BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1179

Length=860
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592532.1|  PREDICTED: probable inactive receptor kinase...    325   1e-102   Nicotiana tomentosiformis
ref|XP_009797253.1|  PREDICTED: probable inactive receptor kinase...    321   3e-101   Nicotiana sylvestris
gb|AGO98727.1|  ovary receptor kinase 11                                320   1e-100   Solanum chacoense
ref|XP_006364614.1|  PREDICTED: probable inactive receptor kinase...    318   4e-100   Solanum tuberosum [potatoes]
gb|AGL74765.1|  ovary receptor kinase 11                                317   1e-99    Solanum chacoense
ref|XP_004250172.1|  PREDICTED: probable inactive receptor kinase...    316   3e-99    Solanum lycopersicum
gb|KJB10488.1|  hypothetical protein B456_001G203900                    312   4e-98    Gossypium raimondii
ref|XP_011099906.1|  PREDICTED: probable inactive receptor kinase...    315   7e-98    Sesamum indicum [beniseed]
ref|XP_007032119.1|  Receptor-like kinase 1                             312   1e-97    
emb|CDP01639.1|  unnamed protein product                                310   1e-96    Coffea canephora [robusta coffee]
gb|KJB43131.1|  hypothetical protein B456_007G186000                    308   1e-96    Gossypium raimondii
ref|XP_002279127.2|  PREDICTED: probable inactive receptor kinase...    310   2e-96    Vitis vinifera
gb|KHG20222.1|  putative inactive receptor kinase -like protein         308   2e-96    Gossypium arboreum [tree cotton]
gb|KHG20593.1|  putative inactive receptor kinase -like protein         307   4e-96    Gossypium arboreum [tree cotton]
gb|ACU19868.1|  unknown                                                 295   1e-95    Glycine max [soybeans]
ref|XP_009356011.1|  PREDICTED: probable inactive receptor kinase...    306   3e-95    Pyrus x bretschneideri [bai li]
ref|XP_008393435.1|  PREDICTED: probable inactive receptor kinase...    305   6e-95    Malus domestica [apple tree]
ref|XP_008240124.1|  PREDICTED: probable inactive receptor kinase...    305   8e-95    Prunus mume [ume]
emb|CBI33513.3|  unnamed protein product                                304   9e-95    Vitis vinifera
ref|XP_010087022.1|  putative inactive receptor kinase                  305   9e-95    Morus notabilis
ref|XP_002317861.2|  hypothetical protein POPTR_0012s04170g             305   1e-94    
ref|XP_004137511.1|  PREDICTED: probable inactive receptor kinase...    305   1e-94    Cucumis sativus [cucumbers]
gb|KHN10529.1|  Putative inactive receptor kinase                       300   1e-94    Glycine soja [wild soybean]
ref|XP_002276147.1|  PREDICTED: probable inactive receptor kinase...    304   1e-94    Vitis vinifera
gb|AET05610.2|  LRR receptor-like kinase                                305   1e-94    Medicago truncatula
ref|XP_007211289.1|  hypothetical protein PRUPE_ppa002536mg             304   1e-94    Prunus persica
ref|XP_012088046.1|  PREDICTED: probable inactive receptor kinase...    304   2e-94    Jatropha curcas
ref|XP_008466324.1|  PREDICTED: probable inactive receptor kinase...    304   2e-94    Cucumis melo [Oriental melon]
ref|XP_003631134.1|  Atypical receptor-like kinase MARK                 305   3e-94    
ref|XP_007036910.1|  Receptor-like kinase 1                             303   4e-94    
ref|XP_002531014.1|  ATP binding protein, putative                      303   4e-94    Ricinus communis
ref|XP_008374868.1|  PREDICTED: probable inactive receptor kinase...    303   4e-94    
ref|XP_011085845.1|  PREDICTED: probable inactive receptor kinase...    302   6e-94    Sesamum indicum [beniseed]
ref|XP_010268752.1|  PREDICTED: probable inactive receptor kinase...    303   1e-93    Nelumbo nucifera [Indian lotus]
ref|XP_009759771.1|  PREDICTED: probable inactive receptor kinase...    301   2e-93    Nicotiana sylvestris
ref|XP_011012967.1|  PREDICTED: probable inactive receptor kinase...    301   2e-93    Populus euphratica
ref|XP_006451587.1|  hypothetical protein CICLE_v10007673mg             299   2e-93    
ref|XP_010271320.1|  PREDICTED: probable inactive receptor kinase...    301   4e-93    Nelumbo nucifera [Indian lotus]
emb|CDO98323.1|  unnamed protein product                                299   6e-93    Coffea canephora [robusta coffee]
emb|CAN82203.1|  hypothetical protein VITISV_018964                     299   7e-93    Vitis vinifera
gb|KHN45250.1|  Putative inactive receptor kinase                       295   8e-93    Glycine soja [wild soybean]
ref|XP_007160555.1|  hypothetical protein PHAVU_002G331400g             300   1e-92    Phaseolus vulgaris [French bean]
ref|XP_002322122.2|  hypothetical protein POPTR_0015s04920g             299   1e-92    
ref|XP_009360057.1|  PREDICTED: probable inactive receptor kinase...    299   1e-92    Pyrus x bretschneideri [bai li]
gb|KHN00136.1|  Putative inactive receptor kinase                       297   2e-92    Glycine soja [wild soybean]
ref|XP_006451586.1|  hypothetical protein CICLE_v10007673mg             299   2e-92    Citrus clementina [clementine]
gb|KDO50809.1|  hypothetical protein CISIN_1g037905mg                   297   2e-92    Citrus sinensis [apfelsine]
ref|XP_006430596.1|  hypothetical protein CICLE_v10011289mg             298   2e-92    Citrus clementina [clementine]
gb|KDO62795.1|  hypothetical protein CISIN_1g006055mg                   299   2e-92    Citrus sinensis [apfelsine]
ref|XP_003525182.1|  PREDICTED: probable inactive receptor kinase...    298   2e-92    Glycine max [soybeans]
ref|XP_009617419.1|  PREDICTED: probable inactive receptor kinase...    298   3e-92    Nicotiana tomentosiformis
gb|KJB08440.1|  hypothetical protein B456_001G081900                    297   4e-92    Gossypium raimondii
gb|KHN43642.1|  Putative inactive receptor kinase                       291   4e-92    Glycine soja [wild soybean]
ref|XP_006482115.1|  PREDICTED: probable inactive receptor kinase...    297   4e-92    Citrus sinensis [apfelsine]
ref|XP_003530966.1|  PREDICTED: probable inactive receptor kinase...    298   4e-92    Glycine max [soybeans]
ref|XP_002533427.1|  ATP binding protein, putative                      298   5e-92    Ricinus communis
gb|KHG17549.1|  putative inactive receptor kinase -like protein         296   8e-92    Gossypium arboreum [tree cotton]
ref|XP_006372561.1|  hypothetical protein POPTR_0017s02820g             294   9e-92    
ref|XP_004503256.1|  PREDICTED: probable inactive receptor kinase...    299   1e-91    
ref|XP_004299514.1|  PREDICTED: probable inactive receptor kinase...    296   1e-91    Fragaria vesca subsp. vesca
ref|XP_010069429.1|  PREDICTED: probable inactive receptor kinase...    296   2e-91    Eucalyptus grandis [rose gum]
gb|EYU30898.1|  hypothetical protein MIMGU_mgv1a003238mg                295   2e-91    Erythranthe guttata [common monkey flower]
ref|XP_002305880.1|  hypothetical protein POPTR_0004s08450g             295   2e-91    Populus trichocarpa [western balsam poplar]
ref|XP_006365414.1|  PREDICTED: probable inactive receptor kinase...    295   2e-91    Solanum tuberosum [potatoes]
gb|ACR38562.1|  unknown                                                 285   3e-91    Zea mays [maize]
gb|ACL52878.1|  unknown                                                 282   3e-91    Zea mays [maize]
ref|XP_010671388.1|  PREDICTED: probable inactive receptor kinase...    295   3e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004241646.1|  PREDICTED: probable inactive receptor kinase...    295   4e-91    Solanum lycopersicum
ref|XP_011007233.1|  PREDICTED: probable inactive receptor kinase...    294   5e-91    Populus euphratica
ref|XP_011002185.1|  PREDICTED: probable inactive receptor kinase...    294   5e-91    Populus euphratica
ref|XP_011035563.1|  PREDICTED: probable inactive receptor kinase...    294   1e-90    Populus euphratica
ref|XP_003530064.1|  PREDICTED: probable inactive receptor kinase...    295   1e-90    Glycine max [soybeans]
ref|XP_012086419.1|  PREDICTED: probable inactive receptor kinase...    293   3e-90    Jatropha curcas
gb|EEC74787.1|  hypothetical protein OsI_10572                          284   4e-90    Oryza sativa Indica Group [Indian rice]
gb|KEH26683.1|  LRR receptor-like kinase family protein                 293   5e-90    Medicago truncatula
ref|XP_011001561.1|  PREDICTED: probable inactive receptor kinase...    291   1e-89    Populus euphratica
ref|XP_007152668.1|  hypothetical protein PHAVU_004G149100g             291   2e-89    Phaseolus vulgaris [French bean]
gb|KJB30188.1|  hypothetical protein B456_005G133200                    290   3e-89    Gossypium raimondii
ref|XP_004512763.1|  PREDICTED: probable inactive receptor kinase...    290   6e-89    Cicer arietinum [garbanzo]
ref|XP_009778793.1|  PREDICTED: probable inactive receptor kinase...    290   1e-88    Nicotiana sylvestris
gb|EPS69043.1|  hypothetical protein M569_05720                         287   2e-88    Genlisea aurea
gb|ACR34746.1|  unknown                                                 283   2e-88    Zea mays [maize]
ref|XP_010670123.1|  PREDICTED: probable inactive receptor kinase...    288   4e-88    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG00875.1|  putative inactive receptor kinase -like protein         284   5e-87    Gossypium arboreum [tree cotton]
gb|AGO98729.1|  ovary receptor kinase 27                                284   9e-87    Solanum chacoense
ref|XP_006826909.1|  PREDICTED: probable inactive receptor kinase...    283   1e-86    Amborella trichopoda
ref|XP_006341503.1|  PREDICTED: probable inactive receptor kinase...    284   1e-86    
gb|AFW89165.1|  putative leucine-rich repeat receptor-like protei...    283   3e-86    
ref|NP_001152341.1|  LOC100285980 precursor                             283   3e-86    Zea mays [maize]
gb|EMT33198.1|  hypothetical protein F775_43654                         274   4e-86    
gb|KJB10379.1|  hypothetical protein B456_001G198100                    281   4e-86    Gossypium raimondii
gb|AAN05336.1|  Putative leucine-rich repeat transmembrane protei...    283   4e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010036979.1|  PREDICTED: probable inactive receptor kinase...    282   4e-86    Eucalyptus grandis [rose gum]
ref|XP_008660393.1|  PREDICTED: probable inactive receptor kinase...    282   6e-86    Zea mays [maize]
ref|NP_001049422.1|  Os03g0223000                                       283   9e-86    
ref|XP_011083189.1|  PREDICTED: probable inactive receptor kinase...    281   1e-85    Sesamum indicum [beniseed]
ref|XP_004235768.1|  PREDICTED: probable inactive receptor kinase...    280   3e-85    Solanum lycopersicum
ref|XP_004985160.1|  PREDICTED: probable inactive receptor kinase...    280   5e-85    Setaria italica
gb|KHN41064.1|  Putative inactive receptor kinase                       277   6e-85    Glycine soja [wild soybean]
ref|XP_008381374.1|  PREDICTED: probable inactive receptor kinase...    266   6e-85    
ref|XP_002468249.1|  hypothetical protein SORBIDRAFT_01g042480          279   7e-85    Sorghum bicolor [broomcorn]
ref|NP_001051064.1|  Os03g0712400                                       265   2e-84    
gb|EPS58567.1|  hypothetical protein M569_16246                         277   2e-84    Genlisea aurea
ref|XP_010916205.1|  PREDICTED: probable inactive receptor kinase...    277   4e-84    Elaeis guineensis
ref|XP_004490822.1|  PREDICTED: probable inactive receptor kinase...    276   4e-84    Cicer arietinum [garbanzo]
ref|XP_006575485.1|  PREDICTED: probable inactive receptor kinase...    276   4e-84    
gb|EYU24506.1|  hypothetical protein MIMGU_mgv1a0087053mg               266   7e-84    Erythranthe guttata [common monkey flower]
ref|XP_010926113.1|  PREDICTED: probable inactive receptor kinase...    276   9e-84    Elaeis guineensis
ref|XP_008781294.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    276   1e-83    
gb|KCW52164.1|  hypothetical protein EUGRSUZ_J01604                     275   2e-83    Eucalyptus grandis [rose gum]
ref|XP_003558467.1|  PREDICTED: probable inactive receptor kinase...    275   4e-83    
ref|XP_010032718.1|  PREDICTED: probable inactive receptor kinase...    275   4e-83    Eucalyptus grandis [rose gum]
ref|XP_008775508.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    274   7e-83    Phoenix dactylifera
ref|XP_007214953.1|  hypothetical protein PRUPE_ppa003172mg             272   7e-83    
ref|XP_011073169.1|  PREDICTED: probable inactive receptor kinase...    273   8e-83    Sesamum indicum [beniseed]
gb|EEE59802.1|  hypothetical protein OsJ_12326                          266   8e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009607528.1|  PREDICTED: probable inactive receptor kinase...    273   2e-82    Nicotiana tomentosiformis
ref|XP_010105639.1|  putative inactive receptor kinase                  272   2e-82    Morus notabilis
ref|XP_009409092.1|  PREDICTED: probable inactive receptor kinase...    272   4e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007141918.1|  hypothetical protein PHAVU_008G236900g             271   5e-82    Phaseolus vulgaris [French bean]
ref|XP_003616273.1|  Leucine-rich repeat transmembrane protein          271   5e-82    Medicago truncatula
dbj|BAJ89911.1|  predicted protein                                      271   8e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN39461.1|  Putative inactive receptor kinase                       270   9e-82    Glycine soja [wild soybean]
ref|XP_004292489.1|  PREDICTED: probable inactive receptor kinase...    268   3e-81    Fragaria vesca subsp. vesca
ref|XP_010932563.1|  PREDICTED: probable inactive receptor kinase...    269   4e-81    Elaeis guineensis
ref|XP_008348609.1|  PREDICTED: probable inactive receptor kinase...    267   9e-81    
gb|EPS62777.1|  hypothetical protein M569_12011                         267   1e-80    Genlisea aurea
ref|XP_008227929.1|  PREDICTED: probable inactive receptor kinase...    267   2e-80    Prunus mume [ume]
ref|XP_009370559.1|  PREDICTED: probable inactive receptor kinase...    266   2e-80    Pyrus x bretschneideri [bai li]
ref|XP_009370052.1|  PREDICTED: probable inactive receptor kinase...    265   5e-80    Pyrus x bretschneideri [bai li]
ref|XP_004145847.1|  PREDICTED: probable inactive receptor kinase...    265   7e-80    Cucumis sativus [cucumbers]
ref|XP_004137566.2|  PREDICTED: probable inactive receptor kinase...    263   3e-79    Cucumis sativus [cucumbers]
ref|XP_008457025.1|  PREDICTED: probable inactive receptor kinase...    264   3e-79    Cucumis melo [Oriental melon]
gb|AAK18840.1|AC082645_10  putative receptor kinase                     265   4e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651742.1|  PREDICTED: probable inactive receptor kinase...    263   4e-79    Oryza brachyantha
ref|XP_009381014.1|  PREDICTED: probable inactive receptor kinase...    262   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390354.1|  PREDICTED: probable inactive receptor kinase...    260   9e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403541.1|  PREDICTED: probable inactive receptor kinase...    259   5e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803916.1|  PREDICTED: uncharacterized protein LOC103717354    267   5e-77    
ref|XP_008343258.1|  PREDICTED: probable inactive receptor kinase...    258   5e-77    
ref|XP_008353859.1|  PREDICTED: probable inactive receptor kinase...    257   7e-77    
gb|EAY91619.1|  hypothetical protein OsI_13254                          244   2e-76    Oryza sativa Indica Group [Indian rice]
gb|AHA84157.1|  atypical receptor-like kinase MARK                      256   5e-76    Phaseolus vulgaris [French bean]
dbj|BAH20271.1|  AT1G48480                                              245   1e-74    Arabidopsis thaliana [mouse-ear cress]
gb|EYU45791.1|  hypothetical protein MIMGU_mgv1a002921mg                251   2e-74    Erythranthe guttata [common monkey flower]
emb|CBI15604.3|  unnamed protein product                                237   3e-74    Vitis vinifera
ref|XP_008812474.1|  PREDICTED: probable inactive receptor kinase...    249   2e-73    
ref|XP_009390851.1|  PREDICTED: probable inactive receptor kinase...    248   4e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006393400.1|  hypothetical protein EUTSA_v10011300mg             246   2e-72    Eutrema salsugineum [saltwater cress]
ref|XP_003559525.1|  PREDICTED: probable inactive receptor kinase...    246   2e-72    Brachypodium distachyon [annual false brome]
ref|XP_004981996.1|  PREDICTED: probable inactive receptor kinase...    246   4e-72    Setaria italica
gb|AAC95351.1|  receptor-like protein kinase                            245   4e-72    Arabidopsis thaliana [mouse-ear cress]
gb|KFK37686.1|  hypothetical protein AALP_AA3G015500                    244   5e-72    Arabis alpina [alpine rockcress]
gb|EYU45792.1|  hypothetical protein MIMGU_mgv1a020384mg                243   5e-72    Erythranthe guttata [common monkey flower]
ref|XP_009391414.1|  PREDICTED: probable inactive receptor kinase...    244   7e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_564528.1|  receptor-like kinase 1                                244   7e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525076.1|  PREDICTED: probable inactive receptor kinase...    243   1e-71    Tarenaya hassleriana [spider flower]
gb|KFK25876.1|  hypothetical protein AALP_AA8G173700                    243   2e-71    Arabis alpina [alpine rockcress]
ref|XP_010910915.1|  PREDICTED: probable inactive receptor kinase...    243   3e-71    Elaeis guineensis
emb|CDY67567.1|  BnaCnng55470D                                          241   5e-71    Brassica napus [oilseed rape]
ref|NP_566589.1|  receptor-like kinase 902                              242   5e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465843.1|  PREDICTED: probable inactive receptor kinase...    241   8e-71    Camelina sativa [gold-of-pleasure]
gb|AAM64268.1|  receptor kinase, putative                               241   8e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408370.1|  hypothetical protein EUTSA_v10020304mg             241   1e-70    Eutrema salsugineum [saltwater cress]
emb|CDY61284.1|  BnaA01g36890D                                          241   1e-70    Brassica napus [oilseed rape]
emb|CDX69441.1|  BnaA10g17900D                                          240   2e-70    
ref|XP_002883091.1|  hypothetical protein ARALYDRAFT_479268             240   2e-70    
ref|XP_009113711.1|  PREDICTED: probable inactive receptor kinase...    240   2e-70    Brassica rapa
gb|KFK39109.1|  hypothetical protein AALP_AA3G202300                    240   3e-70    Arabis alpina [alpine rockcress]
ref|XP_006299778.1|  hypothetical protein CARUB_v10015974mg             240   3e-70    Capsella rubella
ref|XP_009118618.1|  PREDICTED: probable inactive receptor kinase...    239   3e-70    Brassica rapa
emb|CDX95816.1|  BnaC05g35670D                                          239   3e-70    
ref|XP_009121473.1|  PREDICTED: probable inactive receptor kinase...    239   4e-70    Brassica rapa
emb|CDY49655.1|  BnaC09g41330D                                          239   4e-70    Brassica napus [oilseed rape]
ref|XP_009414081.1|  PREDICTED: probable inactive receptor kinase...    240   5e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010479274.1|  PREDICTED: probable inactive receptor kinase...    239   7e-70    Camelina sativa [gold-of-pleasure]
ref|XP_009126125.1|  PREDICTED: probable inactive receptor kinase...    238   8e-70    Brassica rapa
emb|CDY38103.1|  BnaC02g06700D                                          238   8e-70    Brassica napus [oilseed rape]
ref|XP_006406685.1|  hypothetical protein EUTSA_v10020262mg             239   9e-70    Eutrema salsugineum [saltwater cress]
ref|XP_006400197.1|  hypothetical protein EUTSA_v10012966mg             237   2e-69    Eutrema salsugineum [saltwater cress]
ref|XP_010500379.1|  PREDICTED: probable inactive receptor kinase...    238   3e-69    Camelina sativa [gold-of-pleasure]
ref|XP_002891438.1|  hypothetical protein ARALYDRAFT_891670             238   3e-69    Arabidopsis lyrata subsp. lyrata
ref|XP_010461669.1|  PREDICTED: probable inactive receptor kinase...    237   4e-69    Camelina sativa [gold-of-pleasure]
ref|XP_002447974.1|  hypothetical protein SORBIDRAFT_06g019120          238   4e-69    
emb|CDX92167.1|  BnaA05g22400D                                          236   6e-69    
gb|ABR17070.1|  unknown                                                 229   6e-69    Picea sitchensis
gb|AGT16967.1|  hypothetical protein SHCRBa_121_P14_R_290               237   6e-69    Saccharum hybrid cultivar R570
ref|XP_002960794.1|  hypothetical protein SELMODRAFT_74002              236   8e-69    
ref|XP_010495229.1|  PREDICTED: probable inactive receptor kinase...    236   9e-69    Camelina sativa [gold-of-pleasure]
ref|XP_010453822.1|  PREDICTED: probable inactive receptor kinase...    236   1e-68    Camelina sativa [gold-of-pleasure]
ref|XP_006287270.1|  hypothetical protein CARUB_v10000461mg             235   1e-68    Capsella rubella
ref|NP_197162.1|  leucine-rich repeat protein 1                         235   1e-68    Arabidopsis thaliana [mouse-ear cress]
emb|CDY51524.1|  BnaA05g33240D                                          235   2e-68    Brassica napus [oilseed rape]
ref|XP_009147309.1|  PREDICTED: probable inactive receptor kinase...    235   2e-68    Brassica rapa
ref|NP_186938.1|  leucine-rich repeat protein kinase family protein     234   4e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297231.1|  hypothetical protein CARUB_v10013240mg             233   5e-68    Capsella rubella
dbj|BAJ89083.1|  predicted protein                                      234   6e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010420358.1|  PREDICTED: probable inactive receptor kinase...    233   7e-68    Camelina sativa [gold-of-pleasure]
ref|XP_002882256.1|  hypothetical protein ARALYDRAFT_896266             233   8e-68    Arabidopsis lyrata subsp. lyrata
ref|XP_006306949.1|  hypothetical protein CARUB_v10008516mg             234   9e-68    
ref|XP_004975871.1|  PREDICTED: probable inactive receptor kinase...    233   2e-67    Setaria italica
emb|CDY28719.1|  BnaCnng06050D                                          231   3e-67    Brassica napus [oilseed rape]
ref|XP_002463998.1|  hypothetical protein SORBIDRAFT_01g010290          233   4e-67    Sorghum bicolor [broomcorn]
gb|KFK36089.1|  hypothetical protein AALP_AA4G076000                    231   4e-67    Arabis alpina [alpine rockcress]
ref|XP_009145968.1|  PREDICTED: probable inactive receptor kinase...    231   6e-67    Brassica rapa
ref|XP_010485618.1|  PREDICTED: probable inactive receptor kinase...    231   6e-67    Camelina sativa [gold-of-pleasure]
ref|XP_010502431.1|  PREDICTED: probable inactive receptor kinase...    231   6e-67    Camelina sativa [gold-of-pleasure]
ref|XP_010463719.1|  PREDICTED: probable inactive receptor kinase...    231   6e-67    Camelina sativa [gold-of-pleasure]
ref|XP_010558597.1|  PREDICTED: probable inactive receptor kinase...    230   1e-66    Tarenaya hassleriana [spider flower]
emb|CDX77309.1|  BnaC08g03540D                                          230   1e-66    
gb|AGT16430.1|  kinase                                                  230   3e-66    Saccharum hybrid cultivar R570
dbj|BAJ95574.1|  predicted protein                                      230   3e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009417661.1|  PREDICTED: probable inactive receptor kinase...    229   5e-66    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW67828.1|  putative leucine-rich repeat receptor-like protei...    230   5e-66    
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...    229   6e-66    Fragaria vesca subsp. vesca
ref|XP_008463343.1|  PREDICTED: probable inactive receptor kinase...    229   8e-66    Cucumis melo [Oriental melon]
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...    228   9e-66    Prunus mume [ume]
ref|NP_001151626.1|  atypical receptor-like kinase MARK precursor       229   1e-65    
ref|XP_007204237.1|  hypothetical protein PRUPE_ppa002548mg             228   1e-65    Prunus persica
ref|XP_004149854.1|  PREDICTED: probable inactive receptor kinase...    228   1e-65    Cucumis sativus [cucumbers]
emb|CDY41827.1|  BnaA08g03220D                                          228   2e-65    Brassica napus [oilseed rape]
ref|XP_001774015.1|  predicted protein                                  226   2e-65    
ref|NP_001105207.1|  atypical receptor-like kinase MARK precursor       228   2e-65    
ref|XP_006451034.1|  hypothetical protein CICLE_v10007694mg             227   2e-65    
ref|XP_009107354.1|  PREDICTED: probable inactive receptor kinase...    227   3e-65    Brassica rapa
tpg|DAA50992.1|  TPA: putative leucine-rich repeat receptor-like ...    228   3e-65    
ref|XP_008343962.1|  PREDICTED: probable inactive receptor kinase...    227   3e-65    
ref|XP_008386031.1|  PREDICTED: probable inactive receptor kinase...    227   3e-65    
gb|ACZ98536.1|  protein kinase                                          227   3e-65    Malus domestica [apple tree]
ref|XP_002281635.1|  PREDICTED: probable inactive receptor kinase...    227   3e-65    Vitis vinifera
ref|XP_012078693.1|  PREDICTED: probable inactive receptor kinase...    226   5e-65    Jatropha curcas
ref|XP_006475765.1|  PREDICTED: probable inactive receptor kinase...    226   9e-65    Citrus sinensis [apfelsine]
ref|XP_009371417.1|  PREDICTED: probable inactive receptor kinase...    226   9e-65    Pyrus x bretschneideri [bai li]
gb|EMT22086.1|  Putative inactive receptor kinase                       215   1e-64    
ref|NP_001053007.1|  Os04g0463000                                       225   2e-64    
tpg|DAA37428.1|  TPA: putative leucine-rich repeat receptor-like ...    225   2e-64    
ref|XP_010098956.1|  putative inactive receptor kinase                  225   2e-64    Morus notabilis
ref|XP_008669312.1|  PREDICTED: probable inactive receptor kinase...    226   3e-64    
gb|KHN00038.1|  Putative inactive receptor kinase                       213   4e-64    Glycine soja [wild soybean]
ref|XP_008669311.1|  PREDICTED: probable inactive receptor kinase...    226   4e-64    
ref|XP_011009200.1|  PREDICTED: probable inactive receptor kinase...    224   4e-64    Populus euphratica
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...    222   9e-64    
ref|XP_010487681.1|  PREDICTED: probable inactive receptor kinase...    223   1e-63    Camelina sativa [gold-of-pleasure]
ref|XP_001778286.1|  predicted protein                                  222   3e-63    
ref|XP_007013302.1|  Leucine-rich repeat protein kinase family pr...    221   3e-63    
ref|XP_002529343.1|  Nodulation receptor kinase precursor, putative     221   3e-63    Ricinus communis
ref|XP_010505998.1|  PREDICTED: probable inactive receptor kinase...    221   3e-63    Camelina sativa [gold-of-pleasure]
gb|KHN24722.1|  Putative inactive receptor kinase                       213   5e-63    Glycine soja [wild soybean]
gb|KHN30614.1|  Putative inactive receptor kinase                       211   5e-63    Glycine soja [wild soybean]
gb|KCW69386.1|  hypothetical protein EUGRSUZ_F02867                     219   7e-63    Eucalyptus grandis [rose gum]
ref|XP_010551132.1|  PREDICTED: probable inactive receptor kinase...    220   1e-62    Tarenaya hassleriana [spider flower]
ref|XP_010062272.1|  PREDICTED: probable inactive receptor kinase...    220   1e-62    Eucalyptus grandis [rose gum]
gb|KJB54134.1|  hypothetical protein B456_009G022300                    220   1e-62    Gossypium raimondii
ref|XP_010047774.1|  PREDICTED: probable inactive receptor kinase...    220   1e-62    Eucalyptus grandis [rose gum]
ref|XP_002868800.1|  hypothetical protein ARALYDRAFT_356181             219   2e-62    Arabidopsis lyrata subsp. lyrata
gb|KHN40997.1|  Putative inactive receptor kinase                       209   2e-62    Glycine soja [wild soybean]
ref|XP_012091018.1|  PREDICTED: probable inactive receptor kinase...    219   3e-62    Jatropha curcas
ref|XP_010533192.1|  PREDICTED: probable inactive receptor kinase...    219   3e-62    Tarenaya hassleriana [spider flower]
gb|KHG24076.1|  hypothetical protein F383_10304                         219   3e-62    Gossypium arboreum [tree cotton]
gb|EYU36892.1|  hypothetical protein MIMGU_mgv1a0177021mg               206   5e-62    Erythranthe guttata [common monkey flower]
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g             218   7e-62    Phaseolus vulgaris [French bean]
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...    218   8e-62    Sesamum indicum [beniseed]
ref|XP_008244615.1|  PREDICTED: probable inactive receptor kinase...    216   8e-62    Prunus mume [ume]
gb|KHN37771.1|  Putative inactive receptor kinase                       209   8e-62    Glycine soja [wild soybean]
ref|XP_009374078.1|  PREDICTED: probable inactive receptor kinase...    216   9e-62    
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...    217   1e-61    Sesamum indicum [beniseed]
emb|CDP04037.1|  unnamed protein product                                207   1e-61    Coffea canephora [robusta coffee]
ref|XP_001752184.1|  predicted protein                                  218   1e-61    
gb|ERN04237.1|  hypothetical protein AMTR_s00077p00144570               206   1e-61    Amborella trichopoda
ref|XP_004139332.1|  PREDICTED: probable inactive receptor kinase...    217   1e-61    Cucumis sativus [cucumbers]
ref|XP_008458016.1|  PREDICTED: probable inactive receptor kinase...    217   1e-61    Cucumis melo [Oriental melon]
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...    217   2e-61    
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg             216   2e-61    
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...    216   3e-61    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003579913.1|  PREDICTED: probable inactive receptor kinase...    216   4e-61    Brachypodium distachyon [annual false brome]
gb|EPS60479.1|  hypothetical protein M569_14322                         214   5e-61    Genlisea aurea
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...    215   6e-61    
gb|KHN18649.1|  Putative inactive receptor kinase                       214   7e-61    Glycine soja [wild soybean]
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...    215   8e-61    Nelumbo nucifera [Indian lotus]
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative     214   9e-61    
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...    214   1e-60    
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...    215   1e-60    
emb|CBI26846.3|  unnamed protein product                                213   1e-60    
ref|XP_012077868.1|  PREDICTED: probable inactive receptor kinase...    214   1e-60    
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...    214   1e-60    
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...    214   1e-60    
gb|KHG18372.1|  hypothetical protein F383_03411                         214   2e-60    
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...    214   2e-60    
gb|KEH34523.1|  LRR receptor-like kinase                                214   2e-60    
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...    214   2e-60    
gb|KJB64834.1|  hypothetical protein B456_010G067400                    214   2e-60    
ref|XP_003527143.1|  PREDICTED: probable inactive receptor kinase...    214   2e-60    
ref|XP_007154939.1|  hypothetical protein PHAVU_003G159700g             214   2e-60    
ref|XP_004508557.1|  PREDICTED: probable inactive receptor kinase...    214   3e-60    
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...    213   3e-60    
ref|XP_011041763.1|  PREDICTED: probable inactive receptor kinase...    211   3e-60    
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...    213   4e-60    
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...    213   4e-60    
ref|XP_002281181.1|  PREDICTED: probable inactive receptor kinase...    212   4e-60    
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...    213   4e-60    
emb|CDP13882.1|  unnamed protein product                                213   5e-60    
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...    213   5e-60    
ref|XP_002319979.1|  putative plant disease resistance family pro...    213   5e-60    
ref|XP_010249925.1|  PREDICTED: probable inactive receptor kinase...    213   6e-60    
ref|XP_006579204.1|  PREDICTED: probable inactive receptor kinase...    207   6e-60    
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...    212   6e-60    
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                   212   6e-60    
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg             212   6e-60    
gb|KJB29842.1|  hypothetical protein B456_005G120900                    213   8e-60    
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg             212   8e-60    
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...    213   9e-60    
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg             212   1e-59    
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                   211   1e-59    
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...    212   1e-59    
ref|XP_003609204.1|  hypothetical protein MTR_4g113100                  212   1e-59    
gb|EEE55588.1|  hypothetical protein OsJ_03884                          202   1e-59    
ref|XP_010094441.1|  putative inactive receptor kinase                  211   2e-59    
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...    211   2e-59    
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g             211   2e-59    
dbj|BAH57151.1|  AT3G08680                                              201   2e-59    
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...    211   2e-59    
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...    211   2e-59    
emb|CDP03386.1|  unnamed protein product                                211   2e-59    
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...    211   2e-59    
ref|XP_011084098.1|  PREDICTED: probable inactive receptor kinase...    211   3e-59    
gb|KJB07168.1|  hypothetical protein B456_001G003200                    210   3e-59    
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg             210   3e-59    
gb|KHG17391.1|  hypothetical protein F383_22576                         211   3e-59    
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                   210   4e-59    
ref|XP_002325632.1|  putative plant disease resistance family pro...    210   4e-59    
ref|XP_001778285.1|  predicted protein                                  211   4e-59    
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...    210   4e-59    
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...    210   4e-59    
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...    210   5e-59    
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                   210   6e-59    
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                   210   6e-59    
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg             210   6e-59    
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...    210   6e-59    
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...    210   6e-59    
ref|XP_002991819.1|  hypothetical protein SELMODRAFT_42017              209   6e-59    
ref|XP_010557581.1|  PREDICTED: probable inactive receptor kinase...    210   7e-59    
gb|KEH35517.1|  receptor-like kinase                                    209   7e-59    
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...    209   8e-59    
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...    209   9e-59    
gb|KJB27114.1|  hypothetical protein B456_004G278900                    209   1e-58    
ref|XP_010098027.1|  putative inactive receptor kinase                  210   1e-58    
ref|XP_010109178.1|  putative inactive receptor kinase                  209   1e-58    
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...    210   1e-58    
ref|XP_002992978.1|  hypothetical protein SELMODRAFT_270002             209   1e-58    
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...    209   1e-58    
gb|EYU28629.1|  hypothetical protein MIMGU_mgv1a021954mg                208   1e-58    
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...    209   1e-58    
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...    209   1e-58    
emb|CBI15804.3|  unnamed protein product                                209   2e-58    
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...    208   2e-58    
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...    208   2e-58    
ref|XP_010417819.1|  PREDICTED: probable inactive receptor kinase...    209   2e-58    
ref|XP_010473057.1|  PREDICTED: probable inactive receptor kinase...    208   2e-58    
ref|XP_008810158.1|  PREDICTED: probable inactive receptor kinase...    207   2e-58    
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...    209   2e-58    
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...    208   2e-58    
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...    208   2e-58    
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...    208   3e-58    
ref|XP_004140352.1|  PREDICTED: probable inactive receptor kinase...    207   3e-58    
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...    207   3e-58    
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...    207   4e-58    
gb|ACN57540.1|  At2g26730-like protein                                  196   4e-58    
gb|ACN57520.1|  At2g26730-like protein                                  196   4e-58    
gb|ABK93951.1|  unknown                                                 201   5e-58    
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...    207   5e-58    
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...    207   5e-58    
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg                207   5e-58    
ref|XP_006293818.1|  hypothetical protein CARUB_v10022800mg             207   5e-58    
ref|XP_002879005.1|  hypothetical protein ARALYDRAFT_481544             207   6e-58    
emb|CDY04464.1|  BnaA07g12900D                                          207   7e-58    
gb|ACN57533.1|  At2g26730-like protein                                  195   7e-58    
ref|XP_009767272.1|  PREDICTED: probable inactive receptor kinase...    207   7e-58    
ref|XP_010254253.1|  PREDICTED: probable inactive receptor kinase...    207   8e-58    
ref|XP_006397367.1|  hypothetical protein EUTSA_v10022498mg             207   8e-58    
emb|CDY02808.1|  BnaC02g10810D                                          202   8e-58    
gb|AAK92807.1|  putative receptor protein kinase                        207   8e-58    
ref|NP_180241.1|  leucine-rich repeat protein kinase family protein     207   8e-58    
ref|XP_009103556.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    207   9e-58    
ref|NP_001234580.1|  atypical receptor-like kinase 1 precursor          206   9e-58    
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein     207   9e-58    
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...    206   1e-57    
gb|KHN40012.1|  Putative inactive receptor kinase                       195   1e-57    
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...    206   1e-57    
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg             206   1e-57    
ref|XP_009140749.1|  PREDICTED: probable inactive receptor kinase...    206   1e-57    
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative     206   1e-57    
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...    206   1e-57    
ref|XP_009597502.1|  PREDICTED: probable inactive receptor kinase...    206   1e-57    
gb|KHG05843.1|  hypothetical protein F383_32232                         206   1e-57    
gb|KFK32479.1|  hypothetical protein AALP_AA6G247800                    206   1e-57    
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...    206   2e-57    
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...    206   2e-57    
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...    206   2e-57    
ref|XP_002864562.1|  predicted protein                                  206   2e-57    
emb|CDY48185.1|  BnaA04g15490D                                          206   2e-57    
gb|EYU23030.1|  hypothetical protein MIMGU_mgv1a002522mg                206   2e-57    
ref|XP_004236305.1|  PREDICTED: probable inactive receptor kinase...    206   2e-57    
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    206   2e-57    
gb|EMT17815.1|  Putative inactive receptor kinase                       205   2e-57    
gb|KJB20517.1|  hypothetical protein B456_003G153000                    206   2e-57    
gb|KEH23299.1|  LRR receptor-like kinase                                205   2e-57    
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...    206   3e-57    
ref|XP_011622690.1|  PREDICTED: probable inactive receptor kinase...    205   3e-57    
gb|ACN57547.1|  At2g26730-like protein                                  194   3e-57    
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...    206   3e-57    
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...    205   3e-57    
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...    205   3e-57    
emb|CBI22555.3|  unnamed protein product                                205   3e-57    
ref|XP_006351444.1|  PREDICTED: probable inactive receptor kinase...    205   3e-57    
emb|CDX71488.1|  BnaC04g17230D                                          206   3e-57    
gb|EYU34504.1|  hypothetical protein MIMGU_mgv1a003961mg                203   4e-57    
emb|CDY58565.1|  BnaC03g12450D                                          205   4e-57    
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg             205   4e-57    
ref|XP_001752185.1|  predicted protein                                  205   4e-57    
ref|XP_008463153.1|  PREDICTED: probable inactive receptor kinase...    204   4e-57    
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...    204   5e-57    
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...    205   5e-57    
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...    204   5e-57    
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...    204   5e-57    
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...    204   5e-57    
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg             204   6e-57    
ref|XP_010688116.1|  PREDICTED: probable inactive receptor kinase...    204   7e-57    
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...    204   8e-57    
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg             204   8e-57    
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...    204   9e-57    
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...    204   9e-57    
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...    204   1e-56    
gb|EMT33753.1|  Putative inactive receptor kinase                       202   1e-56    
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...    204   1e-56    
ref|XP_003592627.1|  Leucine-rich repeat receptor-like protein ki...    204   1e-56    
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...    204   1e-56    
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg             203   1e-56    
emb|CAN80590.1|  hypothetical protein VITISV_040789                     203   1e-56    
gb|KHN48152.1|  Putative inactive receptor kinase                       194   1e-56    
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...    204   1e-56    
gb|ACN57550.1|  At2g26730-like protein                                  192   1e-56    
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...    203   2e-56    
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg             203   2e-56    
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...    203   2e-56    
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...    203   2e-56    
ref|XP_009395807.1|  PREDICTED: probable inactive receptor kinase...    203   2e-56    
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...    202   2e-56    
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...    202   3e-56    
emb|CDP05105.1|  unnamed protein product                                202   3e-56    
emb|CDP00834.1|  unnamed protein product                                195   3e-56    
ref|XP_008380496.1|  PREDICTED: probable inactive receptor kinase...    202   3e-56    
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...    202   3e-56    
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...    202   3e-56    
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...    202   4e-56    
ref|XP_004511532.1|  PREDICTED: probable inactive receptor kinase...    196   4e-56    
gb|ACA61611.1|  hypothetical protein AP2_E06.2                          202   4e-56    
gb|KJB67957.1|  hypothetical protein B456_010G219700                    201   5e-56    
ref|XP_006350601.1|  PREDICTED: probable inactive receptor kinase...    202   5e-56    
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...    202   5e-56    
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein     202   5e-56    
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...    202   5e-56    
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...    202   5e-56    
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...    202   5e-56    
ref|XP_002535240.1|  receptor kinase, putative                          192   5e-56    
dbj|BAB62593.1|  putative receptor-like protein kinase                  202   5e-56    
ref|NP_001168214.1|  uncharacterized protein LOC100381972               192   6e-56    
gb|KJB71491.1|  hypothetical protein B456_011G125200                    201   6e-56    
ref|XP_010549038.1|  PREDICTED: probable inactive receptor kinase...    201   6e-56    
ref|XP_009393622.1|  PREDICTED: probable inactive receptor kinase...    201   7e-56    
ref|XP_009375580.1|  PREDICTED: probable inactive receptor kinase...    201   7e-56    
ref|XP_007220432.1|  hypothetical protein PRUPE_ppa002831mg             201   7e-56    
ref|XP_009352112.1|  PREDICTED: probable inactive receptor kinase...    201   8e-56    
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...    201   8e-56    
gb|KHF99691.1|  hypothetical protein F383_18108                         201   9e-56    
ref|XP_006371315.1|  putative plant disease resistance family pro...    201   9e-56    
ref|XP_008234792.1|  PREDICTED: probable inactive receptor kinase...    201   9e-56    
ref|XP_003535720.1|  PREDICTED: probable leucine-rich repeat rece...    201   1e-55    
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...    201   1e-55    
emb|CDY32713.1|  BnaA02g07750D                                          201   1e-55    
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...    201   1e-55    
ref|XP_011007941.1|  PREDICTED: probable inactive receptor kinase...    201   1e-55    
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170             201   1e-55    
ref|XP_006374322.1|  hypothetical protein POPTR_0015s06040g             201   1e-55    
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...    201   1e-55    
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...    200   1e-55    
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...    201   1e-55    
ref|XP_009146990.1|  PREDICTED: probable inactive receptor kinase...    200   2e-55    
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g             201   2e-55    
emb|CDY35996.1|  BnaA05g29540D                                          200   2e-55    
gb|EEC75189.1|  hypothetical protein OsI_11426                          197   2e-55    
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110          200   2e-55    
gb|KHG17719.1|  hypothetical protein F383_03334                         200   2e-55    
emb|CDO99209.1|  unnamed protein product                                189   2e-55    
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...    199   3e-55    
ref|XP_002441272.1|  hypothetical protein SORBIDRAFT_09g023570          199   3e-55    
ref|XP_010068754.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    190   3e-55    
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...    200   3e-55    
gb|EEE64112.1|  hypothetical protein OsJ_18944                          199   3e-55    
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...    199   3e-55    
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...    199   3e-55    



