Sbjct  594  LVDNALKNGESEKNASTSIFHKIEAFEEELKSLLPKEVESARIALEAGNPAIGNRIKECR  653

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREELGTE LTGEKV SPGE CDK+FTA+  G I+DPLL+CL+ WNGAPLPIC
Sbjct  654  SYPLYKFIREELGTEYLTGEKVISPGEECDKIFTAISKGLIVDPLLKCLEGWNGAPLPIC  713



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   414 bits (1064),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLEENL++AV
Sbjct  476  TTHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQV+KR LT G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  536  KNTVSQVSKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYVDDPCSATYPLMQKLRQV  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
             VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECR
Sbjct  596  FVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNG+PLPIC
Sbjct  656  SYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPIC  715



>ref|NP_001266106.1| phenylalanine ammonia-lyase 2 [Cicer arietinum]
 sp|Q9SMK9.1|PAL2_CICAR RecName: Full=Phenylalanine ammonia-lyase 2 [Cicer arietinum]
 emb|CAB60719.1| phenylalanine ammonia-lyase [Cicer arietinum]
Length=718

 Score =   414 bits (1064),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRH+EENL++ V
Sbjct  479  TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTFLVALCQAIDLRHIEENLKSVV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT+GVNGELHPSRFCEKDLL VV+REYVFAY DDPCSA YPLMQKLR V
Sbjct  539  KNTVSQVAKRVLTVGVNGELHPSRFCEKDLLNVVEREYVFAYIDDPCSATYPLMQKLRHV  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ E N STSIFQKI AFE ELK LLPKEVE  R  +ENGNPA+PNRI ECR
Sbjct  599  LVDHALENGDREGNSSTSIFQKIGAFEQELKTLLPKEVESVRVDVENGNPAVPNRIIECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEK++SPGE CDKVF A+CDG  IDP+L+CLK WNGAPLPIC
Sbjct  659  SYPLYKFVRENLGTSLLTGEKIRSPGEECDKVFAALCDGRFIDPMLDCLKEWNGAPLPIC  718



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   414 bits (1064),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQ+IDLRHLEENLR  V
Sbjct  473  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSATYLVALCQSIDLRHLEENLRQTV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRF EKDLLRVVDREY+FAY DDPCS  YPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTMGANGELHPSRFAEKDLLRVVDREYLFAYIDDPCSTTYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL N E+EK+ STSIFQKI AFEDELKA+LPKEVE +R ALE+GNPAIPNRI +CR
Sbjct  593  LVEHALNNTENEKSGSTSIFQKIEAFEDELKAVLPKEVESSRVALESGNPAIPNRIKDCR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+R+EL TE LTGE+V SPGEV DKVFTA+  G +IDP+LECLK WNGAPLPIC
Sbjct  653  SYPLYKFVRDELKTEFLTGERVTSPGEVLDKVFTAMSKGLMIDPMLECLKGWNGAPLPIC  712



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   414 bits (1065),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  487  TSHVQSAEQHNQDVNSLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKHTV  546

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT GVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQ LRQV
Sbjct  547  KNTVSQVAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQV  606

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKIAAFE+ELKALLPKEVE AR+A ENGN AI N+ITECR
Sbjct  607  LVEHALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECR  666

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE+LGT +LTGEKV+SPGE  DKV+TA+C G +IDP+LECL+ WNG PLPIC
Sbjct  667  SYPLYKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLECLRGWNGEPLPIC  726



>sp|Q04593.1|PAL2_PEA RecName: Full=Phenylalanine ammonia-lyase 2 [Pisum sativum]
 dbj|BAA00887.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=724

 Score =   414 bits (1064),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 212/239 (89%), Gaps = 0/239 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  485  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  544

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VS VAKRTLT G+NGELHPSRFCEKDLLRVVDRE+VF+Y DDPCSA YPLMQKLRQV
Sbjct  545  KNMVSHVAKRTLTTGINGELHPSRFCEKDLLRVVDREHVFSYIDDPCSATYPLMQKLRQV  604

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN++TSIFQKIA FEDELK LLPKEVE AR A ENGN  I N+I ECR
Sbjct  605  LVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESARGAYENGNTTISNKIKECR  664

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            SYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G IIDPLLECL  WNGAPLPI
Sbjct  665  SYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAICQGKIIDPLLECLGDWNGAPLPI  723



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   414 bits (1063),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  473  TSHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLT GVNGELHPSRFCEKDLL+VV+REY FAY DDPCS  YPLMQKLRQV
Sbjct  533  KNVVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVEREYTFAYIDDPCSGTYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD+AL NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN+I +CR
Sbjct  593  LVDYALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE CDKVF+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  653  SYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPIC  712



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   414 bits (1063),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   414 bits (1063),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 221/240 (92%), Gaps = 3/240 (1%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL NAV
Sbjct  482  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLSNAV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT+G NGELHP+RFCEK+L +VVDREY+FAY DDPC++ YPL+QKLRQV
Sbjct  542  KNTVSQVAKRTLTVGANGELHPARFCEKELPQVVDREYLFAYVDDPCNSTYPLIQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++N   EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECR
Sbjct  602  LVDHAMKN---EKNVNSSIFQKIVAFEDELKAVLPKEVENARAVVESGNPAIPNRITECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYK +R++LGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLK+WNGAP+PIC
Sbjct  659  SYPLYKLVRQQLGTELLTGEKVRSPGEDIEKVFTAICNGEIIDPLLECLKNWNGAPIPIC  718



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   414 bits (1063),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+L ALCQAIDLRHLEENLR+AV
Sbjct  476  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTFLFALCQAIDLRHLEENLRHAV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AKRTLTMGVNGELHPSRFCEKDL+RVVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  536  KNTVSQLAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQV  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+NG+ EK VSTSIFQKI +FE+ELKALLPKEVE AR A+E GN AI NRI ECR
Sbjct  596  LVEHALKNGDGEKTVSTSIFQKIESFEEELKALLPKEVESARMAVEGGNLAISNRIAECR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIREELG+E LTGEK  SPGE C+KVFTA+  G ++DPLL+C+K WNGAPLPIC
Sbjct  656  SYPLYKFIREELGSEFLTGEKTTSPGEECEKVFTALSKGLMVDPLLKCVKGWNGAPLPIC  715



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   413 bits (1062),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQAIDLRHLEENLR AV
Sbjct  469  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAIDLRHLEENLRVAV  528

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDL+RVVDREYVFAY DDPCS  YPLMQKLRQV
Sbjct  529  KNTVSQVAKRTLTMGPNGELHPSRFCEKDLIRVVDREYVFAYVDDPCSGTYPLMQKLRQV  588

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NGE EKN S+SIFQKI AFE+ELK+LLPKEVE AR ALE+GNP I NRI ECR
Sbjct  589  LVDHALKNGEAEKNPSSSIFQKIEAFEEELKSLLPKEVESARVALESGNPTIANRIRECR  648

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELGT +LTGEKV SPGE  DKVF A+  G I+DPLLECL++WNG PLPIC
Sbjct  649  SYPLYRFVREELGTGLLTGEKVISPGEESDKVFVALSKGLIVDPLLECLQTWNGQPLPIC  708



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   413 bits (1062),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+N V
Sbjct  468  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNTV  527

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDL++VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  528  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSATYPLMQKLRQV  587

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HA+ NGE EK  STSIFQKI AFE+ELK LLPKEVE  R  +ENGN A+PN+I ECR
Sbjct  588  LVEHAMANGEREKKSSTSIFQKIGAFEEELKTLLPKEVESTRIEIENGNAAVPNKIKECR  647

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG   LTGEKV+SPGE  DKVF+A+C G +IDP++ECLK WNGAPLP+C
Sbjct  648  SYPLYKFVREELGASFLTGEKVKSPGEEFDKVFSAICAGKLIDPMMECLKEWNGAPLPLC  707



