BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1173

Length=813
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_012087681.1|  PREDICTED: uncharacterized protein LOC105646438    134   3e-33   Jatropha curcas
ref|XP_012075485.1|  PREDICTED: uncharacterized protein LOC105636752    134   3e-31   Jatropha curcas
ref|XP_006470496.1|  PREDICTED: uncharacterized protein LOC102617255    130   5e-31   
ref|XP_006476142.1|  PREDICTED: uncharacterized protein LOC102616098    129   9e-31   
ref|XP_006467327.1|  PREDICTED: uncharacterized protein LOC102625297    126   6e-30   
ref|XP_003598202.1|  60S ribosomal protein L23                          122   5e-28   
ref|XP_006480463.1|  PREDICTED: putative ribonuclease H protein A...    117   2e-26   
ref|XP_007206484.1|  hypothetical protein PRUPE_ppa019056mg             114   3e-26   
ref|XP_012089886.1|  PREDICTED: uncharacterized protein LOC105648185    112   9e-26   Jatropha curcas
ref|XP_012080090.1|  PREDICTED: uncharacterized protein LOC105640399    114   9e-26   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050    115   3e-25   Nicotiana sylvestris
ref|XP_012072680.1|  PREDICTED: uncharacterized protein LOC105634429    110   4e-25   Jatropha curcas
ref|XP_012085858.1|  PREDICTED: uncharacterized protein LOC105644961    111   5e-25   Jatropha curcas
ref|XP_012082585.1|  PREDICTED: uncharacterized protein LOC105642374    111   8e-25   Jatropha curcas
ref|XP_012065725.1|  PREDICTED: uncharacterized protein LOC105628858    111   3e-24   Jatropha curcas
ref|XP_012075779.1|  PREDICTED: uncharacterized protein LOC105636986    109   3e-24   Jatropha curcas
ref|XP_012074682.1|  PREDICTED: uncharacterized protein LOC105636117    109   5e-24   Jatropha curcas
ref|XP_006489961.1|  PREDICTED: uncharacterized protein LOC102608276    106   6e-24   Citrus sinensis [apfelsine]
ref|XP_011470556.1|  PREDICTED: uncharacterized protein LOC105353255    107   9e-23   Fragaria vesca subsp. vesca
ref|XP_010690674.1|  PREDICTED: uncharacterized protein LOC104904177    104   1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009623190.1|  PREDICTED: uncharacterized protein LOC104114439    105   1e-22   Nicotiana tomentosiformis
ref|XP_002531759.1|  conserved hypothetical protein                     100   3e-22   Ricinus communis
ref|XP_012074502.1|  PREDICTED: uncharacterized protein LOC105635962    103   3e-22   Jatropha curcas
ref|XP_008226303.1|  PREDICTED: uncharacterized protein LOC103325890    102   4e-22   
ref|XP_003629388.1|  Cytochrome P450                                    106   4e-22   
ref|XP_012081735.1|  PREDICTED: uncharacterized protein LOC105641750    100   1e-21   Jatropha curcas
ref|XP_012081306.1|  PREDICTED: uncharacterized protein LOC105641393    100   2e-21   Jatropha curcas
ref|XP_012066146.1|  PREDICTED: uncharacterized protein LOC105629211    102   2e-21   Jatropha curcas
ref|XP_012085065.1|  PREDICTED: uncharacterized protein LOC105644336    100   3e-21   Jatropha curcas
ref|XP_012089684.1|  PREDICTED: uncharacterized protein LOC105648037    103   8e-21   Jatropha curcas
ref|XP_012070547.1|  PREDICTED: uncharacterized protein LOC105632718    102   2e-20   Jatropha curcas
ref|XP_010686140.1|  PREDICTED: uncharacterized protein LOC104900422  98.6    2e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008227720.1|  PREDICTED: putative ribonuclease H protein A...  98.2    3e-20   
ref|XP_012089435.1|  PREDICTED: uncharacterized protein LOC105647818  97.1    4e-20   Jatropha curcas
ref|XP_012075337.1|  PREDICTED: uncharacterized protein LOC105636626  99.8    1e-19   Jatropha curcas
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg           99.0    2e-19   
ref|XP_009368150.1|  PREDICTED: uncharacterized protein LOC103957683  94.7    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_010682311.1|  PREDICTED: uncharacterized protein LOC104897185  95.5    2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008352730.1|  PREDICTED: putative ribonuclease H protein A...  95.5    2e-19   
ref|XP_010689379.1|  PREDICTED: uncharacterized protein LOC104903088  94.7    2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002518871.1|  conserved hypothetical protein                   97.8    3e-19   
ref|XP_012083753.1|  PREDICTED: uncharacterized protein LOC105643257  94.7    3e-19   
ref|XP_012086245.1|  PREDICTED: putative cysteine-rich receptor-l...  97.8    4e-19   
ref|XP_009123737.1|  PREDICTED: uncharacterized protein LOC103848614  94.0    4e-19   Brassica rapa
ref|XP_012085836.1|  PREDICTED: uncharacterized protein LOC105644933  95.5    4e-19   Jatropha curcas
ref|XP_010696211.1|  PREDICTED: uncharacterized protein LOC104908759  93.6    1e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|ABD28710.1|  Polynucleotidyl transferase, Ribonuclease H fold      93.6    2e-18   Medicago truncatula
ref|XP_008229913.1|  PREDICTED: uncharacterized protein LOC103329248  93.6    2e-18   
ref|XP_012089683.1|  PREDICTED: uncharacterized protein LOC105648036  90.9    2e-18   Jatropha curcas
gb|ABN09176.1|  Polynucleotidyl transferase, Ribonuclease H fold      91.7    3e-18   Medicago truncatula
ref|XP_003598902.1|  hypothetical protein MTR_3g023170                90.9    6e-18   
ref|XP_002532007.1|  conserved hypothetical protein                   90.5    7e-18   
ref|XP_010670097.1|  PREDICTED: uncharacterized protein LOC104887199  89.0    8e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003612608.1|  Replication protein A 70 kDa DNA-binding sub...  94.0    1e-17   
ref|XP_010687523.1|  PREDICTED: uncharacterized protein LOC104901631  90.1    1e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|AAP44645.1|  putative reverse transcriptase                        90.9    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006471930.1|  PREDICTED: uncharacterized protein LOC102617744  89.4    2e-17   Citrus sinensis [apfelsine]
ref|XP_008346598.1|  PREDICTED: uncharacterized protein LOC103409561  88.2    2e-17   
ref|XP_010684219.1|  PREDICTED: putative ribonuclease H protein A...  89.0    4e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|AAP54617.2|  retrotransposon protein, putative, unclassified       91.7    5e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003605496.1|  hypothetical protein MTR_4g032310                88.2    5e-17   
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...  91.7    5e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CDP14369.1|  unnamed protein product                              88.6    5e-17   Coffea canephora [robusta coffee]
ref|XP_009122880.1|  PREDICTED: uncharacterized protein LOC103847539  87.0    8e-17   Brassica rapa
ref|XP_012092464.1|  PREDICTED: uncharacterized protein LOC105650199  86.3    1e-16   Jatropha curcas
gb|AAU89136.1|  F-box domain containing protein                       90.1    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75888.1|  hypothetical protein OsI_12930                        89.7    1e-16   Oryza sativa Indica Group [Indian rice]
gb|EEE59647.1|  hypothetical protein OsJ_12023                        89.7    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002531249.1|  hypothetical protein RCOM_0494170                85.9    4e-16   
ref|XP_008376986.1|  PREDICTED: putative ribonuclease H protein A...  85.9    5e-16   
ref|XP_012069272.1|  PREDICTED: uncharacterized protein LOC105631710  88.2    5e-16   Jatropha curcas
ref|XP_008228453.1|  PREDICTED: putative ribonuclease H protein A...  87.8    5e-16   
ref|XP_010688579.1|  PREDICTED: uncharacterized protein LOC104902491  88.2    6e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006480206.1|  PREDICTED: uncharacterized protein LOC102628543  82.8    7e-16   Citrus sinensis [apfelsine]
ref|XP_011468628.1|  PREDICTED: uncharacterized protein LOC105352716  84.0    1e-15   Fragaria vesca subsp. vesca
ref|XP_012089877.1|  PREDICTED: uncharacterized protein LOC105648176  82.8    1e-15   Jatropha curcas
ref|XP_002522452.1|  nucleic acid binding protein, putative           86.3    1e-15   
emb|CCA66036.1|  hypothetical protein                                 87.4    1e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS69206.1|  hypothetical protein M569_05560                       85.9    1e-15   Genlisea aurea
ref|XP_012082598.1|  PREDICTED: uncharacterized protein LOC105642390  82.4    2e-15   Jatropha curcas
ref|XP_006483194.1|  PREDICTED: putative ribonuclease H protein A...  86.3    2e-15   
ref|XP_012084642.1|  PREDICTED: uncharacterized protein LOC105644005  82.8    2e-15   Jatropha curcas
ref|XP_012067550.1|  PREDICTED: uncharacterized protein LOC105630354  86.3    2e-15   Jatropha curcas
ref|XP_006487438.1|  PREDICTED: putative ribonuclease H protein A...  83.6    2e-15   
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg           86.3    3e-15   
ref|XP_012079594.1|  PREDICTED: uncharacterized protein LOC105640000  85.9    4e-15   Jatropha curcas
ref|XP_010675644.1|  PREDICTED: uncharacterized protein LOC104891627  82.4    4e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC72753.1|  hypothetical protein OsI_06384                        84.7    5e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_008383144.1|  PREDICTED: uncharacterized protein LOC103445866  82.0    5e-15   
ref|XP_004305978.1|  PREDICTED: uncharacterized protein LOC101292333  81.3    8e-15   Fragaria vesca subsp. vesca
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  85.1    8e-15   
ref|XP_009130307.1|  PREDICTED: putative ribonuclease H protein A...  84.0    8e-15   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455  84.7    9e-15   Citrus sinensis [apfelsine]
gb|ABN06159.1|  Polynucleotidyl transferase, Ribonuclease H fold      81.3    1e-14   Medicago truncatula
ref|XP_002525921.1|  conserved hypothetical protein                   79.7    1e-14   
ref|XP_008337941.1|  PREDICTED: uncharacterized protein LOC103401016  80.9    2e-14   
ref|XP_002529689.1|  conserved hypothetical protein                   77.4    2e-14   
ref|XP_010241360.1|  PREDICTED: uncharacterized protein LOC104585986  80.1    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002447811.1|  hypothetical protein SORBIDRAFT_06g016240        80.9    3e-14   
ref|XP_009137723.1|  PREDICTED: uncharacterized protein LOC103861768  79.7    3e-14   Brassica rapa
ref|XP_002465515.1|  hypothetical protein SORBIDRAFT_01g040340        82.4    3e-14   
ref|XP_010666374.1|  PREDICTED: uncharacterized protein LOC104883530  79.7    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg           82.4    4e-14   
ref|NP_001047170.1|  Os02g0566300                                     79.3    5e-14   
ref|XP_008358038.1|  PREDICTED: uncharacterized protein LOC103421772  78.6    6e-14   
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg           81.6    8e-14   
ref|XP_010673863.1|  PREDICTED: uncharacterized protein LOC104890171  77.8    8e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004292499.1|  PREDICTED: uncharacterized protein LOC101304542  77.8    8e-14   Fragaria vesca subsp. vesca
ref|XP_012081305.1|  PREDICTED: uncharacterized protein LOC105641392  78.2    8e-14   Jatropha curcas
ref|XP_009148205.1|  PREDICTED: putative ribonuclease H protein A...  80.9    9e-14   
ref|XP_012065949.1|  PREDICTED: uncharacterized protein LOC105629045  79.3    1e-13   Jatropha curcas
ref|NP_187562.1|  RNase H domain-containing protein                   80.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115865.1|  PREDICTED: putative ribonuclease H protein A...  80.5    1e-13   
ref|XP_010236322.1|  PREDICTED: uncharacterized protein LOC104583970  78.2    1e-13   Brachypodium distachyon [annual false brome]
ref|XP_012065097.1|  PREDICTED: uncharacterized protein LOC105628309  77.0    2e-13   Jatropha curcas
ref|XP_012072005.1|  PREDICTED: uncharacterized protein LOC105633915  76.3    2e-13   
ref|XP_008352570.1|  PREDICTED: uncharacterized protein LOC103416078  77.0    2e-13   
ref|XP_007214838.1|  hypothetical protein PRUPE_ppa018217mg           78.2    2e-13   
ref|XP_009139324.1|  PREDICTED: uncharacterized protein LOC103863319  78.6    2e-13   Brassica rapa
ref|XP_012069339.1|  PREDICTED: uncharacterized protein LOC105631774  79.7    2e-13   Jatropha curcas
ref|XP_009105592.1|  PREDICTED: uncharacterized protein LOC103831463  79.0    3e-13   
ref|XP_009123637.1|  PREDICTED: putative ribonuclease H protein A...  77.4    3e-13   
ref|XP_009378152.1|  PREDICTED: uncharacterized protein LOC103966680  76.3    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_009123828.1|  PREDICTED: uncharacterized protein LOC103848744  78.6    4e-13   Brassica rapa
gb|AFK38936.1|  unknown                                               77.0    4e-13   Medicago truncatula
ref|XP_003594556.1|  hypothetical protein MTR_2g030550                74.7    4e-13   
ref|XP_003588770.1|  hypothetical protein MTR_1g012560                75.9    5e-13   
ref|XP_002512628.1|  conserved hypothetical protein                   75.9    5e-13   
ref|XP_012083900.1|  PREDICTED: uncharacterized protein LOC105643399  79.0    5e-13   Jatropha curcas
ref|XP_009121392.1|  PREDICTED: uncharacterized protein LOC103846249  76.3    5e-13   Brassica rapa
ref|XP_006493122.1|  PREDICTED: putative ribonuclease H protein A...  78.6    5e-13   
ref|XP_009140658.1|  PREDICTED: uncharacterized protein LOC103864645  75.5    5e-13   Brassica rapa
ref|XP_012065988.1|  PREDICTED: uncharacterized protein LOC105629078  78.6    6e-13   Jatropha curcas
ref|XP_010682926.1|  PREDICTED: uncharacterized protein LOC104897688  76.3    6e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696574.1|  PREDICTED: uncharacterized protein LOC104909083  74.7    6e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010462877.1|  PREDICTED: uncharacterized protein LOC104743503  76.6    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006483704.1|  PREDICTED: uncharacterized protein LOC102620092  77.0    6e-13   
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...  78.6    6e-13   
ref|XP_008340805.1|  PREDICTED: uncharacterized protein LOC103403753  77.8    6e-13   
ref|XP_012066908.1|  PREDICTED: uncharacterized protein LOC105629874  77.0    7e-13   
ref|XP_009124894.1|  PREDICTED: putative ribonuclease H protein A...  77.8    8e-13   
ref|XP_012076717.1|  PREDICTED: uncharacterized protein LOC105637737  78.2    8e-13   Jatropha curcas
gb|EEE56566.1|  hypothetical protein OsJ_05904                        77.4    8e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002525294.1|  hypothetical protein RCOM_0581330                74.7    9e-13   Ricinus communis
ref|XP_009102167.1|  PREDICTED: uncharacterized protein LOC103828310  77.4    9e-13   Brassica rapa
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385  78.2    9e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006464882.1|  PREDICTED: putative ribonuclease H protein A...  77.8    9e-13   
ref|XP_010686173.1|  PREDICTED: uncharacterized protein LOC104900455  74.7    1e-12   
ref|XP_008372934.1|  PREDICTED: putative ribonuclease H protein A...  78.2    1e-12   
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase   78.2    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109961.1|  PREDICTED: uncharacterized protein LOC103835530  77.0    1e-12   Brassica rapa
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg           77.8    1e-12   
ref|XP_009145301.1|  PREDICTED: uncharacterized protein LOC103869012  76.6    1e-12   
gb|ABN08583.1|  Polynucleotidyl transferase, Ribonuclease H fold      74.3    1e-12   Medicago truncatula
ref|XP_009147334.1|  PREDICTED: uncharacterized protein LOC103870904  73.9    2e-12   Brassica rapa