>ref|XP_009592532.1| PREDICTED: probable inactive receptor kinase RLK902 [Nicotiana 
tomentosiformis]
Length=646

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 172/192 (90%), Gaps = 3/192 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAA G ++LH+QG S+SHGNIKSSN  LTKSY+ARVSDFG AQLVGPS T
Sbjct  452  NWETRAGIALGAAHGIAYLHAQGPSVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSST  511

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSVV
Sbjct  512  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSLMNEEGVDLPRWVQSVV  571

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEEDMVQLLQLAV+CTAQYPD+RPSMAE+T+R+E+LCR  F
Sbjct  572  REEWTAEVFDLELLRYQN-VEEDMVQLLQLAVDCTAQYPDRRPSMAEVTSRVEELCRSSF  630

Query  320  QDN--NIVDNPE  291
             D+  +I+DN E
Sbjct  631  MDSGADIIDNAE  642



>ref|XP_009797253.1| PREDICTED: probable inactive receptor kinase RLK902 [Nicotiana 
sylvestris]
Length=645

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAA G ++LH+QG S+SHGNIKSSN  LTKSY ARVSDFG AQLVGPS T
Sbjct  451  NWETRAGIALGAAHGIAYLHAQGPSVSHGNIKSSNILLTKSYAARVSDFGLAQLVGPSST  510

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSVV
Sbjct  511  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSLMNEEGVDLPRWVQSVV  570

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEEDMVQLLQLAV+CTAQYPD+RPSMAE+T R+E+LCR  F
Sbjct  571  REEWTAEVFDLELLRYQN-VEEDMVQLLQLAVDCTAQYPDRRPSMAEVTNRVEELCRSSF  629

Query  320  QDN--NIVDNPE  291
             D+  +I+DN E
Sbjct  630  VDSGADIIDNAE  641



>gb|AGO98727.1| ovary receptor kinase 11 [Solanum chacoense]
Length=644

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAA G ++LH+QG S+SHGNIKSSN  LTKSY+ARVSDFG AQLVGPS T
Sbjct  451  NWETRAGIALGAAHGIAYLHAQGPSVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSST  510

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTH++ NEEGVDLPRWVQSVV
Sbjct  511  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSIMNEEGVDLPRWVQSVV  570

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEEDMVQLLQ+AV+CTAQYPD+RPSMAE+T+R+E+LCR   
Sbjct  571  REEWTAEVFDLELLRYQN-VEEDMVQLLQVAVDCTAQYPDRRPSMAEVTSRVEELCRMDS  629

Query  320  QDNNIVDNPEE*KVA  276
               +I+DN  E + A
Sbjct  630  GGGDIIDNDAEVQTA  644



>ref|XP_006364614.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Solanum 
tuberosum]
Length=647

 Score =   318 bits (816),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 170/195 (87%), Gaps = 1/195 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAA G ++LH+QG S+SHGNIKSSN  LTKSY+ARVSDFG AQLVGPS T
Sbjct  454  NWETRAGIALGAAHGIAYLHAQGPSVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSST  513

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTH++ NEEGVDLPRWVQSVV
Sbjct  514  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSVLNEEGVDLPRWVQSVV  573

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEEDMVQLLQ+AV+CTAQYPD+RPSMAE+T R+E+LCR   
Sbjct  574  REEWTAEVFDLELLRYQN-VEEDMVQLLQVAVDCTAQYPDRRPSMAEVTTRVEELCRMDS  632

Query  320  QDNNIVDNPEE*KVA  276
               +I+DN  E + A
Sbjct  633  GGGDIIDNDAEVQTA  647



>gb|AGL74765.1| ovary receptor kinase 11 [Solanum chacoense]
Length=644

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAA G ++LH+QG S+SHGNIKSSN  LTKSY+A VSDFG AQLVGPS T
Sbjct  451  NWETRAGIALGAAHGIAYLHAQGPSVSHGNIKSSNILLTKSYEAHVSDFGLAQLVGPSST  510

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTH++ NEEGVDLPRWVQSVV
Sbjct  511  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSIMNEEGVDLPRWVQSVV  570

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEEDMVQLLQ+AV+CTAQYPD+RPSMAE+T R+E+LCR   
Sbjct  571  REEWTAEVFDLELLRYQN-VEEDMVQLLQVAVDCTAQYPDRRPSMAEVTTRVEELCRMDS  629

Query  320  QDNNIVDNPEE*KVA  276
               +I+DN  E + A
Sbjct  630  GGGDIIDNDAEVQTA  644



>ref|XP_004250172.1| PREDICTED: probable inactive receptor kinase At1g48480 [Solanum 
lycopersicum]
Length=642

 Score =   316 bits (809),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 171/195 (88%), Gaps = 2/195 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAA G ++LH+QG S+SHGNIKSSN  LTKSY+ARVSDFG AQLVGPS T
Sbjct  450  NWETRAGIALGAAHGIAYLHAQGPSVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSST  509

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTH++ NEEGVDLPRWVQSVV
Sbjct  510  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSVMNEEGVDLPRWVQSVV  569

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEEDMVQLLQ+AV+CTAQYPD+RPSMAE+T+R+E+LCR   
Sbjct  570  REEWTAEVFDLELLRYQN-VEEDMVQLLQVAVDCTAQYPDRRPSMAEVTSRVEELCRMD-  627

Query  320  QDNNIVDNPEE*KVA  276
               +I+DN  E + A
Sbjct  628  SGGDIIDNDAEVQTA  642



>gb|KJB10488.1| hypothetical protein B456_001G203900 [Gossypium raimondii]
Length=606

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR+SIALGAA+G ++LHS+G  ISHGNIKSSN  LT SY+ARVSDFG AQL GP+ T
Sbjct  425  NWDTRSSIALGAAKGIAYLHSKGPGISHGNIKSSNILLTTSYEARVSDFGLAQLSGPTST  484

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RVDGYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPTHAL+NEEGVDLPRWVQSVV
Sbjct  485  PNRVDGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTHALTNEEGVDLPRWVQSVV  544

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFDLELLRYQN VEEDMVQLLQLA+NCTAQYPDKRP+M E+T++IE+LCR
Sbjct  545  REEWTAEVFDLELLRYQN-VEEDMVQLLQLAINCTAQYPDKRPAMDEVTSQIEELCR  600



>ref|XP_011099906.1| PREDICTED: probable inactive receptor kinase At1g48480 [Sesamum 
indicum]
Length=735

 Score =   315 bits (806),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 168/193 (87%), Gaps = 3/193 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR +IALGAA+G S+LH QG +ISHGNIKSSN  LTKSY+ARVSDFG AQL GP+ T
Sbjct  536  NWETRAAIALGAAKGISYLHLQGSTISHGNIKSSNILLTKSYEARVSDFGLAQLAGPAST  595

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSVV
Sbjct  596  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSLMNEEGVDLPRWVQSVV  655

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEEDMVQLLQLAV+CTAQYPDKRPSM E+  +IE+LCR   
Sbjct  656  REEWTAEVFDLELLRYQN-VEEDMVQLLQLAVDCTAQYPDKRPSMVEVVGKIEELCRSSS  714

Query  320  QD--NNIVDNPEE  288
            QD   +IVD  +E
Sbjct  715  QDLSGDIVDVDDE  727



>ref|XP_007032119.1| Receptor-like kinase 1 [Theobroma cacao]
 gb|EOY03045.1| Receptor-like kinase 1 [Theobroma cacao]
Length=642

 Score =   312 bits (799),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR+ IALGAARG ++LHS+G  ISHGNIKSSN  LT SY+ARVSDFG A L GP  T
Sbjct  433  NWDTRSGIALGAARGIAYLHSKGTGISHGNIKSSNILLTTSYEARVSDFGLAHLAGPMST  492

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RVDGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  493  PNRVDGYRAPEVTDARKVSQKADVYSFGILLLELLTGKAPTHALLNEEGVDLPRWVQSIV  552

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFDLELLRYQN VEEDMVQLLQLA+NCTAQYPDKRPSMAE+T++IE+LCR
Sbjct  553  REEWTAEVFDLELLRYQN-VEEDMVQLLQLAINCTAQYPDKRPSMAEVTSQIEELCR  608



>emb|CDP01639.1| unnamed protein product [Coffea canephora]
Length=645

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 169/193 (88%), Gaps = 3/193 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR +IALGAARG ++LHSQG SISHGNIKSSN  LT +Y+ARVSDFG AQLV P+ T
Sbjct  451  NWETRAAIALGAARGITYLHSQGPSISHGNIKSSNILLTTTYEARVSDFGLAQLVSPNPT  510

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP K+SQKADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSVV
Sbjct  511  PNRVAGYRAPEVTDPRKISQKADVYSFGVLLLELLTGKAPTHSLMNEEGVDLPRWVQSVV  570

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQ+ VEEDMVQLLQLAV+CTAQYPDKRPSM E+++RIE++ R   
Sbjct  571  REEWTAEVFDLELLRYQS-VEEDMVQLLQLAVDCTAQYPDKRPSMVEVSSRIEEIHRSSL  629

Query  320  QD--NNIVDNPEE  288
            QD   +I+D  EE
Sbjct  630  QDPAADIIDETEE  642



>gb|KJB43131.1| hypothetical protein B456_007G186000 [Gossypium raimondii]
Length=611

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR+ IALGAARG  +LHS+G  ISHGNIKSSN  LT SY+ARVSDFG AQL GP+ T
Sbjct  428  NWDTRSGIALGAARGIEYLHSKGPGISHGNIKSSNVLLTTSYEARVSDFGLAQLAGPTST  487

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RVDGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTHAL NEEG+DLPRWVQS+V
Sbjct  488  PNRVDGYRAPEVTDTNKVSQKADVYSFGILLLELLTGKAPTHALLNEEGIDLPRWVQSIV  547

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            RE+WTSEVFD+ELLRYQN VE+DMVQLLQLA+NCTAQYPDKRPSMAE+  +IEDLCR
Sbjct  548  REDWTSEVFDVELLRYQN-VEDDMVQLLQLAINCTAQYPDKRPSMAEVMNQIEDLCR  603



>ref|XP_002279127.2| PREDICTED: probable inactive receptor kinase At1g48480 [Vitis 
vinifera]
Length=672

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 162/182 (89%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG S+SHGNIKSSN  LTKSYDARVSDFG A LVGPS T
Sbjct  474  NWEIRSGIALGAARGIEYLHSQGPSVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSST  533

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVL+LELLTGKAPTHA+ NEEGVDLPRWVQS+V
Sbjct  534  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLILELLTGKAPTHAILNEEGVDLPRWVQSIV  593

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQLA++CTAQYPDKRP ++E+T RIE+LCR   
Sbjct  594  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCTAQYPDKRPPISEVTKRIEELCRSSL  652

Query  320  QD  315
            ++
Sbjct  653  RE  654



>gb|KHG20222.1| putative inactive receptor kinase -like protein [Gossypium arboreum]
Length=611

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR+ IALGAARG ++LHS+G  ISHGNIKSSN  LT SY+ARVSD G AQL GP+ T
Sbjct  428  NWDTRSGIALGAARGIAYLHSKGPGISHGNIKSSNVLLTTSYEARVSDLGLAQLAGPTST  487

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RVDGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTHAL NEEG+DLPRWVQS+V
Sbjct  488  PNRVDGYRAPEVTDTNKVSQKADVYSFGILLLELLTGKAPTHALLNEEGIDLPRWVQSIV  547

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            RE+WTSEVFDLELLRYQN VE+DMVQLLQLA+NCTAQYPDKRPSMAE+  +IEDLCR
Sbjct  548  REDWTSEVFDLELLRYQN-VEDDMVQLLQLAINCTAQYPDKRPSMAEVMNQIEDLCR  603



>gb|KHG20593.1| putative inactive receptor kinase -like protein [Gossypium arboreum]
Length=606

 Score =   307 bits (786),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR+SIALGAA+G ++LHS+G  ISHGNIKSSN  LT SY+ARVSDFG AQL GP+ T
Sbjct  425  NWDTRSSIALGAAKGIAYLHSKGPGISHGNIKSSNILLTTSYEARVSDFGLAQLSGPTST  484

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RVDGYRAP+VTD  KVSQKADVYSFGVLLLELLTGKAPTHAL+NEEGVDLPRWVQSVV
Sbjct  485  PNRVDGYRAPDVTDARKVSQKADVYSFGVLLLELLTGKAPTHALTNEEGVDLPRWVQSVV  544

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFDLELLRYQN VEEDMVQLLQLA NCTAQYPDKRP+M E+T +IE+LCR
Sbjct  545  REEWTAEVFDLELLRYQN-VEEDMVQLLQLANNCTAQYPDKRPAMDEVTRQIEELCR  600



>gb|ACU19868.1| unknown [Glycine max]
Length=279

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIALGAARG  +LHSQG S+SHGNIKSSN  LTKSYDARVSDFG   LVG S T
Sbjct  78   NWEMRSSIALGAARGIEYLHSQGPSVSHGNIKSSNILLTKSYDARVSDFGLTHLVGSSST  137

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  138  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  197

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW+SEVFD+ELLRYQN  EE+MVQLLQLAV+C   YPD RPSM+++  RIE+L RP  
Sbjct  198  REEWSSEVFDIELLRYQN-SEEEMVQLLQLAVDCVVPYPDNRPSMSQVRQRIEELRRPSM  256

Query  320  QD  315
            ++
Sbjct  257  KE  258



>ref|XP_009356011.1| PREDICTED: probable inactive receptor kinase At1g48480 [Pyrus 
x bretschneideri]
Length=655

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 161/182 (88%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSY+ARVSDFG A LVGPS T
Sbjct  460  NWEIRSGIALGAARGIEYLHSQGHTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSST  519

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK PTHAL NEEGVDLPRWVQS+V
Sbjct  520  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIV  579

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWTSEVFDLELLRYQN VEE+MVQLLQLA++C+AQYPDKRPS++E+T RIE+L R   
Sbjct  580  KEEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEELRRSSL  638

Query  320  QD  315
            QD
Sbjct  639  QD  640



>ref|XP_008393435.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=651

 Score =   305 bits (781),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 162/182 (89%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQGQ++SHGNIKSSN  LTKSY+ARVSDFG A LVGPS T
Sbjct  456  NWEIRSGIALGAARGIEYLHSQGQTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSST  515

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK PTHAL NEEGVDLPRWVQS+V
Sbjct  516  PNRVSGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIV  575

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWTSEVFD+ELLRYQN VEE+MVQLLQLA++C+AQYPDKRPS++E+T RIE+L R   
Sbjct  576  KEEWTSEVFDVELLRYQN-VEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEELRRSSL  634

Query  320  QD  315
            +D
Sbjct  635  RD  636



>ref|XP_008240124.1| PREDICTED: probable inactive receptor kinase At1g48480 [Prunus 
mume]
Length=660

 Score =   305 bits (781),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQGQ++SHGNIKSSN  LTKSY+ARVSDFG A LVGPS T
Sbjct  461  NWEIRSGIALGAARGIEYLHSQGQTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSST  520

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK PTHAL NEEGVDLPRWVQS+V
Sbjct  521  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIV  580

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWTSEVFDLELLRYQN VEE+MVQLLQLA++C+AQYPDKRPS++E+T RIE+L R   
Sbjct  581  KEEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEELRRSSL  639

Query  320  QDNNIVDNPE  291
            ++++   +P+
Sbjct  640  REDHEQQHPD  649



>emb|CBI33513.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   304 bits (778),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 167/193 (87%), Gaps = 6/193 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG +++HS+G + SHGNIKSSN  LTKSY+ARVSDFG A LVGP+ T
Sbjct  414  NWEARSGIALGAARGIAYIHSRGSASSHGNIKSSNILLTKSYEARVSDFGLAHLVGPTAT  473

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  474  PNRVAGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  533

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEE+MVQLLQLA++C AQYPDKRPSM ++T+RIE+LCR   
Sbjct  534  REEWTAEVFDLELLRYQN-VEEEMVQLLQLALDCAAQYPDKRPSMLDVTSRIEELCRSSS  592

Query  320  Q-----DNNIVDN  297
            Q     D+NI+++
Sbjct  593  QHEQEPDHNIIND  605



>ref|XP_010087022.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB25608.1| putative inactive receptor kinase [Morus notabilis]
Length=658

 Score =   305 bits (780),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 162/183 (89%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSY +RVSDFG A LVGPS T
Sbjct  467  NWEIRSGIALGAARGIQYLHSQGPNVSHGNIKSSNILLTKSYTSRVSDFGLAHLVGPSST  526

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK PTHAL NEEGVDLPRWVQS+V
Sbjct  527  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIV  586

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWTSEVFDLELLRYQN VEE+MVQ+LQLA++C AQYPDKRP+M+E+T+RIE+LCR   
Sbjct  587  KEEWTSEVFDLELLRYQN-VEEEMVQMLQLAIDCAAQYPDKRPTMSEVTSRIEELCRSSL  645

Query  320  QDN  312
            +++
Sbjct  646  RED  648



>ref|XP_002317861.2| hypothetical protein POPTR_0012s04170g [Populus trichocarpa]
 gb|EEE96081.2| hypothetical protein POPTR_0012s04170g [Populus trichocarpa]
Length=675

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LT+SYDARVSDFG A+LVGP  T
Sbjct  453  NWEIRSGIALGAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLARLVGPPST  512

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  513  PNRVAGYRAPEVTDPGKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIV  572

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWTSEVFDLELLRYQN VEE+MVQLLQL ++C AQYPD RPSM+E+T RI++LCR
Sbjct  573  REEWTSEVFDLELLRYQN-VEEEMVQLLQLGIDCAAQYPDNRPSMSEVTRRIDELCR  628



>ref|XP_004137511.1| PREDICTED: probable inactive receptor kinase At1g48480 [Cucumis 
sativus]
 gb|KGN64187.1| hypothetical protein Csa_1G042930 [Cucumis sativus]
Length=663

 Score =   305 bits (780),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSYDARVSDFG A LVGP  T
Sbjct  465  NWEIRSGIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPPST  524

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP KVS KADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSVV
Sbjct  525  PTRVAGYRAPEVTDPRKVSHKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVV  584

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPDKRPSM+E+T RIE+L
Sbjct  585  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDKRPSMSEVTKRIEEL  638



>gb|KHN10529.1| Putative inactive receptor kinase [Glycine soja]
Length=506

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHS+G ++SHGNIKSSN  LTKSYDARVSDFG A LVGPS T
Sbjct  313  NWEVRSGIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSST  372

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQ ADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  373  PNRVAGYRAPEVTDPRKVSQMADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  432

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPDKRPSM+E+   I++L R   
Sbjct  433  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIQELRRSSL  491

Query  320  QDN  312
            +++
Sbjct  492  KED  494



>ref|XP_002276147.1| PREDICTED: probable inactive receptor kinase At1g48480 [Vitis 
vinifera]
Length=639

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 167/193 (87%), Gaps = 6/193 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG +++HS+G + SHGNIKSSN  LTKSY+ARVSDFG A LVGP+ T
Sbjct  433  NWEARSGIALGAARGIAYIHSRGSASSHGNIKSSNILLTKSYEARVSDFGLAHLVGPTAT  492