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   413 bits (1062),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENLR AV
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLRQAV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCSA YPLMQKLRQ+
Sbjct  535  KNTVSQVAKRVLTAGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQI  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN  TS+FQKI+AFE+ELK LLPKEVE  R A E+GNPA  NRI ECR
Sbjct  595  LVEHALANGENEKNAGTSVFQKISAFEEELKTLLPKEVESVRIAYESGNPATANRIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTG+KV S GE  DKVFTA+C G IIDP+++CLK WNGAPLPIC
Sbjct  655  SYPLYKFVREELGTGLLTGDKVMSSGEEFDKVFTAMCQGKIIDPMMDCLKEWNGAPLPIC  714



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   414 bits (1063),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 221/240 (92%), Gaps = 3/240 (1%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYLVALCQAIDLRHLEENL NAV
Sbjct  483  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLSNAV  542

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT+G NGELHP+RFCEK+L +VVDREY+FAY DDPC++ YPL+QKLRQV
Sbjct  543  KNTVSQVAKRTLTVGANGELHPARFCEKELPQVVDREYLFAYVDDPCNSTYPLIQKLRQV  602

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHA++N   EKNV++SIFQKI AFEDELKA+LPKEVE AR+ +E+GNPAIPNRITECR
Sbjct  603  LVDHAMKN---EKNVNSSIFQKIVAFEDELKAVLPKEVENARAVVESGNPAIPNRITECR  659

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYK +R++LGTE+LTGEKV+SPGE  +KVFTA+C+G IIDPLLECLK+WNGAP+PIC
Sbjct  660  SYPLYKLVRQQLGTELLTGEKVRSPGEDIEKVFTAICNGEIIDPLLECLKNWNGAPIPIC  719



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NG LHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQKLRQV
Sbjct  531  KKTVSHVAKKTLTTGANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+EENL++ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECR
Sbjct  592  LVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLEENL++AV
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQV+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQV
Sbjct  535  KNTVSQVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
             VDHAL+NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECR
Sbjct  595  FVDHALENGENEKNFSTSVFQKIEAFEEELKALLPKEVESARAAYDSGNSAIDNKIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKVQSPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  655  SYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   413 bits (1061),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+EENL++ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHVEENLKSTV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECR
Sbjct  592  LVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQA+DLRHLEENL+N+V
Sbjct  484  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAVDLRHLEENLKNSV  543

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLT GVNGELHPSRFCEKDLLRVVDRE+VFAY DDPCSA YPLMQKLRQV
Sbjct  544  KNIVSQVAKRTLTTGVNGELHPSRFCEKDLLRVVDREHVFAYIDDPCSATYPLMQKLRQV  603

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN++TSIFQKIA FEDELK LLPKEVE  R+A E+GNP +PN+I  CR
Sbjct  604  LVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESTRAAYESGNPTVPNKINGCR  663

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            SYPLY+F+R+ELGT +LTGEKV SPGE CDK+FTA+C G IIDPLL+CL  WNGAPLPI
Sbjct  664  SYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPI  722



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   413 bits (1061),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT+G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTIGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVAL QAIDLRHLEENLR+ V
Sbjct  481  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALSQAIDLRHLEENLRSTV  540

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AK+ LT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA Y +MQKLRQV
Sbjct  541  KNTVSQIAKKVLTTGANGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYSMMQKLRQV  600

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKIAAFE+ELKA+LPKEVE AR+++ENGN AIPN+I ECR
Sbjct  601  LVEHALTNGENEKNASTSIFQKIAAFEEELKAVLPKEVESARASVENGNAAIPNKIKECR  660

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            S+PLYKF+REELGT +LTGE V SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  661  SFPLYKFVREELGTGLLTGENVMSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  720



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   413 bits (1061),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQA+DLRHLEENL+N+V
Sbjct  484  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAVDLRHLEENLKNSV  543

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLT GVNGELHPSRFCEKDLLRVVDRE+VFAY DDPCSA YPLMQKLRQV
Sbjct  544  KNIVSQVAKRTLTTGVNGELHPSRFCEKDLLRVVDREHVFAYIDDPCSATYPLMQKLRQV  603

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN++TSIFQKIA FEDELK LLPKEVE  R+A E+GNP +PN+I  CR
Sbjct  604  LVDHALVNGESEKNLNTSIFQKIATFEDELKTLLPKEVESTRAAYESGNPTVPNKINGCR  663

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            SYPLY+F+R+ELGT +LTGEKV SPGE CDK+FTA+C G IIDPLL+CL  WNGAPLPI
Sbjct  664  SYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPI  722



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   413 bits (1061),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NG LHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQKLRQV
Sbjct  531  KKTVSHVAKKTLTTGANGGLHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKLRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR A+E+GNP+ PNRI ECR
Sbjct  591  LVEHALSNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGAVESGNPSTPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   413 bits (1061),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   413 bits (1061),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGL+S+RKT EA+ +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  478  TNHVQSAEQHNQDVNSLGLVSSRKTAEAIDILKLMSSTFLVALCQAIDLRHLEENLKNTV  537

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            +NTVSQVAKR LT+G+NGELHPSRFCEKDLL++VDREYV+AY DDPCSA YPLMQKLR V
Sbjct  538  RNTVSQVAKRVLTVGINGELHPSRFCEKDLLKIVDREYVYAYIDDPCSATYPLMQKLRLV  597

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNG+ E N STSIFQKI AFE+EL ALLPKEVE +R  +ENGNPAIPNRI ECR
Sbjct  598  LVDHALQNGDKEVNSSTSIFQKIGAFEEELNALLPKEVESSRIEVENGNPAIPNRIKECR  657

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE LGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK W GAPLPIC
Sbjct  658  SYPLYKFVRENLGTTLLTGEKVKSPGEEFDKVFTALCEGKLIDPLLDCLKEWKGAPLPIC  717



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>ref|XP_006290660.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
 gb|EOA23558.1| hypothetical protein CARUB_v10016752mg [Capsella rubella]
Length=718

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV +CQA+DLRHLEENLR  V
Sbjct  479  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF YADDPCSA YPLMQKLRQV
Sbjct  539  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYADDPCSATYPLMQKLRQV  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  +GN AIPNRI ECR
Sbjct  599  IVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGSGNAAIPNRIKECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNGAP+PIC
Sbjct  659  SYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  718



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   413 bits (1061),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +L+LMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  485  TTHVQSAEQHNQDVNSLGLISSRKTYEAIEILQLMSSTFLIALCQAIDLRHLEENLKNSV  544

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+TLT+GVNGEL PSR CEKDLL+VVDRE+VFAY DDPCSA YPL QKLRQV
Sbjct  545  KNTVSQVAKKTLTIGVNGELQPSRLCEKDLLKVVDREHVFAYIDDPCSATYPLSQKLRQV  604

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN++TSIFQKIA FE+ELK+LLPKEVE AR+A E+GNP IPN+I  CR
Sbjct  605  LVDHALVNGESEKNLNTSIFQKIATFEEELKSLLPKEVESARTAYESGNPTIPNKINGCR  664

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE V SPGEVCDK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  665  SYPLYKFVREELGTGLLTGENVISPGEVCDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  724



>gb|ACA30407.1| phenylalanine ammonia-lyase [Stylosanthes guianensis]
Length=717

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/238 (81%), Positives = 212/238 (89%), Gaps = 0/238 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+N V
Sbjct  475  TSHVQSAEQHNQDVNSLGLISARKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNTV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL++VDREY FAY DDPCS  YPLMQKLRQV
Sbjct  535  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKIVDREYCFAYIDDPCSGTYPLMQKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL N E+ KNV+TSIFQKI  FE+ELK LLPKEVEGAR A  NG  AIPN+I ECR
Sbjct  595  LVEHALANAENGKNVNTSIFQKITTFEEELKTLLPKEVEGARIAYGNGQSAIPNKIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLP  208
            SYPLYKF+REELGTE+LTGEKV+SPGE CDK+FTA+C G IIDPLLEC+  WNGAPLP
Sbjct  655  SYPLYKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECVGEWNGAPLP  712