ref|XP_010683805.1|  PREDICTED: uncharacterized protein LOC104898417  75.1    2e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN00089.1|  hypothetical protein glysoja_046125                   72.8    2e-12   Glycine soja [wild soybean]
ref|XP_010419203.1|  PREDICTED: uncharacterized protein LOC104704888  77.0    2e-12   
ref|XP_009102722.1|  PREDICTED: uncharacterized protein LOC103828828  76.3    2e-12   Brassica rapa
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase   77.4    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139688.1|  PREDICTED: uncharacterized protein LOC103863688  76.3    2e-12   Brassica rapa
ref|XP_003599995.1|  hypothetical protein MTR_3g050230                74.3    2e-12   
ref|XP_003607468.1|  hypothetical protein MTR_4g078340                73.2    2e-12   
emb|CDY12378.1|  BnaC08g08270D                                        76.6    3e-12   Brassica napus [oilseed rape]
ref|XP_009113626.1|  PREDICTED: uncharacterized protein LOC103838926  74.3    3e-12   
ref|XP_009107615.1|  PREDICTED: putative ribonuclease H protein A...  76.3    3e-12   
ref|XP_003589347.1|  Eukaryotic translation initiation factor 3 s...  76.6    3e-12   
ref|XP_006596580.1|  PREDICTED: uncharacterized protein LOC102666294  73.6    3e-12   Glycine max [soybeans]
ref|XP_010680467.1|  PREDICTED: uncharacterized protein LOC104895604  75.1    3e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006603254.1|  PREDICTED: uncharacterized protein LOC102660201  73.2    3e-12   Glycine max [soybeans]
ref|XP_007206269.1|  hypothetical protein PRUPE_ppa016210mg           72.8    3e-12   
ref|XP_006473914.1|  PREDICTED: uncharacterized protein LOC102629934  74.7    3e-12   
emb|CDY45862.1|  BnaC02g22580D                                        75.5    3e-12   Brassica napus [oilseed rape]
emb|CAN76892.1|  hypothetical protein VITISV_005356                   76.6    4e-12   Vitis vinifera
ref|XP_008231575.1|  PREDICTED: uncharacterized protein LOC103330748  74.3    4e-12   
ref|XP_009148188.1|  PREDICTED: uncharacterized protein LOC103871664  75.9    4e-12   Brassica rapa
ref|NP_194638.1|  ribonuclease H-like protein                         75.5    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006494016.1|  PREDICTED: uncharacterized protein LOC102608298  76.3    5e-12   
gb|EPS63384.1|  hypothetical protein M569_11402                       73.2    5e-12   Genlisea aurea
ref|XP_002446679.1|  hypothetical protein SORBIDRAFT_06g020406        75.1    5e-12   
ref|XP_009126346.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.9    5e-12   
ref|XP_011459685.1|  PREDICTED: uncharacterized protein LOC105350038  73.2    6e-12   Fragaria vesca subsp. vesca
ref|XP_009121339.1|  PREDICTED: uncharacterized protein LOC103846186  72.4    6e-12   Brassica rapa
ref|XP_002517933.1|  conserved hypothetical protein                   73.6    6e-12   
ref|XP_009146764.1|  PREDICTED: uncharacterized protein LOC103870391  75.5    6e-12   Brassica rapa
ref|XP_009102110.1|  PREDICTED: putative ribonuclease H protein A...  75.5    6e-12   
ref|XP_010688587.1|  PREDICTED: uncharacterized protein LOC104902499  74.7    7e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS59181.1|  hypothetical protein M569_15629                       74.3    7e-12   Genlisea aurea
ref|XP_006450894.1|  hypothetical protein CICLE_v10010478mg           72.8    7e-12   
ref|XP_002466618.1|  hypothetical protein SORBIDRAFT_01g011130        74.7    7e-12   
ref|XP_004306193.1|  PREDICTED: uncharacterized protein LOC101291367  72.4    8e-12   Fragaria vesca subsp. vesca
ref|XP_012071990.1|  PREDICTED: uncharacterized protein LOC105633896  70.5    8e-12   Jatropha curcas
ref|XP_010696345.1|  PREDICTED: uncharacterized protein LOC104908875  75.1    8e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|ADK92871.1|  retrotransposon protein                               74.7    8e-12   Hypericum perforatum
ref|XP_009121338.1|  PREDICTED: uncharacterized protein LOC103846184  75.1    9e-12   
ref|XP_010318134.1|  PREDICTED: uncharacterized protein LOC101246115  71.6    9e-12   
ref|XP_006292284.1|  hypothetical protein CARUB_v10018494mg           72.8    9e-12   Capsella rubella
ref|XP_009152173.1|  PREDICTED: uncharacterized protein LOC103875407  73.6    9e-12   Brassica rapa
ref|XP_012090789.1|  PREDICTED: uncharacterized protein LOC105648899  74.3    1e-11   Jatropha curcas
ref|XP_009140657.1|  PREDICTED: uncharacterized protein LOC103864646  72.4    1e-11   Brassica rapa
ref|XP_011463604.1|  PREDICTED: uncharacterized protein LOC105351321  72.0    1e-11   Fragaria vesca subsp. vesca
ref|XP_011468594.1|  PREDICTED: uncharacterized protein LOC101299608  73.2    1e-11   Fragaria vesca subsp. vesca
ref|XP_009118883.1|  PREDICTED: uncharacterized protein LOC103843855  74.7    1e-11   
ref|XP_010693629.1|  PREDICTED: uncharacterized protein LOC104906557  73.2    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009113456.1|  PREDICTED: uncharacterized protein LOC103838755  74.3    2e-11   
gb|EPS73861.1|  hypothetical protein M569_00896                       74.3    2e-11   Genlisea aurea
ref|XP_009130450.1|  PREDICTED: putative ribonuclease H protein A...  73.9    2e-11   
ref|XP_010681661.1|  PREDICTED: uncharacterized protein LOC104896591  70.9    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002527468.1|  conserved hypothetical protein                   70.1    2e-11   
ref|XP_009103761.1|  PREDICTED: putative ribonuclease H protein A...  73.6    2e-11   
gb|EEC72520.1|  hypothetical protein OsI_05906                        70.1    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_003636511.1|  hypothetical protein MTR_043s0014                69.3    2e-11   
ref|NP_180979.1|  polynucleotidyl transferase, ribonuclease H-lik...  72.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KJB23230.1|  hypothetical protein B456_004G088300                  71.6    3e-11   Gossypium raimondii
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...  73.6    3e-11   
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...  73.6    3e-11   
ref|XP_006492749.1|  PREDICTED: uncharacterized protein LOC102612946  73.2    3e-11   
gb|ABK28206.1|  unknown                                               72.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003593283.1|  hypothetical protein MTR_2g009730                71.6    3e-11   
ref|XP_009103764.1|  PREDICTED: uncharacterized protein LOC103829819  72.4    3e-11   Brassica rapa
ref|XP_011459636.1|  PREDICTED: uncharacterized protein LOC105350012  73.6    3e-11   Fragaria vesca subsp. vesca
ref|XP_012080215.1|  PREDICTED: uncharacterized protein LOC105640496  69.3    3e-11   Jatropha curcas
gb|ABN07957.1|  Polynucleotidyl transferase, Ribonuclease H fold      72.4    3e-11   Medicago truncatula
ref|XP_012065107.1|  PREDICTED: uncharacterized protein LOC105628319  69.7    3e-11   Jatropha curcas
ref|XP_010665605.1|  PREDICTED: uncharacterized protein LOC104882889  70.5    3e-11   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY56143.1|  BnaC06g41320D                                        72.4    4e-11   Brassica napus [oilseed rape]
ref|XP_008240489.1|  PREDICTED: uncharacterized protein LOC103338989  70.9    4e-11   
emb|CDP16895.1|  unnamed protein product                              70.1    4e-11   Coffea canephora [robusta coffee]
ref|XP_010679712.1|  PREDICTED: uncharacterized protein LOC104895014  69.7    4e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004298184.1|  PREDICTED: uncharacterized protein LOC101290856  70.5    5e-11   Fragaria vesca subsp. vesca
ref|XP_009378422.1|  PREDICTED: uncharacterized protein LOC103966921  72.0    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_009787297.1|  PREDICTED: uncharacterized protein LOC104235275  69.7    5e-11   Nicotiana sylvestris
gb|EEC73134.1|  hypothetical protein OsI_07152                        72.4    5e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010430818.1|  PREDICTED: uncharacterized protein LOC104715064  72.0    5e-11   Camelina sativa [gold-of-pleasure]
emb|CDX98755.1|  BnaA03g45400D                                        71.6    6e-11   
ref|XP_008367209.1|  PREDICTED: uncharacterized protein LOC103430850  68.9    6e-11   
ref|XP_010456726.1|  PREDICTED: uncharacterized protein LOC104738219  71.2    6e-11   Camelina sativa [gold-of-pleasure]
gb|KHN34964.1|  hypothetical protein glysoja_004730                   68.2    7e-11   Glycine soja [wild soybean]
ref|XP_009113016.1|  PREDICTED: uncharacterized protein LOC103838337  72.4    8e-11   
ref|XP_010501661.1|  PREDICTED: uncharacterized protein LOC104778957  69.7    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010513219.1|  PREDICTED: uncharacterized protein LOC104789182  72.0    8e-11   
ref|XP_007198863.1|  hypothetical protein PRUPE_ppa018328mg           68.2    9e-11   
ref|XP_010666306.1|  PREDICTED: uncharacterized protein LOC104883473  72.0    9e-11   
ref|XP_010495244.1|  PREDICTED: uncharacterized protein LOC104772312  72.0    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009138122.1|  PREDICTED: uncharacterized protein LOC103862171  69.7    1e-10   
ref|XP_010666976.1|  PREDICTED: uncharacterized protein LOC104884079  72.0    1e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012085846.1|  PREDICTED: uncharacterized protein LOC105644944  68.6    1e-10   Jatropha curcas
ref|XP_008377029.1|  PREDICTED: putative ribonuclease H protein A...  71.2    1e-10   
ref|XP_003607370.1|  LCR-like protein                                 67.8    1e-10   
gb|EAZ03196.1|  hypothetical protein OsI_25347                        71.6    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695  71.6    1e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003597249.1|  hypothetical protein MTR_2g094480                68.2    1e-10   
ref|XP_007224031.1|  hypothetical protein PRUPE_ppa015156mg           70.9    1e-10   
ref|XP_010674616.1|  PREDICTED: uncharacterized protein LOC104890737  71.2    1e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE64789.1|  hypothetical protein OsJ_19645                        68.6    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011470453.1|  PREDICTED: uncharacterized protein LOC105353203  68.6    2e-10   Fragaria vesca subsp. vesca
ref|XP_009107610.1|  PREDICTED: putative ribonuclease H protein A...  71.2    2e-10   
ref|XP_008226959.1|  PREDICTED: putative ribonuclease H protein A...  70.5    2e-10   
ref|XP_003623176.1|  hypothetical protein MTR_7g065310                68.6    2e-10   
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574  71.2    2e-10   
ref|XP_006469773.1|  PREDICTED: uncharacterized protein LOC102616843  70.9    2e-10   
ref|XP_008386064.1|  PREDICTED: uncharacterized protein LOC103448574  67.4    2e-10   
ref|XP_009102105.1|  PREDICTED: putative ribonuclease H protein A...  70.5    2e-10   
gb|KDP36415.1|  hypothetical protein JCGZ_08684                       66.6    2e-10   Jatropha curcas
ref|XP_010507162.1|  PREDICTED: uncharacterized protein LOC104783743  70.5    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008231652.1|  PREDICTED: uncharacterized protein LOC103330817  68.2    2e-10   Prunus mume [ume]
ref|XP_003621044.1|  hypothetical protein MTR_7g006490                68.9    2e-10   
ref|XP_003599397.1|  hypothetical protein MTR_3g032730                68.6    2e-10   
gb|KJB20572.1|  hypothetical protein B456_003G154500                  68.2    2e-10   Gossypium raimondii
ref|XP_010473858.1|  PREDICTED: uncharacterized protein LOC104753282  70.1    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_012065314.1|  PREDICTED: uncharacterized protein LOC105628505  67.0    2e-10   Jatropha curcas
ref|XP_010669434.1|  PREDICTED: uncharacterized protein LOC104886665  70.9    2e-10   
ref|XP_009141426.1|  PREDICTED: putative ribonuclease H protein A...  70.5    2e-10   
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...  70.5    2e-10   
gb|KFK24637.1|  hypothetical protein AALP_AA8G005400                  70.5    2e-10   Arabis alpina [alpine rockcress]
ref|NP_192687.1|  polynucleotidyl transferase, ribonuclease H-lik...  67.0    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003617799.1|  hypothetical protein MTR_5g095600                67.4    3e-10   
gb|AFP55557.1|  non-ltr retroelement reverse transcriptase            70.5    3e-10   Rosa rugosa [Japanese rose]
ref|XP_007212745.1|  hypothetical protein PRUPE_ppa019461mg           68.2    3e-10   
gb|KHN23277.1|  hypothetical protein glysoja_040246                   66.6    3e-10   
ref|XP_008393540.1|  PREDICTED: putative ribonuclease H protein A...  69.7    3e-10   
ref|XP_010667872.1|  PREDICTED: uncharacterized protein LOC104884867  67.0    3e-10   
ref|XP_008375086.1|  PREDICTED: putative ribonuclease H protein A...  66.6    3e-10   
ref|XP_002533065.1|  conserved hypothetical protein                   69.3    3e-10   
ref|XP_003609437.1|  hypothetical protein MTR_4g115700                65.9    3e-10   
ref|XP_003624705.1|  hypothetical protein MTR_7g086560                68.2    3e-10   
gb|KHN38789.1|  hypothetical protein glysoja_047929                   67.0    4e-10   
gb|KJB11692.1|  hypothetical protein B456_001G272100                  67.8    4e-10   
ref|XP_003601858.1|  Estradiol 17-beta-dehydrogenase                  69.7    4e-10   
ref|XP_002513210.1|  conserved hypothetical protein                   67.0    4e-10   
ref|XP_011465330.1|  PREDICTED: uncharacterized protein LOC105351724  67.8    4e-10   
ref|XP_009113008.1|  PREDICTED: uncharacterized protein LOC103838329  69.3    4e-10   
ref|XP_010666974.1|  PREDICTED: uncharacterized protein LOC104884077  66.6    4e-10   
ref|XP_009109945.1|  PREDICTED: uncharacterized protein LOC103835513  69.7    4e-10   
ref|XP_012072497.1|  PREDICTED: uncharacterized protein LOC105634269  67.8    4e-10   
ref|XP_009110781.1|  PREDICTED: putative ribonuclease H protein A...  69.7    4e-10   
ref|XP_008229542.1|  PREDICTED: uncharacterized protein LOC103328904  67.0    4e-10   
gb|AAC13594.1|  contains similarity to reverse transcriptase-like...  68.6    4e-10   
ref|XP_012075763.1|  PREDICTED: uncharacterized protein LOC105636967  67.8    5e-10   
ref|XP_010686484.1|  PREDICTED: uncharacterized protein LOC104900691  68.9    5e-10   
gb|EEC81662.1|  hypothetical protein OsI_25211                        69.3    5e-10   
gb|EPS68405.1|  hypothetical protein M569_06367                       69.3    5e-10   
ref|XP_003614116.1|  hypothetical protein MTR_5g045010                65.9    5e-10   
gb|ABA98491.1|  retrotransposon protein, putative, unclassified       69.7    5e-10   
ref|XP_010678934.1|  PREDICTED: uncharacterized protein LOC104894413  66.6    5e-10   
ref|XP_010687489.1|  PREDICTED: uncharacterized protein LOC104901596  69.7    5e-10   
ref|XP_009117699.1|  PREDICTED: uncharacterized protein LOC103842788  68.9    5e-10   
ref|XP_010490288.1|  PREDICTED: uncharacterized protein LOC104768041  68.9    5e-10   
emb|CAN77449.1|  hypothetical protein VITISV_016970                   69.3    6e-10   
gb|AAX95581.1|  hypothetical protein, partial                         68.9    6e-10   
ref|XP_009344564.1|  PREDICTED: uncharacterized protein LOC103936456  67.0    6e-10   
ref|XP_008359305.1|  PREDICTED: uncharacterized protein LOC103423013  66.6    6e-10   
ref|XP_010418625.1|  PREDICTED: uncharacterized protein LOC104704198  68.9    6e-10   
ref|XP_010256191.1|  PREDICTED: uncharacterized protein LOC104596624  69.3    6e-10   
emb|CDY70141.1|  BnaAnng32710D                                        68.2    7e-10   
ref|XP_012065448.1|  PREDICTED: uncharacterized protein LOC105628614  68.9    7e-10   
gb|AAX95549.1|  hypothetical protein                                  68.9    7e-10   