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  493  PNRVAGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  552

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEE+MVQLLQLA++C AQYPDKRPSM ++T+RIE+LCR   
Sbjct  553  REEWTAEVFDLELLRYQN-VEEEMVQLLQLALDCAAQYPDKRPSMLDVTSRIEELCRSSS  611

Query  320  Q-----DNNIVDN  297
            Q     D+NI+++
Sbjct  612  QHEQEPDHNIIND  624



>gb|AET05610.2| LRR receptor-like kinase [Medicago truncatula]
Length=666

 Score =   305 bits (780),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 160/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAA+G  +LHSQG ++SHGNIKSSN  LTKSYDARVSDFG AQLVGPS T
Sbjct  472  NWEMRSGIALGAAKGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAQLVGPSST  531

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  532  PNRVAGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  591

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPDKRPSM+E+   IE+L R   
Sbjct  592  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIEELRRSSL  650

Query  320  QDN  312
            ++N
Sbjct  651  KEN  653



>ref|XP_007211289.1| hypothetical protein PRUPE_ppa002536mg [Prunus persica]
 gb|EMJ12488.1| hypothetical protein PRUPE_ppa002536mg [Prunus persica]
Length=661

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 164/184 (89%), Gaps = 1/184 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQGQ++SHGNIKSSN  LTKSY+ARVSDFG A LVGPS T
Sbjct  461  NWEIRSGIALGAARGIEYLHSQGQTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSST  520

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK PTHAL NEEGVDLPRWVQS+V
Sbjct  521  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIV  580

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWTSEVFDLELLRYQN VEE+MVQLLQLA++C+AQYPDKRPS++E+T RIE+L R   
Sbjct  581  KEEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEELRRSSL  639

Query  320  QDNN  309
            ++++
Sbjct  640  REDH  643



>ref|XP_012088046.1| PREDICTED: probable inactive receptor kinase At1g48480 [Jatropha 
curcas]
 gb|KDP24390.1| hypothetical protein JCGZ_26596 [Jatropha curcas]
Length=655

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LT++Y+ARVSDFG A LVGPS T
Sbjct  458  NWEIRSGIALGAARGIQYLHSQGPNVSHGNIKSSNILLTQNYEARVSDFGLAHLVGPSST  517

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGK PTHAL NEEGVDLPRWVQS+V
Sbjct  518  PNRVAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIV  577

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWTSEVFDLELLRYQN VEE+MVQLLQL ++C AQYPD RPSM+E+T+RIE+LCR
Sbjct  578  REEWTSEVFDLELLRYQN-VEEEMVQLLQLGIDCAAQYPDNRPSMSEVTSRIEELCR  633



>ref|XP_008466324.1| PREDICTED: probable inactive receptor kinase RLK902 [Cucumis 
melo]
Length=662

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSYDARVSDFG A LVGP  T
Sbjct  464  NWEIRSGIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPPST  523

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP KVS KADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSVV
Sbjct  524  PTRVAGYRAPEVTDPRKVSHKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVV  583

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPDKRP+M+E+T RIE+L
Sbjct  584  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDKRPTMSEVTKRIEEL  637



>ref|XP_003631134.1| Atypical receptor-like kinase MARK [Medicago truncatula]
Length=706

 Score =   305 bits (780),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 160/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAA+G  +LHSQG ++SHGNIKSSN  LTKSYDARVSDFG AQLVGPS T
Sbjct  512  NWEMRSGIALGAAKGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAQLVGPSST  571

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  572  PNRVAGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  631

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPDKRPSM+E+   IE+L R   
Sbjct  632  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIEELRRSSL  690

Query  320  QDN  312
            ++N
Sbjct  691  KEN  693



>ref|XP_007036910.1| Receptor-like kinase 1 [Theobroma cacao]
 gb|EOY21411.1| Receptor-like kinase 1 [Theobroma cacao]
Length=659

 Score =   303 bits (776),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSYDARVSDFG A LVGPS T
Sbjct  463  NWDIRSGIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSST  522

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTH++ NEEG+DLPRWVQSVV
Sbjct  523  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSVLNEEGIDLPRWVQSVV  582

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPD+RPSM+++T RIE+L R
Sbjct  583  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDRRPSMSQVTMRIEELRR  638



>ref|XP_002531014.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF31374.1| ATP binding protein, putative [Ricinus communis]
Length=651

 Score =   303 bits (776),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+SIALGAAR  +HLHSQGQ+ SHGNIKSSN  LT S++ARVSDFG A L GP+ T
Sbjct  446  NWETRSSIALGAARAVAHLHSQGQATSHGNIKSSNILLTTSFEARVSDFGLAHLAGPTPT  505

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTH+  NEEGVDLPRWVQSVV
Sbjct  506  PNRIDGYRAPEVTDARKVSQKADVYSFGILLLELLTGKAPTHSHLNEEGVDLPRWVQSVV  565

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            ++EWTSEVFDLELLRYQN VE++MVQLLQLA+NCTAQYPD RPSMAE+  +IE+LCR   
Sbjct  566  KDEWTSEVFDLELLRYQN-VEDEMVQLLQLAINCTAQYPDNRPSMAEVKNQIEELCRSSS  624

Query  320  QDNNI  306
            QD  +
Sbjct  625  QDTRL  629



>ref|XP_008374868.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=655

 Score =   303 bits (776),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 160/182 (88%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSY+ARVSDFG A LVGPS T
Sbjct  460  NWEIRSGIALGAARGIEYLHSQGHTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSST  519

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK PTHAL NEEGVDLPRWVQS+V
Sbjct  520  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIV  579

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWTSEVFDLELLRYQN VEE+MVQLLQLA++C+AQYPDKRPS++E+T RIE+L R   
Sbjct  580  KEEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEELRRSSL  638

Query  320  QD  315
             D
Sbjct  639  LD  640



>ref|XP_011085845.1| PREDICTED: probable inactive receptor kinase At1g48480 [Sesamum 
indicum]
Length=651

 Score =   302 bits (774),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 169/193 (88%), Gaps = 3/193 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR +IALGAARG ++LHSQG S+SHGNIKSSN  LT+SY+ARVSDFG A+L G + T
Sbjct  449  NWETRATIALGAARGITYLHSQGSSVSHGNIKSSNILLTRSYEARVSDFGLARLAGTAAT  508

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTR+ GY+APEVT+P KVSQKADVYSFGVLLLE+LTGKAPTH+LSNEEGVDLPRWV+SVV
Sbjct  509  PTRLAGYQAPEVTNPHKVSQKADVYSFGVLLLEMLTGKAPTHSLSNEEGVDLPRWVKSVV  568

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
             +EWTSEVFDLELLRYQN VEEDMVQLLQLAV+CT QYPDKRPSMA++T +IE+LCR   
Sbjct  569  GDEWTSEVFDLELLRYQN-VEEDMVQLLQLAVDCTEQYPDKRPSMAQVTTKIEELCRRSV  627

Query  320  QD--NNIVDNPEE  288
             D   +I+D  +E
Sbjct  628  DDRSGDIIDVGDE  640



>ref|XP_010268752.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nelumbo 
nucifera]
Length=677

 Score =   303 bits (775),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 165/192 (86%), Gaps = 6/192 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSYDARVSDFG AQLVGP+ T
Sbjct  464  NWETRSGIALGAARGIEYLHSQGSTVSHGNIKSSNILLTKSYDARVSDFGLAQLVGPTAT  523

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV D  KVSQKADVYSFGVLLLELLTGK PTHA+ NEEGVDLPRWVQSVV
Sbjct  524  PNRVAGYRAPEVIDARKVSQKADVYSFGVLLLELLTGKPPTHAILNEEGVDLPRWVQSVV  583

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG-  324
            R+EWTSEVFDLELLRYQ  VEE+MVQLLQLA++C AQYPDKRPSMAE+T RIEDL +   
Sbjct  584  RDEWTSEVFDLELLRYQ-TVEEEMVQLLQLAIDCCAQYPDKRPSMAEVTRRIEDLRQSSL  642

Query  323  --FQDN--NIVD  300
              FQD+  ++VD
Sbjct  643  GQFQDSQADVVD  654



>ref|XP_009759771.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nicotiana 
sylvestris]
Length=671

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R++IALG ARG  +LHSQG S+SHGNIKSSN  LTKSYDARVSDFG AQLVGP  T
Sbjct  479  NWEVRSAIALGTARGIEYLHSQGSSVSHGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTT  538

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEGVDLPRWVQS+V
Sbjct  539  PTRVAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHAILNEEGVDLPRWVQSIV  598

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            RE+WTSEVFDLELLRYQ+ VEE+MVQLLQLA++C AQYPD RPSM+E+  RIE+L R
Sbjct  599  REQWTSEVFDLELLRYQS-VEEEMVQLLQLAIDCAAQYPDHRPSMSEVCERIEELRR  654



>ref|XP_011012967.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=653

 Score =   301 bits (771),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG  +SHGNIKSSN  LT+SYDARVSDFG A LVGP  T
Sbjct  457  NWEIRSGIALGAARGIEYLHSQGPDVSHGNIKSSNILLTQSYDARVSDFGLACLVGPPST  516

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  517  PNRVAGYRAPEVTDPGKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIV  576

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MV+LLQL ++C AQYPD RPSM+E+T RI++LCR   
Sbjct  577  REEWTSEVFDLELLRYQN-VEEEMVELLQLGIDCAAQYPDNRPSMSEVTRRIDELCRSSL  635

Query  320  QDNN  309
            ++++
Sbjct  636  REDS  639



>ref|XP_006451587.1| hypothetical protein CICLE_v10007673mg [Citrus clementina]
 gb|ESR64827.1| hypothetical protein CICLE_v10007673mg [Citrus clementina]
Length=591

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LH+QG ++SHGNIKSSN  LTKSY+ARVSDFG A LVGPS T
Sbjct  396  NWEMRSLIALGAARGIEYLHTQGPNVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSST  455

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  456  PNRVAGYRAPEVTDPCKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIV  515

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            ++EWTSEVFDLELLRYQN VEE+MVQLLQLA++C+AQYPD RPSM+E+  RIE+L
Sbjct  516  KDEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCSAQYPDNRPSMSEVIKRIEEL  569



>ref|XP_010271320.1| PREDICTED: probable inactive receptor kinase RLK902 [Nelumbo 
nucifera]
Length=683

 Score =   301 bits (771),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAARG  +LHS+G ++SHGNIKSSN  L KSYDARVSDFG AQ+VGP+ T
Sbjct  470  NWETRSGIALGAARGVEYLHSKGPNVSHGNIKSSNVLLGKSYDARVSDFGLAQIVGPTST  529

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+ GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSVV
Sbjct  530  PNRIAGYRAPEVTDGRKVSQKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVV  589

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWTSEVFDLELLRYQN VEE+MVQLLQLA++C AQYPDKRPSM E+T RIED+
Sbjct  590  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCCAQYPDKRPSMPEVTKRIEDI  643



>emb|CDO98323.1| unnamed protein product [Coffea canephora]
Length=618

 Score =   299 bits (765),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG  +SHGNIKSSN  LTKSY+ARVSDFG A LVGP  +
Sbjct  426  NWEVRSGIALGAARGIEYLHSQGPDVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPPSS  485

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  486  PTRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIV  545

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN +EE+MVQLLQLA++C AQYPD RPSM+E+  RI++L R   
Sbjct  546  REEWTSEVFDLELLRYQN-LEEEMVQLLQLAIDCAAQYPDNRPSMSEVANRIQELRRSSV  604

Query  320  QD  315
            +D
Sbjct  605  RD  606



>emb|CAN82203.1| hypothetical protein VITISV_018964 [Vitis vinifera]
Length=639

 Score =   299 bits (766),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 165/193 (85%), Gaps = 6/193 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG +++HS+G + SHGNIKSSN  LTKSY+ARVSDFG A LVGP+ T
Sbjct  433  NWEARSGIALGAARGIAYIHSRGSASSHGNIKSSNILLTKSYEARVSDFGLAHLVGPTAT  492

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  493  PNRVAGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  552

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFDLELLRYQN VEE+M QLLQLA++C AQYPDKRPSM ++T+RIE+LCR   
Sbjct  553  REEWTAEVFDLELLRYQN-VEEEMXQLLQLALDCAAQYPDKRPSMLDVTSRIEELCRSSS  611

Query  320  Q-----DNNIVDN  297
                  D+NI+++
Sbjct  612  XHEQEPDHNIIND  624



>gb|KHN45250.1| Putative inactive receptor kinase [Glycine soja]
Length=485

 Score =   295 bits (755),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIALGAARG  +LHSQG S+SHGNIKSSN  LTKSYDARVSDFG   LVG S T
Sbjct  284  NWEMRSSIALGAARGIEYLHSQGPSVSHGNIKSSNILLTKSYDARVSDFGLTHLVGSSST  343

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  344  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  403

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW+SEVFD+ELLRYQN  EE+MVQLLQLAV+C   YPD RPSM+++  RIE+L RP  
Sbjct  404  REEWSSEVFDIELLRYQN-SEEEMVQLLQLAVDCVVPYPDNRPSMSQVRQRIEELRRPSM  462

Query  320  QD  315
            ++
Sbjct  463  KE  464



>ref|XP_007160555.1| hypothetical protein PHAVU_002G331400g [Phaseolus vulgaris]
 gb|ESW32549.1| hypothetical protein PHAVU_002G331400g [Phaseolus vulgaris]
Length=658

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 159/182 (87%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHS+G ++SHGNIKSSN  LTKSYDARVSDFG A LVGPS T
Sbjct  461  NWEVRSGIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSST  520

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  521  PNRVAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  580

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRY+N VEE+MVQLLQLAV+C AQYPDKRPSM+E+   IE+L R   
Sbjct  581  REEWTSEVFDLELLRYRN-VEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIEELRRSSL  639

Query  320  QD  315
            ++
Sbjct  640  KE  641



>ref|XP_002322122.2| hypothetical protein POPTR_0015s04920g [Populus trichocarpa]
 gb|EEF06249.2| hypothetical protein POPTR_0015s04920g [Populus trichocarpa]
Length=652

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 158/184 (86%), Gaps = 1/184 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IAL AARG  +LHSQG ++SHGNIKSSN  LT+SYDARVSDFG A LVGP  T
Sbjct  454  NWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPST  513

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAP HAL NEEGVDLPRWVQS+V
Sbjct  514  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIV  573

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQL ++C AQYPD RPSM+ +T RIE+LCR   
Sbjct  574  REEWTSEVFDLELLRYQN-VEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEELCRSSL  632

Query  320  QDNN  309
            ++++
Sbjct  633  REHH  636



>ref|XP_009360057.1| PREDICTED: probable inactive receptor kinase At1g48480 [Pyrus 
x bretschneideri]
Length=647

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 160/182 (88%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQGQ++SHGNIKSSN  LTKSY+ARVSDFG A LVGPS T
Sbjct  452  NWEIRSRIALGAARGIEYLHSQGQTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSST  511

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK PT AL NEEGVDLPRWVQS+V
Sbjct  512  PNRVSGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTQALLNEEGVDLPRWVQSIV  571

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWTSEVFD+ELLRYQN VEE+MVQLLQLA++C+AQYPDKRPS++E+T RIE+L     
Sbjct  572  KEEWTSEVFDVELLRYQN-VEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEELRHSSL  630

Query  320  QD  315
            +D
Sbjct  631  RD  632



>gb|KHN00136.1| Putative inactive receptor kinase [Glycine soja]
Length=602

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 158/184 (86%), Gaps = 1/184 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHS+G ++SHGNIKSSN  LTKSYDARVSDFG A LV PS T
Sbjct  408  NWEVRSGIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVSPSST  467

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQK DVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  468  PNRVAGYRAPEVTDPRKVSQKVDVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  527

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPD RPSM+E+  RI++L R   
Sbjct  528  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDMRPSMSEVVRRIQELRRSSL  586

Query  320  QDNN  309
            ++ +
Sbjct  587  KEED  590



>ref|XP_006451586.1| hypothetical protein CICLE_v10007673mg [Citrus clementina]
 ref|XP_006490800.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Citrus 
sinensis]
 gb|ESR64826.1| hypothetical protein CICLE_v10007673mg [Citrus clementina]
Length=663

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LH+QG ++SHGNIKSSN  LTKSY+ARVSDFG A LVGPS T
Sbjct  468  NWEMRSLIALGAARGIEYLHTQGPNVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSST  527

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  528  PNRVAGYRAPEVTDPCKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIV  587

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            ++EWTSEVFDLELLRYQN VEE+MVQLLQLA++C+AQYPD RPSM+E+  RIE+L
Sbjct  588  KDEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCSAQYPDNRPSMSEVIKRIEEL  641



>gb|KDO50809.1| hypothetical protein CISIN_1g037905mg, partial [Citrus sinensis]
Length=606

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ +ALGA+R  ++LHS+G + SHGNIKSSN  L+KSY+AR+SDFG A L  PS T
Sbjct  415  NWETRSGLALGASRAIAYLHSKGPANSHGNIKSSNILLSKSYEARISDFGLAHLASPSST  474

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPT AL NEEGVDLPRWVQSVV
Sbjct  475  PNRIDGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTQALLNEEGVDLPRWVQSVV  534

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWT+EVFDLELLRYQN VEE+MVQLLQLA+NCTAQYPD RPSMAE+T++IE++CR   
Sbjct  535  KEEWTAEVFDLELLRYQN-VEEEMVQLLQLAINCTAQYPDNRPSMAEVTSQIEEICRSSL  593

Query  320  QDNNIVD  300
            Q     D
Sbjct  594  QQGQAHD  600



>ref|XP_006430596.1| hypothetical protein CICLE_v10011289mg [Citrus clementina]
 gb|ESR43836.1| hypothetical protein CICLE_v10011289mg [Citrus clementina]
Length=628

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ +ALGA+R  ++LHS+G + SHGNIKSSN  L+KSY+ARVSDFG A L  PS T
Sbjct  437  NWETRSGLALGASRAIAYLHSKGPANSHGNIKSSNILLSKSYEARVSDFGLAHLASPSST  496

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPT AL NEEGVDLPRWVQSVV
Sbjct  497  PNRIDGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTQALLNEEGVDLPRWVQSVV  556

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWT+EVFDLELLRYQN VEE+MVQLLQLA+NCTAQYPD RPSMAE+T++IE++CR   
Sbjct  557  KEEWTAEVFDLELLRYQN-VEEEMVQLLQLAINCTAQYPDNRPSMAEVTSQIEEICRSSL  615

Query  320  QDNNIVD  300
            Q     D
Sbjct  616  QQGQAHD  622



>gb|KDO62795.1| hypothetical protein CISIN_1g006055mg [Citrus sinensis]
Length=663

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LH+QG ++SHGNIKSSN  LTKSY+ARVSDFG A LVGPS T
Sbjct  468  NWEMRSLIALGAARGIEYLHAQGPNVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSST  527

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  528  PNRVAGYRAPEVTDPCKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIV  587

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            ++EWTSEVFDLELLRYQN VEE+MVQLLQLA++C+AQYPD RPSM+E+  RIE+L
Sbjct  588  KDEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCSAQYPDNRPSMSEVIKRIEEL  641



>ref|XP_003525182.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Glycine 
max]
Length=656

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHS+G ++SHGNIKSSN  LTKSYDARVSDFG A LVGPS T
Sbjct  463  NWEVRSGIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSST  522

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQ ADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  523  PNRVAGYRAPEVTDPRKVSQMADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  582

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPDKRPSM+E+   I++L R   
Sbjct  583  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIQELRRSSL  641

Query  320  QDN  312
            +++
Sbjct  642  KED  644



>ref|XP_009617419.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nicotiana 
tomentosiformis]
Length=671

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALG ARG  +LHSQG S+SHGNIKSSN  LTKSYDARVSDFG AQLVGP  T
Sbjct  479  NWEVRSGIALGTARGIEYLHSQGSSVSHGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTT  538

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP +VS KADVYSFGVLLLELLTGKAPTHA+ NEEGVDLPRWVQS+V
Sbjct  539  PTRVAGYRAPEVTDPRRVSHKADVYSFGVLLLELLTGKAPTHAILNEEGVDLPRWVQSIV  598

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            RE+WTSEVFDLELLRYQ+ VEE+MVQLLQLA++C AQYPD RPSM+E+  RI++L R
Sbjct  599  REQWTSEVFDLELLRYQS-VEEEMVQLLQLAIDCAAQYPDNRPSMSEVCERIQELRR  654



>gb|KJB08440.1| hypothetical protein B456_001G081900 [Gossypium raimondii]
Length=636

 Score =   297 bits (761),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR+SIALGAARG ++LHS+G  ISHGNIKSSN  LT SY+ARVSDFG AQ  GP+  
Sbjct  440  NWDTRSSIALGAARGITYLHSKGPLISHGNIKSSNILLTTSYEARVSDFGLAQFAGPTSN  499

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RVDGYRAPEVTD  KVSQK DVYSFG+LLLELLTGKAPTHAL NE+GVDLPRWVQSVV
Sbjct  500  PNRVDGYRAPEVTDTRKVSQKTDVYSFGILLLELLTGKAPTHALLNEDGVDLPRWVQSVV  559

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFDLELLR  N VEEDMVQLLQLA++CTAQYPDKRPSMA +T++IE LCR
Sbjct  560  REEWTAEVFDLELLRDPN-VEEDMVQLLQLAIDCTAQYPDKRPSMANVTSQIEQLCR  615



>gb|KHN43642.1| Putative inactive receptor kinase [Glycine soja]
Length=440

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIALGAA G  +LHSQG S+SHGNIKSSN  LTKSYDARVSDFG   LVGPS T
Sbjct  239  NWEMRSSIALGAACGIQYLHSQGPSVSHGNIKSSNILLTKSYDARVSDFGLTHLVGPSST  298

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV DP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  299  PNRVAGYRAPEVIDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  358

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW+SEVFD+ELLRYQN  EE+MVQLLQLAV+C   YPD RPSM+++  RI++L RP  
Sbjct  359  REEWSSEVFDIELLRYQN-SEEEMVQLLQLAVDCVVPYPDNRPSMSQVIQRIQELRRPSM  417

Query  320  QD  315
            ++
Sbjct  418  KE  419



>ref|XP_006482115.1| PREDICTED: probable inactive receptor kinase RLK902-like [Citrus 
sinensis]
Length=632

 Score =   297 bits (761),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ +ALGA+R  ++LHS+G + SHGNIKSSN  L+KSY+AR+SDFG A L  PS T
Sbjct  441  NWETRSGLALGASRAIAYLHSKGPANSHGNIKSSNILLSKSYEARISDFGLAHLASPSST  500

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPT AL NEEGVDLPRWVQSVV
Sbjct  501  PNRIDGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTQALLNEEGVDLPRWVQSVV  560

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWT+EVFDLELLRYQN VEE+MVQLLQLA+NCTAQYPD RPSMAE+T++IE++CR   
Sbjct  561  KEEWTAEVFDLELLRYQN-VEEEMVQLLQLAINCTAQYPDNRPSMAEVTSQIEEICRSSL  619

Query  320  QDNNIVD  300
            Q     D
Sbjct  620  QQGQAHD  626



>ref|XP_003530966.1| PREDICTED: probable inactive receptor kinase At1g48480-like isoform 
1 [Glycine max]
Length=649

 Score =   298 bits (762),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHS+G ++SHGNIKSSN  LTKSYDARVSDFG A LV PS T
Sbjct  455  NWEVRSGIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVSPSST  514

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQK DVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  515  PNRVAGYRAPEVTDPRKVSQKVDVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  574

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPD RPSM+E+  RI++L R   
Sbjct  575  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDMRPSMSEVVRRIQELRRSSL  633

Query  320  QD  315
            ++
Sbjct  634  KE  635



>ref|XP_002533427.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF28958.1| ATP binding protein, putative [Ricinus communis]
Length=661

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  ++HSQG ++SHGNIKSSN  LT+SY+ARVSDFG A LVGPS T
Sbjct  464  NWEIRSGIALGAARGIQYIHSQGPNVSHGNIKSSNILLTQSYEARVSDFGLAHLVGPSST  523

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK PTHAL NEEGVDLPRWVQS+V
Sbjct  524  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIV  583

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQL ++C AQYPD RPSM+E+T RIE+L R   
Sbjct  584  REEWTSEVFDLELLRYQN-VEEEMVQLLQLGIDCAAQYPDNRPSMSEVTNRIEELRRSSI  642

Query  320  QDN  312
            +++
Sbjct  643  RED  645



>gb|KHG17549.1| putative inactive receptor kinase -like protein [Gossypium arboreum]
Length=636

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR+SIALGAARG ++LHS+G  ISHGNIKSSN  LT SY+ARVSDFG AQ  GP+  
Sbjct  440  NWDTRSSIALGAARGITYLHSKGPLISHGNIKSSNILLTTSYEARVSDFGLAQFAGPTSN  499

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RVDGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTH L NE+GVDLPRWVQSVV
Sbjct  500  PNRVDGYRAPEVTDTRKVSQKADVYSFGILLLELLTGKAPTHTLLNEDGVDLPRWVQSVV  559

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFDLELLR  N VEEDMVQLLQLA++CTAQYPDKRPSMA +T+ IE LCR
Sbjct  560  REEWTAEVFDLELLRDPN-VEEDMVQLLQLAIDCTAQYPDKRPSMANVTSTIEQLCR  615



>ref|XP_006372561.1| hypothetical protein POPTR_0017s02820g [Populus trichocarpa]
 gb|ERP50358.1| hypothetical protein POPTR_0017s02820g [Populus trichocarpa]
Length=547

 Score =   294 bits (752),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 163/188 (87%), Gaps = 1/188 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAARG +++HSQG + SHGNIKSSN  LT S +ARVSDFG A L G + T
Sbjct  358  NWETRSGIALGAARGIAYIHSQGPASSHGNIKSSNILLTTSLEARVSDFGLAHLAGLTPT  417

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTH+  N+EGVDLPRWVQSVV
Sbjct  418  PNRIDGYRAPEVTDARKVSQKADVYSFGILLLELLTGKAPTHSQLNDEGVDLPRWVQSVV  477

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWT+EVFDLELLRYQ  VEEDMVQLLQLA++CTAQYPD RPSM+++ ++IEDLCR   
Sbjct  478  KEEWTAEVFDLELLRYQ-TVEEDMVQLLQLAIDCTAQYPDNRPSMSKVRSQIEDLCRSSS  536

Query  320  QDNNIVDN  297
            Q+++IVD+
Sbjct  537  QEHDIVDD  544



>ref|XP_004503256.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cicer 
arietinum]
Length=758

 Score =   299 bits (766),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSY+ARVSDFG AQLVGPS T
Sbjct  564  NWEMRSGIALGAARGIDYLHSQGPNVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSST  623

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  624  PNRVAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  683

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C A YPDKRPSM+++   IE+L
Sbjct  684  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAPYPDKRPSMSDVVRNIEEL  737



>ref|XP_004299514.1| PREDICTED: probable inactive receptor kinase At1g48480 [Fragaria 
vesca subsp. vesca]
Length=653

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 160/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSY+ RVSDFG A LVGPS T
Sbjct  458  NWEIRSGIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYEGRVSDFGLAHLVGPSST  517

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK PTHAL NEEGVDLPRWVQS+V
Sbjct  518  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIV  577

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWTSEVFDLELLRYQN VEE+MVQLLQLA++C+ QYPDKRPS++E+T RIE+L R   
Sbjct  578  KEEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCSEQYPDKRPSISEVTRRIEELRRSTL  636

Query  320  QDN  312
            +++
Sbjct  637  RED  639



>ref|XP_010069429.1| PREDICTED: probable inactive receptor kinase At1g48480 [Eucalyptus 
grandis]
 gb|KCW57783.1| hypothetical protein EUGRSUZ_H00539 [Eucalyptus grandis]
Length=659

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R++IALGAARG  +LHSQG  +SHGNIKSSN  LT SYDARVSDFG A LVGPS T
Sbjct  460  NWEIRSAIALGAARGIEYLHSQGPIVSHGNIKSSNILLTTSYDARVSDFGLAHLVGPSST  519

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P  V GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAP H+  NEEGVDLPRWVQS+V
Sbjct  520  PNHVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPIHSQLNEEGVDLPRWVQSIV  579

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN +EE+MVQLLQLA++C AQYPDKRPSM+E+ ++IE+LC    
Sbjct  580  REEWTSEVFDLELLRYQN-IEEEMVQLLQLAIDCAAQYPDKRPSMSEVRSQIEELCHSSS  638

Query  320  QDN  312
            Q +
Sbjct  639  QKD  641



>gb|EYU30898.1| hypothetical protein MIMGU_mgv1a003238mg [Erythranthe guttata]
Length=597

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLV-GPSX  684
            NWETR +IALGAARG SHLHSQ  + +HGNIKSSN  LTK+Y+ARV DFG AQL  GP+ 
Sbjct  402  NWETRATIALGAARGISHLHSQSPTTAHGNIKSSNILLTKTYEARVCDFGLAQLASGPAA  461

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            +P RV GYRAPEVTD  K S KADVYSFGVLLLELLTGKAPTH+ +NEEGVDLPRWVQSV
Sbjct  462  SPNRVAGYRAPEVTDARKASHKADVYSFGVLLLELLTGKAPTHSSTNEEGVDLPRWVQSV  521

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
            VREEWT+EVFDLELLRYQ  VEEDMVQ+LQLA++CTAQYPDKRP ++E+ ARIE+LCR G
Sbjct  522  VREEWTAEVFDLELLRYQT-VEEDMVQMLQLAIDCTAQYPDKRPVISEVVARIEELCRSG  580

Query  323  FQDNNIVDNPEE  288
                +IV   EE
Sbjct  581  DSSGDIVGVGEE  592



>ref|XP_002305880.1| hypothetical protein POPTR_0004s08450g [Populus trichocarpa]
 gb|EEE86391.1| hypothetical protein POPTR_0004s08450g [Populus trichocarpa]
Length=623

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAARG +++HSQG + SHGNIKSSN  LT S++ARVSDFG A L GP+ T
Sbjct  434  NWETRSGIALGAARGIAYIHSQGPANSHGNIKSSNILLTTSFEARVSDFGLAHLAGPTPT  493

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTH   N+EGVDLPRWVQSVV
Sbjct  494  PNRIDGYRAPEVTDARKVSQKADVYSFGILLLELLTGKAPTHTQLNDEGVDLPRWVQSVV  553

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW++EVFD ELLRYQ  VEEDMVQLLQLA +CTAQYPD RPSM+E+ +R+EDLCR   
Sbjct  554  REEWSAEVFDPELLRYQ-TVEEDMVQLLQLASDCTAQYPDNRPSMSEVRSRMEDLCRSSS  612

Query  320  QDNNIVDN  297
            Q+++I+D+
Sbjct  613  QEHDIIDD  620



>ref|XP_006365414.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Solanum 
tuberosum]
Length=648

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R++IALG ARG  +LHSQG  +SHGNIKSSN  LTKSY+ARVSDFG A LVG   +
Sbjct  456  NWEIRSNIALGIARGIEYLHSQGPDVSHGNIKSSNVLLTKSYEARVSDFGLANLVGSPSS  515

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP KVSQKADVY+FGVLLLELLTGKAP+HAL NEEGVDLPRWVQSVV
Sbjct  516  PTRVVGYRAPEVTDPRKVSQKADVYNFGVLLLELLTGKAPSHALLNEEGVDLPRWVQSVV  575