>gb|KHN02334.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=619

 Score =   409 bits (1052),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  380  TSHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  439

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQV+KR LT GVNGELHPSRFCEKDLL+VVDREYVF+Y DDPCSA YPLMQKLRQV
Sbjct  440  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLMQKLRQV  499

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E+EK+++TSIFQKIA FE+ELK  LPKEVE AR A E+G  AIPN+I ECR
Sbjct  500  LVDHALVNAENEKDMNTSIFQKIANFEEELKNFLPKEVESARVAYESGKAAIPNKIQECR  559

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  560  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  619



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRH+E NLRN V
Sbjct  482  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHVEGNLRNTV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AK+TLT G NGELHPSRFCEKDLL+ VDREYVF Y DDPCSA YPLMQKLRQV
Sbjct  542  KNTVSQIAKKTLTTGANGELHPSRFCEKDLLKAVDREYVFVYIDDPCSATYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKIA FE+EL A+LPKEVE AR  LENGN AIPN I +CR
Sbjct  602  LVEHALTNGESEKNTSTSIFQKIADFEEELHAVLPKEVESARVTLENGNAAIPNMIKDCR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECLK WNGAPLPIC
Sbjct  662  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFTAMCQGKIIDPMLECLKEWNGAPLPIC  721



>gb|ADR78835.1| phenylalanine ammonia lyase [Ziziphus jujuba]
Length=559

 Score =   407 bits (1047),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQA+DLRHLEE L+N V
Sbjct  320  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAVDLRHLEEQLKNTV  379

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTV QVAKR LT+G NGELHPSRFCEK+LL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  380  KNTVGQVAKRVLTLGSNGELHPSRFCEKELLQVVDREYVFAYIDDPCSATYPLMQKLRQV  439

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +V+HAL+NGE+E+N STSIFQKIAAFE+ELK LLPKEVE AR+  ENGNPAIPN+I E R
Sbjct  440  IVEHALKNGENERNASTSIFQKIAAFEEELKTLLPKEVESARAEYENGNPAIPNKIKERR  499

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG  +LTGEK +SPGE CDKVF+A+  G +IDP+LECLK WNGAPLPI 
Sbjct  500  SYPLYKFVREELGAGLLTGEKARSPGEECDKVFSAIYAGKLIDPMLECLKEWNGAPLPIS  559



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   412 bits (1059),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLEENLR+AV
Sbjct  475  TSHVQSAEQHNQNVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLRSAV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQV
Sbjct  535  KNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EKN STS+FQKIA FE+ELKALLPKEVE AR+A ++GN AI N+I ECR
Sbjct  595  LVDHALANGENEKNASTSVFQKIATFEEELKALLPKEVESARAAYDSGNSAIENKIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  655  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_010426963.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Camelina sativa]
Length=718

 Score =   412 bits (1059),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV +CQA+DLRHLEENLR  V
Sbjct  479  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLMQKLRQV
Sbjct  539  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQV  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPNRITECR
Sbjct  599  IVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRITECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  659  SYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKMIDPLMDCLKEWNGAPIPIC  718



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   412 bits (1060),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT E+V +LKLMS+T+LVALCQAIDLRH+EENLR  V
Sbjct  482  TSHVQSAEQHNQDVNSLGLISSRKTQESVDILKLMSTTFLVALCQAIDLRHMEENLRQTV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT G NGELHPSRFCEK+LL+VVDREYVFAYADDPCS+ YPLMQKLRQV
Sbjct  542  KNTVSQVAKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NG++EKN +TSIFQKI+AFE ELK LLPKEVE AR+A E+GN  IPNRI ECR
Sbjct  602  IVDHALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REE GT ILTG+KV+SPGE  DKVFTA+C G IIDPL++CLK WNGAPLPIC
Sbjct  662  SYPLYKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   412 bits (1060),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT E+V +LKLMS+T+LVALCQAIDLRH+EENLR  V
Sbjct  482  TSHVQSAEQHNQDVNSLGLISSRKTQESVDILKLMSTTFLVALCQAIDLRHMEENLRQTV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT G NGELHPSRFCEK+LL+VVDREYVFAYADDPCS+ YPLMQKLRQV
Sbjct  542  KNTVSQVAKRVLTTGANGELHPSRFCEKELLKVVDREYVFAYADDPCSSTYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NG++EKN +TSIFQKI+AFE ELK LLPKEVE AR+A E+GN  IPNRI ECR
Sbjct  602  IVDHALLNGDNEKNANTSIFQKISAFEAELKTLLPKEVEAARAAYESGNAPIPNRIMECR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REE GT ILTG+KV+SPGE  DKVFTA+C G IIDPL++CLK WNGAPLPIC
Sbjct  662  SYPLYKFVREEQGTGILTGDKVRSPGEEFDKVFTAMCQGKIIDPLMDCLKEWNGAPLPIC  721



>gb|ABV44807.1| phenylalanine ammonia lyase 2 [Eriobotrya japonica]
Length=330

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN V
Sbjct  92   TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  151

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  152  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQV  211

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELK LLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  212  LVEHALTNGESEKNASTSIFQKIGAFEEELKTLLPKEVESARSAIESGNAAVPNRIAECR  271

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLEC  238
            SYPLYKF+REELG E LTGEKV+SPGE CD+VF A+C G IIDP+L C
Sbjct  272  SYPLYKFVREELGGEYLTGEKVRSPGEECDRVFQAICQGKIIDPILGC  319



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   412 bits (1059),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+EENL++ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE E N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECR
Sbjct  592  LVEHALVNGERETNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   412 bits (1059),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+E++ +LKLMSST+L+ALCQAIDLRHLEENLRN V
Sbjct  473  TTHVQSAEQHNQDVNSLGLISSRKTNESIEILKLMSSTFLIALCQAIDLRHLEENLRNTV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAYADDPC A YPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N + EKN +TSIFQKIA FEDELKA+LPKEVE  R A ENG   I N+I ECR
Sbjct  593  LVDHALVNVDGEKNSNTSIFQKIATFEDELKAILPKEVESTRVAYENGQCGISNKIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G I+DPLLECL  WNGAPLPIC
Sbjct  653  SYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLLECLGEWNGAPLPIC  712



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   413 bits (1062),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LVALCQAIDLRHLEENLR AV
Sbjct  521  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTFLVALCQAIDLRHLEENLRLAV  580

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPC A YPLMQKLRQV
Sbjct  581  KNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFAYVDDPCLATYPLMQKLRQV  640

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKN STSIFQKI AFE EL+ LLPKEVEGARSALE GNPAI NRI ECR
Sbjct  641  LVDHALKNGDGEKNPSTSIFQKIEAFEAELEVLLPKEVEGARSALEAGNPAIGNRIKECR  700

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEK  SPGE  +KVFTA+ +G ++DPLL+CL+SWNG PLPIC
Sbjct  701  SYPLYKFVREELGAEFLTGEKATSPGEEGEKVFTALSNGLLVDPLLKCLESWNGEPLPIC  760



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   412 bits (1059),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENL++ V
Sbjct  485  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKSTV  544

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQ+AKR LT GVNGELHPSRFCEKDLL VV+REY+FAY DDPCSA YPLMQ+LRQV
Sbjct  545  KNTVSQLAKRLLTTGVNGELHPSRFCEKDLLMVVEREYLFAYIDDPCSATYPLMQRLRQV  604