ref|XP_009101684.1|  PREDICTED: uncharacterized protein LOC103827880  69.3    7e-10   
gb|AFK42656.1|  unknown                                               67.8    7e-10   
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342  69.3    7e-10   
ref|XP_010512831.1|  PREDICTED: uncharacterized protein LOC104788746  68.6    8e-10   
ref|XP_003596821.1|  hypothetical protein MTR_2g086490                65.5    8e-10   
ref|XP_006491602.1|  PREDICTED: uncharacterized protein LOC102623801  68.6    8e-10   
gb|EPS61425.1|  hypothetical protein M569_13371                       68.9    8e-10   
ref|XP_003610669.1|  hypothetical protein MTR_5g005740                67.4    8e-10   
ref|XP_012084898.1|  PREDICTED: uncharacterized protein LOC105644227  67.8    8e-10   
emb|CCA65997.1|  hypothetical protein                                 68.9    9e-10   
ref|XP_006577722.1|  PREDICTED: putative ribonuclease H protein A...  67.0    9e-10   
emb|CDX95851.1|  BnaC05g36020D                                        67.8    9e-10   
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase   68.9    9e-10   
ref|XP_002489257.1|  hypothetical protein SORBIDRAFT_0011s003210      68.6    1e-09   
ref|XP_004959141.1|  PREDICTED: putative ribonuclease H protein A...  68.6    1e-09   
ref|XP_012072790.1|  PREDICTED: uncharacterized protein LOC105634534  67.8    1e-09   
ref|XP_010667704.1|  PREDICTED: uncharacterized protein LOC104884717  68.9    1e-09   
ref|XP_008381948.1|  PREDICTED: uncharacterized protein LOC103444783  65.9    1e-09   
ref|XP_009119970.1|  PREDICTED: uncharacterized protein LOC103844893  67.0    1e-09   
gb|ABA99010.1|  expressed protein                                     67.0    1e-09   
ref|XP_009109953.1|  PREDICTED: uncharacterized protein LOC103835521  68.6    1e-09   
ref|XP_007214195.1|  hypothetical protein PRUPE_ppa020989mg           68.2    1e-09   
gb|KHN31589.1|  hypothetical protein glysoja_043032                   65.1    1e-09   
gb|AAK39575.1|AC025296_10  putative reverse transcriptase             68.6    1e-09   
ref|XP_012067552.1|  PREDICTED: uncharacterized protein LOC105630356  68.6    1e-09   
ref|XP_006402244.1|  hypothetical protein EUTSA_v10015769mg           67.0    1e-09   
gb|KJB61324.1|  hypothetical protein B456_009G352100                  65.9    1e-09   
emb|CDX96229.1|  BnaC02g14220D                                        65.9    1e-09   
ref|XP_012065266.1|  PREDICTED: uncharacterized protein LOC105628466  65.9    1e-09   
gb|EPS68811.1|  hypothetical protein M569_05963                       67.0    1e-09   
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940  68.2    1e-09   
ref|XP_002455221.1|  hypothetical protein SORBIDRAFT_03g006485        65.5    1e-09   
ref|XP_009117702.1|  PREDICTED: uncharacterized protein LOC103842791  67.8    1e-09   
ref|XP_009140864.1|  PREDICTED: uncharacterized protein LOC103864847  67.0    2e-09   
ref|XP_009113183.1|  PREDICTED: putative ribonuclease H protein A...  67.8    2e-09   
ref|XP_002525961.1|  hypothetical protein RCOM_0596960                66.6    2e-09   
ref|XP_002456488.1|  hypothetical protein SORBIDRAFT_03g037190        67.8    2e-09   
ref|XP_009147176.1|  PREDICTED: uncharacterized protein LOC103870759  67.0    2e-09   
ref|XP_006485451.1|  PREDICTED: uncharacterized protein LOC102622884  68.2    2e-09   
ref|XP_006289152.1|  hypothetical protein CARUB_v10002590mg           66.2    2e-09   
ref|XP_009109964.1|  PREDICTED: putative ribonuclease H protein A...  67.4    2e-09   
gb|KHN31016.1|  hypothetical protein glysoja_020314                   64.3    2e-09   
gb|EMS53876.1|  Bidirectional sugar transporter SWEET14               67.4    2e-09   
ref|XP_009129273.1|  PREDICTED: putative ribonuclease H protein A...  66.6    2e-09   
ref|XP_002451200.1|  hypothetical protein SORBIDRAFT_05g025720        65.5    2e-09   
ref|XP_008240491.1|  PREDICTED: uncharacterized protein LOC103338992  66.6    3e-09   
ref|XP_004289414.1|  PREDICTED: uncharacterized protein LOC101292643  63.9    3e-09   
ref|XP_003623678.1|  hypothetical protein MTR_7g074420                65.5    3e-09   
ref|XP_010474601.1|  PREDICTED: uncharacterized protein LOC104754160  67.4    3e-09   
gb|KHN20416.1|  Putative ribonuclease H protein                       65.5    3e-09   
gb|KJB31632.1|  hypothetical protein B456_005G199400                  65.1    3e-09   
gb|AFK34055.1|  unknown                                               65.1    3e-09   
ref|XP_009120989.1|  PREDICTED: uncharacterized protein LOC103845849  65.9    3e-09   
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947  67.4    3e-09   
ref|XP_002300604.2|  hypothetical protein POPTR_0002s00270g           63.9    3e-09   
ref|XP_009132673.1|  PREDICTED: putative ribonuclease H protein A...  67.0    3e-09   
gb|EEE54600.1|  hypothetical protein OsJ_01823                        67.0    4e-09   
gb|KJB59793.1|  hypothetical protein B456_009G272600                  65.5    4e-09   
emb|CCA66050.1|  hypothetical protein                                 67.0    4e-09   
ref|XP_010688546.1|  PREDICTED: uncharacterized protein LOC104902454  65.1    4e-09   
ref|XP_008382811.1|  PREDICTED: uncharacterized protein LOC103445579  66.2    4e-09   
gb|EMT20455.1|  Putative cysteine-rich receptor-like protein kina...  67.0    4e-09   
ref|XP_009105634.1|  PREDICTED: putative ribonuclease H protein A...  66.6    4e-09   
gb|EEE57524.1|  hypothetical protein OsJ_07834                        66.6    4e-09   
ref|XP_006482369.1|  PREDICTED: putative ribonuclease H protein A...  66.6    4e-09   
ref|XP_003603836.1|  hypothetical protein MTR_3g114760                66.2    4e-09   
ref|XP_009102787.1|  PREDICTED: uncharacterized protein LOC103828902  67.0    4e-09   
ref|XP_006593242.1|  PREDICTED: uncharacterized protein LOC102666191  64.3    4e-09   
ref|XP_010480547.1|  PREDICTED: uncharacterized protein LOC104759300  63.2    4e-09   
ref|XP_003607874.1|  hypothetical protein MTR_4g083950                63.2    4e-09   
ref|XP_003630976.1|  hypothetical protein MTR_8g105730                65.9    4e-09   
gb|EEE66057.1|  hypothetical protein OsJ_22054                        66.6    4e-09   
ref|XP_008222000.1|  PREDICTED: putative ribonuclease H protein A...  66.6    4e-09   
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...  66.6    4e-09   
ref|XP_009107520.1|  PREDICTED: uncharacterized protein LOC103833173  65.9    4e-09   
ref|XP_010258403.1|  PREDICTED: uncharacterized protein LOC104598171  63.9    5e-09   
ref|XP_004308694.1|  PREDICTED: uncharacterized protein LOC101313751  63.9    5e-09   
gb|KHN43835.1|  hypothetical protein glysoja_039082                   64.3    5e-09   
gb|EEE50824.1|  hypothetical protein OsJ_31232                        67.0    5e-09   
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...  66.6    5e-09   
ref|XP_010462680.1|  PREDICTED: uncharacterized protein LOC104743275  65.9    5e-09   
ref|XP_012092402.1|  PREDICTED: uncharacterized protein LOC105650133  65.5    5e-09   
ref|XP_009140200.1|  PREDICTED: putative ribonuclease H protein A...  66.6    5e-09   
ref|XP_010278072.1|  PREDICTED: uncharacterized protein LOC104612377  64.3    5e-09   
ref|XP_003603227.1|  hypothetical protein MTR_3g105270                63.5    5e-09   
ref|XP_003621450.1|  hypothetical protein MTR_7g013520                63.9    5e-09   
ref|XP_008359621.1|  PREDICTED: putative ribonuclease H protein A...  66.2    5e-09   
ref|XP_002451109.1|  hypothetical protein SORBIDRAFT_05g024215        65.9    5e-09   
ref|XP_010673168.1|  PREDICTED: uncharacterized protein LOC104889608  66.6    6e-09   
ref|XP_008243898.1|  PREDICTED: putative ribonuclease H protein A...  65.9    6e-09   
ref|XP_010673165.1|  PREDICTED: uncharacterized protein LOC104889605  63.5    7e-09   
ref|XP_009114812.1|  PREDICTED: uncharacterized protein LOC103840085  63.2    7e-09   
ref|XP_002532287.1|  conserved hypothetical protein                   65.5    7e-09   
ref|XP_009141427.1|  PREDICTED: putative ribonuclease H protein A...  65.9    7e-09   
gb|KJB22308.1|  hypothetical protein B456_004G040000                  63.2    8e-09   
ref|XP_010680493.1|  PREDICTED: uncharacterized protein LOC104895631  63.5    8e-09   
ref|XP_009346162.1|  PREDICTED: uncharacterized protein LOC103937909  65.5    8e-09   
ref|XP_012074428.1|  PREDICTED: uncharacterized protein LOC105635905  66.2    8e-09   
ref|XP_009135908.1|  PREDICTED: uncharacterized protein LOC103860050  66.2    8e-09   
ref|XP_003603808.1|  hypothetical protein MTR_3g114430                64.3    8e-09   
gb|EEC71228.1|  hypothetical protein OsI_03168                        65.9    8e-09   
ref|XP_008391252.1|  PREDICTED: putative ribonuclease H protein A...  65.9    9e-09   
ref|XP_009127063.1|  PREDICTED: uncharacterized protein LOC103851935  65.9    9e-09   
ref|XP_009341350.1|  PREDICTED: uncharacterized protein LOC103933385  63.9    9e-09   
ref|XP_006487889.1|  PREDICTED: uncharacterized protein LOC102617714  65.9    1e-08   
ref|XP_010269328.1|  PREDICTED: uncharacterized protein LOC104606020  62.8    1e-08   
gb|EPS57564.1|  hypothetical protein M569_17254                       65.1    1e-08   
gb|EEE55133.1|  hypothetical protein OsJ_02920                        65.5    1e-08   
ref|XP_012066914.1|  PREDICTED: uncharacterized protein LOC105629879  62.4    1e-08   
gb|EEE54811.1|  hypothetical protein OsJ_02230                        65.5    1e-08   
ref|XP_008226963.1|  PREDICTED: uncharacterized protein LOC103326508  63.5    1e-08   
ref|XP_003613452.1|  hypothetical protein MTR_5g036840                63.9    1e-08   
ref|XP_007227248.1|  hypothetical protein PRUPE_ppa018001mg           65.1    1e-08   
ref|XP_010689004.1|  PREDICTED: uncharacterized protein LOC104902799  62.8    1e-08   
ref|XP_007207608.1|  hypothetical protein PRUPE_ppa018906mg           64.7    1e-08   
ref|XP_010680492.1|  PREDICTED: uncharacterized protein LOC104895629  65.1    1e-08   
gb|EEC70889.1|  hypothetical protein OsI_02427                        65.5    1e-08   
ref|XP_010666759.1|  PREDICTED: uncharacterized protein LOC104883889  63.9    1e-08   
ref|XP_009151504.1|  PREDICTED: uncharacterized protein LOC103874823  62.4    1e-08   
ref|XP_003596081.1|  hypothetical protein MTR_2g065980                61.6    1e-08   
ref|XP_008366160.1|  PREDICTED: putative ribonuclease H protein A...  64.7    2e-08   
gb|EEE53090.1|  hypothetical protein OsJ_35851                        64.7    2e-08   
ref|XP_009354167.1|  PREDICTED: uncharacterized protein LOC103945332  64.7    2e-08   
ref|XP_009334567.1|  PREDICTED: uncharacterized protein LOC103927376  64.7    2e-08   
gb|EEE68803.1|  hypothetical protein OsJ_27549                        62.4    2e-08   
ref|XP_010686471.1|  PREDICTED: uncharacterized protein LOC104900678  64.3    2e-08   
gb|KJB67623.1|  hypothetical protein B456_010G200800                  62.0    2e-08   
ref|XP_004298055.1|  PREDICTED: uncharacterized protein LOC101313796  62.0    2e-08   
ref|XP_010669875.1|  PREDICTED: uncharacterized protein LOC104886996  62.8    2e-08   
emb|CDY67599.1|  BnaAnng24740D                                        64.3    2e-08   
ref|XP_009149305.1|  PREDICTED: putative ribonuclease H protein A...  65.1    2e-08   
ref|XP_002467831.1|  hypothetical protein SORBIDRAFT_01g034800        63.9    2e-08   
ref|XP_009105597.1|  PREDICTED: uncharacterized protein LOC103831468  64.7    2e-08   
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015  65.1    2e-08   
ref|XP_010670096.1|  PREDICTED: uncharacterized protein LOC104887198  64.7    2e-08   
ref|XP_010678553.1|  PREDICTED: uncharacterized protein LOC104894086  63.5    2e-08   
ref|XP_010677668.1|  PREDICTED: uncharacterized protein LOC104893266  62.4    2e-08   
ref|XP_010667861.1|  PREDICTED: uncharacterized protein LOC104884854  63.9    2e-08   
ref|XP_008341962.1|  PREDICTED: uncharacterized protein LOC103404776  63.9    2e-08   
gb|EEC68887.1|  hypothetical protein OsI_37529                        64.7    2e-08   
ref|XP_004248595.1|  PREDICTED: uncharacterized protein LOC101261371  64.7    2e-08   
gb|EAZ07210.1|  hypothetical protein OsI_29454                        62.0    2e-08   
ref|XP_008344497.1|  PREDICTED: uncharacterized protein LOC103407339  63.9    3e-08   
ref|XP_003617149.1|  hypothetical protein MTR_5g088360                61.2    3e-08   
ref|XP_010678022.1|  PREDICTED: uncharacterized protein LOC104893592  61.2    3e-08   
ref|XP_010678407.1|  PREDICTED: uncharacterized protein LOC104893963  61.2    3e-08   
ref|XP_003607028.1|  hypothetical protein MTR_4g071380                62.0    3e-08   
gb|EEC72931.1|  hypothetical protein OsI_06781                        63.5    3e-08   
gb|KHN29674.1|  hypothetical protein glysoja_016296                   60.5    3e-08   
ref|XP_009151515.1|  PREDICTED: putative ribonuclease H protein A...  63.9    4e-08   
ref|XP_004295821.1|  PREDICTED: TMV resistance protein N-like         63.5    4e-08   
ref|XP_012074426.1|  PREDICTED: uncharacterized protein LOC105635902  63.5    4e-08   
gb|ABA97040.1|  retrotransposon protein, putative, unclassified       64.3    4e-08   
emb|CDY51317.1|  BnaCnng20620D                                        63.9    4e-08   
ref|XP_010430942.1|  PREDICTED: uncharacterized protein LOC104715209  62.4    4e-08   
ref|XP_008219206.1|  PREDICTED: uncharacterized protein LOC103319442  61.6    4e-08   
ref|XP_008351938.1|  PREDICTED: uncharacterized protein LOC103415381  62.0    4e-08   
ref|XP_009132198.1|  PREDICTED: uncharacterized protein LOC103856814  63.5    4e-08   
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030  63.9    4e-08   
ref|XP_012084668.1|  PREDICTED: uncharacterized protein LOC105644038  63.5    5e-08   
ref|XP_008345396.1|  PREDICTED: putative ribonuclease H protein A...  63.2    5e-08   
ref|XP_003595869.1|  hypothetical protein MTR_2g062740                60.5    5e-08   
ref|XP_008388887.1|  PREDICTED: uncharacterized protein LOC103451234  62.8    5e-08   
ref|XP_010431104.1|  PREDICTED: uncharacterized protein LOC104715396  62.4    5e-08   
gb|ABN08345.1|  Polynucleotidyl transferase, Ribonuclease H fold      61.6    5e-08   
gb|AAS55787.1|  hypothetical protein                                  63.5    5e-08   
ref|XP_002515720.1|  conserved hypothetical protein                   60.5    5e-08   
gb|EMS67609.1|  Alanyl-tRNA synthetase                                63.5    6e-08   
ref|XP_010684542.1|  PREDICTED: uncharacterized protein LOC104899105  60.8    6e-08   
ref|XP_010259171.1|  PREDICTED: uncharacterized protein LOC104598689  62.0    6e-08   
ref|XP_002462405.1|  hypothetical protein SORBIDRAFT_02g025125        63.2    6e-08   
ref|XP_009114471.1|  PREDICTED: uncharacterized protein LOC103839734  63.2    6e-08   
gb|ACP30591.1|  disease resistance protein                            63.5    6e-08   
ref|XP_006285450.1|  hypothetical protein CARUB_v10006875mg           63.2    6e-08   
gb|EMT03045.1|  hypothetical protein F775_03696                       60.5    6e-08   
ref|NP_179015.1|  RNase H domain-containing protein                   60.5    7e-08   
ref|XP_009102231.1|  PREDICTED: uncharacterized protein LOC103828378  63.2    7e-08   
ref|XP_010101832.1|  hypothetical protein L484_023622                 63.2    7e-08   
ref|XP_010686122.1|  PREDICTED: uncharacterized protein LOC104900404  63.2    7e-08   
ref|XP_010682232.1|  PREDICTED: uncharacterized protein LOC104897109  62.4    7e-08   
gb|KHN40002.1|  hypothetical protein glysoja_009379                   61.6    7e-08   
ref|XP_010694802.1|  PREDICTED: uncharacterized protein LOC104907559  63.2    7e-08   
ref|XP_002525878.1|  conserved hypothetical protein                   62.8    8e-08   