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW SEVFD+ELLRYQ   EE+MVQLLQLA+NCTAQYPDKRPSMAEI+ +IE+L RP  
Sbjct  576  REEWPSEVFDIELLRYQ-TAEEEMVQLLQLAINCTAQYPDKRPSMAEISKQIEELRRPTS  634

Query  320  QD  315
             D
Sbjct  635  HD  636



>gb|ACR38562.1| unknown [Zea mays]
Length=304

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  110  DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  169

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  170  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  229

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RP+M+E+  RI+++ R   
Sbjct  230  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSSL  288

Query  320  QDNNIVDNPE  291
             D  + D+ E
Sbjct  289  GDRQVADSAE  298



>gb|ACL52878.1| unknown [Zea mays]
 gb|AFW89166.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=237

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  43   DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  102

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  103  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  162

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RP+M+E+  RI+++ R   
Sbjct  163  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSSL  221

Query  320  QDNNIVDNPE  291
             D  + D+ E
Sbjct  222  GDRQVADSAE  231



>ref|XP_010671388.1| PREDICTED: probable inactive receptor kinase At1g48480 [Beta 
vulgaris subsp. vulgaris]
Length=659

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIALG ARG S+LHSQG  +SHGNIKSSN  LTKSY+ RVSDFG AQLVGPS T
Sbjct  461  NWELRSSIALGVARGISYLHSQGSDVSHGNIKSSNVLLTKSYEPRVSDFGLAQLVGPSST  520

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV+GYRAPEVT+P K SQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  521  PTRVNGYRAPEVTEPRKTSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  580

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLC  333
            +++W SEVFDLELLRYQ+  EE+MVQLLQ+AV+C AQYPD RPSM ++T +IE+LC
Sbjct  581  KDDWASEVFDLELLRYQH-AEEEMVQLLQIAVDCAAQYPDTRPSMIDVTKQIEELC  635



>ref|XP_004241646.1| PREDICTED: probable inactive receptor kinase At1g48480 [Solanum 
lycopersicum]
Length=634

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 154/178 (87%), Gaps = 1/178 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIALG ARG  +LHSQG  +SHGNIKSSN  LTKSY+ARVSDFG A LVGP  +
Sbjct  455  NWEIRSSIALGIARGIEYLHSQGPDVSHGNIKSSNVLLTKSYEARVSDFGLANLVGPPSS  514

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAP+HAL NEEGVDLPRWVQSVV
Sbjct  515  PTRVVGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPSHALLNEEGVDLPRWVQSVV  574

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
            REEW SEVFD+ELLRYQ   EE MVQLLQLA+NCT QYP+ RPSMAEI+ +IE+L RP
Sbjct  575  REEWPSEVFDIELLRYQ-TAEEQMVQLLQLAMNCTVQYPNNRPSMAEISKQIEELQRP  631



>ref|XP_011007233.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=624

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 161/188 (86%), Gaps = 1/188 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAARG +++HSQG + SHGNIKSSN  LT S+ ARVSDFG A L GP+ T
Sbjct  435  NWETRSGIALGAARGIAYIHSQGPANSHGNIKSSNILLTTSFGARVSDFGLAHLAGPTPT  494

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTH   N+EGVDLPRWVQSVV
Sbjct  495  PNRIDGYRAPEVTDARKVSQKADVYSFGILLLELLTGKAPTHTQLNDEGVDLPRWVQSVV  554

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW++EVFD ELLRYQ  VEEDMVQLLQLA +CTAQYPD RPSM+E+ +R+EDLCR   
Sbjct  555  REEWSAEVFDPELLRYQ-TVEEDMVQLLQLASDCTAQYPDNRPSMSEVRSRMEDLCRSSS  613

Query  320  QDNNIVDN  297
            Q+++I+D+
Sbjct  614  QEHDIIDD  621



>ref|XP_011002185.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=624

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 161/188 (86%), Gaps = 1/188 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAARG +++HSQG + SHGNIKSSN  LT S+ ARVSDFG A L GP+ T
Sbjct  435  NWETRSGIALGAARGIAYIHSQGPANSHGNIKSSNILLTTSFGARVSDFGLAHLAGPTPT  494

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTH   N+EGVDLPRWVQSVV
Sbjct  495  PNRIDGYRAPEVTDARKVSQKADVYSFGILLLELLTGKAPTHTQLNDEGVDLPRWVQSVV  554

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW++EVFD ELLRYQ  VEEDMVQLLQLA +CTAQYPD RPSM+E+ +R+EDLCR   
Sbjct  555  REEWSAEVFDPELLRYQ-TVEEDMVQLLQLASDCTAQYPDNRPSMSEVRSRMEDLCRSSS  613

Query  320  QDNNIVDN  297
            Q+++I+D+
Sbjct  614  QEHDIIDD  621



>ref|XP_011035563.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=652

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 158/184 (86%), Gaps = 1/184 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IAL AARG  +LHSQG ++SHGNIKSSN  LT+SYDARVSDFG A LVGP  T
Sbjct  454  NWKIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPST  513

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAP HAL NEEGVDLPRWVQS+V
Sbjct  514  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIV  573

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLEL+RYQN VEE+MVQLLQL ++C AQYPD RPSM+ +T RIE+LC+   
Sbjct  574  REEWTSEVFDLELVRYQN-VEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEELCQSSL  632

Query  320  QDNN  309
            ++++
Sbjct  633  REHH  636



>ref|XP_003530064.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Glycine 
max]
Length=684

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIALGAARG  +LHSQG S+SHGNIKSSN  LTKSYDARVSDFG   LVG S T
Sbjct  483  NWEMRSSIALGAARGIEYLHSQGPSVSHGNIKSSNILLTKSYDARVSDFGLTHLVGSSST  542

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  543  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  602

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW+SEVFD+ELLRYQN  EE+MVQLLQLAV+C   YPD RPSM+++  RIE+L RP  
Sbjct  603  REEWSSEVFDIELLRYQN-SEEEMVQLLQLAVDCVVPYPDNRPSMSQVRQRIEELRRPSM  661

Query  320  QD  315
            ++
Sbjct  662  KE  663



>ref|XP_012086419.1| PREDICTED: probable inactive receptor kinase At5g16590 [Jatropha 
curcas]
 gb|KDP25788.1| hypothetical protein JCGZ_22510 [Jatropha curcas]
Length=647

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAARG +HLHSQG + SHGNIKSSN  LT S++ARVSDFG A L GP+ T
Sbjct  440  NWETRSGIALGAARGIAHLHSQGFTNSHGNIKSSNILLTTSFEARVSDFGLAHLAGPTPT  499

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RVDGYRAPEVTD  KVS KADVYSFG+LLLELLTGKAPTH+  NEEGVDLPRWVQSVV
Sbjct  500  PNRVDGYRAPEVTDARKVSPKADVYSFGILLLELLTGKAPTHSHLNEEGVDLPRWVQSVV  559

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            ++EWT+EVFDLELLRYQN VEEDMVQLLQLA+NCTAQYPD RPSMAE+  +IE++C    
Sbjct  560  KDEWTTEVFDLELLRYQN-VEEDMVQLLQLAINCTAQYPDNRPSMAEVRNQIEEICHSSS  618

Query  320  Q  318
            Q
Sbjct  619  Q  619



>gb|EEC74787.1| hypothetical protein OsI_10572 [Oryza sativa Indica Group]
Length=366

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  171  DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  230

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  231  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  290

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RPSM+E+ ARI+++ R   
Sbjct  291  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPSMSEVAARIDEIRRSSL  349

Query  320  QDNNIVDNPEE  288
             D    D+  E
Sbjct  350  GDRPATDSAGE  360



>gb|KEH26683.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=676

 Score =   293 bits (749),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXTP  678
            WE R+ IALGAARG  +LHSQG ++SHGNIKSSN  LTKSYDARVSDFG A LVGPS TP
Sbjct  476  WEMRSGIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSSTP  535

Query  677  TRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVVR  498
             RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL N+EGVDLPRWVQSVV+
Sbjct  536  NRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNDEGVDLPRWVQSVVK  595

Query  497  EEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            EEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C A YPD RPSM+++   IE+L R
Sbjct  596  EEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAPYPDNRPSMSQVRQHIEELHR  650



>ref|XP_011001561.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=625

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 161/188 (86%), Gaps = 1/188 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAARG +++HSQG + SHGNIKSSN  LT S +ARVSDFG A L G +  
Sbjct  436  NWETRSGIALGAARGIAYIHSQGPASSHGNIKSSNILLTTSLEARVSDFGLAHLAGLTPA  495

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFG+LLLELLTGKAPTH+  N+EGVDLPRWVQSVV
Sbjct  496  PNRIDGYRAPEVTDARKVSQKADVYSFGILLLELLTGKAPTHSQLNDEGVDLPRWVQSVV  555

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWT+EVFDLELLRYQ  VEEDMVQLLQLA++CTAQYPD RPSM+++ ++IEDLCR   
Sbjct  556  KEEWTAEVFDLELLRYQ-TVEEDMVQLLQLAIDCTAQYPDNRPSMSKVRSQIEDLCRSSS  614

Query  320  QDNNIVDN  297
            Q ++IVD+
Sbjct  615  QGHDIVDD  622



>ref|XP_007152668.1| hypothetical protein PHAVU_004G149100g [Phaseolus vulgaris]
 gb|ESW24662.1| hypothetical protein PHAVU_004G149100g [Phaseolus vulgaris]
Length=673

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IA+GAARG  +LHSQG S+SHGNIKSSN  LTKSYDARVSDFG A LVGPS T
Sbjct  472  NWEMRSEIAIGAARGIEYLHSQGPSVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSST  531

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  532  PNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  591

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW+SEVFD+ELLRYQN  EE+MVQLLQLAV+C   YPD RPS++++  RIE+L R   
Sbjct  592  REEWSSEVFDIELLRYQN-SEEEMVQLLQLAVDCVVPYPDNRPSISQVRQRIEELRRSSM  650

Query  320  QD  315
            ++
Sbjct  651  KE  652



>gb|KJB30188.1| hypothetical protein B456_005G133200 [Gossypium raimondii]
Length=655

 Score =   290 bits (743),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IALGAA G  +LHSQG ++SHGNIKSSN  LTKSY+ARVSDFG A +VG S +
Sbjct  468  NWDIRSGIALGAACGIEYLHSQGPNVSHGNIKSSNILLTKSYEARVSDFGLANIVGSSSS  527

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTH++ NEEG+DLPRWVQSVV
Sbjct  528  PNRVLGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSILNEEGIDLPRWVQSVV  587

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPDKRP+M+++ +RIE+L +   
Sbjct  588  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDKRPTMSQVRSRIEELRQSSL  646

Query  320  QDNNI  306
            +D+ I
Sbjct  647  RDDLI  651



>ref|XP_004512763.1| PREDICTED: probable inactive receptor kinase RLK902-like [Cicer 
arietinum]
Length=681

 Score =   290 bits (742),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIALGA+RG  +LHSQG ++SHGNIKSSN  LTK+YDA+VSDFG A LVGPS T
Sbjct  481  NWEMRSSIALGASRGIEYLHSQGPNVSHGNIKSSNILLTKTYDAKVSDFGLAHLVGPSPT  540

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHA+ NEEGVDLPRWVQSVV
Sbjct  541  PNRVSGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHAVLNEEGVDLPRWVQSVV  600

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            ++EWTSEVFDLELLRYQN VE++MVQLLQLAV+C A YPD RPS++++   IE+L R   
Sbjct  601  KDEWTSEVFDLELLRYQN-VEDEMVQLLQLAVDCAATYPDNRPSISQVRHHIEELHRSSL  659

Query  320  QD  315
            ++
Sbjct  660  KE  661



>ref|XP_009778793.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nicotiana 
sylvestris]
Length=686

 Score =   290 bits (741),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIAL  A+G  +LHSQG ++SH NIKSSN  LTKSY+ARVSDFG A LVGP  +
Sbjct  494  NWEIRSSIALQIAQGIDYLHSQGPNVSHANIKSSNVLLTKSYEARVSDFGLANLVGPPSS  553

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWV+SVV
Sbjct  554  PTRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVESVV  613

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW SEVFD+ELLRYQ   EE+MVQLLQLA++CTAQYPD RPSM+E++ RIE+L R   
Sbjct  614  REEWPSEVFDIELLRYQ-TAEEEMVQLLQLAIDCTAQYPDNRPSMSEVSKRIEELRRSTL  672

Query  320  QDNNIVD  300
             ++ +V+
Sbjct  673  HEHYLVN  679



>gb|EPS69043.1| hypothetical protein M569_05720, partial [Genlisea aurea]
Length=614

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR +IALGAARG S+LHSQG S+SHGNIKSSN  LTKSY+ARVSDFG AQL  P+  
Sbjct  426  NWETRAAIALGAARGISYLHSQGSSVSHGNIKSSNILLTKSYEARVSDFGLAQLATPTTG  485

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
              RV GYRAPEVTDP KVSQ ADVYSFGVLLLELLT KAPT+++ NEEGVDLPRWVQSVV
Sbjct  486  TARVAGYRAPEVTDPQKVSQNADVYSFGVLLLELLTAKAPTNSVLNEEGVDLPRWVQSVV  545

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEW +EVFD+ELLRYQ+ VEEDMVQLL+LAV+CTAQ+PD RPSM  +T +IEDLCR
Sbjct  546  REEWAAEVFDVELLRYQS-VEEDMVQLLELAVDCTAQHPDNRPSMEVVTTKIEDLCR  601



>gb|ACR34746.1| unknown [Zea mays]
Length=462

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR+++AL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  268  DWETRSAVALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  327

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  328  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  387

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RP+M+E+  RI+++ R   
Sbjct  388  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSSL  446

Query  320  QDNNIVDNPE  291
             D  + D+ E
Sbjct  447  GDRQVADSAE  456



>ref|XP_010670123.1| PREDICTED: probable inactive receptor kinase At5g16590 [Beta 
vulgaris subsp. vulgaris]
Length=662

 Score =   288 bits (736),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 158/195 (81%), Gaps = 6/195 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR++IALGAARG +++HSQ    SHGNIKSSN  L+ SY+ARVSD G AQL  PS T
Sbjct  462  NWETRSAIALGAARGITYIHSQNSKASHGNIKSSNILLSNSYEARVSDCGLAQLANPSTT  521

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPE+TD  KVSQKADVYSFGV LLELLTGKAPTH L NEEGVDLPRWVQSVV
Sbjct  522  PNRVAGYRAPEITDARKVSQKADVYSFGVFLLELLTGKAPTHTLLNEEGVDLPRWVQSVV  581

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW SEVFD+ELLRYQN VEEDMV+LLQLA++CT QYPD RPSM+E+T+RIE++C+   
Sbjct  582  REEWASEVFDMELLRYQN-VEEDMVKLLQLAIDCTVQYPDSRPSMSEVTSRIEEICQSSL  640

Query  320  QDN-----NIVDNPE  291
                    +I  +PE
Sbjct  641  SSGQDPLADITSDPE  655



>gb|KHG00875.1| putative inactive receptor kinase -like protein [Gossypium arboreum]
Length=631

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAARG ++LHS+G  ISHGNIKSSN  LT SY+AR+SDFG AQL GP+  
Sbjct  435  NWETRCGIALGAARGIAYLHSKGPEISHGNIKSSNILLTTSYEARISDFGLAQLAGPTSA  494

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV+GYRAPEVTD  +VSQKADVYSFG+LLLELLTGKAP HAL NE+GVDL RWVQSVV
Sbjct  495  PDRVNGYRAPEVTDVRRVSQKADVYSFGILLLELLTGKAPRHALLNEDGVDLSRWVQSVV  554

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             EEWT+EVFDLELLR+QN VEEDMV+LLQLA++CTAQYPDKRPS++E+T RIE++  P
Sbjct  555  PEEWTTEVFDLELLRHQN-VEEDMVKLLQLAIDCTAQYPDKRPSLSEMTTRIEEIHGP  611



>gb|AGO98729.1| ovary receptor kinase 27 [Solanum chacoense]
Length=661

 Score =   284 bits (726),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R+ IALG ARG  +LHSQG ++ HGNIKSSN  LTKSYDARVSDFG AQLVGP  +
Sbjct  470  DWQVRSGIALGTARGIEYLHSQGSNV-HGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTS  528

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  529  PTRVAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIV  588

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLC  333
            +++WTS+VFD+ELLRYQ+ VEE+MVQLLQLA++C+ QYPD RPSM+ +  RI++LC
Sbjct  589  QDQWTSQVFDIELLRYQS-VEEEMVQLLQLAIDCSTQYPDHRPSMSAVVERIQELC  643



>ref|XP_006826909.1| PREDICTED: probable inactive receptor kinase At1g48480 [Amborella 
trichopoda]
 gb|ERM94146.1| hypothetical protein AMTR_s00010p00158940 [Amborella trichopoda]
Length=651

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 154/177 (87%), Gaps = 3/177 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAAR   +LHSQG ++SHGNIKSSN  LTK Y+ARVSDFG AQLV  S +
Sbjct  446  NWETRSGIALGAARAIEYLHSQGSTVSHGNIKSSNILLTKDYEARVSDFGLAQLVSSSAS  505

Query  680  PT--RVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQS  507
            PT  RV GYRAPEVTD  K+SQKADVYSFGVLLLELLTGK P+H+L+NEEGVDLPRWVQS
Sbjct  506  PTANRVIGYRAPEVTDAHKISQKADVYSFGVLLLELLTGKPPSHSLTNEEGVDLPRWVQS  565

Query  506  VVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            VVREEWT+EVFDLELLRYQN VEEDMVQLLQLA++C AQYPD+RPSM E+  RIE+L
Sbjct  566  VVREEWTAEVFDLELLRYQN-VEEDMVQLLQLAMDCAAQYPDQRPSMREVVQRIEEL  621



>ref|XP_006341503.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Solanum 
tuberosum]
Length=666

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R+ IALG ARG  +LHSQG ++ HGNIKSSN  LTKSYDARVSDFG AQLVGP  +
Sbjct  475  DWQVRSGIALGTARGIEYLHSQGSNV-HGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTS  533

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  534  PTRVAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIV  593

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLC  333
            +++WTS+VFD+ELLRYQ+ VEE+MVQLLQLA++C+ QYPD RPSM+ +  RI++LC
Sbjct  594  QDQWTSQVFDIELLRYQS-VEEEMVQLLQLAIDCSTQYPDHRPSMSAVVERIQELC  648



>gb|AFW89165.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=669

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  475  DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  534

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  535  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  594

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RP+M+E+  RI+++ R   
Sbjct  595  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSSL  653

Query  320  QDNNIVDNPE  291
             D  + D+ E
Sbjct  654  GDRQVADSAE  663



>ref|NP_001152341.1| LOC100285980 precursor [Zea mays]
 gb|ACG47114.1| atypical receptor-like kinase MARK [Zea mays]
Length=669

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  475  DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  534

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  535  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  594

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RP+M+E+  RI+++ R   
Sbjct  595  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSSL  653

Query  320  QDNNIVDNPE  291
             D  + D+ E
Sbjct  654  GDRQVADSAE  663



>gb|EMT33198.1| hypothetical protein F775_43654 [Aegilops tauschii]
Length=373

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WE R++IAL  ARG +H+HS G + SHGNIKSSN  LTKSY+ARVSD G   LVGPS +
Sbjct  172  DWEARSAIALSTARGVAHIHSTGPTASHGNIKSSNVLLTKSYEARVSDHGLPTLVGPSFS  231

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  232  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  291

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RPSM++  ARI+++ R
Sbjct  292  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPSMSDAAARIDEIRR  347



>gb|KJB10379.1| hypothetical protein B456_001G198100 [Gossypium raimondii]
Length=630

 Score =   281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 154/178 (87%), Gaps = 1/178 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAARG ++LHS+G  ISHGNIKSSN  LT SY+AR+SDFG AQL GP+  
Sbjct  434  NWETRCGIALGAARGIAYLHSKGPEISHGNIKSSNILLTTSYEARISDFGLAQLAGPTSA  493

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV+GYRAPEVTD  +VSQKADVYSFG+LLLELLTGKAP HAL NE+GVDL RWVQSVV
Sbjct  494  PDRVNGYRAPEVTDVRRVSQKADVYSFGILLLELLTGKAPRHALLNEDGVDLSRWVQSVV  553

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             EEWT+EVFD ELLR+QN VEEDMV+LLQLA++CTAQYPDKRPS++E+T RIE+L  P
Sbjct  554  PEEWTTEVFDHELLRHQN-VEEDMVKLLQLAIDCTAQYPDKRPSLSEMTTRIEELHGP  610



>gb|AAN05336.1| Putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABF94713.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ26109.1| hypothetical protein OsJ_09969 [Oryza sativa Japonica Group]
 dbj|BAG89413.1| unnamed protein product [Oryza sativa Japonica Group]
Length=675

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  480  DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  539

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  540  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  599

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RPSM+E+ ARI+++ R   
Sbjct  600  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPSMSEVAARIDEIRRSSL  658

Query  320  QDNNIVDNPEE  288
             D    D+  E
Sbjct  659  GDRPATDSAGE  669



>ref|XP_010036979.1| PREDICTED: probable inactive receptor kinase At1g48480 [Eucalyptus 
grandis]
 gb|KCW48615.1| hypothetical protein EUGRSUZ_K02280 [Eucalyptus grandis]
Length=666

 Score =   282 bits (722),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIALG ARG  +LHSQG  +SHGNIKSSN  LTKS++AR+SDFG A +VGPS  
Sbjct  469  NWELRSSIALGVARGIEYLHSQGHHVSHGNIKSSNVLLTKSHNARLSDFGLAHIVGPSVV  528

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTR+ GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAP +++ NEEG+DLPRWVQSVV
Sbjct  529  PTRLAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPANSVLNEEGIDLPRWVQSVV  588

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW+SEVFDLELLRYQN  EE+MV+LLQLA++C AQYPD+RPSM ++  RIE+L R   
Sbjct  589  REEWSSEVFDLELLRYQN-AEEEMVELLQLAMDCAAQYPDQRPSMPDVRRRIEELSRRSL  647

Query  320  QDN  312
             D+
Sbjct  648  PDH  650



>ref|XP_008660393.1| PREDICTED: probable inactive receptor kinase At1g48480 [Zea mays]
 gb|AFW89168.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=672

 Score =   282 bits (722),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR+++AL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  478  DWETRSAVALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  537

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  538  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  597

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RP+M+E+  RI+++ R   
Sbjct  598  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSSL  656

Query  320  QDNNIVDNPE  291
             D  + D+ E
Sbjct  657  GDRQVADSAE  666



>ref|NP_001049422.1| Os03g0223000 [Oryza sativa Japonica Group]
 dbj|BAF11336.1| Os03g0223000, partial [Oryza sativa Japonica Group]
Length=713

 Score =   283 bits (723),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  518  DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  577

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  578  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  637

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RPSM+E+ ARI+++ R   
Sbjct  638  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPSMSEVAARIDEIRRSSL  696

Query  320  QDNNIVDNPEE  288
             D    D+  E
Sbjct  697  GDRPATDSAGE  707



>ref|XP_011083189.1| PREDICTED: probable inactive receptor kinase At1g48480 [Sesamum 
indicum]
Length=654

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE RT IALGAARG  +LH QG S+SHGNIKSSN  LTKSYDARVSDFG   LVGP  +
Sbjct  462  NWEIRTRIALGAARGIEYLHFQGHSVSHGNIKSSNILLTKSYDARVSDFGLNHLVGPPSS  521

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP KVSQKADVYS GVLLLELLTGKAPTHAL NEEGVDLPRWVQSVV
Sbjct  522  PTRVAGYRAPEVTDPRKVSQKADVYSLGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVV  581

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VE++MVQLLQL ++CTAQYPD RPS++E+  RIE+L R   
Sbjct  582  REEWTSEVFDLELLRYQN-VEDEMVQLLQLGIDCTAQYPDNRPSISEVARRIEELRRSSL  640

Query  320  QDN  312
            +DN
Sbjct  641  RDN  643



>ref|XP_004235768.1| PREDICTED: probable inactive receptor kinase At1g48480 [Solanum 
lycopersicum]
Length=661

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R+ IALG ARG  +LHSQG ++ HGNIKSSN  LTKSYDARVSDFG AQLVGP  +
Sbjct  470  DWKVRSGIALGTARGIEYLHSQGSTV-HGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTS  528

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP +V+QKADVYSFGVLLLELLTGKAPTHAL NEEGVDLPRWVQS+V
Sbjct  529  PTRVAGYRAPEVTDPRRVTQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIV  588

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            +++WTS+VFD+ELLRYQ+ VEE+MVQLLQLA++C+ QYPD RPSM+++  RI++L
Sbjct  589  QDQWTSQVFDIELLRYQS-VEEEMVQLLQLAIDCSTQYPDNRPSMSDVVERIQEL  642



>ref|XP_004985160.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Setaria 
italica]
Length=675

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  478  DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  537

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  538  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  597

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RP+MAE+  RI+++ R   
Sbjct  598  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPTMAEVATRIDEIRRSSL  656

Query  320  QDNNIVDN  297
             D    D+
Sbjct  657  GDRQAGDS  664



>gb|KHN41064.1| Putative inactive receptor kinase [Glycine soja]
Length=566

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR++IALGAARG +++HS G + SHGNIKSSN  LTK+++ARVSDFG A L  P+ T
Sbjct  357  NWETRSAIALGAARGIAYIHSHGPTSSHGNIKSSNILLTKTFEARVSDFGLAYLALPTST  416

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  K+SQKADVYSFG++LLELLTGKAPTH+   EEGVDLPRWVQSVV
Sbjct  417  PNRVSGYRAPEVTDARKISQKADVYSFGIMLLELLTGKAPTHSSLTEEGVDLPRWVQSVV  476

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            ++EW +EVFD+ELLRYQN VEE+MV+LLQLA+ CTAQYPDKRPSM  + ++IE++C P  
Sbjct  477  QDEWNTEVFDMELLRYQN-VEEEMVKLLQLALECTAQYPDKRPSMDVVASKIEEICHPSL  535

Query  320  Q  318
            +
Sbjct  536  E  536



>ref|XP_008381374.1| PREDICTED: probable inactive receptor kinase RLK902 [Malus domestica]
Length=236

 Score =   266 bits (680),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IA+G AR  +++HS G + SHGNIKSSN  LT+SY+A VSDF  A L  P+ T
Sbjct  47   NWETRSGIAVGVARAITYIHSHGPTTSHGNIKSSNILLTRSYEACVSDFCLAHLASPTST  106

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+ GYRAPE+TD  KV+QKADVYSFGVLLLE+LTGK PT  + NEEGVDLPRWV SVV
Sbjct  107  PNRISGYRAPELTDTSKVTQKADVYSFGVLLLEILTGKPPTQTIMNEEGVDLPRWVHSVV  166

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWT+EVFD ELLRYQN VEE+MVQLLQ+A+ CT QYPD RPSM E+T+RIEDL
Sbjct  167  REEWTAEVFDFELLRYQN-VEEEMVQLLQIALECTVQYPDSRPSMGEVTSRIEDL  220



>ref|XP_002468249.1| hypothetical protein SORBIDRAFT_01g042480 [Sorghum bicolor]
 gb|EER95247.1| hypothetical protein SORBIDRAFT_01g042480 [Sorghum bicolor]
Length=674

 Score =   279 bits (714),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 161/192 (84%), Gaps = 3/192 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  478  DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  537

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  538  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  597

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP--  327
            REEWT+EVFD ELLRYQN VEE+MVQLLQLA++C+AQ+PD+RP+M+E+  RI+D+ R   
Sbjct  598  REEWTAEVFDQELLRYQN-VEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDDIRRSSL  656

Query  326  GFQDNNIVDNPE  291
            G  D    D+ E
Sbjct  657  GGGDRQAADSAE  668



>ref|NP_001051064.1| Os03g0712400 [Oryza sativa Japonica Group]
 dbj|BAF12978.1| Os03g0712400, partial [Oryza sativa Japonica Group]
Length=225

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+SIAL AARG  ++HS   S SHGNIKSSN  L KSY AR+SD G + LVGPS  
Sbjct  12   NWETRSSIALAAARGVEYIHSTSSSASHGNIKSSNVLLNKSYQARLSDNGLSALVGPSSA  71

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAP+ A  N+EGVDLPRWVQSVV
Sbjct  72   PSRASGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVV  131

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            R EWT+EVFD+ELLRYQN VEE MVQLLQLA++C AQ PD RPSM  +  RIE++ +
Sbjct  132  RSEWTAEVFDMELLRYQN-VEEQMVQLLQLAIDCVAQVPDARPSMPHVVLRIEEIKK  187



>gb|EPS58567.1| hypothetical protein M569_16246, partial [Genlisea aurea]
Length=646

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVG-PSX  684
            +W  RTSIALGAARG  +LH QG +ISHGNIKSSN  LT S +AR+SDFG   L G PS 
Sbjct  471  SWNIRTSIALGAARGIEYLHFQGTTISHGNIKSSNILLTNSCEARLSDFGLNHLAGSPSS  530

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            +P RV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSV
Sbjct  531  SPIRVAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSV  590

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            VREEWTSEVFDLELLRYQ+ VE++MVQ+LQL ++CTAQYPDKRPS++E+  RIE+L
Sbjct  591  VREEWTSEVFDLELLRYQS-VEDEMVQMLQLGMDCTAQYPDKRPSISEVAKRIEEL  645



>ref|XP_010916205.1| PREDICTED: probable inactive receptor kinase At1g48480 [Elaeis 
guineensis]
Length=667

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 151/177 (85%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IAL AA G  ++HS G S SHGNIKSSN  LTK+Y+ARVSD G A LVG + T
Sbjct  451  NWETRSGIALAAAHGIEYIHSTGPSASHGNIKSSNILLTKTYEARVSDHGLAHLVGQTST  510

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAP  AL N+EGVDLPRWVQSVV
Sbjct  511  PTRVAGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPAQALLNDEGVDLPRWVQSVV  570

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFDLELLRYQN VEE+MVQLLQLA++C AQYPDKRP+++E+  RIE++ R
Sbjct  571  REEWTAEVFDLELLRYQN-VEEEMVQLLQLAIDCAAQYPDKRPTISEVVVRIEEIRR  626



>ref|XP_004490822.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cicer 
arietinum]
Length=620

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+SIALGAA G ++LHSQG + SHGNIKSSN  LTKS++ RVSDFG A L  P+ T
Sbjct  439  NWETRSSIALGAAHGIAYLHSQGPTSSHGNIKSSNILLTKSFEPRVSDFGLAYLALPTAT  498

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  KVSQKADVYSFG++LLELLTGKAPTH+  NEEGVDLPRWVQSVV
Sbjct  499  PNRVSGYRAPEVTDARKVSQKADVYSFGIMLLELLTGKAPTHSSLNEEGVDLPRWVQSVV  558

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            ++EW +EVFD+ELLRYQN VEE+MV LLQLA+ CTAQYPDKRPSM  +  RIE +C    
Sbjct  559  QDEWNTEVFDMELLRYQN-VEEEMVNLLQLALECTAQYPDKRPSMDVVANRIEKICHSSL  617

Query  320  Q  318
            +
Sbjct  618  E  618



>ref|XP_006575485.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Glycine 
max]
Length=643