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN +TSIFQKI+AFE+ELK +LPKEVE AR+A E+GN AIPNRI ECR
Sbjct  605  LVEHALTNGENEKNANTSIFQKISAFEEELKTILPKEVESARAACESGNAAIPNRIIECR  664

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELG E LTGEKV+SPGE CDKVFTA+C G IIDP+L+CL  WNG PLPIC
Sbjct  665  SYPLYKFVREELGGEFLTGEKVRSPGEECDKVFTAMCQGKIIDPILDCLSGWNGEPLPIC  724



>gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala]
Length=365

 Score =   400 bits (1028),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 210/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYL+ALCQAIDLRHLEENL+N V
Sbjct  126  TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTYLIALCQAIDLRHLEENLKNTV  185

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN V+QVAK+ LTMGVNGEL PSRFCEKDLL VVDRE+VF Y DDPCSA YPLMQKLRQV
Sbjct  186  KNAVNQVAKKVLTMGVNGELLPSRFCEKDLLTVVDREHVFDYIDDPCSATYPLMQKLRQV  245

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHALQNG  E + +TSIF KIAAFE ELK LLPKEVE AR  +ENG  AIPNRI ECR
Sbjct  246  LVDHALQNGNRENDANTSIFLKIAAFEKELKTLLPKEVESARIEVENGKSAIPNRIKECR  305

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELGT +LTGEKV+SPGE  DKVFTA+C+G +IDPLL+CLK WNGAPLP+C
Sbjct  306  SYPLYRFVREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLDCLKGWNGAPLPLC  365



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   412 bits (1058),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   412 bits (1058),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLV LCQAIDLRHLEENLR  V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVGLCQAIDLRHLEENLRTTV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS VAKR LTMG NGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLM+KLRQV
Sbjct  535  KNTVSLVAKRVLTMGANGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMEKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL+N   EKNVSTSIFQKI AFE+ELKALLPKEVE  R+ +E+GN  I NRI +CR
Sbjct  595  LVEHALKNEVSEKNVSTSIFQKIGAFEEELKALLPKEVESTRALIESGNGGIANRIKDCR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGTE+LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL SWNG+PLPIC
Sbjct  655  SYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLTSWNGSPLPIC  714



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   412 bits (1058),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENL+N V
Sbjct  479  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNTV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAK+TLT G NGELHPSRFCEKDLL+ VD EYVF+Y DDPCSA YPLMQKLRQV
Sbjct  539  KNIVSQVAKKTLTTGPNGELHPSRFCEKDLLKAVDHEYVFSYIDDPCSATYPLMQKLRQV  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NG +E N STSIFQKIAAFE+ELK LLPKEVE +R ++ENGN AIPN+I ECR
Sbjct  599  LVEHALSNGNNENNASTSIFQKIAAFEEELKTLLPKEVENSRVSVENGNAAIPNKIMECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVF A+C G +IDP+LECLK WNGAPLPIC
Sbjct  659  SYPLYKFVREELGTGLLTGEKVKSPGEEFDKVFIAICQGKVIDPMLECLKEWNGAPLPIC  718



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   411 bits (1057),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  468  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  527

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEK LL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  528  KKTVSHVAKKTLTTGANGELHPSRFCEKXLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  587

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  588  LVEHALNNGENEKNGSTSIFQKIVAFEEELKAVLPKEVESARGGVESGNPSIPNRIRECR  647

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  648  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  707



>ref|XP_006403711.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
 dbj|BAJ33750.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45164.1| hypothetical protein EUTSA_v10010153mg [Eutrema salsugineum]
Length=725

 Score =   412 bits (1058),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLEENLR  V
Sbjct  486  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTV  545

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLMQKLRQV
Sbjct  546  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQV  605

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKNV+TSIFQKI AFE+ELKA LPKEVE  R+A  NG  AIPNRI ECR
Sbjct  606  IVDHALCNGETEKNVATSIFQKIGAFEEELKATLPKEVEATRAAFGNGTAAIPNRIKECR  665

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNGAP+PIC
Sbjct  666  SYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPIC  725



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   411 bits (1057),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQA+DLRHLEENL++AV
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAVDLRHLEENLKHAV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMGVNGELHPSRFCEKDL+RVVDREYVFAY DDP SA YPLMQKLRQV
Sbjct  532  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLIRVVDREYVFAYIDDPSSATYPLMQKLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NG+ EKN STSIFQKI AFE+ELKALLPKEV  AR ALE+G+P + NRI ECR
Sbjct  592  LVDHALKNGDLEKNASTSIFQKIEAFEEELKALLPKEVGSARMALESGSPTVANRIAECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKFIRE+LG   LTGEK  SPGE C+KVFTA+ +G IIDPLLECL+ WNG PLPIC
Sbjct  652  SYPLYKFIREQLGAGFLTGEKAVSPGEECEKVFTALSNGLIIDPLLECLQGWNGQPLPIC  711



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   411 bits (1057),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+E++ +LKLMSST+L+ALCQAIDLRHLEENLRN V
Sbjct  473  TTHVQSAEQHNQDVNSLGLISSRKTNESIEILKLMSSTFLIALCQAIDLRHLEENLRNTV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAYADDPC A YPLMQKLRQV
Sbjct  533  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYADDPCLATYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N + EKN +TSIFQKIA FEDELKA+LPKEVE  R A ENG   I N+I ECR
Sbjct  593  LVDHALVNVDGEKNSNTSIFQKIATFEDELKAILPKEVESTRVAYENGQCGISNKIKECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE CDK+FTA+C G I+DPLLEC+  WNGAPLPIC
Sbjct  653  SYPLYKFVREELGTALLTGEKVISPGEECDKLFTAMCQGKIVDPLLECMGEWNGAPLPIC  712



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   411 bits (1056),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+EENL++ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQ LRQV
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQNLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECR
Sbjct  592  LVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   410 bits (1054),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  447  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  506

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQ +RQV
Sbjct  507  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQNVRQV  566

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  567  LVEHALNNGENEKNGSTSIFQKILAFEEELKAVLPKEVESARGGVESGNPSIPNRIKECR  626

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  627  SYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  686



>gb|KDO50672.1| hypothetical protein CISIN_1g037382mg [Citrus sinensis]
Length=555

 Score =   406 bits (1043),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENL++ V
Sbjct  316  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTV  375

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVA++ LT+G NGELHPSRFCEKDLL+  DRE+VFAY DDPCSA YPLMQKLRQV
Sbjct  376  KDTVSQVARKVLTVGANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQV  435

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECR
Sbjct  436  LVEHALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECR  495

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  496  SYPLYRLVREELGTNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLWEWNGAPLPIC  555



>gb|ACV30588.1| phenylalanine ammonia-lyase [Carica papaya]
Length=268

 Score =   395 bits (1016),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 209/239 (87%), Gaps = 0/239 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLEENL+N V
Sbjct  29   TTHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKNTV  88

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN+VSQV ++ L MG NGELHPSRFCEKDLL+VVDREY+FAYADDPCSA YPLMQKLRQV
Sbjct  89   KNSVSQVIRKVLFMGDNGELHPSRFCEKDLLKVVDREYLFAYADDPCSATYPLMQKLRQV  148

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N + +KN  +SIF KI AFE+ELK LLPKEVEG R  +E GN AIPNRI ECR
Sbjct  149  LVDHALINADRDKNSGSSIFHKIGAFEEELKTLLPKEVEGTRLEVEAGNAAIPNRIKECR  208

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVF+A+C G +IDPLL+CLK WNGAPLPI
Sbjct  209  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFSAMCAGKMIDPLLDCLKEWNGAPLPI  267



>sp|Q40910.1|PAL4_POPKI RecName: Full=Phenylalanine ammonia-lyase G4, partial [Populus 
sieboldii x Populus grandidentata]
 dbj|BAA07861.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=571