>ref|XP_012087681.1| PREDICTED: uncharacterized protein LOC105646438 [Jatropha curcas]
Length=307

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 129/237 (54%), Gaps = 3/237 (1%)
 Frame = -1

Query  792  LFYAFVSCSLAQKCWDLFEHTIPHHCVS-FMDWVELQFNSLSDNELCKLISICWKVWDAR  616
            L + FV CS A+  W L         VS +  W+E  F   S     +++ I W +W AR
Sbjct  60   LLHLFVQCSFARSVWMLTSVGWQFPRVSSWRAWLETVFQCSSLKAADEILMILWALWSAR  119

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDE  436
            N++VWN   ++   VV  A   L EW +           +     WS+P  G+LK+N D 
Sbjct  120  NKRVWNFQFVNPSSVVQMAGRVLNEWSNHRAKPPRLGVGNPANRAWSRPPTGFLKINLDA  179

Query  435  ALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQ  256
            ++ S     G+GLV  +++G+F+AAK++   G    + AEA+++REAL W+K+     + 
Sbjct  180  SVFSGGTVAGVGLVCQNSFGEFIAAKTMLLHGQFNALHAEALSVREALSWIKAKAWSSII  239

Query  255  IESDCIKVIQAINSTSLC--SSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
            +ESD + V+ AINS+++   SSF L+I+D + +  +  N+   FV RSAN VAH LA
Sbjct  240  VESDALMVVNAINSSTVTDDSSFGLVISDCKLLINEIDNVECRFVYRSANVVAHLLA  296



>ref|XP_012075485.1| PREDICTED: uncharacterized protein LOC105636752 [Jatropha curcas]
Length=1028

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/264 (35%), Positives = 131/264 (50%), Gaps = 5/264 (2%)
 Frame = -1

Query  792   LFYAFVSCSLAQKCWDLFEHTIP-HHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
             +F+ FV C  A++CW          HC+SF DW +    +L + E    I I W +W+AR
Sbjct  766   VFHVFVQCDFARECWQSSSIGFRFGHCLSFWDWFKSMATALGEFEFKVQIMILWAIWEAR  825

Query  615   NEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDE  436
             N+ +W +  +SS  VV  A + L  W  AN +      +     +WSKP  G LKLN D 
Sbjct  826   NDLLWRDKRLSSFQVVRRANNLLSCWTQANGVDGDVGRMVACA-SWSKPSQGILKLNVDG  884

Query  435   ALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQ  256
             AL  N    G+G V+ D+ G FV A  +   G       EA+AIRE L W+K +    V 
Sbjct  885   AL-FNGDYAGIGAVIRDSNGAFVRALQMSIPGNFESCTVEAMAIREVLSWVKEVGWSSVV  943

Query  255   IESDCIKVIQAINSTSLC--SSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
             +ESD    ++AI   +    S+F L+I+D R +  +  ++   FV+RSAN  AH LAR  
Sbjct  944   VESDAQTCVRAITDPNYSDGSAFGLVISDCRSLLDELRDVRLVFVRRSANGAAHMLARAV  1003

Query  81    MFKADCMVCVSVPFPCIAHSLELD  10
                   +V    P  CI   L L+
Sbjct  1004  TISTGKVVWSDRPPVCIFDILRLE  1027



>ref|XP_006470496.1| PREDICTED: uncharacterized protein LOC102617255 [Citrus sinensis]
Length=440

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 120/239 (50%), Gaps = 4/239 (2%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEK  607
            +  + C  A+ CW            + + W+E  FN  S  +    + ICW +W  RN+ 
Sbjct  176  HILLQCPFARTCWMTSSIGFFGDGSNLLLWLEALFNRYSLEQTQLAVMICWSLWQNRNDM  235

Query  606  VWNNIVISSHDVVSGALSYLLEWQSANQ---LshhqshvshqVETWSKPLVGWLKLNSDE  436
            VW         +++ A  +L +WQ   +   L    S + H    W  P+ G LK N D 
Sbjct  236  VWRGKTSGVQQLLNSAGHFLFQWQLVRKQQFLFSQPSPIGHGAICWEPPVAGRLKCNVDV  295

Query  435  ALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQ  256
            AL +    +G G V+ D+   F+AA+     G     +AEA+ +REAL W+K LQL  V 
Sbjct  296  ALFAFRGYIGFGNVIRDSNCAFMAARCCSIPGRFSARDAEALGVREALSWIKQLQLSNVT  355

Query  255  IESDCIKVIQA-INSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
            IE DC+ V  A +N+ S  SSF LII D R ++    ++SF FV+RSAN VAH +A+  
Sbjct  356  IEMDCLTVYNALVNNLSGPSSFSLIIEDCRALSNSIRDVSFSFVRRSANSVAHYVAQAG  414



>ref|XP_006476142.1| PREDICTED: uncharacterized protein LOC102616098 [Citrus sinensis]
Length=510

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 132/264 (50%), Gaps = 6/264 (2%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI-CWKVWDA  619
            ++ +  V+CS A+ CW L        C +FMDW+E  F+  S ++ C L ++ CW +W+ 
Sbjct  246  IVAHCLVNCSFAKSCWLLSPIGYVGGCENFMDWLEGIFSRYSSDD-CDLAAMTCWSLWEN  304

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET---WSKPLVGWLKL  448
            +N KVW N       V++ A   L +W+S  +L    ++          W +P V W K 
Sbjct  305  KNAKVWKNRKGRLSSVLNLAGQVLFQWKSVRKLQVFDNNSVSSSHGAVCWQRPCVWWFKC  364

Query  447  NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQL  268
            N D     +S  +  G V+ ++ G+FV A+S          EAEAI +RE L WLK L  
Sbjct  365  NVDATTFLSSGTIMYGAVIQNSEGEFVTARSNWLISSFGAREAEAIGVREILSWLKGLPF  424

Query  267  DKVQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
              V IE D ++V  A+   S   + F L+I+D R +A+   +++F FV+RSAN  AH + 
Sbjct  425  LHVIIEMDSLQVFTALTMDSFSPNGFGLLIDDCRALAQSLGDVTFSFVRRSANSAAHSVT  484

Query  90   REAMFKADCMVCVSVPFPCIAHSL  19
            R   F +       +P P +   L
Sbjct  485  RVGGFLSGLGEWRLIPPPSLVSQL  508



>ref|XP_006467327.1| PREDICTED: uncharacterized protein LOC102625297 [Citrus sinensis]
Length=412

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 107/192 (56%), Gaps = 4/192 (2%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
             + ++ V+CS A+ CW         +C +F+DW+   F   S +E    + ICW++W  R
Sbjct  220  TVLHSLVACSFAKSCWTSSSVGFVGYCSNFLDWLAHVFTRCSKDECNTAMMICWRIWVNR  279

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQ----LshhqshvshqVETWSKPLVGWLKL  448
            N KVWNN   S   +++ A  +L +WQ+A Q    ++     + H    W +P  GW+K 
Sbjct  280  NNKVWNNTTSSVCQILNSAGQFLYQWQAAKQQVFDVNDDTHRLVHGALCWEQPKFGWVKC  339

Query  447  NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQL  268
            N D A+  +   +G+G V+ ++ G FVAA+ +   G+    EAEA+ IREAL W+K LQ+
Sbjct  340  NVDAAVFESQGKIGIGCVIRNSQGGFVAARCVSVAGIFGAREAEALGIREALSWMKELQI  399

Query  267  DKVQIESDCIKV  232
              V IE DC++V
Sbjct  400  PCVIIEMDCLQV  411



>ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatula]
Length=547

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 109/208 (52%), Gaps = 2/208 (1%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSA-NQLshhqshvshqVETWSKPL  466
            + W +W  RN+KVW+  +  S+  V  A   L +WQ+A N  +            W  P 
Sbjct  2    MLWCIWRRRNDKVWDGQLQPSNIAVQLARELLFQWQAARNSATTQVQQSPQDTIAWQPPA  61