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR++IALGAARG +++HS G + SHGNIKSSN  LTK+++ARVSDFG A L  P+ T
Sbjct  434  NWETRSAIALGAARGIAYIHSHGPTSSHGNIKSSNILLTKTFEARVSDFGLAYLALPTST  493

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  K+SQKADVYSFG++LLELLTGKAPTH+   EEGVDLPRWVQSVV
Sbjct  494  PNRVSGYRAPEVTDARKISQKADVYSFGIMLLELLTGKAPTHSSLTEEGVDLPRWVQSVV  553

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            ++EW +EVFD+ELLRYQN VEE+MV+LLQLA+ CTAQYPDKRPSM  + ++IE++C P  
Sbjct  554  QDEWNTEVFDMELLRYQN-VEEEMVKLLQLALECTAQYPDKRPSMDVVASKIEEICHPSL  612

Query  320  Q  318
            +
Sbjct  613  E  613



>gb|EYU24506.1| hypothetical protein MIMGU_mgv1a0087053mg, partial [Erythranthe 
guttata]
Length=315

 Score =   266 bits (680),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQ-GQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSX  684
            NWE R+ IALG+ARG  +LH Q G   SHGNIKSSN  LTKS   +VSDFG   LVGP  
Sbjct  135  NWELRSEIALGSARGIEYLHLQNGPHFSHGNIKSSNILLTKSNSPKVSDFGLNHLVGPPS  194

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            +PTRV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEGVDLPRWVQSV
Sbjct  195  SPTRVAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHAILNEEGVDLPRWVQSV  254

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            VREEWT+EVFDLELLR  N +EE+MV++LQL ++CTAQYPD+RP+++++  RIEDL R
Sbjct  255  VREEWTAEVFDLELLRDPN-MEEEMVEMLQLGIDCTAQYPDQRPTISDVVRRIEDLRR  311



>ref|XP_010926113.1| PREDICTED: probable inactive receptor kinase At1g48480 [Elaeis 
guineensis]
Length=641

 Score =   276 bits (705),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR+SIAL AARG  ++HS G S SHGNIKSSN  LTKSY+ARVSD G A LVGP+ T
Sbjct  447  DWETRSSIALAAARGIEYIHSTGPSASHGNIKSSNILLTKSYEARVSDHGLAHLVGPTLT  506

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
             TR+ GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAP  A  N+EGVDLPRWVQSVV
Sbjct  507  TTRIAGYRAPEVTDAQKVSQKADVYSFGVLLLELLTGKAPAQAFLNDEGVDLPRWVQSVV  566

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWTSEVFDLELLRYQN  EE MVQLLQLA++C AQYPDKRP+++E+  RIE++
Sbjct  567  REEWTSEVFDLELLRYQN-AEEQMVQLLQLAIDCAAQYPDKRPTISEVVVRIEEI  620



>ref|XP_008781294.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g48480 [Phoenix dactylifera]
Length=668

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR+SIAL AARG  ++HS G S SH NIKSSN  LTKSY+ARVSD G A LVGP+  
Sbjct  453  NWDTRSSIALAAARGIEYIHSTGPSASHANIKSSNILLTKSYEARVSDHGLALLVGPASA  512

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAP  AL N+EGVDLPRWVQSVV
Sbjct  513  PTRVAGYRAPEVTDAQKVSQKADVYSFGVLLLELLTGKAPAQALLNDEGVDLPRWVQSVV  572

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            +EEWTSEVFDLELLRYQN VEE+MVQLLQLA++C AQYPD+RP+++E+  RIE++
Sbjct  573  QEEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCAAQYPDRRPTISEVVVRIEEI  626



>gb|KCW52164.1| hypothetical protein EUGRSUZ_J01604 [Eucalyptus grandis]
Length=629

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR  IALGAARG +HLHSQ    SHGNIKSSN  LTKSY ARVSDF  A +      
Sbjct  425  NWDTRCDIALGAARGIAHLHSQDAVTSHGNIKSSNVLLTKSYKARVSDFSLAPIANLIAA  484

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSVV
Sbjct  485  PNRIDGYRAPEVTDYHKVSQKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVV  544

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            +EEWT+EVFD ELLRYQ+ VEEDMV+LLQLA++C AQYPDKRP MA++  +IE++CR
Sbjct  545  KEEWTAEVFDDELLRYQD-VEEDMVELLQLAMHCAAQYPDKRPPMAQVVNKIEEICR  600



>ref|XP_003558467.1| PREDICTED: probable inactive receptor kinase At1g48480 [Brachypodium 
distachyon]
 ref|XP_010228954.1| PREDICTED: probable inactive receptor kinase At1g48480 [Brachypodium 
distachyon]
Length=676

 Score =   275 bits (703),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR++IAL AARG +H+HS G + SHGNIKSSN  LTK+Y+ARVSD G   LVGPS +
Sbjct  479  DWETRSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFS  538

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  539  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  598

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD ELLRYQ+ VEE+MVQLLQLA++C+AQ+PD+RP+M++  ARI+++ R
Sbjct  599  REEWTAEVFDQELLRYQS-VEEEMVQLLQLAIDCSAQHPDRRPTMSDAAARIDEIRR  654



>ref|XP_010032718.1| PREDICTED: probable inactive receptor kinase At3g02880 [Eucalyptus 
grandis]
Length=662

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+TR  IALGAARG +HLHSQ    SHGNIKSSN  LTKSY ARVSDF  A +      
Sbjct  458  NWDTRCDIALGAARGIAHLHSQDAVTSHGNIKSSNVLLTKSYKARVSDFSLAPIANLIAA  517

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPTH+L NEEGVDLPRWVQSVV
Sbjct  518  PNRIDGYRAPEVTDYHKVSQKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVV  577

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            +EEWT+EVFD ELLRYQ+ VEEDMV+LLQLA++C AQYPDKRP MA++  +IE++CR
Sbjct  578  KEEWTAEVFDDELLRYQD-VEEDMVELLQLAMHCAAQYPDKRPPMAQVVNKIEEICR  633



>ref|XP_008775508.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g48480 [Phoenix dactylifera]
Length=663

 Score =   274 bits (700),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 151/177 (85%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR+ IAL AARG  ++HS G S SHGNIKSSN  LTKSY+ARVSD G A LVGP+ T
Sbjct  447  DWETRSGIALAAARGIEYIHSTGPSASHGNIKSSNILLTKSYEARVSDHGLAHLVGPTST  506

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  KVSQKADVYS GVLLLELLTGKAP  AL N++GVDLPRWVQSVV
Sbjct  507  PARVAGYRAPEVTDARKVSQKADVYSXGVLLLELLTGKAPAQALLNDDGVDLPRWVQSVV  566

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFDLELLRYQN VEE+MVQLLQLA++C AQYPD+RP+++E+  RIE++ R
Sbjct  567  REEWTAEVFDLELLRYQN-VEEEMVQLLQLAIDCAAQYPDRRPTISEVVVRIEEIRR  622



>ref|XP_007214953.1| hypothetical protein PRUPE_ppa003172mg [Prunus persica]
 gb|EMJ16152.1| hypothetical protein PRUPE_ppa003172mg [Prunus persica]
Length=596

 Score =   272 bits (696),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IA+GAAR  ++LHS G +ISHGNIKSSN  LT+S++A VSDF  A L  P+ T
Sbjct  387  NWETRSGIAVGAARAITYLHSHGPTISHGNIKSSNILLTRSFEACVSDFCLAHLASPTST  446

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+ GYRAPE+TD  KV+QKADVYSFGVLLLELLTGKAPT A+ NEEGVDLPRWV SVV
Sbjct  447  PNRISGYRAPELTDASKVTQKADVYSFGVLLLELLTGKAPTQAIMNEEGVDLPRWVHSVV  506

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWT EVFDLELLRYQN VEEDMVQLLQ+A+ CT Q+PD RP M E+T+RIE+L
Sbjct  507  REEWTVEVFDLELLRYQN-VEEDMVQLLQIALECTVQHPDNRPLMGEVTSRIEEL  560



>ref|XP_011073169.1| PREDICTED: probable inactive receptor kinase At1g48480 [Sesamum 
indicum]
Length=655

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 151/183 (83%), Gaps = 6/183 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LH QG S +HGNIKSSN  LTKSYDAR+SDFG  QLVGP  +
Sbjct  468  NWEIRSRIALGAARGIEYLHCQGSSTAHGNIKSSNVLLTKSYDARISDFGLNQLVGPPSS  527

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGK P      E+G+DLPRWVQSVV
Sbjct  528  PTRVTGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPL-----EDGLDLPRWVQSVV  582

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQ+ ++CTAQYPD+RP ++++  RIE+L     
Sbjct  583  REEWTSEVFDLELLRYQN-VEEEMVQLLQIGIDCTAQYPDQRPLISQVAKRIEELRCSSL  641

Query  320  QDN  312
            QD+
Sbjct  642  QDD  644



>gb|EEE59802.1| hypothetical protein OsJ_12326 [Oryza sativa Japonica Group]
Length=379

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+SIAL AARG  ++HS   S SHGNIKSSN  L KSY AR+SD G + LVGPS  
Sbjct  166  NWETRSSIALAAARGVEYIHSTSSSASHGNIKSSNVLLNKSYQARLSDNGLSALVGPSSA  225

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAP+ A  N+EGVDLPRWVQSVV
Sbjct  226  PSRASGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVV  285

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            R EWT+EVFD+ELLRYQN VEE MVQLLQLA++C AQ PD RPSM  +  RIE++ +
Sbjct  286  RSEWTAEVFDMELLRYQN-VEEQMVQLLQLAIDCVAQVPDARPSMPHVVLRIEEIKK  341



>ref|XP_009607528.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nicotiana 
tomentosiformis]
Length=668

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 153/188 (81%), Gaps = 4/188 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIALG A G  +LHSQG ++SH NIKS N  LTKSY+ARVSDFG A LVGP  +
Sbjct  482  NWEIRSSIALGIAHGIDYLHSQGPNVSHANIKSCNVLLTKSYEARVSDFGLANLVGPPSS  541

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAPT    NEEGVDLPRWV+SVV
Sbjct  542  PTRVAGYRAPEVTDSRKVSQKADVYSFGVLLLELLTGKAPTM---NEEGVDLPRWVESVV  598

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEW SEVFD+ELLRY    EE+MVQLLQLA++CTAQYPD RPSM+E++ RIE+L R   
Sbjct  599  REEWPSEVFDIELLRYH-TAEEEMVQLLQLAIDCTAQYPDNRPSMSEVSKRIEELRRSTL  657

Query  320  QDNNIVDN  297
             +++ + N
Sbjct  658  HEHSDLVN  665



>ref|XP_010105639.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC05427.1| putative inactive receptor kinase [Morus notabilis]
Length=639

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 152/189 (80%), Gaps = 4/189 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IALGAARG ++LHS G S  HGNIKSSN  LT+SY+ARVSDFG A L  P  T
Sbjct  427  NWETRSGIALGAARGIAYLHSHGSS--HGNIKSSNILLTRSYEARVSDFGLAHLANPDPT  484

Query  680  PT-RVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            P  RV GYRAPEVTDP KVS KADVYSFGVLLLELLTGK PTH+  N+EGVDLPRWVQSV
Sbjct  485  PNHRVAGYRAPEVTDPHKVSPKADVYSFGVLLLELLTGKPPTHSQLNDEGVDLPRWVQSV  544

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
            VREEWT EVFDLELLRYQN VE++MV+LLQLA++CT QYPDKRP MA +T RIE+LC   
Sbjct  545  VREEWTVEVFDLELLRYQN-VEDEMVELLQLALDCTVQYPDKRPPMAVVTRRIEELCHSS  603

Query  323  FQDNNIVDN  297
             Q    V N
Sbjct  604  SQREENVTN  612



>ref|XP_009409092.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=674

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETRT IAL AA+G  ++HS G S SHGNIKSSN  LTKSYDARVSD G A L G +  
Sbjct  460  NWETRTGIALAAAQGIQYIHSTGPSASHGNIKSSNILLTKSYDARVSDHGLALLAGAASA  519

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP KVSQKADVYSFGVLLLELLTGKAP  AL NEEGVDLPRWVQSVV
Sbjct  520  PTRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAQALLNEEGVDLPRWVQSVV  579

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            +EEWT+EVFD+ELLRYQN VEEDMVQLLQLA++C AQYPDKRPSM E+  RI+++ R
Sbjct  580  KEEWTAEVFDVELLRYQN-VEEDMVQLLQLAIDCVAQYPDKRPSMPEVVVRIDEISR  635



>ref|XP_007141918.1| hypothetical protein PHAVU_008G236900g [Phaseolus vulgaris]
 gb|ESW13912.1| hypothetical protein PHAVU_008G236900g [Phaseolus vulgaris]
Length=644

 Score =   271 bits (693),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR++IALGAARG +++HS G + SHGNIKSSN  LTKS++ARVSDFG A L  P+ T
Sbjct  431  NWETRSAIALGAARGIAYIHSHGPTSSHGNIKSSNILLTKSFEARVSDFGLAYLALPTST  490

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPE+TD  KVSQKADVYSFG++LLELLTGKAP H+  N+EGVDLPRWVQSVV
Sbjct  491  PNRVSGYRAPEITDARKVSQKADVYSFGIMLLELLTGKAPAHSSLNDEGVDLPRWVQSVV  550

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            + EW ++VFD+ELLRYQ+ VEE+MV+LLQLA+ CTAQYPDKRPSM  + ++IE++C P  
Sbjct  551  QGEWNTDVFDMELLRYQS-VEEEMVKLLQLALECTAQYPDKRPSMDVVESKIEEICHPSL  609

Query  320  Q  318
            +
Sbjct  610  E  610



>ref|XP_003616273.1| Leucine-rich repeat transmembrane protein [Medicago truncatula]
 gb|AES99231.1| LRR receptor-like kinase [Medicago truncatula]
Length=632

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR++IALGAA+G ++LHSQ  + SHGNIKSSN  LTKS++ RVSDFG A L  P+ T
Sbjct  437  NWETRSTIALGAAQGIAYLHSQSPTSSHGNIKSSNILLTKSFEPRVSDFGLAYLALPTAT  496

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  KVSQKADVYSFG++LLELLTGKAPTH+  NEEGVDLPRWVQS+V
Sbjct  497  PNRVSGYRAPEVTDARKVSQKADVYSFGIMLLELLTGKAPTHSSLNEEGVDLPRWVQSIV  556

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            ++EW +EVFD+ELLRYQ+ VEE+MV LLQLA+ CT QYPDKRPSM  + ++IE +C P  
Sbjct  557  QDEWNTEVFDMELLRYQS-VEEEMVNLLQLALECTTQYPDKRPSMDVVASKIEKICHPSL  615

Query  320  Q  318
            +
Sbjct  616  E  616



>dbj|BAJ89911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97284.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=689

 Score =   271 bits (694),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WE R++IAL  ARG +H+HS G + SHGNIKSSN  LTKSY+ARVSD G   LVGPS +
Sbjct  489  DWEARSAIALATARGVAHIHSTGPTASHGNIKSSNVLLTKSYEARVSDHGLPTLVGPSFS  548

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTD  +VSQKADVYSFGVLLLELLTGKAPTHA+ NEEG+DLPRWVQSVV
Sbjct  549  PTRVSGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVV  608

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD ELLRY N VEE+MVQLLQLA++C+AQ+PD+RP+M++  ARI+++ R
Sbjct  609  REEWTAEVFDQELLRYHN-VEEEMVQLLQLAIDCSAQHPDRRPNMSDAAARIDEIRR  664



>gb|KHN39461.1| Putative inactive receptor kinase [Glycine soja]
Length=642

 Score =   270 bits (691),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR++IALGAARG +++HS G + SHGNIKSSN  LTK+++ARVSDFG A L  P+ T
Sbjct  433  NWETRSAIALGAARGIAYIHSLGPTSSHGNIKSSNILLTKTFEARVSDFGLAYLALPTST  492

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GY APEVTD  K+SQKADVYSFG++LLELLTGKAPTH+  N+EGVDLPRWVQSV+
Sbjct  493  PNRVSGYCAPEVTDARKISQKADVYSFGIMLLELLTGKAPTHSSLNDEGVDLPRWVQSVI  552

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            ++EW +EVFD+ELLRYQ+ VEE+MV+LLQLA+ CTAQYPDKRPSM  + ++IE++C P  
Sbjct  553  QDEWNTEVFDMELLRYQS-VEEEMVKLLQLALECTAQYPDKRPSMDVVASKIEEICHPSL  611

Query  320  Q  318
            +
Sbjct  612  E  612



>ref|XP_004292489.1| PREDICTED: probable inactive receptor kinase At1g48480 [Fragaria 
vesca subsp. vesca]
Length=617

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IA+GAAR  ++LHS G +ISHGNIKSSN  LT SY+A VSDF  A    P+ T
Sbjct  432  NWETRSGIAVGAARAITYLHSHGPTISHGNIKSSNILLTSSYEACVSDFCLAHFASPAST  491

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTD  K++QKADVYSFGVLLLELLTGK PT AL  EEGVDLPRWV SVV
Sbjct  492  PNRVSGYRAPEVTDTNKITQKADVYSFGVLLLELLTGKPPTQALMTEEGVDLPRWVHSVV  551

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWT EVFDLELLRYQN VE++MVQLLQ+A+ CT QYPDKRPSMAE+ ++IE+L
Sbjct  552  REEWTVEVFDLELLRYQN-VEDEMVQLLQIALECTVQYPDKRPSMAEVASQIEEL  605



>ref|XP_010932563.1| PREDICTED: probable inactive receptor kinase At1g48480 [Elaeis 
guineensis]
Length=671

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR+ IAL AARG  ++HS G  +SHGNIKSSN  L KS DA VS+ G A LVGPS T
Sbjct  463  DWETRSGIALDAARGIEYIHSMGPGVSHGNIKSSNILLGKSLDAHVSEHGLANLVGPSST  522

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R  GY APEVTD  K SQK DVYSFGVLLLELL+GKAP  A  NEEG+DLPRWVQSVV
Sbjct  523  PNRAAGYLAPEVTDVRKASQKGDVYSFGVLLLELLSGKAPAQAFLNEEGIDLPRWVQSVV  582

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWTSEVFDLELLRYQN VEE+MVQLLQLAV+C AQYPD RPSM+E+  RIE++CR
Sbjct  583  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDSRPSMSEVVVRIEEICR  638



>ref|XP_008348609.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=618

 Score =   267 bits (683),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IA+G AR  +++HS G + SHGNIKSSN  LT+SY+A VSDF  A L  P+ T
Sbjct  429  NWETRSGIAVGXARAITYIHSHGPTTSHGNIKSSNILLTRSYEACVSDFCLAHLASPTST  488

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+ GYRAPE+TD  KV+QKADVYSFGVLLLE+LTGK PT  + NEEGVDLPRWV SVV
Sbjct  489  PNRISGYRAPELTDTSKVTQKADVYSFGVLLLEILTGKPPTQTIMNEEGVDLPRWVHSVV  548

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWT+EVFD ELLRYQN VEE+MVQLLQ+A+ CT QYPD RPSM E+T+RIEDL
Sbjct  549  REEWTAEVFDFELLRYQN-VEEEMVQLLQIALECTVQYPDSRPSMGEVTSRIEDL  602



>gb|EPS62777.1| hypothetical protein M569_12011, partial [Genlisea aurea]
Length=618

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPS-XT  681
            W+ R +IALGAARG  +LHSQG + SHGNIKSSN  L  SY  RVSDFG   LVGPS  +
Sbjct  445  WKIRKTIALGAARGIEYLHSQGSNTSHGNIKSSNILLNNSYQPRVSDFGLNHLVGPSTAS  504

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP +VSQ+ADVYSFGV+LLELLTGKAPT +L+NEEGVDLPRWVQSVV
Sbjct  505  PARVAGYRAPEVTDPRRVSQQADVYSFGVILLELLTGKAPTQSLANEEGVDLPRWVQSVV  564

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWTSEVFD+ELLRY N VE++MVQLLQL ++CT +YPD+RP+++E+  RIE+L
Sbjct  565  REEWTSEVFDIELLRY-NTVEDEMVQLLQLGIDCTVRYPDQRPAISEVAKRIEEL  618



>ref|XP_008227929.1| PREDICTED: probable inactive receptor kinase At1g48480 [Prunus 
mume]
Length=644

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IA+GAAR  ++LHS G +ISHGNIKSSN  LT+S++A VSDF  A L  P+ T
Sbjct  435  NWETRSGIAVGAARAITYLHSHGPTISHGNIKSSNILLTRSFEACVSDFCLAHLASPTST  494

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+ GYRAPE+TD  KV+QKADVYSFGVLLLELLTGKAPT A+ NEEGVDLPRWV SVV
Sbjct  495  PNRISGYRAPELTDASKVTQKADVYSFGVLLLELLTGKAPTQAIMNEEGVDLPRWVHSVV  554

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            +EEWT EVFDLELLRYQN VEEDMV LLQ+A+ CT Q+PD RP M E+T+RIE+L
Sbjct  555  QEEWTVEVFDLELLRYQN-VEEDMVLLLQIALECTVQHPDNRPLMGEVTSRIEEL  608



>ref|XP_009370559.1| PREDICTED: probable inactive receptor kinase At1g48480 [Pyrus 
x bretschneideri]
Length=626

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 1/180 (1%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXTP  678
            WETR+ IA+GAAR  ++LHSQG + SHGNIKSSN  LT++Y+A VSDF  A L  P+ TP
Sbjct  430  WETRSGIAVGAARAITYLHSQGPTTSHGNIKSSNILLTRTYEACVSDFCLAHLASPTSTP  489

Query  677  TRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVVR  498
             R+ GYRAPE+TD  KV+QKADVYSFGVLLLELLTGK PT A+ N+EGVDLPRWV SVVR
Sbjct  490  NRISGYRAPELTDTSKVTQKADVYSFGVLLLELLTGKPPTQAIMNDEGVDLPRWVHSVVR  549

Query  497  EEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGFQ  318
            EEWT+EVFD ELLRYQN VEEDMVQLL +A+ CT  YPD RPSM E+T+RI++LC    Q
Sbjct  550  EEWTAEVFDSELLRYQN-VEEDMVQLLHIALECTVTYPDSRPSMGEVTSRIQELCSSSLQ  608



>ref|XP_009370052.1| PREDICTED: probable inactive receptor kinase At1g48480 [Pyrus 
x bretschneideri]
Length=618

 Score =   265 bits (678),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+ IA+GAAR  ++LHS G + SHGNIKSSN  LT+SY+A VSDF  A L  P+ T
Sbjct  429  NWETRSGIAVGAARAITYLHSHGPTTSHGNIKSSNILLTRSYEACVSDFCLAHLASPTST  488

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+ GYRAPE+TD  KV+QKADVYSFGVLLLE+LTGK+PT  + NEEGVDLPRWV SVV
Sbjct  489  PNRISGYRAPELTDTSKVTQKADVYSFGVLLLEILTGKSPTQTIMNEEGVDLPRWVHSVV  548

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            REEWT+EVFD ELLRYQN VEE+MVQLL +A+ CT QYPD RPSM E+T+RI++L
Sbjct  549  REEWTAEVFDFELLRYQN-VEEEMVQLLHIALECTVQYPDSRPSMGEVTSRIDEL  602



>ref|XP_004145847.1| PREDICTED: probable inactive receptor kinase RLK902 [Cucumis 
sativus]
 gb|KGN57791.1| hypothetical protein Csa_3G303640 [Cucumis sativus]
Length=643

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R  IALG  RG  +LHSQG +ISHGNIKSSN  LT+SY+A VSD+G AQL     T
Sbjct  434  NWEARCGIALGVGRGIHYLHSQGPTISHGNIKSSNILLTRSYEACVSDYGLAQLAMSPST  493

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+RV GYRAPEVTD  KVSQKADVYSFGVLLLE+LTGK+PTH++ NEE VDLPRWVQSVV
Sbjct  494  PSRVAGYRAPEVTDSRKVSQKADVYSFGVLLLEMLTGKSPTHSIFNEEAVDLPRWVQSVV  553

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            +EEWT+EVFD +LLRYQN VEE+MVQLL+LA+ CT  YPD RP M EI  RI++LCR
Sbjct  554  QEEWTAEVFDEQLLRYQN-VEEEMVQLLELALQCTVPYPDNRPGMDEIVRRIDELCR  609



>ref|XP_004137566.2| PREDICTED: probable inactive receptor kinase RLK902 [Cucumis 
sativus]
 gb|KGN63945.1| hypothetical protein Csa_1G031200 [Cucumis sativus]
Length=628

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 147/178 (83%), Gaps = 1/178 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R  IA G ARG  +LHSQG ++SHGNIKSSN  L   YDARVSDFG AQLVGP+ +
Sbjct  447  NWEMRRGIASGVARGIKYLHSQGPNVSHGNIKSSNILLADPYDARVSDFGLAQLVGPASS  506

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAP+V D  KVSQKADVYSFGVLLLELLTGKAP+H + NEEGVDLPRWVQSVV
Sbjct  507  PNRVAGYRAPDVIDTRKVSQKADVYSFGVLLLELLTGKAPSHGVLNEEGVDLPRWVQSVV  566

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
            +EEW  EVFD+ELLRY+  +EE+MVQ+L+LA++C  Q+PD+RPSM E+++RIE++  P
Sbjct  567  QEEWKLEVFDVELLRYEG-IEEEMVQMLELALDCATQHPDRRPSMFEVSSRIEEILCP  623



>ref|XP_008457025.1| PREDICTED: probable inactive receptor kinase RLK902 [Cucumis 
melo]
Length=643

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 145/181 (80%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R  IALG  RG  +LHSQG +ISHGNIKSSN  LT+SY+A VSD+G AQL     T
Sbjct  434  NWEARCGIALGVGRGIHYLHSQGPTISHGNIKSSNILLTRSYEACVSDYGLAQLAMAPST  493

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+RV GYRAPEVTD  KVS KADVYSFGVLLLE+LTGK+PTH++ +EE VDLPRWVQSVV
Sbjct  494  PSRVAGYRAPEVTDSRKVSHKADVYSFGVLLLEMLTGKSPTHSIFHEEAVDLPRWVQSVV  553

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            +EEWT+EVFD +LLRYQN VEE+MVQLL+LA+ CT  YPD RP M EI  RIE+LCR   
Sbjct  554  QEEWTAEVFDEQLLRYQN-VEEEMVQLLELALQCTVPYPDNRPGMDEIVGRIEELCRTTL  612

Query  320  Q  318
            Q
Sbjct  613  Q  613



>gb|AAK18840.1|AC082645_10 putative receptor kinase [Oryza sativa Japonica Group]
 gb|ABF98524.1| atypical receptor-like kinase MARK, putative, expressed [Oryza 
sativa Japonica Group]
Length=686

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+SIAL AARG  ++HS   S SHGNIKSSN  L KSY AR+SD G + LVGPS  
Sbjct  473  NWETRSSIALAAARGVEYIHSTSSSASHGNIKSSNVLLNKSYQARLSDNGLSALVGPSSA  532

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAP+ A  N+EGVDLPRWVQSVV
Sbjct  533  PSRASGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVV  592

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            R EWT+EVFD+ELLRYQN VEE MVQLLQLA++C AQ PD RPSM  +  RIE++
Sbjct  593  RSEWTAEVFDMELLRYQN-VEEQMVQLLQLAIDCVAQVPDARPSMPHVVLRIEEI  646



>ref|XP_006651742.1| PREDICTED: probable inactive receptor kinase At1g48480-like, 
partial [Oryza brachyantha]
Length=608

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR+SIAL AARG  ++HS   S SHGNIKSSN  LTKSY ARVSD G + LVGPS  
Sbjct  395  NWETRSSIALAAARGVEYIHSTSSSASHGNIKSSNVLLTKSYQARVSDNGLSALVGPSSA  454

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEVTDP +V QKADVYSFGVLLLELLTGKAP+ A  N+EGVDLPRWVQSVV
Sbjct  455  PSRATGYRAPEVTDPRRVPQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVV  514

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            R EWT+EVFD+ELLRYQ+ VEE MVQLLQLA++C A  PD RPSM  +  RIE++
Sbjct  515  RSEWTAEVFDMELLRYQH-VEEQMVQLLQLAIDCVASVPDARPSMPHVVLRIEEI  568



>ref|XP_009381014.1| PREDICTED: probable inactive receptor kinase RLK902 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETRT IAL AARG  ++HS G S +HGNIKSSN  LTKSY ARVSD G A LVG +  
Sbjct  461  NWETRTGIALAAARGIEYIHSTGPSAAHGNIKSSNILLTKSYQARVSDHGLALLVGSASA  520

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
              RV GYRAPEVTD  KVSQKADVYSFGVLLLELLTGKAP+ AL N++G DLPRWVQSVV
Sbjct  521  TARVAGYRAPEVTDTRKVSQKADVYSFGVLLLELLTGKAPSQAL-NDDGFDLPRWVQSVV  579

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            +EEWT+EVFD ELLRYQN VEEDMVQLLQLA +C AQYPDKRPSM ++ ARIE + +
Sbjct  580  KEEWTAEVFDPELLRYQN-VEEDMVQLLQLATDCAAQYPDKRPSMPDVVARIEAISK  635



>ref|XP_009390354.1| PREDICTED: probable inactive receptor kinase RLK902 [Musa acuminata 
subsp. malaccensis]
Length=667

 Score =   260 bits (665),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            N ETR  I L AARG  ++HS G   SHGNIKSSN  LTKSY+ R+SD G A L GP  +
Sbjct  460  NLETRIGIVLAAARGIEYIHSAGPWASHGNIKSSNILLTKSYEGRLSDHGLALLAGPISS  519

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAPT AL N+EGVDLPRWV+S+V
Sbjct  520  PTRVSGYRAPEVTDPCRVSQKADVYSFGVLLLELLTGKAPTQALLNDEGVDLPRWVRSIV  579

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            R+EW +EVFD ELLRYQN VEE+MVQLLQLA+NC AQ PD RPSM E+  RIE++
Sbjct  580  RDEWAAEVFDPELLRYQN-VEEEMVQLLQLAINCAAQSPDMRPSMPEVVVRIEEI  633



>ref|XP_009403541.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=676

 Score =   259 bits (661),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW TR  I L AARG  ++HS G S SHGNIKSSN  LTK Y+ARVSD G A L+G + T
Sbjct  461  NWVTRIGIGLSAARGIEYIHSTGPSSSHGNIKSSNILLTKPYEARVSDHGLALLMGSAST  520

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
             TR+ GYRAPEV DP KVSQKADVYSFGVLLLELLTGKAP  AL N+EG+DLP WVQSVV
Sbjct  521  TTRIAGYRAPEVADPQKVSQKADVYSFGVLLLELLTGKAPAQALLNDEGIDLPIWVQSVV  580

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+ELLRYQ+ VEEDMVQLLQLA+ C A++PDKRP MAE+  RI ++ +
Sbjct  581  REEWTAEVFDVELLRYQS-VEEDMVQLLQLAIECVARFPDKRPCMAEVVIRISEIIK  636



>ref|XP_008803916.1| PREDICTED: uncharacterized protein LOC103717354 [Phoenix dactylifera]
Length=1708

 Score =   267 bits (682),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = -1

Query  860   NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
             +WETR+ IAL AARG  ++HS G  +SHGNIKSSN  L+KS++A VS+ G A LVGPS T
Sbjct  1492  DWETRSGIALSAARGIEYIHSMGPGVSHGNIKSSNILLSKSFEAHVSEHGLANLVGPSST  1551