 Score =   406 bits (1044),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 209/240 (87%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +L +MS+T+LVALCQAIDLRH+EENL+N V
Sbjct  332  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILNVMSTTWLVALCQAIDLRHIEENLKNTV  391

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCSA YPLMQKLRQV
Sbjct  392  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRQV  451

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE E+N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRIT+ R
Sbjct  452  LVDHALMNGEKEQNSSTSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPNRITDRR  511

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP    LK WNGAPLP+C
Sbjct  512  SYPLYKFVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGAPLPLC  571



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   411 bits (1056),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVALCQAIDLRHLEENL++AV
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVALCQAIDLRHLEENLKSAV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSANYPLM+KLRQV
Sbjct  535  KNTVSHVSKRILTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSANYPLMKKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECR
Sbjct  595  LVDHALANGENEKNASTSVFQKIGAFEEELKALLPKEVESARAAYDSGNSAIENKIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  655  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   411 bits (1056),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT E+V +LKLMS+T+LVALCQAIDLRHLEENLR+AV
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTAESVDILKLMSTTFLVALCQAIDLRHLEENLRSAV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQV
Sbjct  535  KNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE+EKN STS+FQKI AFE+ELKALLPKEVE AR+A ++GN AI N+I ECR
Sbjct  595  LVDHALANGENEKNTSTSVFQKITAFEEELKALLPKEVESARAAYDSGNSAIENKIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPIC
Sbjct  655  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPIC  714



>gb|AFZ78653.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   411 bits (1056),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+EENL++ V
Sbjct  472  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKSTV  531

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDRE+VF+Y DDPCSA YPLMQ LRQV
Sbjct  532  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREHVFSYIDDPCSATYPLMQNLRQV  591

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE E+N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNPAIPNRI ECR
Sbjct  592  LVEHALVNGERERNSTTSIFQKIGSFEEELKTLLPKEVESARLEVENGNPAIPNRIKECR  651

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G +IDPLLECLK W+GAPLPIC
Sbjct  652  SYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPIC  711



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   410 bits (1055),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HV+SAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TYLVALCQAIDLRHLEENL++ V
Sbjct  471  TNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTV  530

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K TVS VAK+TLT G NGELHPSRFCEKDLL+VVDRE+VFAY DDPCSA YPLMQK+RQV
Sbjct  531  KKTVSHVAKKTLTTGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQV  590

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI AFE+ELKA+LPKEVE AR  +E+GNP+IPNRI ECR
Sbjct  591  LVEHALNNGENEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECR  650

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C+G IIDPLL+CL +WNGAPLPIC
Sbjct  651  SYPLYKFVREELGTGLLTGETVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC  710



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   411 bits (1056),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT E++ +LKLMS+T+LV LCQAIDLRHLEENL++ V
Sbjct  487  TSHVQSAEQHNQDVNSLGLISSRKTAESIDILKLMSTTFLVGLCQAIDLRHLEENLKHTV  546

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT GVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQ LRQV
Sbjct  547  KNTVSQVAKRVLTTGVNGELHPSRFCEKDLLKVVDREYVYAYIDDPCSATYPLMQTLRQV  606

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKIAAFE+ELKALLPKEVE AR+A ENGN AI N+ITECR
Sbjct  607  LVEHALTNGESEKNTSTSIFQKIAAFEEELKALLPKEVESARTAYENGNAAISNKITECR  666

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE+LGT +LTGEKV+SPGE  DKV+TA+C G +IDP+L CL  WNG PLPIC
Sbjct  667  SYPLYKFVREQLGTSLLTGEKVRSPGEEFDKVYTAMCQGKLIDPMLACLSGWNGEPLPIC  726



>emb|CDY18464.1| BnaA04g21230D [Brassica napus]
Length=423

 Score =   401 bits (1030),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 187/240 (78%), Positives = 208/240 (87%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV +CQAIDLRHLEENL+  V
Sbjct  184  TTHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVGICQAIDLRHLEENLKQTV  243

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV
Sbjct  244  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  303

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIF KI AFE+ELKA+LP EVE AR A +NG  AIPNRI ECR
Sbjct  304  IVDHALVNGESEKNAMTSIFHKIGAFEEELKAVLPDEVEAARVAYDNGTSAIPNRIKECR  363

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELGTE+LTGEK  SPGE  DKVFTA+C+G IIDPL+ECL  WNGAP+PIC
Sbjct  364  SYPLYRFVREELGTELLTGEKATSPGEEFDKVFTAICEGKIIDPLMECLDEWNGAPIPIC  423



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   411 bits (1056),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LV LCQAIDLRHLEENL++AV
Sbjct  477  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVGLCQAIDLRHLEENLKSAV  536

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVAK+ LTMGVNGELHPSRFCEKDLL+VVDREYV+AY DDPCSA YPLMQKLRQV
Sbjct  537  KSTVSQVAKKVLTMGVNGELHPSRFCEKDLLQVVDREYVYAYIDDPCSAVYPLMQKLRQV  596

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN STSIFQKI+ FE+ELK LLPKEVE ARSA+E+ N AIPN+I +CR
Sbjct  597  LVEHALSNGENEKNSSTSIFQKISLFEEELKVLLPKEVESARSAVESDNAAIPNQIKDCR  656

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+FIR ELGT +LTGEKV SPGE  DKVFTA+C+G +IDPLLECLK WNGAPLPIC
Sbjct  657  SYPLYRFIRGELGTALLTGEKVVSPGEEIDKVFTAMCEGKLIDPLLECLKEWNGAPLPIC  716



>gb|ADL09136.1| phenylanlanine ammonia-lyase [Brassica oleracea var. botrytis]
Length=723

 Score =   411 bits (1056),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 210/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVA+CQA+DLRHLEENLR  V
Sbjct  484  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSSTFLVAICQAVDLRHLEENLRQTV  543

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLMQKLRQV
Sbjct  544  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQV  603

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIFQKI AFE+ELK +LPKEV+ AR A  NG  AIPNRI ECR
Sbjct  604  IVDHALSNGETEKNAVTSIFQKIGAFEEELKMVLPKEVDAAREAYGNGTAAIPNRIKECR  663

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL+ECLK WNGAP+PIC
Sbjct  664  SYPLYKFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMECLKEWNGAPIPIC  723



>ref|XP_010515816.1| PREDICTED: phenylalanine ammonia-lyase 2 [Camelina sativa]
Length=718

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV +CQA+DLRHLEENLR  V
Sbjct  479  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVGICQAVDLRHLEENLRQTV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE VF Y DDPCSA YPLMQKLRQV
Sbjct  539  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVFTYVDDPCSATYPLMQKLRQV  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIFQKI AFE+ELKA+LPKEVE  R+A  NG  AIPNRITECR
Sbjct  599  IVDHALSNGETEKNAGTSIFQKIGAFEEELKAVLPKEVEATRAAYGNGTAAIPNRITECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELGT++LTGEKV SPGE  DKVFTA+C+G +IDPL++CLK WNGAP+PIC
Sbjct  659  SYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPIC  718



>sp|P19142.1|PAL2_PHAVU RecName: Full=Phenylalanine ammonia-lyase class 2; AltName: Full=Phenylalanine 
ammonia-lyase class II [Phaseolus vulgaris]
 prf||1807329A Phe ammonia lyase
Length=712

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  473  TSHVQSAEQHNQDVNSLGLISSRKTNEALEILKLMSSTFLVALCQAIDLRHLEENLKNTV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KN VSQVAKRTLT GVNGELHPSRFCEK LL+VV+REY FAY DDPCS  YPLMQKLRQV
Sbjct  533  KNVVSQVAKRTLTTGVNGELHPSRFCEKALLKVVEREYTFAYIDDPCSGTYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVD+AL NGE+EKN++TSIFQKIA+FE+ELK LLPKEVEGAR A EN   AIPN+I +CR
Sbjct  593  LVDYALANGENEKNLNTSIFQKIASFEEELKTLLPKEVEGARLAYENDQCAIPNKIKDCR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE CDKVF+A+C G IIDPLLECL  WNGAPLPIC
Sbjct  653  SYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPIC  712