Query  465  VGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
             G+LK N D A+ S     G G+ + D  G+F+ A +  ++G   P EAEA+ +R+A+ W
Sbjct  62   AGFLKCNVDAAIFSEQNRFGTGMCVRDQRGRFLKAATNWYEGCPPPQEAEAVGLRDAILW  121

Query  285  LKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
            L  L+L  VQ+E DC  V+ +I +  +  + F  II+D R + + FTN    FV+R AN 
Sbjct  122  LGQLELSNVQLELDCKLVVDSIYDKNNNQAEFGSIIDDCRSLLQQFTNFKISFVRRQANV  181

Query  108  VAHELAREAMFKADCMVCVSVPFPCIAH  25
            VAH  AR ++F+    +  + P   + H
Sbjct  182  VAHSFARVSIFQPLFGLAFAKPESILEH  209



>ref|XP_006480463.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=459

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 117/239 (49%), Gaps = 21/239 (9%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
             + +  V C  A+ CW   +        SF DW++  F + ++ +    + +CWK+W  R
Sbjct  220  TVLHLLVDCPFARSCWIKSKVGFFGIYSSFKDWLQALFRNCTNEQCWIAVMVCWKLWCNR  279

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDE  436
            N  VW     ++  +V+ A                          WS P VGWLK N D 
Sbjct  280  NNLVWQGKCDTTKQIVNAA--------------------GVGAVAWSPPRVGWLKCNIDA  319

Query  435  ALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQ  256
             + +N   +G+G V+ D  G+FVAA      G   P +AE ++IREAL  LKS++L KV 
Sbjct  320  TVFANEGRVGLGSVIRDESGKFVAALCCHIRGNYSPRDAEVLSIREALSLLKSMKLSKVI  379

Query  255  IESDCIKVIQA-INSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
            +E+DC++   A ++     +SF  ++ D + IA    +++F FV RSAN  +H +A+  
Sbjct  380  VETDCLQAFNALVDRKCPLNSFGSLVLDCKCIADSIGDIAFSFVGRSANSASHFVAKAG  438



>ref|XP_007206484.1| hypothetical protein PRUPE_ppa019056mg, partial [Prunus persica]
 gb|EMJ07683.1| hypothetical protein PRUPE_ppa019056mg, partial [Prunus persica]
Length=298

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 111/264 (42%), Gaps = 4/264 (2%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWD---LFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDA  619
             +    C  A   W+   L  H    HC +  DW+       S  +   +I++ W +W  
Sbjct  16   LHVLAMCPFAVATWNISLLTRHAHQVHCHTMKDWLREMLEGTSKAQRDHIITLLWAIWGN  75

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSD  439
            RN  +W  +  S H+VV  A  Y+ E+ +AN      +        W+ P  G LK N D
Sbjct  76   RNALLWQGVQRSPHEVVGFAQQYVHEFITANDTPSKVTDRVRDPVRWAAPPSGRLKFNFD  135

Query  438  EALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKV  259
             A D  S    +G+V  DA G FVAA +     +     AE +A RE +    SL     
Sbjct  136  GAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILAAREGVALALSLGTASP  195

Query  258  QIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
              E D   V+ AI       S+   I+ D++ + + F +  F F  R AN VAH LAR  
Sbjct  196  IFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREANGVAHRLARFG  255

Query  81   MFKADCMVCVSVPFPCIAHSLELD  10
            +   D  +   VP   I  +L  D
Sbjct  256  LHNVDNFIWFEVPPDLIQDALLCD  279



>ref|XP_012089886.1| PREDICTED: uncharacterized protein LOC105648185 [Jatropha curcas]
Length=262

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 126/241 (52%), Gaps = 9/241 (4%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI-CWKVWDA  619
            VLF+    C  A+ CW L    +     SF D + L F     N+ C L  + C+ +W  
Sbjct  3    VLFH----CEKARLCWPLTGIPLDGSTTSFNDTL-LGFIDRRSNDQCLLFGVLCYFLWFD  57

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSD  439
            RN +VW    I+ +++V+ A S+L EWQ+A     + S  S  V TW+ P  G +K N D
Sbjct  58   RNRRVWQQTNIAPYNIVTVATSFLREWQNAQIERSNPSVSSECVPTWAPPPTGIVKCNVD  117

Query  438  EALD-SNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDK  262
             A+  +  R    GLV  +A GQF+ A +  + G+  P  AEAI +RE L WL +  + +
Sbjct  118  AAVHMTEGRSSYAGLVRNEA-GQFLVACTGHFTGVLKPHIAEAIGLREVLSWLLTRSISR  176

Query  261  VQIESDCIKVIQAINST-SLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELARE  85
            V +E+DC+++ QA+ +     S +  ++ +I+++          +V+R  NK AH LAR 
Sbjct  177  VLVETDCLRLFQAVTTRFDYYSDWAPVLAEIKQLLSQIPFSELVWVRRQGNKPAHALARV  236

Query  84   A  82
            A
Sbjct  237  A  237



>ref|XP_012080090.1| PREDICTED: uncharacterized protein LOC105640399 [Jatropha curcas]
Length=340

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 79/264 (30%), Positives = 125/264 (47%), Gaps = 8/264 (3%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFEHTIP-HHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARN  613
             +  ++C  +++ W L          +SF +W +    SL+   L  +  +CW +W  RN
Sbjct  79   LHVLINCPFSRQVWTLSHIGFRWSSALSFGEWFQQASTSLTLENLSYVSMVCWALWVTRN  138

Query  612  EKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEA  433
            + VW     +   V+  A      W+ A               TWS P   WLK+N+D +
Sbjct  139  DTVWRQKSRNPRAVILLATGVWHAWKEAKLHDLGAPSPVFSNHTWSPPPFNWLKVNTDAS  198

Query  432  LDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQI  253
                S  +G+G V+ ++  +F+A+K+  + G      AEAIA+REAL W+K    + + +
Sbjct  199  TGVASGYVGIGTVVRNSASEFIASKAWRFPGYFNAKVAEAIAVREALSWIKDHGWNYILL  258

Query  252  ESDCIKVIQAIN--STSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAM  79
            E+D   V  AIN  +T+  S+F LII+D + +  +      +FV RSAN  AH LA    
Sbjct  259  ETDSQSVANAINNDNTNDSSAFGLIIHDCKSLLSEIPVAKCNFVYRSANVAAHTLAVGTH  318

Query  78   FKADCMVCVSVPFPCIAHSLELDF  7
             +A      SVP P +     LDF
Sbjct  319  SEAGLGDWNSVPPPAL-----LDF  337



>ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246050 [Nicotiana sylvestris]
Length=690

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/257 (32%), Positives = 124/257 (48%), Gaps = 3/257 (1%)
 Frame = -1

Query  792  LFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARN  613
            + +  V C+ A+  W            SFM+W      +++  +L + I + W++W+ARN
Sbjct  423  IMHCLVMCTAAKLVWLKSSMGWRPVGASFMEWFTALVAAVTKEKLQEAIMLLWEIWNARN  482

Query  612  EKVWNNIVISSHDVVSGALSYLLEWQSA-NQLshhqshvshqVETWSKPLVGWLKLNSDE  436
              VWN   +    ++  A  +  EW S  +  + +       V  W  P  G LK N D 
Sbjct  483  NLVWNGKTMRPETIILRASRFWKEWTSTRSDNNIYSVARPEFVVKWFPPDPGTLKCNIDA  542

Query  435  ALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLK-SLQLDKV  259
              + NS     G+++ D +G FV   S         + AE + +REAL WLK       +
Sbjct  543  FYEVNSGRAWAGMLIRDTHGNFVRGFSTLLGASHDAVIAEILTVREALSWLKMQHHRSPI  602

Query  258  QIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
             IE DC+   QA+  S S  S FD+I+ D +E+ RDFT++S +FVKRSA + AH LAR A
Sbjct  603  TIEMDCLLAKQALERSDSGNSYFDIIVQDCKELMRDFTSISLYFVKRSAKQRAHMLARAA  662

Query  81   MFKADCMVCVSVPFPCI  31
               +D M  +  P   I
Sbjct  663  SSMSDAMEWIVHPLSLI  679



>ref|XP_012072680.1| PREDICTED: uncharacterized protein LOC105634429 [Jatropha curcas]
Length=219

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 110/215 (51%), Gaps = 6/215 (3%)
 Frame = -1

Query  636  WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQL----shhqshvshqVETWSKP  469
            W++W  RN++VW     +   ++ GA   ++EWQ A Q+    S  Q+   +    W  P
Sbjct  2    WELWLHRNKRVWEQRAWNVDKILYGARRNIVEWQQAQQIKLPISGVQAVSLNSSVRWKNP  61

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
              G LKLN D A D++S     G +L    G  V   S           AEAI IREAL 
Sbjct  62   DSGMLKLNIDAAYDASSGKSSCGWILRRHDGNMVGGGSRNCGTTLNAAVAEAIGIREALS  121

Query  288  WLKSLQLDK-VQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHFVKRSA  115
            WLK L L++ V +ESDC+ V++ INS     S   LI+  I+E+  D    S  FV++SA
Sbjct  122  WLKPLNLEESVLVESDCMVVVRLINSEVQDLSYLGLIVKQIKELMSDINLSSISFVRKSA  181

Query  114  NKVAHELAREAMFKADCMVCVSVPFPCIAHSLELD  10
            N+VA+ LAR A+ +AD M    +P   I   L  D
Sbjct  182  NRVAYSLARAALLQADFMEWGIIPPNFIMDVLAFD  216



>ref|XP_012085858.1| PREDICTED: uncharacterized protein LOC105644961 [Jatropha curcas]
Length=284

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 116/225 (52%), Gaps = 2/225 (1%)
 Frame = -1

Query  711  SFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQS  532
            SF +++    ++L  + +     + +++W ARN+ VW   + S + VV+ A   L +W S
Sbjct  52   SFGEFLVHVLSTLPASRIPSFAMLLYQIWFARNKLVWQQQIASPYSVVTAAACGLRDWLS  111

Query  531  AN-QLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKS  355
               + S   + +   +  W  P  G +K N D  + +       G V+ D  G F+ A S
Sbjct  112  HQVRSSSRHTVLGQILPRWIAPPEGAVKCNVDATIYTLDNKFSYGAVIRDHRGSFIKAVS  171

Query  354  IPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIIN  178
                GLC P  AE IA+RE L WL+SL L    IE+DC++++ A+   SL  S + L++ 
Sbjct  172  GYSSGLCSPRVAETIAMREVLSWLRSLHLGLTIIETDCLQLVNAVQGGSLDYSDWSLVLG  231

Query  177  DIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADCMVCVSVP  43
            DI+      +++S  +VKR AN+ AH LAR A + A   V   +P
Sbjct  232  DIKHFISQSSDISIAWVKRHANQPAHSLARAACYFASFCVWDMIP  276



>ref|XP_012082585.1| PREDICTED: uncharacterized protein LOC105642374 [Jatropha curcas]
Length=386

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 123/239 (51%), Gaps = 9/239 (4%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI-CWKVWDA  619
            VLF+    C  A+ CW L    +     SF D + L F     N+ C L  + C+ +W  
Sbjct  129  VLFH----CEKARLCWTLTGIPLDGSTTSFNDTL-LGFIDRRSNDQCLLFGVLCYFLWFD  183

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSD  439
            RN +VW    I+ +++V+ A S+L EWQ+A     + S  S  V TW+ P  G +K N D
Sbjct  184  RNRRVWQQTNIAPYNIVTAATSFLREWQNAQIERSNPSVSSASVPTWAPPPTGIVKCNVD  243

Query  438  EALD-SNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDK  262
             A+  +  R    GLV  +A GQF+ A +  + G+  P  AEAI +RE L WL    + +
Sbjct  244  AAVHMTEGRSSYAGLVRNEA-GQFLVACTGHFTGVLKPHIAEAIGLREVLSWLLMRSISR  302

Query  261  VQIESDCIKVIQAINST-SLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
            V +E+DC+ + QA+ +     S +  ++ +I+++          +V+R  NK AH LAR
Sbjct  303  VLVETDCLCLFQAVTTRFDYYSDWAPVLAEIKQLLSQIPFRELGWVRRQGNKPAHALAR  361



>ref|XP_012065725.1| PREDICTED: uncharacterized protein LOC105628858 [Jatropha curcas]
Length=503

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 119/230 (52%), Gaps = 5/230 (2%)
 Frame = -1

Query  762  AQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI-CWKVWDARNEKVWNNIVI  586
            A+ CW L    +     SF D + L F     N+ C L  + C+ +W  RN +VW    I
Sbjct  253  ARLCWTLTGVPLDGSTTSFNDTL-LGFIDRRSNDQCLLFGVLCYFLWFDRNRRVWQQTNI  311

Query  585  SSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALD-SNSR*M  409
            + +++V+ A S+L EWQ+A     + S  S  V TW+ P  G +K N D A+  +  R  
Sbjct  312  APYNIVTAATSFLREWQNAQIERSNPSVSSASVPTWAPPPTGIVKCNVDAAVHMTEGRSS  371

Query  408  GMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVI  229
              GLV  +A GQF+ A +  + G+  P  AEAI +RE L WL +  + +V +E+DC+ + 
Sbjct  372  YAGLVRNEA-GQFLVACTGHFTGVLKPHIAEAIGLREVLSWLLTRSISRVLVETDCLHLF  430

Query  228  QAINST-SLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
            QA+ +     S +  ++ +I+++          +V R  NK AH LAR A
Sbjct  431  QAVTTRFDYYSDWTPVLAEIKQLPSQIPFSELVWVSRQGNKPAHALARVA  480



>ref|XP_012075779.1| PREDICTED: uncharacterized protein LOC105636986 [Jatropha curcas]
Length=382

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 122/257 (47%), Gaps = 4/257 (2%)
 Frame = -1

Query  771  CSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI-CWKVWDARNEKVWNN  595
            C  A+ CW L    +      F D + L        E C   S+ C+ +W  RN +VW  
Sbjct  128  CEKARLCWTLTGIPLDRSTTDFRDML-LGLIDRCSTEQCSFFSVLCYFIWFDRNRRVWQQ  186

Query  594  IVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR  415
            I +  +++V  A S+L EW++A     + S       TW  P  G +K N D A+ +   
Sbjct  187  INVDPYNIVMAATSFLREWKNAQLNRSNSSVPLASGPTWVPPPTGTVKCNFDAAIHATEG  246

Query  414  *MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIK  235
                  ++ D  GQF+ A +  + G+  P  AEAI +RE L WL    +D++ +E+DC++
Sbjct  247  RSSYAGLIRDEAGQFLVACTGHFAGVLQPHIAEAIGLREVLYWLLMRNIDRILVETDCLR  306