Query  680   PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
             P+R  GYRAPEVTD  KVSQK DVYSFGVLLLELLTGKAP  A  NE+G+DLPRWV SV 
Sbjct  1552  PSRAAGYRAPEVTDIRKVSQKGDVYSFGVLLLELLTGKAPAQAFLNEDGIDLPRWVHSVA  1611

Query  500   REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
              EEWTSEVFDLELLRY N VEE+MVQLLQLA++C AQYP+KRPSMA++  RIE++CR
Sbjct  1612  PEEWTSEVFDLELLRYHN-VEEEMVQLLQLAIDCAAQYPEKRPSMADVVVRIEEICR  1667


 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 92/194 (47%), Gaps = 33/194 (17%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQ-SISHGNIKSSNXXLTKSYDARVSDFGXAQLV--GPS  687
            W+ R  IAL  ARG  +LHS  Q S  H ++K SN  L     A+VSDFG  +L      
Sbjct  647  WKQRLVIALDVARGVEYLHSMAQESFIHRDLKPSNILLDNDKRAKVSDFGLVKLAVDRQK  706

Query  686  XTPTRVDG---YRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRW  516
               TR+ G   Y APE     KV+ K DVY+FGV+L+EL TG+        +E  +L   
Sbjct  707  SMMTRLAGTFGYLAPEYAITGKVTTKIDVYAFGVILMELTTGERVLDDTRPDEDTNL---  763

Query  515  VQSVVREEWTSEVFDLELLRYQNVV-----------EEDMVQL---LQLAVNCTAQYPDK  378
                        VF   +L  +N +           EED++ L    +LA  CTA+ P +
Sbjct  764  ----------VHVFRRNILDKKNFLKSSPDPTLDLDEEDLISLWEVAELARYCTAREPSQ  813

Query  377  RPSMAEITARIEDL  336
            RP M+ +  ++  L
Sbjct  814  RPDMSHVVNKLASL  827



>ref|XP_008343258.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=625

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 146/180 (81%), Gaps = 1/180 (1%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXTP  678
            WETR+ IA+GAAR  ++LHSQG + SHGNIKSSN  LT+SY+A VSDF  A L  P+ TP
Sbjct  429  WETRSGIAVGAARAITYLHSQGPTTSHGNIKSSNILLTRSYEACVSDFCLAHLASPTSTP  488

Query  677  TRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVVR  498
              + GYRAPE+ D  KV+QKADVYSFGVLLLELLTGK PT A+ N+EGVDLPRWV+SVV+
Sbjct  489  NLISGYRAPELXDTSKVTQKADVYSFGVLLLELLTGKPPTQAIMNDEGVDLPRWVRSVVQ  548

Query  497  EEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGFQ  318
            EEWT+EVFD ELLRYQN VEEDMVQLLQ+A+ CT  YPD RPSM+E+T+RI++L     Q
Sbjct  549  EEWTAEVFDSELLRYQN-VEEDMVQLLQIALECTVTYPDSRPSMSEVTSRIQELYSSSLQ  607



>ref|XP_008353859.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=626

 Score =   257 bits (657),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 146/180 (81%), Gaps = 1/180 (1%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXTP  678
            WETR+ IA+GAAR  ++LHSQG + SHGNIKSSN  LT+SY+A VSDF  A L  P+ TP
Sbjct  430  WETRSGIAVGAARAITYLHSQGPTTSHGNIKSSNILLTRSYEACVSDFCLAHLASPTSTP  489

Query  677  TRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVVR  498
              + GYRAPE+ D  KV+QKADVYSFGVLLLELLTGK PT A+ N+EGVDLPRWV+SVV+
Sbjct  490  NLISGYRAPELXDTSKVTQKADVYSFGVLLLELLTGKPPTQAIMNDEGVDLPRWVRSVVQ  549

Query  497  EEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGFQ  318
            EEWT+EVFD ELLRYQN VEEDMVQLLQ+A+ CT  YPD RPSM+E+T+RI++L     Q
Sbjct  550  EEWTAEVFDSELLRYQN-VEEDMVQLLQIALECTVTYPDSRPSMSEVTSRIQELYSSSLQ  608



>gb|EAY91619.1| hypothetical protein OsI_13254 [Oryza sativa Indica Group]
Length=224

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = -1

Query  824  ARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXTPTRVDGYRAPEV  645
            ARG  ++HS   S SHGNIKSSN  L KSY AR+SD G + LVGPS  P+R  GYRAPEV
Sbjct  23   ARGVEYIHSTSSSASHGNIKSSNVLLNKSYQARLSDNGLSALVGPSSAPSRASGYRAPEV  82

Query  644  TDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVVREEWTSEVFDLE  465
            TDP +VSQKADVYSFGVLLLELLTGKAP+ A  N+EGVDLPRWVQSVVR EWT+EVFD+E
Sbjct  83   TDPRRVSQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVVRSEWTAEVFDME  142

Query  464  LLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            LLRYQN VEE MVQLLQLA++C AQ PD RPSM  +  RIE++ +
Sbjct  143  LLRYQN-VEEQMVQLLQLAIDCVAQVPDARPSMPHVVLRIEEIKK  186



>gb|AHA84157.1| atypical receptor-like kinase MARK [Phaseolus vulgaris]
Length=707

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 143/180 (79%), Gaps = 2/180 (1%)
 Frame = -1

Query  851  TRTSIALGAARGXSHLHSQGQSI-SHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXTPT  675
             R+ I L  ARG  +LH + + I SH   KSS   LTK YDARVSDFG A LVGPS TP 
Sbjct  512  VRSVIPLNHARGIEYLHFKRRRIVSHEIKKSSKIFLTKLYDARVSDFGLAHLVGPSSTPN  571

Query  674  RVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVVRE  495
            RV GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAPTHA  NEEGVDLPRWVQSVVRE
Sbjct  572  RVAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHAFLNEEGVDLPRWVQSVVRE  631

Query  494  EWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGFQD  315
            EWT EVFDLELLRYQN VEE+MVQLLQLAV+C AQYPDKRPSM E+   IE+L R   ++
Sbjct  632  EWTFEVFDLELLRYQN-VEEEMVQLLQLAVDCAAQYPDKRPSMFEVVRSIEELRRSSLKE  690



>dbj|BAH20271.1| AT1G48480 [Arabidopsis thaliana]
Length=400

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IA+GAARG  +LHSQG S SHGNIKSSN  LTKS+DA+VSDFG AQLVG S T
Sbjct  212  NWDVRSRIAIGAARGLDYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSAT  271

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P R  GYRAPEVTDP +VSQK DVYSFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SV
Sbjct  272  NPNRATGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSV  331

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             R+EW  EVFD ELL      EE M +++QL + CT+Q+PD+RP M+E+  ++E+L RP
Sbjct  332  ARDEWRREVFDSELLSLATDEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKMENL-RP  389



>gb|EYU45791.1| hypothetical protein MIMGU_mgv1a002921mg [Erythranthe guttata]
Length=625

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 6/182 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR SIALGAA+G S+LHS G SISHGNIKSSN  LTK Y+ RVSDF  A++  P   
Sbjct  442  NWETRASIALGAAQGISYLHSHGPSISHGNIKSSNILLTKKYEPRVSDFLLARMARPGSA  501

Query  680  --PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQS  507
              P+RV+GYRAPEVTDP +VSQKADVYSFGVL+LE+LTGK+P   +  E+G DLP WV+S
Sbjct  502  LGPSRVEGYRAPEVTDPQRVSQKADVYSFGVLVLEMLTGKSP---VVGEDGFDLPLWVRS  558

Query  506  VVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
            VV++ WTSEVFD ELLRYQN VEEDMV+LLQ+ V+CT  YPDKRPSM+E+  +IE+LCR 
Sbjct  559  VVKDAWTSEVFDAELLRYQN-VEEDMVRLLQIGVDCTESYPDKRPSMSEVATKIEELCRW  617

Query  326  GF  321
             F
Sbjct  618  SF  619



>emb|CBI15604.3| unnamed protein product [Vitis vinifera]
Length=190

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 133/182 (73%), Gaps = 31/182 (17%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+ IALGAARG  +LHSQG S+SHGNIKSSN  LTKSYDARVSDFG A LVGPS T
Sbjct  22   NWEIRSGIALGAARGIEYLHSQGPSVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSST  81

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEVTDP K                              EGVDLPRWVQS+V
Sbjct  82   PNRVAGYRAPEVTDPRK------------------------------EGVDLPRWVQSIV  111

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWTSEVFDLELLRYQN VEE+MVQLLQLA++CTAQYPDKRP ++E+T RIE+LCR   
Sbjct  112  REEWTSEVFDLELLRYQN-VEEEMVQLLQLAIDCTAQYPDKRPPISEVTKRIEELCRSSL  170

Query  320  QD  315
            ++
Sbjct  171  RE  172



>ref|XP_008812474.1| PREDICTED: probable inactive receptor kinase At1g48480 [Phoenix 
dactylifera]
Length=657

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 151/196 (77%), Gaps = 9/196 (5%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR+ IAL AARG  ++HS G  +SHGNIKSSN  L KS++A VSD G A LV PS T
Sbjct  439  DWETRSGIALDAARGIEYIHSMGPGVSHGNIKSSNILLDKSFEAHVSDHGLANLVSPSTT  498

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P    GY APEVTD  +VSQKA+VYSFGVLLLELLTG++PT A  +EEG +LP+WV+SVV
Sbjct  499  PCHAAGYCAPEVTDARRVSQKAEVYSFGVLLLELLTGRSPTQAFHDEEGTNLPKWVRSVV  558

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            RE+W SEVFDLELLRYQN ++E+MVQLLQLA++C A+YPDKRPSM+E+  RIE++ R   
Sbjct  559  REDWVSEVFDLELLRYQN-LKEEMVQLLQLAIDCAARYPDKRPSMSEVVIRIEEIRRSSL  617

Query  320  --------QDNNIVDN  297
                    QD++ +D+
Sbjct  618  ASTKRSHHQDHHAIDD  633



>ref|XP_009390851.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=654

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 144/178 (81%), Gaps = 4/178 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETRT IAL AARG  ++HS   S +HGNIKSSN  L  + +ARVSD G A L GP  +
Sbjct  452  DWETRTGIALAAARGIEYIHSTSPSAAHGNIKSSNILLAATREARVSDHGLALLAGPQSS  511

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEE---GVDLPRWVQ  510
            P R  GYRAPEVTD  +VSQKADVYSFGVLLLELLTGK+P  ALSN++   GVDLPRWVQ
Sbjct  512  PARAAGYRAPEVTDTRRVSQKADVYSFGVLLLELLTGKSPGQALSNDDDGGGVDLPRWVQ  571

Query  509  SVVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            SVV+EEWT+EVFD+ELLR Q+  EE+MV+LLQLAV+C AQYPDKRPSMAE+ ARI+++
Sbjct  572  SVVQEEWTAEVFDVELLRQQD-AEEEMVRLLQLAVDCAAQYPDKRPSMAEVVARIQEI  628



>ref|XP_006393400.1| hypothetical protein EUTSA_v10011300mg [Eutrema salsugineum]
 gb|ESQ30686.1| hypothetical protein EUTSA_v10011300mg [Eutrema salsugineum]
Length=656

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 143/181 (79%), Gaps = 2/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPS--  687
            NW+ R+ IALGAARG  +LHSQG S SHGNIKSSN  LTKS+DA+VSDFG +QLVG S  
Sbjct  468  NWDVRSRIALGAARGLDYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLSQLVGASST  527

Query  686  XTPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQS  507
             TP R  GYRAPEVTDP +VSQK DVYS+GV+LLEL+TGKAP++++ NEEGVDL RWV+S
Sbjct  528  TTPNRATGYRAPEVTDPKRVSQKGDVYSYGVVLLELITGKAPSNSVMNEEGVDLARWVKS  587

Query  506  VVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
            VVR+EW  EVFD ELL      EE M +++QL + CT+Q+PDKRP MAE+  +IE+L R 
Sbjct  588  VVRDEWRREVFDSELLSLATEDEEMMAEMVQLGLECTSQHPDKRPEMAEVVRKIENLRRS  647

Query  326  G  324
            G
Sbjct  648  G  648



>ref|XP_003559525.1| PREDICTED: probable inactive receptor kinase RLK902 [Brachypodium 
distachyon]
Length=679

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW  R+SIAL AARG   +HS   S SHGNIKSSN  L KSY ARV+D G A LVGPS T
Sbjct  469  NWAIRSSIALAAARGLEFIHSTSSSTSHGNIKSSNILLAKSYQARVTDNGLATLVGPSST  528

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEVTDP +VSQKADVYSFGVLLLELLTGKAP+ A  N+EGVDLPRWVQSVV
Sbjct  529  PSRTTGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVV  588

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            R EWT+EVFD+ELLR+QN VEE MVQLLQLA++C AQ PD RP+M+ I  RI+++
Sbjct  589  RSEWTAEVFDMELLRHQN-VEEQMVQLLQLAIDCVAQVPDARPTMSHIVVRIDEI  642



>ref|XP_004981996.1| PREDICTED: probable inactive receptor kinase RLK902-like [Setaria 
italica]
Length=692

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 140/183 (77%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIAL AARG  ++HS   + SHGNIKSSN  L KSY ARVSD G   LVGPS +
Sbjct  489  NWELRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGKSYQARVSDNGLTTLVGPSSS  548

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEV D  ++SQKADVYSFGVLLLELLTGKAP+ A  N+EGVDLPRWVQSV 
Sbjct  549  PSRTTGYRAPEVIDSRRISQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVN  608

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            R EW+SEVFD+EL+R+QN  EE M QLLQLA++C AQ P+ RPSMA +  R+E++ +   
Sbjct  609  RSEWSSEVFDMELMRHQN-GEEPMAQLLQLAIDCVAQVPEARPSMAHVVMRLEEIKKSSV  667

Query  320  QDN  312
              N
Sbjct  668  ASN  670



>gb|AAC95351.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=645

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IA+GAARG ++LHSQG S SHGNIKSSN  LTKS+DA+VSDFG AQLVG S T
Sbjct  457  NWDVRSRIAIGAARGLNYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSAT  516

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P R  GYRAPEVTDP +VSQK DVYSFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SV
Sbjct  517  NPNRATGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSV  576

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             R+EW  EVFD ELL      EE M +++QL + CT+Q+PD+RP M+E+  ++E+L RP
Sbjct  577  ARDEWRREVFDSELLSLATDEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKMENL-RP  634



>gb|KFK37686.1| hypothetical protein AALP_AA3G015500 [Arabis alpina]
Length=618

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S++HS+  + SHGNIKSSN  L+KSY+A+VSD+G A ++  +  
Sbjct  432  NWETRAGIALGAARAISYIHSRDSTTSHGNIKSSNILLSKSYEAKVSDYGLAPIISSTSA  491

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQS+ 
Sbjct  492  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSIT  551

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
             ++  S+VFD EL RYQ+   E+M++LL++ ++CTAQYPDKRPSM E+T  IE++     
Sbjct  552  EQQTPSDVFDPELTRYQSEGNENMIRLLKIGMSCTAQYPDKRPSMVEVTRLIEEVSHSSG  611

Query  320  QDNNIVD  300
              N + D
Sbjct  612  SSNPVSD  618



>gb|EYU45792.1| hypothetical protein MIMGU_mgv1a020384mg [Erythranthe guttata]
Length=593

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 144/182 (79%), Gaps = 6/182 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLV--GPS  687
            NWETR SIALGA +G S+LH  G SISHGNI SSN  LTK+Y+ RVSDF  A L   GP+
Sbjct  410  NWETRASIALGATQGISYLHLHGPSISHGNITSSNILLTKTYEPRVSDFLLAGLARPGPT  469

Query  686  XTPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQS  507
              P+RV+GYRAPEVTDP +VSQKADVYSFGVL+LE++TGK+P   +  E+G DLP WV+S
Sbjct  470  SGPSRVEGYRAPEVTDPRRVSQKADVYSFGVLVLEIMTGKSP---VVGEDGFDLPLWVRS  526

Query  506  VVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
            VV++ WTSEV D ELLRYQNVV EDMV LLQ+ V+CT  +PDKRPSMAE+  +IE+LCR 
Sbjct  527  VVKDAWTSEVLDAELLRYQNVV-EDMVWLLQIGVDCTGSHPDKRPSMAEVATKIEELCRW  585

Query  326  GF  321
             F
Sbjct  586  SF  587



>ref|XP_009391414.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=643

 Score =   244 bits (624),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+TR  IALGAARG  ++H +   +SHGNI SSN  L K  +A VSDFG   L      
Sbjct  444  DWKTRLEIALGAARGIEYIHLKSSGLSHGNITSSNIVLAKFNEALVSDFGLNSLGSTPMP  503

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
              R  GYRAPEVTD  +VSQKADVYSFGVLL+ELLTGK PT AL+NE+GVDLPRWV+SVV
Sbjct  504  SQRAAGYRAPEVTDIRRVSQKADVYSFGVLLMELLTGKPPTQALNNEDGVDLPRWVESVV  563

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEW SEVFDLELLRYQN VEE MVQLLQLA++C  Q+P+ RPSM+E+ ARIE++CR
Sbjct  564  REEWNSEVFDLELLRYQN-VEEAMVQLLQLAIDCAVQFPENRPSMSEVVARIEEICR  619



>ref|NP_564528.1| receptor-like kinase 1 [Arabidopsis thaliana]
 sp|Q9LP77.1|Y1848_ARATH RecName: Full=Probable inactive receptor kinase At1g48480; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF79696.1|AC020889_4 T1N15.9 [Arabidopsis thaliana]
 gb|ACI49789.1| At1g48480 [Arabidopsis thaliana]
 gb|ACN59244.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32298.1| receptor-like kinase 1 [Arabidopsis thaliana]
Length=655

 Score =   244 bits (624),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IA+GAARG  +LHSQG S SHGNIKSSN  LTKS+DA+VSDFG AQLVG S T
Sbjct  467  NWDVRSRIAIGAARGLDYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSAT  526

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P R  GYRAPEVTDP +VSQK DVYSFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SV
Sbjct  527  NPNRATGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSV  586

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             R+EW  EVFD ELL      EE M +++QL + CT+Q+PD+RP M+E+  ++E+L RP
Sbjct  587  ARDEWRREVFDSELLSLATDEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKMENL-RP  644



>ref|XP_010525076.1| PREDICTED: probable inactive receptor kinase At5g16590 [Tarenaya 
hassleriana]
Length=624

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S++HS+    SHGNIKSSN  L++SY+A+VSD+  A L+ P+  
Sbjct  438  NWETRAGIALGAARAISYIHSRDTMTSHGNIKSSNVLLSESYEAKVSDYCLAPLISPASA  497

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQSV 
Sbjct  498  PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVA  557

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++  S+VFD EL RYQ+   E+M++LL++ + CTAQYPDKRPSMAE+T  IE++ R
Sbjct  558  EQQSQSDVFDPELTRYQSDGNENMIRLLKIGIGCTAQYPDKRPSMAEVTRLIEEISR  614



>gb|KFK25876.1| hypothetical protein AALP_AA8G173700 [Arabis alpina]
Length=619

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L++SY+A+VSD+G A ++ P+ T
Sbjct  433  NWETRAGIALGAARAISYLHSRDPTTSHGNIKSSNILLSESYEAKVSDYGLAPMISPTST  492

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVLLLELLTGK+PTH   NEEGVDLPRWV S+ 
Sbjct  493  PNRIDGYRAPEVTDARRISQKADVYSFGVLLLELLTGKSPTHQQLNEEGVDLPRWVSSIT  552

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++  S+VFD EL RYQ    E+M++LL++ ++CTAQYPD RP+M E+T  IE++ R
Sbjct  553  EQQSPSDVFDPELTRYQAEGNENMIRLLKIGISCTAQYPDSRPTMPEVTRLIEEVSR  609



>ref|XP_010910915.1| PREDICTED: probable inactive receptor kinase At1g48480 [Elaeis 
guineensis]
Length=630

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR+ IAL AARG  ++HS G  +SHGNIKSSN  L  S++A VSD+  A LV PS T
Sbjct  421  DWETRSGIALAAARGIEYIHSIGSEVSHGNIKSSNILLGNSFEAHVSDYSLANLVSPSDT  480

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+    YRAPEVTD  KVSQKADVYSFGVLLLELLTGK P     +E G DLPRWVQSVV
Sbjct  481  PSHAACYRAPEVTDAQKVSQKADVYSFGVLLLELLTGKPPMQGFHDEGGPDLPRWVQSVV  540

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            +EEW SEVFDL LLRYQN VEE+MVQLLQ+ ++C AQYPDKRPSM+++  +IE++ R
Sbjct  541  QEEWISEVFDLGLLRYQN-VEEEMVQLLQVGIDCAAQYPDKRPSMSQVVIQIEEVHR  596



>emb|CDY67567.1| BnaCnng55470D [Brassica napus]
Length=583

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 141/182 (77%), Gaps = 3/182 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WE R  IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLVG S T
Sbjct  397  DWEVRARIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSST  456

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P RV GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  457  TPNRVTGYRAPEVTDPSRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  516

Query  503  VREEWTSEVFDLELLRYQNV--VEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             REEW  EVFD EL+  + V  VE +M ++LQL + CT Q+PDKRP M E+  RI++L +
Sbjct  517  EREEWRREVFDSELMSLERVDSVEGEMEEMLQLGIECTEQHPDKRPVMVEVVRRIQELRQ  576

Query  329  PG  324
            PG
Sbjct  577  PG  578



>ref|NP_566589.1| receptor-like kinase 902 [Arabidopsis thaliana]
 sp|Q9LVI6.1|RLK90_ARATH RecName: Full=Probable inactive receptor kinase RLK902; AltName: 
Full=Receptor-like kinase 902; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB02707.1| probable receptor-like protein kinase protein [Arabidopsis thaliana]
 gb|AAM19950.1| AT3g17840/MEB5_6 [Arabidopsis thaliana]
 gb|AAN72294.1| At3g17840/MEB5_6 [Arabidopsis thaliana]
 gb|ACN59318.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE76013.1| receptor-like kinase 902 [Arabidopsis thaliana]
Length=647

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLV-GPSX  684
            NWE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLV   S 
Sbjct  461  NWEVRSGIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASST  520

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP R  GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  521  TPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  580

Query  503  VREEWTSEVFDLELLRYQNV--VEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             REEW +EVFD EL+  + V  VEE+M ++LQL ++CT Q+PDKRP M E+  RI++L +
Sbjct  581  AREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQ  640

Query  329  PG  324
             G
Sbjct  641  SG  642



>ref|XP_010465843.1| PREDICTED: probable inactive receptor kinase RLK902 [Camelina 
sativa]
Length=643

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 141/180 (78%), Gaps = 6/180 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLV-GPSX  684
            NWE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLV   S 
Sbjct  464  NWEIRSRIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASST  523

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP R  GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  524  TPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  583

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
             REEW +EVFD EL+     VEE+M ++LQL ++CT Q+PDKRP M E+  RI++L +PG
Sbjct  584  AREEWRNEVFDSELM-----VEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQPG  638



>gb|AAM64268.1| receptor kinase, putative [Arabidopsis thaliana]
Length=639

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLV-GPSX  684
            NWE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLV   S 
Sbjct  453  NWEVRSGIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASST  512

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP R  GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  513  TPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  572

Query  503  VREEWTSEVFDLELLRYQNV--VEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             REEW +EVFD EL+  + V  VEE+M ++LQL ++CT Q+PDKRP M E+  RI++L +
Sbjct  573  AREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQ  632

Query  329  PG  324
             G
Sbjct  633  SG  634



>ref|XP_006408370.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
 gb|ESQ49823.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
Length=622

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L+ SY+A+VSD+G A ++  +  
Sbjct  436  NWETRAGIALGAARAISYLHSRDSTTSHGNIKSSNILLSDSYEAKVSDYGLAPIISSTSA  495

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQS+ 
Sbjct  496  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSIT  555

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
             ++  S+VFD EL RYQ+   E+M++LL++ ++CTAQYPD RPSMAE+T  IE++     
Sbjct  556  DQQSPSDVFDPELTRYQSEGNENMIRLLKIGMSCTAQYPDSRPSMAEVTRLIEEVSHSSG  615

Query  320  QDNNIVD  300
              N + D
Sbjct  616  SPNPVSD  622



>emb|CDY61284.1| BnaA01g36890D [Brassica napus]
Length=632

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPS-X  684
            +WE R  IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLVG S  
Sbjct  446  DWEVRARIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSSA  505

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP RV GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  506  TPNRVTGYRAPEVTDPSRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  565

Query  503  VREEWTSEVFDLELLRYQNV--VEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             REEW  EVFD EL+  + V  VE +M ++LQL ++CT Q+PDKRP M E+  RI++L +
Sbjct  566  EREEWRREVFDSELMSLERVDSVEGEMEEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQ  625

Query  329  PG  324
            PG
Sbjct  626  PG  627



>emb|CDX69441.1| BnaA10g17900D [Brassica napus]
Length=618

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L++SY+A+VSD+  A ++ P+ T
Sbjct  432  NWETRAGIALGAARAISYLHSRDATTSHGNIKSSNILLSESYEAKVSDYCLAPMISPTST  491

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   +EEGVDLPRWV S+ 
Sbjct  492  PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLSEEGVDLPRWVSSIT  551

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++ TS+VFD EL RYQ+   E+M++LL++ ++CTAQYPD RP+M E+T  IE++ R
Sbjct  552  EQQSTSDVFDPELTRYQDGDNENMIRLLKIGISCTAQYPDSRPTMPEVTRLIEEVSR  608



>ref|XP_002883091.1| hypothetical protein ARALYDRAFT_479268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59350.1| hypothetical protein ARALYDRAFT_479268 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLV-GPSX  684
            NWE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLV   S 
Sbjct  453  NWEVRSGIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASST  512

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP R  GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  513  TPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  572

Query  503  VREEWTSEVFDLELLRYQNV--VEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             REEW +EVFD EL+  + V  VEE+M ++LQL ++CT Q+PDKRP M E+  RI++L +
Sbjct  573  PREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQ  632

Query  329  PG  324
             G
Sbjct  633  SG  634



>ref|XP_009113711.1| PREDICTED: probable inactive receptor kinase RLK902 [Brassica 
rapa]
Length=632

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 141/182 (77%), Gaps = 3/182 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPS-X  684
            +WE R  IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLVG S  
Sbjct  446  DWEVRARIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSSA  505

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP RV GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP+++  NEEG+DL RWV SV
Sbjct  506  TPNRVTGYRAPEVTDPSRVSQKADVYSFGVVLLELLTGKAPSNSAMNEEGMDLARWVHSV  565

Query  503  VREEWTSEVFDLELLRYQNV--VEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             REEW  EVFD EL+  + V  VE +M ++LQL ++CT Q+PDKRP M E+  RI++L +
Sbjct  566  EREEWRREVFDSELMSLERVDSVEGEMEEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQ  625

Query  329  PG  324
            PG
Sbjct  626  PG  627



>gb|KFK39109.1| hypothetical protein AALP_AA3G202300 [Arabis alpina]
Length=649

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLVG S T
Sbjct  463  DWEIRSRIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSTT  522

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P RV GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  523  TPNRVTGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  582

Query  503  VREEWTSEVFDLELLRYQNV--VEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             REEW SEVFD EL+  + V  VE +M ++LQL + CT Q+PDKRP M E+  RI++L +
Sbjct  583  EREEWRSEVFDSELMSLETVVSVEAEMAEMLQLGLECTEQHPDKRPVMVEVVKRIQELRQ  642

Query  329  PG  324
             G
Sbjct  643  SG  644



>ref|XP_006299778.1| hypothetical protein CARUB_v10015974mg [Capsella rubella]
 gb|EOA32676.1| hypothetical protein CARUB_v10015974mg [Capsella rubella]
Length=648

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 141/180 (78%), Gaps = 2/180 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLV-GPSX  684
            NWE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLV   S 
Sbjct  465  NWEIRSRIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASST  524

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP R  GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  525  TPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  584

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
             REEW +EVFD EL+  +  VEE+M ++LQL ++CT Q+PDKRP M E+  RI++L + G
Sbjct  585  AREEWRNEVFDSELMSIE-TVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQSG  643



>ref|XP_009118618.1| PREDICTED: probable inactive receptor kinase At3g02880 [Brassica 
rapa]
Length=609

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L+ SY+A+VSD+G A ++  +  
Sbjct  423  NWETRAGIALGAARAISYLHSRDSTTSHGNIKSSNILLSNSYEAKVSDYGLAPIISSTSA  482

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQSV 
Sbjct  483  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVT  542

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
             ++ TS+VFD EL RY++   E++++LL++ ++CTAQYPD RPSMA++T  IE++     
Sbjct  543  DQQSTSDVFDPELTRYESEGNENIIRLLKIGMSCTAQYPDSRPSMADVTRLIEEVSHSSG  602

Query  320  QDNNIVD  300
              N + D
Sbjct  603  SPNPVSD  609



>emb|CDX95816.1| BnaC05g35670D [Brassica napus]
Length=590

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DAR+SDFG AQLVG S T
Sbjct  406  DWEVRSRIALGAARGLDYLHSQDPLTSHGNVKSSNILLTNSHDARLSDFGLAQLVGSSTT  465

Query  680  PT-RVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             T RV GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  466  TTNRVTGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  525

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
             +E W SEVFD EL+  + VVE +M ++LQL + CT Q+PDKRP M E+  RI++L + G
Sbjct  526  GKEAWRSEVFDSELMSLETVVEGEMEEMLQLGIECTEQHPDKRPVMVEVVRRIQELRQSG  585



>ref|XP_009121473.1| PREDICTED: probable inactive receptor kinase At5g16590 [Brassica 
rapa]
Length=617

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L++SY+A+VSD+  A ++ P+ T
Sbjct  431  NWETRAGIALGAARAISYLHSRDATTSHGNIKSSNILLSESYEAKVSDYCLAPMISPTST  490

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   +EEGVDLPRWV S+ 
Sbjct  491  PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLSEEGVDLPRWVSSIS  550

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++ TS+VFD EL RYQ+   E+M++LL++ ++CTAQYPD RP+M E+T  IE++ R
Sbjct  551  EQQSTSDVFDPELTRYQDGDNENMIRLLKIGISCTAQYPDSRPTMPEVTRLIEEVSR  607



>emb|CDY49655.1| BnaC09g41330D [Brassica napus]
Length=617

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L++SY+A+VSD+  A ++ P+ T
Sbjct  431  NWETRAGIALGAARAISYLHSRDATTSHGNIKSSNILLSESYEAKVSDYCLAPMISPTST  490

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R++GYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   +EEGVDLPRWV S+ 
Sbjct  491  PNRIEGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLSEEGVDLPRWVSSIT  550

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++ TS+VFD EL RYQ+   E+M++LL++ ++CTAQYPD RPSM E+T  IE++ R
Sbjct  551  EQQSTSDVFDPELTRYQDGDNENMIRLLKIGISCTAQYPDSRPSMPEVTRLIEEVSR  607



>ref|XP_009414081.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 145/191 (76%), Gaps = 7/191 (4%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR  IALGAARG   +H QG  ++HGNIKSSN  L+KS +ARVSDFG + L      
Sbjct  467  DWETRLEIALGAARGIEFIHLQGSGLTHGNIKSSNIILSKSNEARVSDFGLSSLGSTPMP  526