>gb|KHN09507.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=701

 Score =   410 bits (1054),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  462  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  521

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQV+KR LT GVNGELHPSRFCEKDLL+VVDREY+F+Y DDPCSA YPLMQKLRQV
Sbjct  522  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLMQKLRQV  581

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E EK+V++SIFQKIA FE+ELK LLPKEVEGAR+A E+G  AIPN+I ECR
Sbjct  582  LVDHALVNAESEKDVNSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPNKIQECR  641

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPL+ECL  WNGAPLPI 
Sbjct  642  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPIS  701



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  474  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  533

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQV+KR LT GVNGELHPSRFCEKDLL+VVDREY+F+Y DDPCSA YPLMQKLRQV
Sbjct  534  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYIFSYIDDPCSATYPLMQKLRQV  593

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E EK+V++SIFQKIA FE+ELK LLPKEVEGAR+A E+G  AIPN+I ECR
Sbjct  594  LVDHALVNAESEKDVNSSIFQKIAIFEEELKNLLPKEVEGARAAYESGKAAIPNKIQECR  653

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPL+ECL  WNGAPLPI 
Sbjct  654  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPIS  713



>pir||S60043 phenylalanine ammonia-lyase (EC 4.3.1.5) 4 - Japanese aspen x 
large-toothed aspen (fragment)
Length=582

 Score =   406 bits (1044),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 209/240 (87%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +L +MS+T+LVALCQAIDLRH+EENL+N V
Sbjct  343  TNHVQSAEQHNQDVNSLGLISARKTAEAVEILNVMSTTWLVALCQAIDLRHIEENLKNTV  402

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDLL+VVDREYVF Y DDPCSA YPLMQKLRQV
Sbjct  403  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLLKVVDREYVFTYIDDPCSATYPLMQKLRQV  462

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE E+N STSIFQKI AFE+ELK LLPKEVE AR  LENGNPAIPNRIT+ R
Sbjct  463  LVDHALMNGEKEQNSSTSIFQKIGAFEEELKILLPKEVESARLELENGNPAIPNRITDRR  522

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV SPGE  DKVFTA+C G +IDP    LK WNGAPLP+C
Sbjct  523  SYPLYKFVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGAPLPLC  582



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLEENLR  V
Sbjct  486  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTV  545

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV
Sbjct  546  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  605

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECR
Sbjct  606  IVDHALVNGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  665

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  666  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLEENLR  V
Sbjct  486  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTV  545

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV
Sbjct  546  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  605

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECR
Sbjct  606  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  665

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  666  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   410 bits (1054),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+L+ALCQAIDLRHLEENL+N+V
Sbjct  473  TSHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLIALCQAIDLRHLEENLKNSV  532

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQV+KR LT GVNGELHPSRFCEKDLL+VVDREYVF+Y DDPCSA YPLMQKLRQV
Sbjct  533  KNTVSQVSKRILTTGVNGELHPSRFCEKDLLKVVDREYVFSYIDDPCSATYPLMQKLRQV  592

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E+EK+++TSIFQKIA FE+ELK  LPKEVE AR A E+G  AIPN+I ECR
Sbjct  593  LVDHALVNAENEKDMNTSIFQKIANFEEELKNFLPKEVESARVAYESGKAAIPNKIQECR  652

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  653  SYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC  712



>gb|AIZ76770.1| PAL2, partial [Pyrus pyrifolia]
Length=368

 Score =   398 bits (1023),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/226 (84%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN V
Sbjct  142  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  201

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+V
Sbjct  202  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  261

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  262  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  321

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLL  244
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L
Sbjct  322  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPIL  367



>gb|AAX84839.1| phenylalanine ammonia-lyase [Astragalus mongholicus]
Length=718

 Score =   410 bits (1054),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 211/239 (88%), Gaps = 0/239 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  479  TTHVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTFLVALCQAIDLRHLEENLKNTV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPC A YP+MQ LRQV
Sbjct  539  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCLATYPMMQSLRQV  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E EKNV+TSIFQKIA FEDELKALLPKEVE  R+A ENG  AIPN+I ECR
Sbjct  599  LVDHALANAEAEKNVNTSIFQKIATFEDELKALLPKEVENTRAAYENGQCAIPNKIKECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            SYPLYKF+R ELGT +LTGEKV SPGE  DK+FTA+C G IIDPLLECL  WNGAPLPI
Sbjct  659  SYPLYKFVRGELGTGLLTGEKVISPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPI  717



>ref|XP_006488063.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Citrus sinensis]
Length=714

 Score =   410 bits (1053),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 209/240 (87%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLEENL++ V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNT+SQV K+ LTMGVNGELHPSRFCEKDLL+VVDREYVF+YADDPCSA YPLMQKLRQV
Sbjct  535  KNTISQVVKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMQKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E  KN + SIF KI AFE+ELK LLPKEVE ARSA E+GN  IPNRI ECR
Sbjct  595  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG   LTGEK  SPGE CDKVFTA+C G IIDPLLECLK W+G+PLPIC
Sbjct  655  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  714



>gb|AIZ76768.1| PAL2, partial [Pyrus pyrifolia]
Length=367

 Score =   398 bits (1022),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/226 (84%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQ+IDLRHLEENLRN V
Sbjct  141  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQSIDLRHLEENLRNTV  200

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLT GVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQKLR+V
Sbjct  201  KNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLREV  260

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EKN STSIFQKI AFE+ELKALLPKEVE ARSA+E+GN A+PNRI ECR
Sbjct  261  LVEHALTNGESEKNASTSIFQKIGAFEEELKALLPKEVESARSAIESGNAAVPNRIAECR  320

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLL  244
            SYPLYKF+REELG E LTGEKV+SPGE CDKVF A+C G IIDP+L
Sbjct  321  SYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPIL  366



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   410 bits (1053),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSSTYLVALCQA+DLRH+EEN++ AV
Sbjct  477  TNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLVALCQAVDLRHVEENMKLAV  536

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKRTLTMGVNGELHPSRFCEK+L+RVVDREYVF Y DDPC A YPLMQKLRQV
Sbjct  537  KNTVSQVAKRTLTMGVNGELHPSRFCEKELIRVVDREYVFTYIDDPCLATYPLMQKLRQV  596

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL+NGE EKNVSTSIF KI AFE+ELKALLPKEVE AR ALE+G+PA+ NRI ECR
Sbjct  597  LVDHALKNGESEKNVSTSIFHKIEAFEEELKALLPKEVESARIALESGSPAVANRIEECR  656

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            S+PLYKFIREELGT  LTGEK  SPGE C+KVF A+ +G IIDPLLECL+ WNG PLPIC
Sbjct  657  SFPLYKFIREELGTGFLTGEKAVSPGEECEKVFAALSNGLIIDPLLECLQGWNGEPLPIC  716



>ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
 gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
Length=726

 Score =   410 bits (1053),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLEENL+  V
Sbjct  487  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTV  546

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV
Sbjct  547  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  606

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECR
Sbjct  607  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  666

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAPLPIC
Sbjct  667  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPLPIC  726



>dbj|BAM28965.1| phenylalanine ammonia lyase, partial [Lilium hybrid division 
I]
Length=301

 Score =   395 bits (1015),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 207/240 (86%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQA+DLRHLEENL+ AV
Sbjct  62   TNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTFLVALCQAVDLRHLEENLKAAV  121

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMGVNGELHPSRFCEKDL++V+DREYVFAYADDPCSA YPLMQKLR V
Sbjct  122  KNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVIDREYVFAYADDPCSAAYPLMQKLRGV  181