Query  234  VIQAINST-SLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADCMV  58
            + QA+ +     S +  ++ +I+++    ++    + +R ANK AH LA  A       +
Sbjct  307  LFQAVTTGFEPYSDWAPVLEEIKQLISQLSSCELVWARRQANKPAHALAHVACLHPCFRL  366

Query  57   CVSVPFPCIAHSLELDF  7
              S+P  CIA  +  D 
Sbjct  367  WDSIP-QCIAALISHDL  382



>ref|XP_012074682.1| PREDICTED: uncharacterized protein LOC105636117 [Jatropha curcas]
Length=382

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 121/257 (47%), Gaps = 4/257 (2%)
 Frame = -1

Query  771  CSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI-CWKVWDARNEKVWNN  595
            C  A+ CW L    +      F D + L        E C   S+ C+ +W  RN +VW  
Sbjct  128  CEKARLCWTLTGIPLDRSTTDFRDML-LGLIDRRSTEQCSFFSVLCYFIWFDRNRRVWQQ  186

Query  594  IVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR  415
            I +  +++V  A S+L EW++A     + S       TW  P  G +K N D A+ +   
Sbjct  187  INVDPYNIVMAATSFLREWKNAQLNRSNSSVPLASGPTWVPPPTGTVKCNFDAAIHATEG  246

Query  414  *MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIK  235
                  ++ D  GQF+ A +  + G+  P  AEAI +RE L WL    +D+V +E+DC++
Sbjct  247  RSSYAGLIRDEAGQFLVACTGHFAGVLQPHIAEAIGLREVLYWLLMRNIDRVLVETDCLR  306

Query  234  VIQAINST-SLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADCMV  58
            + QA+ +     S +  ++ +I+++    ++    + +R  NK AH LA  A       +
Sbjct  307  LFQAVTTGFEPYSDWAPVLEEIKQLISQLSSCELVWARRQVNKPAHALAHVACLHPCFRL  366

Query  57   CVSVPFPCIAHSLELDF  7
              S+P  CIA  +  D 
Sbjct  367  WDSIP-QCIATLISHDL  382



>ref|XP_006489961.1| PREDICTED: uncharacterized protein LOC102608276 [Citrus sinensis]
Length=190

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 93/166 (56%), Gaps = 5/166 (3%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhq----shvshqVETWS  475
            ICWK+W  RN+KVWNN     + +++ A   L +WQS  + +       S   H    W 
Sbjct  25   ICWKIWAHRNDKVWNNRSGRVYQILNSAGHLLYQWQSLRKQAMFTDVDESSSVHGAVCWK  84

Query  474  KPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREA  295
            +P VGW+K N D A+ S+   +G+G V+ ++ G F+ AK   + G     EAEA  +REA
Sbjct  85   RPHVGWVKCNVDAAVFSSQAMVGLGCVVRNSEGIFLTAKCDRFLGSFGAREAEAFGVREA  144

Query  294  LKWLKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREIA  160
            L WLK LQ  +V IE DC++V +A+    S  + F LII + R +A
Sbjct  145  LSWLKKLQFPRVIIEIDCLQVFKALTENHSSPNGFGLIIEECRFLA  190



>ref|XP_011470556.1| PREDICTED: uncharacterized protein LOC105353255 [Fragaria vesca 
subsp. vesca]
Length=623

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 117/241 (49%), Gaps = 8/241 (3%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFEHTIPHHC---VSFMDWVELQFNSLSDNELCKLISICWKVWDA  619
             + F+ C  AQ+ W     +IP++    V+  DW+     +++ +   K++ I W +W  
Sbjct  361  MHLFLHCPYAQETWS--TASIPNNAANHVNLQDWLLTLVGTVTKDVFAKVLIIMWSIWKN  418

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSD  439
            RN ++W N      +    +L +L E+ + N  +        + + W KP  GW K + D
Sbjct  419  RNTQLWENKRQRPSEAALLSLGWLTEFTAIN--TSSLGTTVGRQKKWEKPRHGWYKCSCD  476

Query  438  EALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKV  259
             A  ++    G G+V+ D +GQF A        +  P  AE IA+ E LK  ++L + K+
Sbjct  477  GAFVTDIHRGGSGVVIRDEHGQFRAGAGKVLVQVTSPFHAELIALLEGLKLAETLHISKI  536

Query  258  QIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
              E+DC+ + QA++      S+   II +++E    + +     V R AN+VAH LA  A
Sbjct  537  VFETDCLLLQQAVSQPDTDLSTLGTIIAEVKEFLHRYADFRVLHVPREANRVAHILANHA  596

Query  81   M  79
            +
Sbjct  597  L  597



>ref|XP_010690674.1| PREDICTED: uncharacterized protein LOC104904177 [Beta vulgaris 
subsp. vulgaris]
Length=280

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/242 (33%), Positives = 112/242 (46%), Gaps = 5/242 (2%)
 Frame = -1

Query  801  R*VLFYAFVSCSLAQKCWDLFEH--TIPHHCVSFMDWVELQFNSLSDNELCKLISICWKV  628
            R V  +  V   +A+  W    H   +     S  DW    F  + + ELC  ++  W +
Sbjct  12   RVVYMHVLVHFPMAKAVWRCSSHDGRLCEGGGSLGDWWGRCFEKMEEEELCVFLTTAWAI  71

Query  627  WDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET-WSKPLVGWLK  451
            W AR   +  N      D +  A+    E   A Q+    S       T W+KP   W+K
Sbjct  72   WGARCRALMANEKSDPVDTLGYAMMISSETLEARQIHVAASSEISAHPTSWAKPAPHWMK  131

Query  450  LNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQ  271
            +N D  L   S   G+G+V WD  G+ +AA +  +        AEA AI   LK    L 
Sbjct  132  VNVDAGL-VGSLGCGIGVVCWDYMGEVLAASTFQFHETWETRVAEAKAIFYGLKVALELG  190

Query  270  LDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIREIARDFTNLSFHFVKRSANKVAHEL  94
               V++ESD +  IQA+ S    SS F LII+D+ ++   F+N+ + FVKRS NKVAH L
Sbjct  191  YAHVEVESDSLLAIQALRSGKGGSSDFHLIIDDVLDLVSSFSNVEWSFVKRSGNKVAHML  250

Query  93   AR  88
            A 
Sbjct  251  AH  252



>ref|XP_009623190.1| PREDICTED: uncharacterized protein LOC104114439 [Nicotiana tomentosiformis]
Length=362

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 123/264 (47%), Gaps = 10/264 (4%)
 Frame = -1

Query  792  LFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARN  613
            + +  V C+ A+  W            SFM W       ++  +L   I + W++W+ARN
Sbjct  95   IMHCLVMCNAAKLVWLKSSMGWRPVGTSFMKWFTTLVAVVTSEKLQGAIMLLWEIWNARN  154

Query  612  EKVWNNIVISSHDVVSGALSYLLEWQSA---NQLshhqshvshqVETWSKPLVGWLKLNS  442
              VWN   I    ++  A  +  EW S    N +             W  P  G LK N 
Sbjct  155  NLVWNGRTIRLETIILRANRFWKEWTSTRSDNNIYSVAGPEFVI--KWFPPDPGTLKCNI  212

Query  441  DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDK  262
            D + D NS     G+++   +  FV   + P +     + AE + +REAL WLK +Q  K
Sbjct  213  DASYDVNSGRAWDGMLIRSTHENFVRGFTTPLEASHDAVIAEILTVREALSWLK-MQHHK  271

Query  261  --VQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
              + IE DC+   QA+  S +  S FD+I+ D + +  DFT++S  FVKRSAN+ AH L 
Sbjct  272  SPITIEMDCLLAKQALERSDNGNSYFDIIVQDCKVLMCDFTSISLSFVKRSANQCAHMLV  331

Query  90   REAMFKADCMVCVSVPFPCIAHSL  19
            R A   +D M  +  P P + H +
Sbjct  332  RAASSMSDAMEWIVHP-PSLIHDV  354



>ref|XP_002531759.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30615.1| conserved hypothetical protein [Ricinus communis]
Length=163

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  483  TWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAI  304
             W+ P +G +K+N D  + SN   MG+G V+ D  G FV A ++ + G  +P  AE +AI
Sbjct  27   VWNTPSLGSMKVNMDATIFSNPDSMGVGCVMKDHAGLFVCAMAVSFAGAYIPEIAEGLAI  86

Query  303  REALKWLKSLQLDKVQIESDCIKVIQA-INSTSLCSSFDLIINDIREIARDFTNLSFHFV  127
            +EAL W +  QL  V  E DC+ +++A +   +  SS  LII D + ++   +N SF FV
Sbjct  87   QEALSWARDRQLLNVVFELDCLHIVEALLRKGTDRSSLGLIIKDCKLLSSSISNCSFAFV  146

Query  126  KRSANKVAHELAR  88
            KRS N+VAH+LAR
Sbjct  147  KRSRNEVAHKLAR  159



>ref|XP_012074502.1| PREDICTED: uncharacterized protein LOC105635962 [Jatropha curcas]
Length=379

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 116/257 (45%), Gaps = 6/257 (2%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
             + +   +C+     W +          S  DW++     L   +      + W++W  R
Sbjct  110  TVLHCLYNCAYVTLVWSMSGVGCFKGVASMEDWLDCCKMFLDKEQQQLSFFLMWELWLHR  169

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQL----shhqshvshqVETWSKPLVGWLKL  448
            N++VW     +   ++ GA   ++EWQ A Q+    S  Q+   +    W  P  G LKL
Sbjct  170  NKRVWEQRAWNVDKILYGARRNMVEWQQAQQIKLPISGVQAVSLNSSVRWQNPDSGMLKL  229

Query  447  NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQL  268
            N D A D +S     G +L    G  V   S            EAI IREAL WLK L L
Sbjct  230  NIDAAYDGSSGKSSCGWILRRHDGNMVGGGSRNCGTTLNASVPEAIGIREALSWLKPLNL  289

Query  267  -DKVQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHEL  94
             + V ++SDC+ V+  INS     S   LI+  I+E+  D    S  FV +SAN+V H L
Sbjct  290  KESVLVKSDCMVVVHLINSQVQDLSYLGLIVKQIKELMSDINLSSISFVCKSANQVTHSL  349

Query  93   AREAMFKADCMVCVSVP  43
            AR A+  AD M   ++P
Sbjct  350  ARAALLHADFMEWGTIP  366



>ref|XP_008226303.1| PREDICTED: uncharacterized protein LOC103325890 [Prunus mume]
Length=271

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/234 (29%), Positives = 108/234 (46%), Gaps = 4/234 (2%)
 Frame = -1

Query  771  CSLAQKCWD---LFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVW  601
            C  A+  W    +    I        DWV    + LS   L     I W +W+ARN K+W
Sbjct  11   CPFARGVWACALIGSGGISQQYHHVHDWVLSCIDHLSYANLDLFFVIGWAIWEARNGKLW  70

Query  600  NNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSN  421
            NN         S A   LL++  A           +  + W+KP  G LK+N D +  + 
Sbjct  71   NNQTPKPEFTSSSAAVRLLDFVRARPQGTALGRGCYAPQPWTKPCAGSLKINVDGSWTAG  130

Query  420  SR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDC  241
            +   G+G+V+ D+ G+FVA +++  D +   ++ EA+A RE          +    ESD 
Sbjct  131  NTYGGVGIVVRDSNGKFVAGRALHVDNVFSALQVEAMAAREGAILAVEGDFNNAIFESDS  190

Query  240  IKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
            ++++ AI S+S+  S+   ++ D + +    T   F  ++R AN  AH LAR A
Sbjct  191  LQIVSAIRSSSVDRSNVGPVVEDTKALLTQITGDGFTHIRRVANGAAHRLARYA  244



>ref|XP_003629388.1| Cytochrome P450 [Medicago truncatula]
Length=687

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 110/214 (51%), Gaps = 7/214 (3%)
 Frame = -1

Query  669  DNELCKLISIC-WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvsh  493
            D +  ++ S+  W +W  RN KVWNNI  ++ D+ + A S L  W++A  + H       
Sbjct  462  DQQQKQIFSVTLWSIWKHRNNKVWNNITDTAQDICARAGSLLTSWRNAQNIRHPSPQNPS  521

Query  492  qVE--TWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPME-  322
                  W KP  G    N D +       +G+G+ + D  G+FV AK+  W    L +E 
Sbjct  522  TPNDLKWVKPSPGRFTCNVDASFSQARNRVGIGVCIRDEEGRFVLAKT-EWMTPLLDVEL  580

Query  321  AEAIAIREALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIRE-IARDFT  148
             EA+ +  A+ W++ LQL  V  E D   V+ ++  STS  S+F  +IN+ R  +A D  
Sbjct  581  GEALGLLSAMHWVRDLQLGIVDFELDSKSVVDSLYGSTSGVSNFSAVINECRRLLASDLV  640

Query  147  NLSFHFVKRSANKVAHELAREAMFKADCMVCVSV  46
                 F++R AN+VAH  AR A+ +  C++ VS+
Sbjct  641  TSDVRFIRRQANEVAHSFARVALLEWLCVMLVSI  674



>ref|XP_012081735.1| PREDICTED: uncharacterized protein LOC105641750 [Jatropha curcas]
Length=227

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 103/206 (50%), Gaps = 3/206 (1%)
 Frame = -1

Query  651  LISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSAN--QLshhqshvshqVETW  478
            L+ + W +W  RN  VW     S + +V+ A  +  +W++A         S       +W
Sbjct  9    LVVLLWFLWYNRNLLVWKGTNNSPNIIVAQAGRFFQDWRTAQIAHTPSPCSSCPVLHRSW  68

Query  477  SKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIRE  298
            + P  G LKLN D ++ ++    G G +L D+ G+F+ A +    G   P  AEAI +RE
Sbjct  69   TPPCPGSLKLNVDASVFADLNCTGFGALLRDSRGRFIVAVTGTVAGNRTPRMAEAIGLRE  128

Query  297  ALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKR  121
             L WLK+ Q   V +E D  +V   + ++   CS F L+++D + +  +    SF++V+R
Sbjct  129  VLSWLKTQQFGSVVVELDAHEVCHVLSDNAGDCSEFGLVVSDCKFLGVEANVSSFYWVRR  188

Query  120  SANKVAHELAREAMFKADCMVCVSVP  43
              N VAH LAR A       +  S+P
Sbjct  189  RVNTVAHSLARVAYLHTGLHIWNSLP  214



>ref|XP_012081306.1| PREDICTED: uncharacterized protein LOC105641393 [Jatropha curcas]
Length=262