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
              R   YRAPEVTD  KVSQKADVYSFGVLL+ELLTGK PT AL NE+GVDLPRWVQSVV
Sbjct  527  NQRAASYRAPEVTDVRKVSQKADVYSFGVLLMELLTGKPPTQALHNEDGVDLPRWVQSVV  586

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            RE+W+SEVFD ELLR+QNV  E+M+QLLQLA++C  Q+P+ RPSM+E+ ARIE     G 
Sbjct  587  REKWSSEVFDHELLRHQNV--EEMMQLLQLAIDCAVQFPENRPSMSEVVARIE-----GI  639

Query  320  QDNNIVDNPEE  288
            + N+ + N ++
Sbjct  640  RSNSSMTNQQQ  650



>ref|XP_010479274.1| PREDICTED: probable inactive receptor kinase At1g48480 [Camelina 
sativa]
Length=652

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IA+GAARG  +LHSQG + SHGN+KSSN  LTKS+ A++SDFG AQLVG S T
Sbjct  466  NWDVRSRIAIGAARGLDYLHSQGTTTSHGNVKSSNILLTKSHHAKISDFGLAQLVGSSAT  525

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P R  GYRAPEVTDP +VSQK DV+SFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SV
Sbjct  526  NPNRATGYRAPEVTDPKRVSQKGDVFSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSV  585

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             R+EW  EVFD ELL      EE M +++QL ++CT+Q+PD+RP M+E+  ++E+L RP
Sbjct  586  ARDEWRREVFDSELLSLATKEEEMMAEMVQLGLDCTSQHPDQRPEMSEVVRKMENL-RP  643



>ref|XP_009126125.1| PREDICTED: probable inactive receptor kinase At5g16590 [Brassica 
rapa]
 emb|CDX85498.1| BnaA02g03150D [Brassica napus]
Length=613

 Score =   238 bits (608),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR  IALGAAR  S+LHS+  + SHGNIKS N  L++SY+A+VSD+  A ++ P+ T
Sbjct  427  SWETRAGIALGAARAISYLHSRDATTSHGNIKSCNILLSESYEAKVSDYCLAPMISPTST  486

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWV S+ 
Sbjct  487  PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVSSIT  546

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++  S+VFD EL RYQ    E+M++LL++ ++CTAQYPD RPSMAE+T  IE++ R
Sbjct  547  EQQSPSDVFDPELTRYQAEGNENMIRLLKIGISCTAQYPDSRPSMAEVTRLIEEVSR  603



>emb|CDY38103.1| BnaC02g06700D [Brassica napus]
Length=613

 Score =   238 bits (608),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR  IALGAAR  S+LHS+  + SHGNIKS N  L++SY+A+VSD+  A ++ P+ T
Sbjct  427  SWETRAGIALGAARAISYLHSRDATTSHGNIKSCNILLSESYEAKVSDYCLAPMISPTST  486

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWV S+ 
Sbjct  487  PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVSSIT  546

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++  S+VFD EL RYQ    E+M++LL++ ++CTAQYPD RPSMAE+T  IE++ R
Sbjct  547  EQQSPSDVFDPELTRYQAEGNENMIRLLKIGISCTAQYPDSRPSMAEVTRLIEEVSR  603



>ref|XP_006406685.1| hypothetical protein EUTSA_v10020262mg [Eutrema salsugineum]
 gb|ESQ48138.1| hypothetical protein EUTSA_v10020262mg [Eutrema salsugineum]
Length=648

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WE R+ IALGAARG  +LHSQ    SHGN+K+SN  LT S+DARVSDFG AQLVG S T
Sbjct  462  DWEIRSRIALGAARGLDYLHSQDPLSSHGNVKASNILLTNSHDARVSDFGLAQLVGSSST  521

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P RV GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  522  TPNRVTGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  581

Query  503  VREEWTSEVFDLELLRYQNV--VEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             REEW SEVFD EL+  + V  VEE+M  +LQL ++CT Q+P+KRP M E+  RI +L +
Sbjct  582  EREEWRSEVFDSELMSLETVASVEEEMAGMLQLGIDCTEQHPEKRPVMVEVVRRIHELRQ  641

Query  329  PG  324
             G
Sbjct  642  SG  643



>ref|XP_006400197.1| hypothetical protein EUTSA_v10012966mg [Eutrema salsugineum]
 gb|ESQ41650.1| hypothetical protein EUTSA_v10012966mg [Eutrema salsugineum]
Length=628

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L++S++A+VSD+  A ++ P+ T
Sbjct  442  NWETRAGIALGAARAISYLHSRDATTSHGNIKSSNVLLSESFEAKVSDYCLAPMISPTST  501

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVLLLELLTGK+PTH    EEGVDLPRWV S+ 
Sbjct  502  PNRIDGYRAPEVTDARRISQKADVYSFGVLLLELLTGKSPTHQQLTEEGVDLPRWVSSIT  561

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++  S+VFD EL RYQ    E+M++LL++ ++CTAQYPD RPSM E+T  IE++ R
Sbjct  562  EQQSPSDVFDPELTRYQADGNENMIRLLKIGISCTAQYPDSRPSMPEVTRLIEEVSR  618



>ref|XP_010500379.1| PREDICTED: probable inactive receptor kinase At1g48480 [Camelina 
sativa]
Length=651

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IA+GAARG  +LHSQG + SHGN+KSSN  LTKS+ A++SDF  AQLVG S T
Sbjct  465  NWDVRSRIAIGAARGLDYLHSQGTTTSHGNVKSSNILLTKSHHAKISDFDLAQLVGSSST  524

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P R  GYRAPEVTDP +VSQK DVYSFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SV
Sbjct  525  NPNRATGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSV  584

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             R+EW  EVFD ELL      EE M +++QL ++CT+Q+PD+RP M+E+  ++E+L RP
Sbjct  585  ARDEWRREVFDSELLSLATKEEEMMAEMVQLGLDCTSQHPDQRPEMSEVVRKMENL-RP  642



>ref|XP_002891438.1| hypothetical protein ARALYDRAFT_891670 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67697.1| hypothetical protein ARALYDRAFT_891670 [Arabidopsis lyrata subsp. 
lyrata]
Length=654

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IA+GA RG ++LHSQG S SHGNIKSSN  LTKS+DA+VSDFG AQLVG S T
Sbjct  466  NWDVRSRIAIGAGRGLAYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSAT  525

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P R  GYRAPEVTDP +VSQK DVYSFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SV
Sbjct  526  NPNRATGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSV  585

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             R+EW  EVFD ELL      EE M +++QL + CT+Q+PDKRP M+E+  ++E+L RP
Sbjct  586  ARDEWRREVFDSELLSLAREEEEMMAEMVQLGLECTSQHPDKRPEMSEVVRKMENL-RP  643



>ref|XP_010461669.1| PREDICTED: probable inactive receptor kinase At1g48480 [Camelina 
sativa]
Length=652

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IA+GAARG  +LHSQG + SHGN+KSSN  LTKS+ A++SDFG +QLVG S T
Sbjct  466  NWDVRSRIAIGAARGLDYLHSQGTTTSHGNVKSSNILLTKSHHAKISDFGLSQLVGSSAT  525

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P R  GYRAPEVTDP +VSQK DV+SFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SV
Sbjct  526  NPNRATGYRAPEVTDPKRVSQKGDVFSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSV  585

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             R+EW  EVFD ELL      EE M +++QL + CT+Q+PD+RP M+E+  ++E+L RP
Sbjct  586  ARDEWRREVFDSELLSLATKEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKMENL-RP  643



>ref|XP_002447974.1| hypothetical protein SORBIDRAFT_06g019120 [Sorghum bicolor]
 gb|EES12302.1| hypothetical protein SORBIDRAFT_06g019120 [Sorghum bicolor]
Length=662

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WE+R  IAL +ARG  ++H+ G  ++HGNIKSSN  L++S DARV+D G A LVGP+  
Sbjct  452  SWESRRRIALASARGLEYIHATGSMVTHGNIKSSNILLSRSVDARVADHGLAHLVGPAGA  511

Query  680  PT-RVDGYRAPEV-TDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQS  507
            PT RV GYRAPEV  DP + SQKADVYSFGVLLLELLTGKAPTHA+ +EEGVDLPRW +S
Sbjct  512  PTTRVAGYRAPEVVADPRRASQKADVYSFGVLLLELLTGKAPTHAVLHEEGVDLPRWARS  571

Query  506  VVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            VV+EEWTSEVFD ELLR+    EE+MV++LQLA++C+   PD+RP+M EI ARIE L
Sbjct  572  VVKEEWTSEVFDTELLRHPG-AEEEMVEMLQLAMDCSEPAPDQRPAMPEIVARIEAL  627



>emb|CDX92167.1| BnaA05g22400D [Brassica napus]
Length=624

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPS-X  684
            +WE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLVG S  
Sbjct  440  DWEVRSRIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSTA  499

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            T  RV GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  500  TTNRVTGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  559

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
             RE W SEVFD EL+  + VVE +M ++LQL + CT  +PDKRP M E+  RI++L + G
Sbjct  560  GREAWRSEVFDSELMSLETVVEGEMEEMLQLGIECTEPHPDKRPVMVEVVRRIQELRQSG  619

Query  323  F  321
             
Sbjct  620  L  620



>gb|ABR17070.1| unknown [Picea sitchensis]
Length=340

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 136/185 (74%), Gaps = 2/185 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQ-SISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSX  684
            +W+TR  IALGAARG SH+H +G    +HGNIKSSN  LT   D  VSDFG   L   + 
Sbjct  125  DWDTRMRIALGAARGISHIHEEGGGKFTHGNIKSSNVLLTTDLDGCVSDFGLVPLFSAAA  184

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
               R+ GYRAPEV +  KV+QK+DVYSFGVLLLELLTGKAP  A  N+EG+DLPRWVQSV
Sbjct  185  AANRIAGYRAPEVIETRKVTQKSDVYSFGVLLLELLTGKAPNQASLNDEGIDLPRWVQSV  244

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
            VREEWT+EVFD+EL+RYQN +EE+MVQLLQ+A+ C A  PD+RP M ++   IED+ +  
Sbjct  245  VREEWTAEVFDVELMRYQN-IEEEMVQLLQIAMACVAAVPDQRPRMQDVVKMIEDMRQFE  303

Query  323  FQDNN  309
              D N
Sbjct  304  TDDGN  308



>gb|AGT16967.1| hypothetical protein SHCRBa_121_P14_R_290 [Saccharum hybrid cultivar 
R570]
Length=670

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WE+R  IAL +ARG  ++H+ G  ++HGNIKSSN  L++S DARV+D G A LVGP+  
Sbjct  460  SWESRRRIALASARGLEYIHATGSMVTHGNIKSSNILLSRSVDARVADHGLAHLVGPAGA  519

Query  680  PT-RVDGYRAPEV-TDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQS  507
            PT RV GYRAPEV  DP +VSQKADVYSFGVLLLELLTGKAPTHA+ ++EGVDLPRW +S
Sbjct  520  PTTRVAGYRAPEVVADPRRVSQKADVYSFGVLLLELLTGKAPTHAVLHDEGVDLPRWARS  579

Query  506  VVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            VV+EEWTSEVFD ELLR+    EE+MV++L+LA++CT   PD+RP+M EI ARIE L
Sbjct  580  VVKEEWTSEVFDTELLRHPG-AEEEMVEMLRLAMDCTEPAPDQRPAMPEIVARIEAL  635



>ref|XP_002960794.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
 ref|XP_002983874.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ14886.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ38333.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
Length=649

 Score =   236 bits (603),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQS-ISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSX  684
            +W +R  IALGAARG ++LH QG S   HGNIKSSN  L K+YDA VSDFG AQL   S 
Sbjct  420  DWVSRVRIALGAARGITYLHEQGGSNFVHGNIKSSNILLKKNYDAAVSDFGLAQLFNSSS  479

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
              +R+ GYRAPEV +  K +Q++DVYSFGVLLLELLTGKAPT A  N+EG+DLPRWVQSV
Sbjct  480  AASRIVGYRAPEVAETRKSTQRSDVYSFGVLLLELLTGKAPTQASLNDEGIDLPRWVQSV  539

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            VREEWT+EVFDLEL+RYQN +EE+MVQLLQ+A+ C A  PD+RP M ++   IED+
Sbjct  540  VREEWTAEVFDLELMRYQN-IEEEMVQLLQVAMACVATSPDQRPKMKDVVRMIEDI  594



>ref|XP_010495229.1| PREDICTED: probable inactive receptor kinase At5g16590, partial 
[Camelina sativa]
Length=632

 Score =   236 bits (601),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L++S++A+VSD+  A ++ P+ T
Sbjct  446  NWETRAGIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTST  505

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   +EEGVDLPRWV S+ 
Sbjct  506  PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSIT  565

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++  S+VFD EL RYQ    E+MV+LL++ ++CTAQYPD RP+M E+T  IE++ R
Sbjct  566  EQQSPSDVFDPELTRYQAEGNENMVRLLKIGISCTAQYPDSRPTMPEVTRLIEEVTR  622



>ref|XP_010453822.1| PREDICTED: probable inactive receptor kinase At5g16590 [Camelina 
sativa]
Length=636

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L++S++A+VSD+  A ++ P+ T
Sbjct  450  NWETRAGIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTST  509

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   +EEGVDLPRWV S+ 
Sbjct  510  PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSIT  569

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++  S+VFD EL RYQ    E+MV+LL++ ++CTAQYPD RP+M E+T  IE++ R
Sbjct  570  EQQSPSDVFDPELTRYQAEGNENMVRLLKIGISCTAQYPDSRPTMPEVTRLIEEVTR  626



>ref|XP_006287270.1| hypothetical protein CARUB_v10000461mg [Capsella rubella]
 gb|EOA20168.1| hypothetical protein CARUB_v10000461mg [Capsella rubella]
Length=626

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L+++++A+VSD+  A ++ P+ T
Sbjct  440  NWETRAGIALGAARAISYLHSRDATTSHGNIKSSNILLSETFEAKVSDYCLAPMISPTST  499

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   +EEGVDLPRWV S+ 
Sbjct  500  PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSIT  559

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR-PG  324
             ++  S+VFD EL RYQ+   E+M++LL++ ++CTAQYPD RP+M E+T  IE++ R PG
Sbjct  560  EQQTPSDVFDPELTRYQSEGNENMIRLLKIGISCTAQYPDSRPTMPEVTRLIEEVSRSPG  619



>ref|NP_197162.1| leucine-rich repeat protein 1 [Arabidopsis thaliana]
 sp|Q9FMD7.1|Y5659_ARATH RecName: Full=Probable inactive receptor kinase At5g16590; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10186.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAS49054.1| At5g16590 [Arabidopsis thaliana]
 gb|AAS76757.1| At5g16590 [Arabidopsis thaliana]
 dbj|BAF00775.1| receptor like protein kinase [Arabidopsis thaliana]
 gb|ACN59369.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92314.1| leucine-rich repeat protein 1 [Arabidopsis thaliana]
Length=625

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR +IALGAAR  S+LHS+  + SHGNIKSSN  L++S++A+VSD+  A ++ P+ T
Sbjct  439  NWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTST  498

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH   +EEGVDLPRWV S+ 
Sbjct  499  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSIT  558

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++  S+VFD EL RYQ+   E+M++LL + ++CT QYPD RP+M E+T  IE++ R
Sbjct  559  EQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVTRLIEEVSR  615



>emb|CDY51524.1| BnaA05g33240D [Brassica napus]
Length=620

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR SIALGAAR  S+LHS+  + SHGNIKSSN  L+ SY+A+VSD+G A ++  +  
Sbjct  434  NWETRASIALGAARAISYLHSRDSTTSHGNIKSSNILLSNSYEAKVSDYGLAPIISSTSA  493

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH    EEGVDLPRWVQS+ 
Sbjct  494  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLTEEGVDLPRWVQSIT  553

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
             ++  S+VFD EL  +Q+   E+M++LL++ ++CTAQYPD RPSMAE+T  IE++
Sbjct  554  DQQSPSQVFDPELAGHQSEGNENMIRLLKIGISCTAQYPDSRPSMAEVTRLIEEV  608



>ref|XP_009147309.1| PREDICTED: probable inactive receptor kinase At3g02880 [Brassica 
rapa]
Length=623

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR SIALGAAR  S+LHS+  + SHGNIKSSN  L+ SY+A+VSD+G A ++  +  
Sbjct  437  NWETRASIALGAARAISYLHSRDSTTSHGNIKSSNILLSNSYEAKVSDYGLAPIISSTSA  496

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH    EEGVDLPRWVQS+ 
Sbjct  497  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLTEEGVDLPRWVQSIT  556

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
             ++  S+VFD EL  +Q+   E+M++LL++ ++CTAQYPD RPSMAE+T  IE++
Sbjct  557  DQQSPSQVFDPELAGHQSEGNENMIRLLKIGISCTAQYPDSRPSMAEVTRLIEEV  611



>ref|NP_186938.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9M8T0.1|Y3288_ARATH RecName: Full=Probable inactive receptor kinase At3g02880; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF26971.1|AC018363_16 putative protein kinase [Arabidopsis thaliana]
 gb|AAK50106.1|AF372969_1 AT3g02880/F13E7_17 [Arabidopsis thaliana]
 gb|AAP21160.1| At3g02880/F13E7_17 [Arabidopsis thaliana]
 gb|ACN59311.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE73873.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=627

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L+ SY+A+VSD+G A ++  +  
Sbjct  441  NWETRAGIALGAARAISYLHSRDGTTSHGNIKSSNILLSDSYEAKVSDYGLAPIISSTSA  500

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPE+TD  K+SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQSV 
Sbjct  501  PNRIDGYRAPEITDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVT  560

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
             ++  S+V D EL RYQ    E++++LL++ ++CTAQ+PD RPSMAE+T  IE++     
Sbjct  561  EQQTPSDVLDPELTRYQPEGNENIIRLLKIGMSCTAQFPDSRPSMAEVTRLIEEVSHSSG  620

Query  320  QDNNIVD  300
              N + D
Sbjct  621  SPNPVSD  627



>ref|XP_006297231.1| hypothetical protein CARUB_v10013240mg [Capsella rubella]
 gb|EOA30129.1| hypothetical protein CARUB_v10013240mg [Capsella rubella]
Length=617

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR S+ALGAA+  S++HS+  + SHGNIKSSN  L++SY+A+VSD+G A ++  +  
Sbjct  431  NWETRVSVALGAAKAISYIHSRDATTSHGNIKSSNILLSESYEAKVSDYGLAPIISSTSA  490

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQSV 
Sbjct  491  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVT  550

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
             ++  S+V D EL RYQ    E++++LL++ ++CTAQYPD RPSMA++T  IE++     
Sbjct  551  EQQSPSDVLDPELTRYQPEGNENIIRLLKIGMSCTAQYPDSRPSMADVTRLIEEVSHSSG  610

Query  320  QDNNIVD  300
              N + D
Sbjct  611  SPNPVSD  617



>dbj|BAJ89083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=669

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 144/181 (80%), Gaps = 3/181 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W++R  IAL +ARG  ++H+ G  ++HGNIKSSN  L +S DARV+D G A LVGP+  
Sbjct  459  SWDSRRRIALASARGLEYIHATGSKVAHGNIKSSNILLGRSVDARVADHGLASLVGPAGA  518

Query  680  PT-RVDGYRAPEVT-DPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQS  507
            P+ RV GYRAPEV  DP ++SQKADVYSFGVLLLE+LTGKAPT+A+ ++EGVDLPRW +S
Sbjct  519  PSMRVAGYRAPEVVADPRRLSQKADVYSFGVLLLEMLTGKAPTNAVLHDEGVDLPRWARS  578

Query  506  VVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
            VVREEWTSEVFD ELLR+    EE+MV++L+LA++CT   PD+RP+M EI  RIE+L  P
Sbjct  579  VVREEWTSEVFDTELLRHPG-AEEEMVEMLRLAMDCTVPVPDQRPAMPEIVVRIEELAAP  637

Query  326  G  324
            G
Sbjct  638  G  638



>ref|XP_010420358.1| PREDICTED: probable inactive receptor kinase At5g16590 [Camelina 
sativa]
Length=633

 Score =   233 bits (595),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L++S++A+VSD+  A ++ P+ T
Sbjct  447  NWETRAGIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTST  506

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  ++SQKADVYSFGVL+LELLTGK+PTH   +EEGVDLPRWV S+ 
Sbjct  507  PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSIT  566

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++   +VFD EL RYQ    E+MV+LL++ ++CTAQYPD RP+M E+T  IE++ R
Sbjct  567  EQQSPLDVFDPELTRYQAEGNENMVRLLKIGISCTAQYPDSRPTMTEVTRLIEEVTR  623



>ref|XP_002882256.1| hypothetical protein ARALYDRAFT_896266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58515.1| hypothetical protein ARALYDRAFT_896266 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score =   233 bits (595),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IA+GAAR  S+LHS+  + SHGNIKSSN  L+ SY+A+VSD+G A ++  +  
Sbjct  440  NWETRAGIAVGAARAISYLHSRDATTSHGNIKSSNILLSDSYEAKVSDYGLAPIISSTSA  499

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQSV 
Sbjct  500  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVT  559

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
             ++  S+V D EL RYQ    E++++LL++ ++CTAQ+PD RPSMAE+T  IE++     
Sbjct  560  DQQSPSDVLDPELTRYQPESNENIIRLLKIGMSCTAQFPDSRPSMAEVTRLIEEVSHSSG  619

Query  320  QDNNIVD  300
              N + D
Sbjct  620  SPNPVSD  626



>ref|XP_006306949.1| hypothetical protein CARUB_v10008516mg, partial [Capsella rubella]
 gb|EOA39847.1| hypothetical protein CARUB_v10008516mg, partial [Capsella rubella]
Length=666

 Score =   234 bits (596),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 141/179 (79%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+ IA+GAARG  +LHSQG   SHGN+KSSN  LTKS+ A+VSDFG AQLVG S T
Sbjct  478  NWDVRSRIAIGAARGLDYLHSQGTMTSHGNVKSSNILLTKSHGAKVSDFGLAQLVGSSAT  537

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P R  GYRAPEVTDP +VSQK DVYSFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SV
Sbjct  538  TPIRTTGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSV  597

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRP  327
             R+EW  EVFD ELL      EE M +++QL + CT+Q+PDKRP M+E+  +IE+L RP
Sbjct  598  ARDEWRREVFDSELLSLATEEEEMMAEMVQLGIECTSQHPDKRPEMSEVVRKIENL-RP  655



>ref|XP_004975871.1| PREDICTED: probable inactive receptor kinase RLK902-like [Setaria 
italica]
Length=673

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 144/182 (79%), Gaps = 4/182 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WE+R  IAL +ARG  ++H+ G  ++HGNI+SSN  L++S DARV+D G A LVGP+  
Sbjct  463  SWESRRRIALASARGLEYIHATGSMVTHGNIRSSNILLSRSVDARVADHGLAHLVGPAGA  522

Query  680  P--TRVDGYRAPEVT-DPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQ  510
            P  TRV GYRAPEV  DP +VSQKADVYSFGVLLLE+LTGKAPTHA+ ++EGVDLPRW +
Sbjct  523  PAATRVAGYRAPEVVADPRRVSQKADVYSFGVLLLEMLTGKAPTHAVLHDEGVDLPRWAR  582

Query  509  SVVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            SVV+EEWT+EVFD ELLR+    EE MV++L+LA++CT   PD+RP+M EI ARIE++  
Sbjct  583  SVVKEEWTAEVFDTELLRHPG-AEEQMVEMLRLAMDCTVPAPDQRPAMPEIVARIEEIGT  641

Query  329  PG  324
             G
Sbjct  642  AG  643



>emb|CDY28719.1| BnaCnng06050D [Brassica napus]
Length=604

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALGAAR  S+LHS+  + SHGNIKSSN  L+ SY+A+VSD+G A ++  +  
Sbjct  418  NWETRAGIALGAARAISYLHSRDSTTSHGNIKSSNILLSNSYEAKVSDYGLAPIISSTSA  477

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH    EEGVDLPRWVQS+ 
Sbjct  478  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLTEEGVDLPRWVQSIT  537

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
             ++  S+VFD EL  +Q+   E+M++LL++A++CTAQYPD RP MA++T  IE++     
Sbjct  538  DQQSPSQVFDPELAGHQSEGNENMIRLLKIAISCTAQYPDSRPFMADVTRLIEEVSHSSG  597

Query  320  QDNNI  306
              N I
Sbjct  598  SPNPI  602



>ref|XP_002463998.1| hypothetical protein SORBIDRAFT_01g010290 [Sorghum bicolor]
 gb|EER90996.1| hypothetical protein SORBIDRAFT_01g010290 [Sorghum bicolor]
Length=696

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+SIAL AARG  ++HS     SHGNIKSSN  L KSY ARVSD G   LVGPS +
Sbjct  493  NWDLRSSIALAAARGVEYIHSTSSMASHGNIKSSNILLGKSYQARVSDNGLNTLVGPSSS  552

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEV D  +VSQKADVYSFGVLLLEL+TGKAP+ A  N+EGVDLPRWVQSV 
Sbjct  553  PSRTTGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVDLPRWVQSVN  612

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            R EW SEVFD+EL R+Q   EE + QL+ LA++C AQ PD RPSMA +  RIE++
Sbjct  613  RSEWGSEVFDMELTRHQ-TGEEPLAQLVLLAMDCVAQVPDARPSMAHVVMRIEEI  666



>gb|KFK36089.1| hypothetical protein AALP_AA4G076000 [Arabis alpina]
Length=639

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 140/179 (78%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGP--S  687
            NWE R+ IALGAARG  +LHSQG + SHGN+KSSN  LTKS+DA+VSDFG +QLV    S
Sbjct  449  NWEVRSRIALGAARGLDYLHSQGVTTSHGNVKSSNILLTKSHDAKVSDFGLSQLVASPSS  508

Query  686  XTPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQS  507
             TP R  GYRAPEVTDP +VSQK DVYSFGV++LEL+TGKAP++++ NEEGVDLPRWV+S
Sbjct  509  TTPNRATGYRAPEVTDPKRVSQKGDVYSFGVVVLELITGKAPSNSVMNEEGVDLPRWVKS  568

Query  506  VVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            VVREEW  EVFD ELL      E  M ++++L + CT+ +PDKRP M+++  +IE+L R
Sbjct  569  VVREEWRREVFDSELLSLATEEEVMMEEMVELGIECTSMHPDKRPEMSQVVRKIENLRR  627



>ref|XP_009145968.1| PREDICTED: probable inactive receptor kinase RLK902 [Brassica 
rapa]
Length=631

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPS-X  684
            +WE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLVG S  
Sbjct  447  DWEVRSRIALGAARGLDYLHSQDPLSSHGNVKSSNVLLTNSHDARVSDFGLAQLVGSSTA  506

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            T  RV GYRAPEVTD  +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  507  TTNRVTGYRAPEVTDARRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  566

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
             RE W SEVF+ EL+  + VVE +M ++LQL + CT  +PDKRP M E+  RI++L + G
Sbjct  567  GREAWRSEVFESELMSLETVVEGEMEEMLQLGIECTEPHPDKRPVMVEVVRRIQELRQSG  626

Query  323  F  321
             
Sbjct  627  L  627



>ref|XP_010485618.1| PREDICTED: probable inactive receptor kinase At3g02880 [Camelina 
sativa]
Length=630

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  +ALGAAR    LHS+  + SHGNIKSSN  L++SY+A+VSD+G A ++  +  
Sbjct  443  NWETRVGVALGAARAIKFLHSRDATTSHGNIKSSNVLLSESYEAKVSDYGLAPIISSTSA  502

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQSV 
Sbjct  503  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVT  562

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
             ++  SEV D EL RYQ    E++++LL++ ++CTAQYPD RPSMA++T  IE++
Sbjct  563  DQQSPSEVLDPELTRYQPEGNENIIRLLKIGMSCTAQYPDSRPSMADVTRLIEEV  617



>ref|XP_010502431.1| PREDICTED: probable inactive receptor kinase At3g02880 [Camelina 
sativa]
Length=629

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  +ALGAAR    LHS+  + SHGNIKSSN  L++SY+A+VSD+G A ++  +  
Sbjct  442  NWETRVGVALGAARAIKFLHSRDATTSHGNIKSSNVLLSESYEAKVSDYGLAPIISSTSA  501

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQSV 
Sbjct  502  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVT  561

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
             ++  SEV D EL RYQ    E++++LL++ ++CTAQYPD RPSMA++T  IE++
Sbjct  562  DQQSPSEVLDPELTRYQPEGNENIIRLLKIGMSCTAQYPDSRPSMADVTRLIEEV  616



>ref|XP_010463719.1| PREDICTED: probable inactive receptor kinase At3g02880 [Camelina 
sativa]
Length=627

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  +ALGAAR    LHS+  + SHGNIKSSN  L++SY+A+VSD+G A ++  +  
Sbjct  440  NWETRVGVALGAARAIKFLHSRDGTTSHGNIKSSNVLLSESYEAKVSDYGLAPIISSTSA  499

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVL+LELLTGK+PTH   NEEGVDLPRWVQSV 
Sbjct  500  PNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVT  559

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
             ++  SEV D EL RYQ    E++++LL++ ++CTAQYPD RPSMA++T  IE++
Sbjct  560  DQQSPSEVLDPELTRYQPEGNENIIRLLKIGMSCTAQYPDTRPSMADVTRLIEEV  614



>ref|XP_010558597.1| PREDICTED: probable inactive receptor kinase At5g16590 [Tarenaya 
hassleriana]
Length=619

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 138/179 (77%), Gaps = 2/179 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWETR  IALG AR  S++HS   + SHGNIKSSN  L++SY+A+VSD+  A L+ P+ T
Sbjct  437  NWETRAGIALGTARAISYIHSLDTTTSHGNIKSSNILLSESYEAKVSDYCLAPLITPTST  496

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+DGYRAPEVTD  K+SQKADVYSFGVLLLELLTGK+PT    NEEGVDLPRWVQ+V 
Sbjct  497  PNRIDGYRAPEVTDARKISQKADVYSFGVLLLELLTGKSPTQQQLNEEGVDLPRWVQAVA  556

Query  500  REEWTSEVFDLELLRY--QNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
             ++  S+VFD EL RY  +    E+M++LL++ ++CTAQYPDKRPSM E T  IE++ R
Sbjct  557  EQQSPSDVFDPELTRYEPEGNGNENMIRLLKIGISCTAQYPDKRPSMDEATRLIEEVSR  615



>emb|CDX77309.1| BnaC08g03540D [Brassica napus]
Length=646

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 143/179 (80%), Gaps = 1/179 (1%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT-  681
            W+ R+ IALGAARG  +LHSQG S SHGN+KSSN  LTKS+DA+VSDFG +QLV  S T 
Sbjct  460  WDVRSRIALGAARGLDYLHSQGTSTSHGNVKSSNTLLTKSHDAKVSDFGLSQLVAASSTT  519

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R  GYRAPEVTDP +VSQK DVYSFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SVV
Sbjct  520  PNRGTGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVV  579

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
            R+EW  EVFD ELL  +   EE M +++QL + CT+Q+PD+RP MAE+ ++IE L R G
Sbjct  580  RDEWRREVFDSELLSLEREEEEMMEEMVQLGIECTSQHPDQRPEMAEVVSKIESLRRSG  638