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE EK V TSIFQKIAAFE+ELK  LPKEVEG R A +NG   I NRI+ECR
Sbjct  182  LVEHALVNGEKEKEVGTSIFQKIAAFEEELKVTLPKEVEGVRMAFDNGTNVIANRISECR  241

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG   LTGEKV+SPGE  +KVF A+    +IDPLLECL  WNGAPLPIC
Sbjct  242  SYPLYRFVREELGAGYLTGEKVRSPGEEFNKVFIAMSQWKVIDPLLECLSDWNGAPLPIC  301



>ref|XP_009103852.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Brassica rapa]
Length=718

 Score =   409 bits (1052),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLEENLR AV
Sbjct  479  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQAV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGE+HPSRFCE+DLL+VVDRE VF Y DDPCSA+YPLMQKLRQV
Sbjct  539  KNTVSQVAKKVLTTGVNGEMHPSRFCERDLLKVVDREQVFTYVDDPCSASYPLMQKLRQV  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKNV TSIFQKI AFE+ELK +LPKEV+ AR A  NGN AIPNRI ECR
Sbjct  599  IVDHALANGETEKNVETSIFQKIGAFEEELKTVLPKEVDAAREAYGNGNAAIPNRIKECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+R ELGT++LTGEKV SPGE  DKVFTA+C+G IIDPL++CLK WNGAP+P+C
Sbjct  659  SYPLYKFVRGELGTKLLTGEKVVSPGEEFDKVFTAMCEGKIIDPLMDCLKEWNGAPIPLC  718



>sp|P45731.1|PAL1_POPKI RecName: Full=Phenylalanine ammonia-lyase G1 [Populus sieboldii 
x Populus grandidentata]
 dbj|BAA06337.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=682

 Score =   408 bits (1049),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LV LCQA+DLRH+EENL+N V
Sbjct  443  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKNTV  502

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSR CEKDLL++VD+E+VFAY DDPCSA YPLMQKLRQV
Sbjct  503  KNTVSQVAKRVLTMGFNGELHPSRLCEKDLLKLVDKEHVFAYIDDPCSATYPLMQKLRQV  562

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE E N +TSIFQKI +FE+ELK LLPKEVE AR  +ENGNP +PNRI ECR
Sbjct  563  LVEHALVNGERETNSTTSIFQKIRSFEEELKTLLPKEVESARLEVENGNPVVPNRIKECR  622

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +LTGEKV+SPGE  DKVFTA+C G ++DPLLECLK WNGAPLPIC
Sbjct  623  SYPLYKFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGAPLPIC  682



>ref|XP_006424538.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
 gb|ESR37778.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
Length=714

 Score =   409 bits (1051),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 210/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLEENL++ V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNT+SQVAK+ LTMGVNGELHPSRFCEKDLL+VVDREYVF+YADDPCSA YPLM+KLRQV
Sbjct  535  KNTISQVAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMRKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E  KN + SIF KI AFE+ELK LLPKEVE ARSA E+GN  IPNRI ECR
Sbjct  595  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG   LTGEK  SPGE CDKVFTA+C G IIDPLLECLK W+G+PLPIC
Sbjct  655  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  714



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   409 bits (1051),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 210/239 (88%), Gaps = 0/239 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMS++YLVALCQ+IDLRHLEEN+R+ V
Sbjct  474  TNHVQSAEQHNQDVNSLGLISARKTSEAVEILKLMSTSYLVALCQSIDLRHLEENMRSTV  533

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LTMGVNGELHPSRFCEKDLLRVVDREYVFAY DDPCSA YPLMQKLR+V
Sbjct  534  KNTVSQVAKKVLTMGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLREV  593

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE EKN STSIFQKI AFEDELKA+LPKEVEG R++ E+G  AIPNRI  CR
Sbjct  594  LVDHALNNGETEKNTSTSIFQKIGAFEDELKAILPKEVEGVRTSYEDGTLAIPNRIKACR  653

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            SYPLY+F+REELGT  LTGEKV SPGE  DK FT +C G IIDPLLEC++ WNG PLPI
Sbjct  654  SYPLYRFVREELGTGFLTGEKVTSPGEEFDKGFTPMCKGQIIDPLLECVEGWNGVPLPI  712



>ref|XP_006481493.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
Length=721

 Score =   409 bits (1052),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENL++ V
Sbjct  482  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVA++ LT+G NGELHPSRFCEKDLL+  DRE+VFAY DDPCSA YPLMQKLRQV
Sbjct  542  KDTVSQVARKVLTVGANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECR
Sbjct  602  LVEHALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  662  SYPLYRLVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>emb|CAB42793.1| phenylalanine-ammonia lyase [Citrus clementina x Citrus reticulata]
Length=721

 Score =   409 bits (1052),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 213/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENL++ V
Sbjct  482  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTV  541

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+TVSQVA++ LT+G NGELHPSRFCEKDLL+  DRE+VFAY DDPCSA YPLMQKLRQV
Sbjct  542  KDTVSQVARKVLTVGANGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQV  601

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HAL NGE+EKN ++SIFQKIAAFE+ELKA+LPKEVE AR  +ENGNP IPNRI ECR
Sbjct  602  LVEHALNNGENEKNANSSIFQKIAAFEEELKAVLPKEVENARQTVENGNPTIPNRIKECR  661

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+ +REELGT  LTGEKV SPGE  DKVFTA+C G IIDP+LECL+ WNGAPLPIC
Sbjct  662  SYPLYRLVREELGTNFLTGEKVTSPGEKFDKVFTAMCQGKIIDPMLECLREWNGAPLPIC  721



>ref|XP_010516949.1| PREDICTED: phenylalanine ammonia-lyase 1 [Camelina sativa]
Length=727

 Score =   409 bits (1052),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 188/240 (78%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLEENLR  V
Sbjct  488  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLRQTV  547

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV
Sbjct  548  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  607

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECR
Sbjct  608  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  667

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REE+GTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  668  SYPLYRFVREEIGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  727



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   409 bits (1051),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 210/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLISARKT EAV +LKLMSSTYL+ALCQAIDLRHLEENL++ V
Sbjct  475  TNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLIALCQAIDLRHLEENLKSTV  534

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            K+T+SQVAK+ LTMGVNGELHPSRFCEKDLL+VVDREYVF+YADDPCSA YPLMQKLRQV
Sbjct  535  KSTISQVAKKVLTMGVNGELHPSRFCEKDLLKVVDREYVFSYADDPCSATYPLMQKLRQV  594

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL N E  KN + SIF KI AFE+ELK LLPKEVE ARSA E+GN  IPNRI ECR
Sbjct  595  LVDHALTNNEDLKNANASIFLKIGAFEEELKTLLPKEVESARSAFESGNLEIPNRIKECR  654

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELG   LTGEK  SPGE CDKVFTA+C G IIDPLLECLK W+G+PLPIC
Sbjct  655  SYPLYRFVREELGARYLTGEKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPIC  714



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   409 bits (1051),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EA+ +LKLMSST+LVA+CQA+DLRHLEENL++ V
Sbjct  479  TTHVQSAEQHNQDVNSLGLISSRKTQEAIDILKLMSSTFLVAICQAVDLRHLEENLKSTV  538

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LT G NGELHPSRFCEKDLL+VVDREYVFAYADDPCSA YPLMQKLRQV
Sbjct  539  KNTVSQVAKRVLTTGANGELHPSRFCEKDLLKVVDREYVFAYADDPCSATYPLMQKLRQV  598

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LVDHAL NGE E+N +TS+FQKIAAFE+ELK LLPKE+EG R A E+GN AIPNRI ECR
Sbjct  599  LVDHALANGEGERNPNTSVFQKIAAFEEELKDLLPKEIEGVRLAYESGNTAIPNRIKECR  658