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 113/234 (48%), Gaps = 3/234 (1%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI-CWKVWDARNE  610
            +    C  A+ CW L    +    + F D + L F    + E C L  + C+ +W  RN 
Sbjct  2    HMLFGCEKARLCWTLARLPLNGSAIRFSD-ILLGFIDRHNEEHCLLFGVLCYFIWFDRNR  60

Query  609  KVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEAL  430
            +VW    +  +++V  A S+  EW++A     + S     + TW+ P +G +K N D A+
Sbjct  61   RVWQQTDVDPYNIVMAATSFPREWKNAQISRCNSSSPPASILTWAPPPIGIVKCNFDAAV  120

Query  429  DSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIE  250
             +         ++ +  GQF+AA +  + G+     AEAI +RE L WL +     V +E
Sbjct  121  HTTEGRSSYASLVRNEVGQFLAACTGHFAGVLQSHIAEAIGLREVLSWLLARSFGGVLLE  180

Query  249  SDCIKVIQAINST-SLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
            +DC+++ QA+ +     S +  ++ +I+ +     +    +V+R  NK AH LA
Sbjct  181  TDCLRLFQAVTTGFEHYSDWAPVLEEIKHLLSQIPSCELIWVRRQVNKPAHALA  234



>ref|XP_012066146.1| PREDICTED: uncharacterized protein LOC105629211 [Jatropha curcas]
Length=383

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 123/256 (48%), Gaps = 4/256 (2%)
 Frame = -1

Query  771  CSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNI  592
            C  A+ CW L    +    + F+D +    +  SD      + +C+ +W  RN +VW   
Sbjct  128  CEKARLCWTLARIPLDGSAIGFIDLLLGFIDQRSDEHCLLFVVLCYFIWFDRNRRVWQPT  187

Query  591  VISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNS-R  415
             +  +++V  A S+L EW++A       S  S  V TW  P  G +K N D A+ + + R
Sbjct  188  NVDPYNIVMAATSFLREWKNAQISRSPSSSPSASVLTWVPPPTGAVKCNFDAAVHTTAGR  247

Query  414  *MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIK  235
                GLV  +A GQF+ A +  +  +     AEAI +RE L WL +    +V +E+DC++
Sbjct  248  SSYAGLVRSEA-GQFLVACTGHFAEVLKTHIAEAIGLREVLSWLLTRSFGRVLLETDCLR  306

Query  234  VIQAINST-SLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADCMV  58
            + QA+ +     S +  ++ +I+++     +    + +R  NK AH LAR A     C  
Sbjct  307  LFQAVTAGFEPFSDWAPVLEEIKQLLSQNPSYELIWARRQVNKPAHALARVACLHP-CFH  365

Query  57   CVSVPFPCIAHSLELD  10
               + F CI   + LD
Sbjct  366  SWDMIFHCIEDLIALD  381



>ref|XP_012085065.1| PREDICTED: uncharacterized protein LOC105644336 [Jatropha curcas]
Length=278

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/265 (29%), Positives = 131/265 (49%), Gaps = 12/265 (5%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVEL--QFNSLSDNELCKLISIC-WKVW  625
             L +A V C  A+ CW  F   +  H   F +++++    + + ++E  +   +C W VW
Sbjct  15   TLAHALVECPKARFCWQFF--AVELHIGKFSNFLQMFEYLHKVWESEFLESFIMCLWSVW  72

Query  624  DARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshh---qshvshqVETWSKPLVGWL  454
             +RNE  WN +    + VV+ A   L  W+ A QL          +     W  P  G  
Sbjct  73   LSRNELKWNQVEEGPYHVVTRARRILASWKKA-QLKLSGSDTGIGTSGGSQWFPPPTGTF  131

Query  453  KLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSL  274
            K+N D AL  +     +G V+ + +G FV+A +    G   P  AEA A+R+ L W+ S 
Sbjct  132  KINFDAALLPSVGHGAVGAVISNCHGGFVSAATSSLQGCSSPAVAEAQALRKVLSWVLSG  191

Query  273  QLD-KVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAH  100
              +  +Q+E+DC++V  A+ S++   S F ++I++ + +     ++S  +++R AN +AH
Sbjct  192  HPNLTIQVETDCLQVYHAMKSSANDWSEFGVVISECKLLLVQLPSVSLAWIRRQANDIAH  251

Query  99   ELAREAMFKADCMVCVSVPFPCIAH  25
             LA+    +A   +    P  CIAH
Sbjct  252  VLAKSVPSEACFQIWDDAP-NCIAH  275



>ref|XP_012089684.1| PREDICTED: uncharacterized protein LOC105648037 [Jatropha curcas]
Length=1259

 Score =   103 bits (256),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 116/238 (49%), Gaps = 7/238 (3%)
 Frame = -1

Query  789   FYAFVSCSLAQKCWDL-FEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARN  613
              +  V+C  +++ W   F         SF +W+   F   +D +    +++CW++W +RN
Sbjct  998   LHLLVNCYFSEQVWQASFLGWYSPIVNSFQEWLSQIFRIFNDKDAAMALTVCWQIWKSRN  1057

Query  612   EKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEA  433
               +W     S+  +   A  ++ +W  A  +   +         W +P + W+K+N D A
Sbjct  1058  NVIWKQQFPSAMAIWMRAWRFIEDWSKATAVVGRRLATVI---KWQRPELNWVKVNVDAA  1114

Query  432   LDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQI  253
                     G G+V+ D+ G  +  K   +     P EAEA+A++EAL WL+     K+ +
Sbjct  1115  GTVGDSCAGFGVVVRDSNGAVLGLKIGRFGTGLRPKEAEAMAVKEALSWLEGKGWSKLVV  1174

Query  252   ESDCIKVIQAINSTSLCSS--FDLIINDIREI-ARDFTNLSFHFVKRSANKVAHELAR  88
             ESD + VI A+N  S      F  IIN I +I +R  + + F  + RS+N++AH LA+
Sbjct  1175  ESDNLMVINALNDKSYLDGTVFGDIINSICQISSRIRSEVKFRHIYRSSNEIAHGLAQ  1232



>ref|XP_012070547.1| PREDICTED: uncharacterized protein LOC105632718 [Jatropha curcas]
Length=1382

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 117/238 (49%), Gaps = 7/238 (3%)
 Frame = -1

Query  789   FYAFVSCSLAQKCWDL-FEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARN  613
              +  V+CS +++ W   F         SF +W+   F   +D +    +++CW++W++RN
Sbjct  1121  LHLLVNCSFSKQVWQASFLGWYSPIVNSFQEWLSQIFRIFNDKDAVMALTVCWQIWNSRN  1180

Query  612   EKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEA  433
               +W     S+  +   A  ++ +W  A  +   +         W +P + W+K+N D A
Sbjct  1181  NVIWKQQFPSAMAIWMRAWRFIEDWSKATAVVGRRLATVI---KWQRPELNWVKVNVDAA  1237

Query  432   LDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQI  253
                     G G+V+ D+ G  +  K   +     P EAEA+A++EAL WL+     K+ +
Sbjct  1238  GTVGDSCAGFGVVVRDSNGAVLGLKIGRFGTGLRPKEAEAMAVKEALSWLEGKGWSKLVV  1297

Query  252   ESDCIKVIQAINSTSLCSS--FDLIINDIREI-ARDFTNLSFHFVKRSANKVAHELAR  88
             ESD + VI A+N  S      F  II  I +I +R  + + F  + RS+N++AH LA+
Sbjct  1298  ESDNLMVINALNDKSYLDGTVFGDIIYSICQISSRIRSEVKFRHIYRSSNEIAHGLAQ  1355



>ref|XP_010686140.1| PREDICTED: uncharacterized protein LOC104900422 [Beta vulgaris 
subsp. vulgaris]
Length=322

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/251 (31%), Positives = 114/251 (45%), Gaps = 15/251 (6%)
 Frame = -1

Query  813  CAM*R*VLFYAFVSCSLAQKCWDLFE--HTIPHHCVSFMDWVELQFNSLSDNELCKLISI  640
            C M      ++   C LAQ  W   E    +P  C+S   W    FN + D ++C  ++ 
Sbjct  48   CGMAEDSALHSLAYCPLAQGIWASSEIRQGVPRGCLSVAGWFAYCFNLMDDGDVCLFLTT  107

Query  639  CWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQS---ANQLshhqshvshqVETWSKP  469
            CW VW AR +      V   +   + A     E +      Q++            W  P
Sbjct  108  CWAVWGARCKMSIEGEVSPPNRTAAYAAKICAEAREVVDVVQVAGKSVGSVTSQVRWQAP  167

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIP----WDGLCLPMEAEAIAIR  301
              GW+K+N D          G+G+V  D  G  ++  ++     W+    P+ AEA A+ 
Sbjct  168  SDGWMKINVDAGQAGGGL-SGLGVVCRDTEGSILSCAAVQIRANWE---TPI-AEARAVL  222

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVK  124
            E +   K+L L KV IESDC +V+QA+       SSF+LII+DI  +      + + FVK
Sbjct  223  EGVVMAKTLGLQKVIIESDCQRVVQALQKQEKGSSSFNLIIDDIVSVILSSLQVVWSFVK  282

Query  123  RSANKVAHELA  91
            R  N+VAHELA
Sbjct  283  RVGNRVAHELA  293



>ref|XP_008227720.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=342

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 120/249 (48%), Gaps = 4/249 (2%)
 Frame = -1

Query  813  CAM*R*VLFYAFVSCSLAQKCW---DLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLIS  643
            C++      +    C  A+ CW    L          S  +WV     SL+  +L     
Sbjct  68   CSLMSETTLHVLRDCPFARCCWLSSSLGSLRNLERLPSVWEWVSHYIRSLTLADLDLFFM  127

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            I W +W+ RN  +W N       V   A + LLE+   N           QV+ W+KP +
Sbjct  128  IGWSIWEQRNGLLWKNKSSCPSLVGLVARNRLLEFVQINGSGGTSCSTRDQVQRWTKPPM  187

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
             + K+N D A +++++  G+G+V+ D+ G F+  ++  +D +   +++EA+A RE +   
Sbjct  188  SFFKINVDGAWNADTKSGGVGVVVRDSTGAFIVGRARKFDNVFSALQSEALAAREGVVLE  247

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSF-DLIINDIREIARDFTNLSFHFVKRSANKV  106
                L  +  ESD ++++ A+  +SL  SF   I+ D + +    T   F+ V+R+AN+ 
Sbjct  248  AERGLTNICFESDSLQIVTALGYSSLDRSFIGPILEDSKFLLLQITGEGFNHVRRTANEA  307

Query  105  AHELAREAM  79
            AH +AR A+
Sbjct  308  AHHIARFAL  316



>ref|XP_012089435.1| PREDICTED: uncharacterized protein LOC105647818 [Jatropha curcas]
Length=278

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/265 (29%), Positives = 130/265 (49%), Gaps = 12/265 (5%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVEL--QFNSLSDNELC-KLISICWKVW  625
             L +A V C  A+ CW  F   +  +  +F +++++    N   ++      I   W VW
Sbjct  15   TLAHALVECPKARLCWQFF--GVQPNIGNFPNFLQMLEHLNKAWESAFFDSFIMGLWSVW  72

Query  624  DARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshh---qshvshqVETWSKPLVGWL  454
             +RNE  WN++    + VV+ A S L  W+ A QL          +     W  P  G  
Sbjct  73   LSRNELKWNHVEEGPYHVVTRARSMLASWKKA-QLKLSGSDTGIGASAGSQWLSPPTGTF  131

Query  453  KLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSL  274
            K+N D  L  +     +G V+ + +G FV+A      G   P  AEA A+R+ L W+ S 
Sbjct  132  KINFDVTLLPSVGHGAIGAVISNCHGGFVSAAMSSLHGCSSPAVAEAQALRKVLSWVLSG  191

Query  273  QLD-KVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAH  100
              +  +QIE+DC++V  A+ S++   S F ++I++ + +     +++  +++R AN +AH
Sbjct  192  HPNLTIQIETDCLQVYHAMKSSAHDWSEFGVVISECKLLLVQLPSVTLAWIRRQANDIAH  251

Query  99   ELAREAMFKADCMVCVSVPFPCIAH  25
             LA+    +A   +  S+P  CIAH
Sbjct  252  VLAKSVPSEACFQIWDSIP-ACIAH  275



>ref|XP_012075337.1| PREDICTED: uncharacterized protein LOC105636626 [Jatropha curcas]
Length=1127

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 132/265 (50%), Gaps = 12/265 (5%)
 Frame = -1

Query  795   VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVEL--QFNSLSDNELCKLISIC-WKVW  625
              L +A V C  A+ CW  F   +  H   F +++++    + + ++E  +   +C W VW
Sbjct  864   TLAHALVECPKARFCWQFF--GVELHIGKFSNFLQMFEYLHKVWESEFLESFIMCLWSVW  921

Query  624   DARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshv---shqVETWSKPLVGWL  454
              +RNE  WN +    + VV+ A   L  W+ A QL    S     +     W  P  G  
Sbjct  922   LSRNELKWNQVEEGPYHVVTRARRILASWKKA-QLKLSGSDTDIGTSGGSQWFPPPTGTF  980

Query  453   KLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSL  274
             K+N D AL  +     +G V+ + +G FV+A +    G   P  AEA A+R+ L W+ S 
Sbjct  981   KINFDAALLPSVGHGAVGAVISNCHGGFVSAATSSLQGCSSPAVAEAQALRKVLSWVLSG  1040

Query  273   QLD-KVQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFHFVKRSANKVAH  100
               +  +Q+E+DC++V  A+ S++   S F ++I++ + +     ++S  +++R AN +AH
Sbjct  1041  HPNLTIQVETDCLQVYHAMKSSANDWSEFGVVISECKLLLVQLPSVSLAWIRRQANDIAH  1100

Query  99    ELAREAMFKADCMVCVSVPFPCIAH  25
              LA+    +A   +    P  CIAH
Sbjct  1101  VLAKSVPSEACFQIWDDAP-NCIAH  1124



>ref|XP_007212995.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
 gb|EMJ14194.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
Length=887

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 108/212 (51%), Gaps = 1/212 (0%)
 Frame = -1

Query  711  SFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQS  532
            S  DWV   F SL+  +L     + W +W+ RN   WNN       V   A + LLE+  
Sbjct  650  SVKDWVSHCFRSLTPTDLGFFFMMGWSLWEQRNGLPWNNKSSCPSLVGHIAHNRLLEYLQ  709

Query  531  ANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSI  352
             N+          QV+ W+KP +  LK+N D A ++ ++  G+G+V+ D+ G F+A ++ 
Sbjct  710  VNRPGGTPCSNQDQVQRWTKPPMRHLKINVDGAWNAITKSGGVGVVIRDSAGAFIAGRAR  769