>gb|AGT16430.1| kinase [Saccharum hybrid cultivar R570]
Length=692

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NWE R+SIAL AARG  ++HS     SHGNIKSSN  L KSY ARVSD G   LVGPS +
Sbjct  489  NWELRSSIALAAARGVEYIHSTSSMASHGNIKSSNVLLGKSYQARVSDNGINTLVGPSSS  548

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEV D  +VSQKADVYSFGVLLLEL+TGKAP+ A  N+EGVDLPRWVQSV 
Sbjct  549  PSRTTGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVDLPRWVQSVN  608

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            R EW SEVFD EL R+Q   EE + QL+ LA++C AQ PD RPSM  +  RIE++ +   
Sbjct  609  RSEWGSEVFDTELTRHQP-GEEPLAQLVLLAMDCVAQVPDARPSMTHVVMRIEEIKKSSV  667

Query  320  QDN  312
              N
Sbjct  668  ASN  670



>dbj|BAJ95574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=671

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W  R+SIAL AARG  ++HS   S SHGNIKSSN  L+K+Y ARVSD G A LVG S +
Sbjct  467  DWPIRSSIALAAARGIEYIHSTSSSTSHGNIKSSNILLSKAYQARVSDNGLATLVGSSSS  526

Query  680  -PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
             P+R  GYRAPEVTDP +VSQKADV+SFGVLLLELLTGKAP+ +  N+EGVDLPRWVQSV
Sbjct  527  GPSRATGYRAPEVTDPRRVSQKADVFSFGVLLLELLTGKAPSQSALNDEGVDLPRWVQSV  586

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            VR EWTSEVFD+ELLR Q+  EE MVQLLQLA++C AQ PD RP+M+ +  RIE++
Sbjct  587  VRSEWTSEVFDMELLRNQS-SEEQMVQLLQLAIDCVAQVPDARPTMSHVVVRIEEI  641



>ref|XP_009417661.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 136/175 (78%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +WETR  IALGAA+G  ++H +G  +SHGNIKSSN  L++S  A V+DFG + L      
Sbjct  447  DWETRLEIALGAAQGIEYIHLKGAGVSHGNIKSSNVILSRSNKACVADFGLSSLGSIPMP  506

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
              R  GYRAPEVTD  KVSQKADVYSFGVLL+ELLTGK+P   L++E+ +DLPRWVQSVV
Sbjct  507  NQRAAGYRAPEVTDVRKVSQKADVYSFGVLLMELLTGKSPAQTLNDEDTIDLPRWVQSVV  566

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            RE W SEVFDLEL R+QN VEE+MVQLLQLA++C  QYP+ RPSM+E+ A+IE +
Sbjct  567  REAWNSEVFDLELSRHQN-VEEEMVQLLQLAIDCAVQYPESRPSMSEVVAQIEQI  620



>gb|AFW67828.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=724

 Score =   230 bits (587),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+SIAL AARG  ++HS   + SHGNIKSSN  L +SY A VSD G   LVGPS +
Sbjct  520  NWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSS  579

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEV DP +VSQKADVYSFGVLLLEL+TGKAP+ A  N+EGV+LPRWVQSV 
Sbjct  580  PSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVS  639

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            R EW SEVFD+EL+R++   EE M QL+ LA++C AQ P+ RPSM  +  RIE++ +   
Sbjct  640  RSEWGSEVFDIELMRHE-AGEEPMAQLVLLALDCVAQVPEARPSMGHVVTRIEEIRKSSL  698

Query  320  QDN  312
              N
Sbjct  699  TTN  701



>ref|XP_004287382.1| PREDICTED: probable inactive receptor kinase At2g26730 [Fragaria 
vesca subsp. vesca]
Length=654

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L   +DA +SDFG   L G S  
Sbjct  443  DWDNRMRIALSAARGLAHLHVAGKVV-HGNIKSSNILLRPDHDATISDFGLNPLFGTSTP  501

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  502  PNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  561

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RYQN +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  562  REEWTAEVFDVELMRYQN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  617



>ref|XP_008463343.1| PREDICTED: probable inactive receptor kinase At2g26730 [Cucumis 
melo]
Length=665

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L  ++DA VSDFG   L G S  
Sbjct  453  DWDNRMKIALSAARGLAHLHVSGKLV-HGNIKSSNILLRPNHDAAVSDFGLNPLFGASTP  511

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+ GYRAPEV +  KV+ K+DVYSFGVLLLELLTGK+P  A   EEG+DLPRWVQSVV
Sbjct  512  PNRIAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVQSVV  571

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C A  PD+RPSM E+   IE+L R
Sbjct  572  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVATVPDQRPSMQEVVRMIEELNR  627



>ref|XP_008242698.1| PREDICTED: probable inactive receptor kinase At2g26730 [Prunus 
mume]
Length=659

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L   +DA VSDFG   L G S  
Sbjct  448  DWDNRMKIALSAARGIAHLHVSGKVV-HGNIKSSNILLRPEHDASVSDFGLNPLFGTSTP  506

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  507  PNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  566

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  567  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  622



>ref|NP_001151626.1| atypical receptor-like kinase MARK precursor [Zea mays]
 gb|ACG43563.1| atypical receptor-like kinase MARK [Zea mays]
Length=684

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 141/191 (74%), Gaps = 6/191 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+SIAL AARG  ++HS   + SHGNIKSSN  L +SY A VSD G   LVGPS +
Sbjct  480  NWDLRSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSS  539

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEV DP +VSQKADVYSFGVLLLEL+TGKAP+ A  N+EGV+LPRWVQSV 
Sbjct  540  PSRATGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVS  599

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            R EW SEVFD+EL+R++   EE M QL+ LA++C AQ P+ RPSM  +  RIE++     
Sbjct  600  RSEWGSEVFDIELMRHE-ADEELMAQLVLLALDCVAQVPEARPSMGHVVTRIEEI-----  653

Query  320  QDNNIVDNPEE  288
            + +++  N EE
Sbjct  654  RKSSVTTNMEE  664



>ref|XP_007204237.1| hypothetical protein PRUPE_ppa002548mg [Prunus persica]
 gb|EMJ05436.1| hypothetical protein PRUPE_ppa002548mg [Prunus persica]
Length=659

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L   +DA VSDFG   L G S  
Sbjct  448  DWDNRMKIALSAARGIAHLHVSGKVV-HGNIKSSNILLRPEHDASVSDFGLNPLFGTSTP  506

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  507  PNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  566

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  567  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  622



>ref|XP_004149854.1| PREDICTED: probable inactive receptor kinase At2g26730 [Cucumis 
sativus]
 gb|KGN65392.1| hypothetical protein Csa_1G407160 [Cucumis sativus]
Length=664

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L  ++DA VSDFG   L G S  
Sbjct  452  DWDNRMKIALSAARGLAHLHLSGKLV-HGNIKSSNILLRPNHDAAVSDFGLNPLFGASTP  510

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R+ GYRAPEV +  KV+ K+DVYSFGVLLLELLTGK+P  A   EEG+DLPRWVQSVV
Sbjct  511  PNRIAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVQSVV  570

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C A  PD+RPSM E+   IE+L R
Sbjct  571  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVATVPDQRPSMQEVVRMIEELNR  626



>emb|CDY41827.1| BnaA08g03220D [Brassica napus]
Length=647

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 141/179 (79%), Gaps = 1/179 (1%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT-  681
            W+ R+ IALGAARG  +LHSQG S SHGN+KSSN  LTKS+DA+VSDFG +QLV  S T 
Sbjct  461  WDVRSRIALGAARGLDYLHSQGTSTSHGNVKSSNILLTKSHDAKVSDFGLSQLVAASTTT  520

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R  GYRAPEVTDP +VSQK DVYSFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SVV
Sbjct  521  PNRGTGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVV  580

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
            R+EW  EVFD ELL  +   EE M +++QL + CT+Q+PD+RP M E+  +IE L R G
Sbjct  581  RDEWRREVFDSELLSLEREEEEMMEEMVQLGIECTSQHPDQRPEMTEVVRKIESLRRSG  639



>ref|XP_001774015.1| predicted protein [Physcomitrella patens]
 gb|EDQ61205.1| predicted protein, partial [Physcomitrella patens]
Length=591

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQS-ISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSX  684
            +W +R  IALGAARG ++LH+QG S  +H NIKSSN  L++  DA +SD+G AQL+  S 
Sbjct  419  DWLSRVKIALGAARGLAYLHAQGGSKFAHANIKSSNILLSRDLDACISDYGLAQLLNSSS  478

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
              +R+ GYRAPEVTD  KV+QK+DVYSFGVLLLELLTGKAPT A  N+EG+DLPRWVQSV
Sbjct  479  AASRIVGYRAPEVTDARKVTQKSDVYSFGVLLLELLTGKAPTQAALNDEGIDLPRWVQSV  538

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIE  342
            VREEWT+EVFDLEL+RYQN +EE+MV +LQ+A+ C    P++RP M  +   +E
Sbjct  539  VREEWTAEVFDLELMRYQN-IEEEMVSMLQIAMQCVDPVPERRPKMNNVLLLLE  591



>ref|NP_001105207.1| atypical receptor-like kinase MARK precursor [Zea mays]
 gb|AAO83390.1| atypical receptor-like kinase MARK [Zea mays]
Length=694

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+SIAL AARG  ++HS   + SHGNIKSSN  L KSY ARVS+ G   LVGPS +
Sbjct  490  NWDLRSSIALAAARGVEYIHSTTSTASHGNIKSSNVLLGKSYQARVSENGLTTLVGPSSS  549

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
             +R  GYRAPEV D  +VSQKADVYSFGVLLLEL+TGKAP+ A  N+EGVDLPRWVQSV 
Sbjct  550  SSRTTGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVDLPRWVQSVN  609

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            R EW S VFD+EL+R+Q   EE M QL+ LA++CTAQ P+ RPSMA +  RIE++ +   
Sbjct  610  RSEWGSLVFDMELMRHQ-TGEEPMAQLVLLAMDCTAQVPEARPSMAHVVMRIEEIKKSSV  668

Query  320  QDN  312
              N
Sbjct  669  TPN  671



>ref|XP_006451034.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
 ref|XP_006451035.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
 gb|ESR64274.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
 gb|ESR64275.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
Length=654

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ I HGNIK+SN  L   +DA VSDFG   L G +  
Sbjct  444  DWDNRMRIALSAARGLAHLHVSGK-IVHGNIKASNILLRPDHDACVSDFGLNPLFGNTTP  502

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  503  PTRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  562

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  563  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMGCVSTVPDQRPAMQEVVRMIEDMNR  618



>ref|XP_009107354.1| PREDICTED: probable inactive receptor kinase At1g48480 [Brassica 
rapa]
Length=666

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 141/179 (79%), Gaps = 1/179 (1%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT-  681
            W+ R+ IALGAARG  +LHSQG S SHGN+KSSN  LTKS+DA+VSDFG +QLV  S T 
Sbjct  480  WDVRSRIALGAARGLDYLHSQGTSTSHGNVKSSNILLTKSHDAKVSDFGLSQLVAASTTT  539

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P R  GYRAPEVTDP +VSQK DVYSFGV+LLEL+TGKAP++++ NEEGVDLPRWV+SVV
Sbjct  540  PNRGTGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVV  599

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
            R+EW  EVFD ELL  +   EE M +++QL + CT+Q+PD+RP M E+  +IE L R G
Sbjct  600  RDEWRREVFDSELLSLEREEEEMMEEMVQLGIECTSQHPDQRPEMTEVVRKIESLRRSG  658



>tpg|DAA50992.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=694

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            NW+ R+SIAL AARG  ++HS   + SHGNIKSSN  L KSY ARVS+ G   LVGPS +
Sbjct  490  NWDLRSSIALAAARGVEYIHSTTSTASHGNIKSSNVLLGKSYQARVSENGLTTLVGPSSS  549

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
             +R  GYRAPEV D  +VSQKADVYSFGVLLLEL+TGKAP+ A  N+EGVDLPRWVQSV 
Sbjct  550  SSRTTGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVDLPRWVQSVN  609

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            R EW S VFD+EL+R+Q   EE M QL+ LA++CTAQ P+ RPSMA +  RIE++ +   
Sbjct  610  RSEWGSLVFDMELMRHQ-TGEEPMAQLVLLAMDCTAQVPEARPSMAHVVMRIEEIKKSSV  668

Query  320  QDN  312
              N
Sbjct  669  TPN  671



>ref|XP_008343962.1| PREDICTED: probable inactive receptor kinase At2g26730 [Malus 
domestica]
Length=656

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L    DA VSDFG   L G S  
Sbjct  445  DWDNRMKIALSAARGIAHLHVSGKVV-HGNIKSSNILLRPDNDASVSDFGLNPLFGTSTP  503

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  504  PNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  563

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  564  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  619



>ref|XP_008386031.1| PREDICTED: probable inactive receptor kinase At2g26730 [Malus 
domestica]
Length=656

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L    DA VSDFG   L G S  
Sbjct  445  DWDNRMKIALSAARGIAHLHVSGKVV-HGNIKSSNILLRPDNDASVSDFGLNPLFGTSTP  503

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  504  PNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  563

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  564  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  619



>gb|ACZ98536.1| protein kinase [Malus domestica]
Length=655

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L    DA VSDFG   L G S  
Sbjct  444  DWDNRMKIALSAARGIAHLHVSGKVV-HGNIKSSNILLRPDNDASVSDFGLNPLFGTSTP  502

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  503  PNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  562

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  563  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  618



>ref|XP_002281635.1| PREDICTED: probable inactive receptor kinase At2g26730 [Vitis 
vinifera]
 emb|CBI28134.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L   +DA VSDFG   L G S  
Sbjct  443  DWDNRMRIALSAARGIAHLHVSGKVV-HGNIKSSNILLRPDHDACVSDFGLNPLFGNSTP  501

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  502  PNRVAGYRAPEVMETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  561

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  562  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  617



>ref|XP_012078693.1| PREDICTED: probable inactive receptor kinase At2g26730 [Jatropha 
curcas]
 gb|KDP32336.1| hypothetical protein JCGZ_13261 [Jatropha curcas]
Length=652

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IA+ AARG +HLH  G+ + HGNIKSSN  L   +DA VSDFG   L G +  
Sbjct  442  DWDNRMRIAMSAARGLAHLHVVGKVV-HGNIKSSNILLRPDHDASVSDFGLNPLFGTATP  500

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+RV GYRAPEV +  KV+ KADVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  501  PSRVAGYRAPEVVETRKVTFKADVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  560

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  561  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVLRMIEDINR  616



>ref|XP_006475765.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Citrus 
sinensis]
 gb|KDO80389.1| hypothetical protein CISIN_1g036334mg [Citrus sinensis]
Length=654

 Score =   226 bits (575),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 134/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ I HGNIK+SN  L   +DA VSDFG   L G +  
Sbjct  444  DWDNRMRIALSAARGLAHLHVSGK-IVHGNIKASNILLRPDHDACVSDFGLNPLFGNTTP  502

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            PTRV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  503  PTRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  562

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IE++ R
Sbjct  563  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMGCVSTVPDQRPAMQEVVRMIENMNR  618



>ref|XP_009371417.1| PREDICTED: probable inactive receptor kinase At2g26730 [Pyrus 
x bretschneideri]
Length=655

 Score =   226 bits (575),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IAL AARG +HLH  G+ + HGNIKSSN  L    DA VSDFG   L G S  
Sbjct  444  DWDNRMKIALSAARGIAHLHVSGKVV-HGNIKSSNILLRPDNDASVSDFGLNPLFGTSTP  502

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  503  PNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  562

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   +ED+ R
Sbjct  563  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMMEDMNR  618



>gb|EMT22086.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=266

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 138/180 (77%), Gaps = 2/180 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W  R+SIAL AARG  ++HS   S SHGNIKSSN  L+KSY ARVSD G A LVG S +
Sbjct  62   DWTIRSSIALAAARGIEYIHSTSSSTSHGNIKSSNILLSKSYQARVSDNGLATLVGSSSS  121

Query  680  PTRVDG-YRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
                   YRAPEVTDP +VSQKADV+SFGVLLLELLTGKAP+ A  N+EGVDLPRWVQSV
Sbjct  122  GPSRASGYRAPEVTDPRRVSQKADVFSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSV  181

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
            VR EWT+EVFD+ELLR Q+  EE M+QLLQLA++C AQ PD RP+M+ +  RIE++   G
Sbjct  182  VRSEWTAEVFDMELLRNQS-SEEQMIQLLQLAIDCVAQVPDARPTMSHVVVRIEEIKMSG  240



>ref|NP_001053007.1| Os04g0463000 [Oryza sativa Japonica Group]
 emb|CAE76007.1| B1358B12.16 [Oryza sativa Japonica Group]
 emb|CAH67634.1| B0812A04.4 [Oryza sativa Indica Group]
 dbj|BAF14921.1| Os04g0463000 [Oryza sativa Japonica Group]
 gb|EAY94430.1| hypothetical protein OsI_16200 [Oryza sativa Indica Group]
 gb|EAZ30995.1| hypothetical protein OsJ_15077 [Oryza sativa Japonica Group]
Length=669

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 140/178 (79%), Gaps = 5/178 (3%)
 Frame = -1

Query  857  WETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKS-YDARVSDFGXAQLVGPSXT  681
            WE+R  IAL +ARG  ++H+ G  + HGNIKSSN  L++S  DARV+D G A LVGP+  
Sbjct  462  WESRRRIALASARGLEYIHATGSKVVHGNIKSSNVLLSRSSVDARVADHGLAHLVGPAGA  521

Query  680  PT-RVDGYRAPEVT-DPXKVSQKADVYSFGVLLLELLTGKAPTHA-LSNEEGVDLPRWVQ  510
            P+ RV GYRAPEV  DP ++SQKADVYSFGVLLLELLTGKAPTHA L ++EGVDLPRW +
Sbjct  522  PSSRVAGYRAPEVVADPWRLSQKADVYSFGVLLLELLTGKAPTHAVLHDDEGVDLPRWAR  581

Query  509  SVVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            SVVREEWTSEVFD ELLR+    E++MV++L+LA++CT   PD+RP+M EI  RIE L
Sbjct  582  SVVREEWTSEVFDTELLRHPG-AEDEMVEMLRLAMDCTVTVPDQRPAMPEIVVRIEQL  638



>tpg|DAA37428.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=677

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 139/178 (78%), Gaps = 4/178 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPS--  687
            +WE+R  IAL +ARG  ++H+ G  ++HGNIKSSN  L+++ DARV+D G A LV P+  
Sbjct  465  SWESRRRIALASARGLEYIHATGSMVTHGNIKSSNILLSRTVDARVADHGLAHLVNPAGA  524

Query  686  XTPTRVDGYRAPEV-TDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQ  510
             T TRV GYRAPEV  DP + SQKAD YSFGVLLLELLTGKAP HA+ ++EGVDLPRW +
Sbjct  525  ATTTRVAGYRAPEVVADPRRASQKADAYSFGVLLLELLTGKAPAHAVLHDEGVDLPRWAR  584

Query  509  SVVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            SVV+EEWTSEVFD ELLR+    E++MV++L+LA++CT   PD+RP+M EI ARIE L
Sbjct  585  SVVKEEWTSEVFDTELLRHPG-AEDEMVEMLRLAMDCTEPAPDQRPAMPEIVARIEGL  641



>ref|XP_010098956.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB76258.1| putative inactive receptor kinase [Morus notabilis]
Length=659

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W++R  IA+GAARG +HLH   + I HGNIKSSN  L   +DA VSDFG   L G S  
Sbjct  449  DWDSRMRIAIGAARGLTHLHVS-EKIVHGNIKSSNILLRPDHDACVSDFGLHSLFGSSTP  507

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P RV GYRAPEV +  K + K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  508  PNRVAGYRAPEVFETRKFTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  567

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A++C +  PD+RP M E+   IED+ R
Sbjct  568  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMSCVSTVPDQRPGMQEVLRMIEDMNR  623



>ref|XP_008669312.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X2 
[Zea mays]
Length=744

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 139/178 (78%), Gaps = 4/178 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPS--  687
            +WE+R  IAL +ARG  ++H+ G  ++HGNIKSSN  L+++ DARV+D G A LV P+  
Sbjct  532  SWESRRRIALASARGLEYIHATGSMVTHGNIKSSNILLSRTVDARVADHGLAHLVNPAGA  591

Query  686  XTPTRVDGYRAPEV-TDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQ  510
             T TRV GYRAPEV  DP + SQKAD YSFGVLLLELLTGKAP HA+ ++EGVDLPRW +
Sbjct  592  ATTTRVAGYRAPEVVADPRRASQKADAYSFGVLLLELLTGKAPAHAVLHDEGVDLPRWAR  651

Query  509  SVVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            SVV+EEWTSEVFD ELLR+    E++MV++L+LA++CT   PD+RP+M EI ARIE L
Sbjct  652  SVVKEEWTSEVFDTELLRHPG-AEDEMVEMLRLAMDCTEPAPDQRPAMPEIVARIEGL  708



>gb|KHN00038.1| Putative inactive receptor kinase [Glycine soja]
Length=233

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 135/185 (73%), Gaps = 2/185 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+TR  IALGAARG + LH  G+ + HGNIKSSN  L  +++A VSDFG   +      
Sbjct  22   DWDTRMKIALGAARGLACLHVSGKLV-HGNIKSSNILLHPTHEACVSDFGLNPIFANPVP  80

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
              RV GYRAPEV +  K++ K+DVYSFGVL+LELLTGKAP  A  +EEG+DLPRWVQSVV
Sbjct  81   SNRVAGYRAPEVQETKKITFKSDVYSFGVLMLELLTGKAPNQASLSEEGIDLPRWVQSVV  140

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPGF  321
            REEWT+EVFD EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   I+D+ R   
Sbjct  141  REEWTAEVFDAELMRYHN-IEEEMVQLLQIAMTCVSLVPDQRPNMDEVVHMIQDISRSET  199

Query  320  QDNNI  306
             D+ +
Sbjct  200  TDDGL  204



>ref|XP_008669311.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X1 
[Zea mays]
Length=775

 Score =   226 bits (575),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 139/178 (78%), Gaps = 4/178 (2%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPS--  687
            +WE+R  IAL +ARG  ++H+ G  ++HGNIKSSN  L+++ DARV+D G A LV P+  
Sbjct  563  SWESRRRIALASARGLEYIHATGSMVTHGNIKSSNILLSRTVDARVADHGLAHLVNPAGA  622

Query  686  XTPTRVDGYRAPEV-TDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQ  510
             T TRV GYRAPEV  DP + SQKAD YSFGVLLLELLTGKAP HA+ ++EGVDLPRW +
Sbjct  623  ATTTRVAGYRAPEVVADPRRASQKADAYSFGVLLLELLTGKAPAHAVLHDEGVDLPRWAR  682

Query  509  SVVREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            SVV+EEWTSEVFD ELLR+    E++MV++L+LA++CT   PD+RP+M EI ARIE L
Sbjct  683  SVVKEEWTSEVFDTELLRHPG-AEDEMVEMLRLAMDCTEPAPDQRPAMPEIVARIEGL  739



>ref|XP_011009200.1| PREDICTED: probable inactive receptor kinase At2g26730 [Populus 
euphratica]
Length=653

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IA+  ARG +HLH  G+ I HGNIKSSN  L   +DA VSD+G   L G S  
Sbjct  443  DWDNRMRIAMSTARGLAHLHIAGKVI-HGNIKSSNILLRPEHDACVSDYGLNPLFGTSTP  501

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  502  PSRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  561

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  562  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMEEVVRMIEDMNR  617



>ref|XP_002324958.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF03523.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=621

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IA+  ARG +HLH  G+ I HGNIKSSN  L    DA VSD+G   L G S  
Sbjct  411  DWDNRMRIAMSTARGLAHLHIAGKVI-HGNIKSSNILLRPDNDACVSDYGLNPLFGTSTP  469

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  470  PSRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  529

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  530  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  585



>ref|XP_010487681.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X1 
[Camelina sativa]
 ref|XP_010487682.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X2 
[Camelina sativa]
Length=647

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVG-PSX  684
            NW+ R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLV   S 
Sbjct  464  NWQIRSRIALGAARGLDYLHSQDPLSSHGNVKSSNILLTSSHDARVSDFGLAQLVSTSST  523

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP R  GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ N+EG+DL RWV SV
Sbjct  524  TPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNDEGMDLARWVHSV  583

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
             REEW +EVFD EL+  + V EE     LQL ++CT Q+PDKRP M E+  RI++L + G
Sbjct  584  AREEWRNEVFDSELMSIEMVEEEMAEM-LQLGIDCTEQHPDKRPVMVEVVRRIQELRQSG  642



>ref|XP_001778286.1| predicted protein [Physcomitrella patens]
 gb|EDQ56953.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 136/176 (77%), Gaps = 2/176 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQS-ISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSX  684
            +W TR  IALGAARG ++LH+QG S   HGNIKSSN  L +  +A +SDFG AQL+  + 
Sbjct  429  DWVTRVRIALGAARGLAYLHAQGGSRFVHGNIKSSNILLNRDLEACISDFGLAQLLSSTS  488

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
              +R+ GYRAPE+++  KV+Q++DVYSFGVLLLELLTGKAP     NEEG+DLP WVQSV
Sbjct  489  ASSRIIGYRAPEISETRKVTQQSDVYSFGVLLLELLTGKAPAQVSMNEEGIDLPGWVQSV  548

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
            VREEWT+EVFDLEL+RYQN +EE+MV +LQ+A+ C    PD+RP MA++   +ED+
Sbjct  549  VREEWTAEVFDLELMRYQN-IEEEMVGMLQIAMQCVDAVPDRRPKMADVHLLLEDV  603



>ref|XP_007013302.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY30921.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=650

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W++R  IAL AARG +HLH  G+ + HGNIKSSN  L   ++A +SDFG   L G +  
Sbjct  440  DWDSRMRIALSAARGLTHLHVSGKVV-HGNIKSSNILLRPDHEACISDFGLNPLFGNTTP  498

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  499  PSRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  558

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY + +EE+MVQLLQ+A+ C +  PD+RP+M ++   IED+ R
Sbjct  559  REEWTAEVFDVELMRYHS-IEEEMVQLLQIAMTCVSTVPDQRPAMEDVVRMIEDMNR  614



>ref|XP_002529343.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33010.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=657

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+ R  IA+ AARG +HLH  G+ + HGNIKSSN  L    DA +SDF    L G +  
Sbjct  447  DWDNRMRIAMSAARGLAHLHVVGKVV-HGNIKSSNILLRPDQDAAISDFALNPLFGTATP  505

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+RV GYRAPEV +  KV+ K+DVYSFGVLLLELLTGKAP  A   EEG+DLPRWVQSVV
Sbjct  506  PSRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVV  565

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCR  330
            REEWT+EVFD+EL+RY N +EE+MVQLLQ+A+ C +  PD+RP+M E+   IED+ R
Sbjct  566  REEWTAEVFDVELMRYHN-IEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDINR  621



>ref|XP_010505998.1| PREDICTED: probable inactive receptor kinase RLK902 [Camelina 
sativa]
Length=643

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 142/180 (79%), Gaps = 6/180 (3%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLV-GPSX  684
            NWE R+ IALGAARG  +LHSQ    SHGN+KSSN  LT S+DARVSDFG AQLV   S 
Sbjct  464  NWEIRSRIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASST  523

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP RV GYRAPEVTDP +VSQKADVYSFGV+LLELLTGKAP++++ NEEG+DL RWV SV
Sbjct  524  TPNRVTGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSV  583

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDLCRPG  324
             REEW +EVFD      + +VEE+MV++LQL ++CT Q+PDKRP M E+ +RI++L + G
Sbjct  584  AREEWRNEVFD-----SELMVEEEMVEMLQLGIDCTEQHPDKRPVMVEVVSRIQELRQSG  638



>gb|KHN24722.1| Putative inactive receptor kinase, partial [Glycine soja]
Length=327

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 138/195 (71%), Gaps = 8/195 (4%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHS-QGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSX  684
            +W++R  I+LG A+G +H+HS  G   +HGNIKSSN  L +  D  +SDFG A L+    
Sbjct  129  DWDSRIKISLGTAKGLAHIHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPA  188

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP+R  GYRAPEV +  K S K+DVYSFGVLLLE+LTGKAP  +   ++ VDLPRWVQSV
Sbjct  189  TPSRAAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSV  248

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL----  336
            VREEWT+EVFD+EL+RYQN +EE+MVQ+LQ+A+ C A+ PD RPSM E    IE++    
Sbjct  249  VREEWTAEVFDVELMRYQN-IEEEMVQMLQIAMACVAKMPDMRPSMDEAVRMIEEIRQSD  307

Query  335  --CRPGFQDNNIVDN  297
               RP  ++N   D+
Sbjct  308  SENRPSSEENKSKDS  322



>gb|KHN30614.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 135/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHS-QGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSX  684
            +W +R  I++G ARG +H+HS  G   +HGN+KSSN  L +  D  +SDFG   L+    
Sbjct  54   DWNSRIKISVGIARGIAHIHSVGGPKFAHGNVKSSNVLLNQDNDGCISDFGLTPLMNVPS  113

Query  683  TPTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSV  504
            TP+R  GYRAPEV +  K + K+DVYSFGVLLLE+LTGKAP  +   ++ VDLPRWVQSV
Sbjct  114  TPSRAAGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSV  173

Query  503  VREEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL----  336
            VREEWT+EVFD+EL+RYQN +EE+MVQ+LQ+A+ C A+ PD RPSM E+   IE++    
Sbjct  174  VREEWTAEVFDVELMRYQN-IEEEMVQMLQIAMACVAKVPDMRPSMEEVVRMIEEIRLSD  232

Query  335  --CRPGFQDN  312
               RP  ++N
Sbjct  233  SENRPSSEEN  242



>gb|KCW69386.1| hypothetical protein EUGRSUZ_F02867 [Eucalyptus grandis]
Length=593

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -1

Query  860  NWETRTSIALGAARGXSHLHSQGQSISHGNIKSSNXXLTKSYDARVSDFGXAQLVGPSXT  681
            +W+TR  IAL  A+  +H+HS G   SHGNIKSS   LTK Y+  +SD+G A+L GP+ +
Sbjct  410  SWDTRCRIALRTAQAVAHIHSWGPGASHGNIKSSTVLLTKLYEPCLSDYGLARLAGPAVS  469

Query  680  PTRVDGYRAPEVTDPXKVSQKADVYSFGVLLLELLTGKAPTHALSNEEGVDLPRWVQSVV  501
            P+R  GYRAPEV D   VSQ+ADVYSFGVL+LEL+TGKAP  +L  E+GVDLPRWV+  V
Sbjct  470  PSRFHGYRAPEVIDIRIVSQEADVYSFGVLILELVTGKAPLMSLLAEDGVDLPRWVRGAV  529

Query  500  REEWTSEVFDLELLRYQNVVEEDMVQLLQLAVNCTAQYPDKRPSMAEITARIEDL  336
             ++ T+EVFD ELLRYQN VEEDM+Q+LQ+ ++CT Q PD+RPSMA++T R+E  
Sbjct  530  EQDPTAEVFDAELLRYQN-VEEDMIQMLQIGIDCTEQSPDQRPSMAQLTKRMESF  583



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1894952386554