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+RE  GT +LTGEKV SPGE  DKVFTA+C G IIDP+L+CL+ W+G PLPIC
Sbjct  659  SYPLYKFVREVAGTSLLTGEKVTSPGEELDKVFTAICQGKIIDPILDCLEEWDGTPLPIC  718



>ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   409 bits (1052),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 188/240 (78%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+T+LVA+CQA+DLRHLEENL+  V
Sbjct  486  TSHVQSAEQHNQDVNSLGLISSRKTSEAVDILKLMSTTFLVAICQAVDLRHLEENLKQTV  545

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+ LT GVNGELHPSRFCEKDLL+VVDRE V+ YADDPCSA YPL+QKLRQV
Sbjct  546  KNTVSQVAKKVLTTGVNGELHPSRFCEKDLLKVVDREQVYTYADDPCSATYPLIQKLRQV  605

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            +VDHAL NGE EKN  TSIF KI AFE+ELKA+LPKEVE AR+A +NG  AIPNRI ECR
Sbjct  606  IVDHALINGESEKNAVTSIFHKIGAFEEELKAVLPKEVEAARAAYDNGTSAIPNRIKECR  665

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLY+F+REELGTE+LTGEKV SPGE  DKVFTA+C+G IIDP++ECL  WNGAP+PIC
Sbjct  666  SYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPIC  725



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   409 bits (1051),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMS+TY+VALCQAIDLRHLEE L++ V
Sbjct  476  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSATYMVALCQAIDLRHLEETLKSTV  535

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTV Q+AKR LTMGVNGELHPSRFCEKDLL+VVDREYVFAY DDPCSA YPLMQ LRQV
Sbjct  536  KNTVGQLAKRVLTMGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQNLRQV  595

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV HAL NGE+EKN +TSIFQKI AFE+ELKALLPKEVEGAR A E+G+PA+PNRI ECR
Sbjct  596  LVQHALLNGENEKNSNTSIFQKITAFEEELKALLPKEVEGARIAYESGSPAVPNRIKECR  655

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYP+YKF+RE+L T +LTGEKV+SPGE  DKVF+A+C+G +IDPLL+CL+ WNGAPLPIC
Sbjct  656  SYPIYKFVREQLHTGLLTGEKVRSPGEEFDKVFSAMCEGKMIDPLLDCLRDWNGAPLPIC  715



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   409 bits (1051),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 195/241 (81%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKT-DEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNA  745
            T HVQSAEQHNQ VNSLGLIS+RKT  EAV +LKLMS+T+LVALCQA+DLRHLEENLR+A
Sbjct  475  TSHVQSAEQHNQDVNSLGLISSRKTGSEAVDILKLMSTTFLVALCQAVDLRHLEENLRSA  534

Query  744  VKNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQ  565
            VKNTVS V+KR LT G NGELHPSRFCEK+LL+VVDRE VFAYADDPCSA YPLMQKLRQ
Sbjct  535  VKNTVSHVSKRVLTTGANGELHPSRFCEKELLKVVDREDVFAYADDPCSATYPLMQKLRQ  594

Query  564  VLVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITEC  385
            VLVDHAL NGE+EKN STS+FQKIAAFEDELKALLPKEVE AR+A ++GN AI N+I EC
Sbjct  595  VLVDHALANGENEKNASTSVFQKIAAFEDELKALLPKEVESARAAYDSGNSAIENKIKEC  654

Query  384  RSYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPI  205
            RSYPLYKF+REELGT +LTGE V+SPGE  DKVFTA+C G IIDP+LECL  WNGAPLPI
Sbjct  655  RSYPLYKFVREELGTGLLTGENVRSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGAPLPI  714

Query  204  C  202
            C
Sbjct  715  C  715



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   409 bits (1050),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 190/238 (80%), Positives = 214/238 (90%), Gaps = 0/238 (0%)
 Frame = -2

Query  915  HVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAVKN  736
            HVQSAEQHNQ VNSLGLIS+RKT+EA+ +LKLMSSTYL+ALCQAIDLRHLEENL++ V +
Sbjct  477  HVQSAEQHNQDVNSLGLISSRKTNEAIEILKLMSSTYLIALCQAIDLRHLEENLKSTVNS  536

Query  735  TVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQVLV  556
            TVSQVAKRTLT GVNGELH SRFCE+DLL+VVDRE+VF Y DDP SA YPLMQKLRQVLV
Sbjct  537  TVSQVAKRTLTTGVNGELHSSRFCERDLLKVVDREHVFTYIDDPTSATYPLMQKLRQVLV  596

Query  555  DHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECRSY  376
            DHAL+NG++EKN STSIFQKIAAFE+ELK LLPKEVE AR+A ENGN ++PN+I ECRSY
Sbjct  597  DHALENGDNEKNSSTSIFQKIAAFEEELKTLLPKEVERARTAYENGNSSVPNKIKECRSY  656

Query  375  PLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            PLYKF+RE+LG  +LTGEK +SPGE CDKVFTA+C G IIDPLLECL  WNGAPLPIC
Sbjct  657  PLYKFVREDLGAGLLTGEKTRSPGEECDKVFTALCQGKIIDPLLECLGEWNGAPLPIC  714



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   409 bits (1051),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSSTYLVALCQAIDLRHLEENLRN V
Sbjct  489  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNTV  548

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAK+TLT G NGELHPSRFCEKDLL+ VDREYVFAY DDPCSA YPLMQKLRQV
Sbjct  549  KNTVSQVAKKTLTTGNNGELHPSRFCEKDLLKAVDREYVFAYIDDPCSATYPLMQKLRQV  608

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HA  NG++EK+ +TSIFQKI AFEDE KA LPKEVEG R +LENGN  IPN+I  CR
Sbjct  609  LVEHAFANGDNEKDTNTSIFQKITAFEDEFKAALPKEVEGTRVSLENGNATIPNKIKGCR  668

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT +L+GE+ +SPGE  DKVF A+C+G IIDP++ECLK WNGAPLPIC
Sbjct  669  SYPLYKFVREELGTGLLSGEQGKSPGEEFDKVFIAMCEGKIIDPMMECLKGWNGAPLPIC  728



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   409 bits (1050),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = -2

Query  921  TXHVQSAEQHNQGVNSLGLISARKTDEAVGVLKLMSSTYLVALCQAIDLRHLEENLRNAV  742
            T HVQSAEQHNQ VNSLGLIS+RKT EAV +LKLMSST+LVALCQAIDLRHLEENL+N V
Sbjct  468  TNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTV  527

Query  741  KNTVSQVAKRTLTMGVNGELHPSRFCEKDLLRVVDREYVFAYADDPCSANYPLMQKLRQV  562
            KNTVSQVAKR LTMG NGELHPSRFCEKDL++VVDREYVFAY DDPCSA YPL QKLRQV
Sbjct  528  KNTVSQVAKRVLTMGFNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSATYPLTQKLRQV  587

Query  561  LVDHALQNGEHEKNVSTSIFQKIAAFEDELKALLPKEVEGARSALENGNPAIPNRITECR  382
            LV+HA+ NG+ EKN STSIFQKI AFE+ELK LLPKEVE  R  +ENGN A+PN+I ECR
Sbjct  588  LVEHAMANGDAEKNSSTSIFQKIGAFEEELKTLLPKEVESTRIEIENGNAAVPNKIKECR  647

Query  381  SYPLYKFIREELGTEILTGEKVQSPGEVCDKVFTAVCDGGIIDPLLECLKSWNGAPLPIC  202
            SYPLYKF+REELGT  LTGEK +SPGE  DKVF+A+C G +IDP++ECLK WNGAPLP+C
Sbjct  648  SYPLYKFVREELGTSFLTGEKARSPGEEFDKVFSAMCAGKLIDPMMECLKEWNGAPLPLC  707



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2159265676996