Query  351  PWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSF-DLIIND  175
             +D +   ++ EA+A RE +       L  +  ESD ++++ A+  +SL  SF   I+ D
Sbjct  770  KFDNVFSALQIEALAAREGVVLAVERGLTNICFESDSLQIVTALGCSSLDRSFIGPILED  829

Query  174  IREIARDFTNLSFHFVKRSANKVAHELAREAM  79
             + +    T   F  V R+AN+  H +AR A+
Sbjct  830  SKFLLLQITGEGFAHVCRTANEATHRIARFAL  861



>ref|XP_009368150.1| PREDICTED: uncharacterized protein LOC103957683 [Pyrus x bretschneideri]
Length=241

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 108/213 (51%), Gaps = 7/213 (3%)
 Frame = -1

Query  672  SDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvsh  493
            S  ELC  +++ W +W  RNE +WN   ++  ++V  A  +L E+   ++   +      
Sbjct  20   SGFELC--LTLIWSLWHNRNEVLWNGKPLNPFEIVLQAEGWLQEFHRCDK--TNAKKGRR  75

Query  492  qVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEA  313
            +++ WSKP  GW+K N D A   + +  G G+V+ +  G F+ A + P++ +   + AE 
Sbjct  76   ELQKWSKPDEGWVKCNFDGAWIPSQKRGGFGVVIRNQVGDFLGAAAGPFERITSALHAEF  135

Query  312  IAIREALKWLKSLQLD--KVQIESDCIKVIQAINSTSLCSS-FDLIINDIREIARDFTNL  142
            +A R+AL  +  L      VQ E D +  + A+    + SS F  IIND+R   R +++ 
Sbjct  136  MAARQALLLVNMLYSTDVHVQFEGDAVIAVSAMKDQGVDSSVFGPIINDLRCFLRKWSSS  195

Query  141  SFHFVKRSANKVAHELAREAMFKADCMVCVSVP  43
                V+R  N VAH LAR  +  A  +V    P
Sbjct  196  KLSNVQREGNSVAHRLARFGVTCARAVVGFEEP  228



>ref|XP_010682311.1| PREDICTED: uncharacterized protein LOC104897185 [Beta vulgaris 
subsp. vulgaris]
Length=345

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 119/245 (49%), Gaps = 20/245 (8%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWD--LFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
             +A + C LAQ  W+    E  +   CVS  +W       +++ E+   +++ W VW AR
Sbjct  80   LHALLRCGLAQGVWEECGCEFDLLVRCVSVANWWSYSVKEMNEEEVGLFLTLYWAVWGAR  139

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQLs-----hhqshvshqVETWSKPLVGWLK  451
               +  +      D    AL     WQ A   S          V+  ++ WS P  GW+K
Sbjct  140  CSALMESNFAKPADTCYYALK---TWQEAKDASLHNNPASSKMVAPHLDAWSLPQGGWVK  196

Query  450  LNSDEALDSNSR*MGMGLVLWDAYGQF----VAAKSIPWDGLCLPMEAEAIAIREALKWL  283
             N D  + ++   +G+G V  D  G+     V  + + W+       AEA A+ E ++  
Sbjct  197  CNVDAGMVADFG-VGVGAVCRDEVGEVLGCAVLQQHVGWE----MRVAEARAVFEGVRLA  251

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIREIARDFTNLSFHFVKRSANKV  106
            K+L + K+ +ESDC++VI A+ S S  +S F LII DI E  + F  + + FVKR+ NKV
Sbjct  252  KNLGVRKLIVESDCLQVISALKSKSTGASDFYLIIEDIPEFVKFFNVVVWSFVKRTGNKV  311

Query  105  AHELA  91
            AH +A
Sbjct  312  AHMMA  316



>ref|XP_008352730.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=331

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/245 (27%), Positives = 109/245 (44%), Gaps = 11/245 (4%)
 Frame = -1

Query  786  YAFVSCSLAQKCW---DLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
            +  + C  A+  W    L   ++ H  +    W+      LS      ++ + W +W  R
Sbjct  62   HVLLRCPHAKATWCSSPLGLPSMQHGDIGLQGWLARLVYHLSRESFELVLILLWNIWKXR  121

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDE  436
            NE VW  + I+  ++   A ++LLE++  N +             W KP  GWLK N D 
Sbjct  122  NELVWKGVTIAPXEIPIKAHTWLLEFKKWNVVHPKTKTADV--HKWRKPEXGWLKCNFDG  179

Query  435  ALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQ  256
            A D +     +G+V+ D  G+FVAA ++  +G+   +  E  A R A+ +++     KV 
Sbjct  180  AWDEHRAVGRVGIVIKDTDGEFVAAXALKLEGITXXLLVETTAARXAVLFVQQWWTRKVI  239

Query  255  IESDCIKVIQAI------NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHEL  94
            +E D + VI AI      N        D   ++ R + + F      FV++  N VAH L
Sbjct  240  LEGDALLVIAAIQNGVNVNHGPYGLVGDCCYSEWRTLLQXFQQWKAQFVRKEVNXVAHRL  299

Query  93   AREAM  79
            AR  +
Sbjct  300  ARRGL  304



>ref|XP_010689379.1| PREDICTED: uncharacterized protein LOC104903088 [Beta vulgaris 
subsp. vulgaris]
Length=259

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 93/186 (50%), Gaps = 3/186 (2%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE-TWSKPL  466
            + W VW  RN  V+   +I   +VVS A+  + E Q   +               W  P 
Sbjct  42   LLWGVWLRRNAWVFERKIIKVEEVVSKAMKLVGECQPQEEPKRINDSAEPIKPIRWKPPG  101

Query  465  VGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
             G  K+NSD A+  + + +G+G V+ D  G  +AA      G     EAEA+A R A   
Sbjct  102  FGLYKINSDAAVSEDGK-VGLGGVMRDDVGDVIAAVCEEVRGRVEVSEAEAMAARLAFST  160

Query  285  LKSLQLDKVQIESDCIKVI-QAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
               + L  + +ESDC+K+I Q  N T   +SF  I  DI+E+A+ + N+SF FV R  NK
Sbjct  161  AIDVGLRDIILESDCLKLITQLKNGTEDQTSFGFITRDIQELAKLYRNISFEFVSREGNK  220

Query  108  VAHELA  91
            VA +LA
Sbjct  221  VAQKLA  226



>ref|XP_002518871.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43404.1| conserved hypothetical protein [Ricinus communis]
Length=668

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 102/191 (53%), Gaps = 9/191 (5%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDL--FEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWD  622
             LF+    CS+A++CWDL  F  + P        W++  F    ++   K+  +C  +W+
Sbjct  478  TLFHVLFGCSMARECWDLLGFRFSFPTES-PICSWIQNFFIDNHEDTCAKMALVCGSLWN  536

Query  621  ARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ-----LshhqshvshqVETWSKPLVGW  457
             RN  VWN    +++ V+S A + LLE ++  Q     ++    H +     W+KP +GW
Sbjct  537  QRNHWVWNKQSNTTYGVISPA-NQLLEQRTRAQSADEEIAPPLGHNTDVTRKWTKPELGW  595

Query  456  LKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKS  277
            LK+N+D AL      +G+G V+ D+ G+ + A+S    G     EAEA++++EAL ++K 
Sbjct  596  LKINTDTALFLKQGRIGLGCVVRDSNGRMIMARSERRVGRFTAREAEALSMKEALSYMKD  655

Query  276  LQLDKVQIESD  244
             Q+DK   E D
Sbjct  656  YQMDKCFFELD  666



>ref|XP_012083753.1| PREDICTED: uncharacterized protein LOC105643257 [Jatropha curcas]
Length=326

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 105/196 (54%), Gaps = 3/196 (2%)
 Frame = -1

Query  669  DNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshq  490
            D++      +C+ +W  RN  VW    I+ ++VV  A S+L EW +      + S  S  
Sbjct  122  DDQCLLFGMLCYFIWFDRNRWVWQQTNIAPYNVVMAATSFLREWNNMQIDRSNSSVSSAL  181

Query  489  VETWSKPLVGWLKLNSDEALD-SNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEA  313
            V TW+ P  G +K N D A+  +  R    GL+  +  GQF+ A +  ++G+  P  AEA
Sbjct  182  VPTWAPPPTGVVKSNVDAAVRMTEGRSSYAGLIR-NEVGQFLVACTGHFEGVLKPHIAEA  240

Query  312  IAIREALKWLKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREIARDFTNLSF  136
            I +RE L W+ +  +D+V +E+DC+++ QA+ +     S +  ++ +I+++    ++   
Sbjct  241  IGLREVLSWMLTRSIDRVLVETDCLRLFQAVTTGFDSYSDWAPVLEEIKQLLSQISSSEL  300

Query  135  HFVKRSANKVAHELAR  88
             +V+R  N  AH LAR
Sbjct  301  VWVQRQGNMPAHALAR  316



>ref|XP_012086245.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Jatropha curcas]
Length=900

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 112/217 (52%), Gaps = 15/217 (7%)
 Frame = -1

Query  762  AQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI-CWKVWDARNEKVWNNIVI  586
            A+ CW L    +     SF D + L       N+ C L  + C+ +W  RN +VW    I
Sbjct  10   ARLCWTLTGIPLDGSSTSFSDTL-LGIIDRRSNDHCLLFGVLCYFIWFDRNRRVWQQTNI  68

Query  585  SSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MG  406
            + +++V  A S+L EW++A     + S  S  V TW+ P  G +K N D A+      M 
Sbjct  69   APYNIVMAATSFLREWKNAQIDRSNSSVPSTLVPTWAPPPTGVVKCNVDAAVH-----MT  123

Query  405  MGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQ  226
             G      YGQF+ A +  + G+  P  AEAI +RE L WL +  +D+V +E+DC+++ Q
Sbjct  124  EG-----TYGQFLVACTGHFAGVLKPHIAEAIGLREVLSWLITRSIDRVLVETDCLRLFQ  178

Query  225  AINSTSLCSSFD--LIINDIREIARDFTNLSFHFVKR  121
            A+ +T   S FD   ++ +I+++    ++    +V+R
Sbjct  179  AV-TTGFDSYFDWAPVLEEIKKLLSQISSSELVWVRR  214



>ref|XP_009123737.1| PREDICTED: uncharacterized protein LOC103848614 [Brassica rapa]
Length=252

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 114/254 (45%), Gaps = 13/254 (5%)
 Frame = -1

Query  792  LFYAFVSCSLAQKCWDLFE-----HTIPHHCVSFMDWVELQFNSLSDNELCKLIS--ICW  634
            + + F  CS A + W+L       HT  H  +S      L    L    L   IS  ICW
Sbjct  1    MLFIFFHCSFATQVWNLAPIKQTFHTTEHDTLSSAIRESLTLICLPPTGLLVNISSWICW  60

Query  633  KVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWL  454
             +W ARN  V+ N  +++   +S ALS   EWQ+A          S             +
Sbjct  61   YLWSARNLLVFENRHVTARTTISSALSSAREWQAAQHYDTVPRSPSLTPPEPHNEGPFAV  120

Query  453  KLNSDEALDSNSR*MGMGLVLWDAYGQFVAAK---SIPWDGLCLPMEAEAIAIREALKWL  283
              NSD A    +   G+G   W   G   AA+   S     +  P+ AEA+A+REAL+  
Sbjct  121  LCNSDAAWSKETETAGLG---WMFDGPAPAARQCMSTTRHAVSSPLMAEALAMREALQAA  177

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
            K   L  V   +D  ++++AINS S       +++DI  ++R F ++ F +V RS N +A
Sbjct  178  KQGLLSNVWFRTDSQELVRAINSKSFSVELYGVLSDIEFLSRSFISVLFSYVPRSQNLIA  237

Query  102  HELAREAMFKADCM  61
              LA+ A+  A  +
Sbjct  238  DSLAKNALRSAATL  251



>ref|XP_012085836.1| PREDICTED: uncharacterized protein LOC105644933 [Jatropha curcas]
Length=408

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 103/216 (48%), Gaps = 6/216 (3%)
 Frame = -1

Query  771  CSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI-CWKVWDARNEKVWNN  595
            C  A+ CW L    +      F D + L        E C   S+ C+ +W  RN +VW  
Sbjct  183  CEKARLCWTLTGIPLDRSTTDFRDML-LGLIDRCSTEQCSFFSVLCYFIWFDRNRRVWQQ  241

Query  594  IVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR  415
            I +  +++V  A S+L EW++A     + S       TW  P  G +K N D A+ +   
Sbjct  242  INVDPYNIVMAATSFLREWKNAQLNRSNSSVPLASGPTWVPPPTGTVKCNFDAAIHATEG  301

Query  414  *MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIK  235
                  ++ D  GQF+ A +  + G+  P  AEAI +RE L WL    +++V +E+DC++
Sbjct  302  RSSYAGLIRDEAGQFLVACTGHFAGVLQPHIAEAIGLREVLYWLLMRNIERVLVETDCLR  361

Query  234  VIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFV  127
            + QA+  T+    +      + EI + F  L++H V
Sbjct  362  LFQAV--TTGFEPYSDWAPVLEEIKQRF--LNYHLV  393



>ref|XP_010696211.1| PREDICTED: uncharacterized protein LOC104908759 [Beta vulgaris 
subsp. vulgaris]
Length=338

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 116/234 (50%), Gaps = 3/234 (1%)
 Frame = -1

Query  714  VSFMDWVE-LQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEW  538
            V F +WVE L  + L D        +CW++W ARN  V+++  +   ++V  AL   LE+
Sbjct  100  VRFREWVEELARSRLEDEWWALFWCLCWQIWLARNAWVFDHKRVCFREIVEKALRRGLEY  159

Query  537  QSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAK  358
             +AN      S+V      W  P     KLN+D A+  N+R +G+G V+ D  G  + A 
Sbjct  160  ATANAPKDVLSNVCESSSRWCAPPSALYKLNTDAAMFKNNR-IGLGGVVRDQAGDMLMAT  218

Query  357  SIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLII  181
             +  DG+     AEA++ R  ++      L ++ +E DC+K+   +      SS F  I+
Sbjct  219  CVVVDGVEDVDVAEALSARHGIQTAVDAGLRQLIMEVDCLKLFNYLRDGRRESSPFGFIV  278

Query  180  NDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADCMVCVSVPFPCIAHSL  19
             DI   A   +N+ F  V+RS NKVAH LA+ +    DC V +    P I  S+
Sbjct  279  QDILCAAGLCSNIRFAHVRRSGNKVAHNLAKLSFSIVDCRVWLEEVPPEIVSSV  332



>gb|ABD28710.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=393

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 119/263 (45%), Gaps = 25/263 (10%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFE--HTIPHHCVSFMDWVELQFN---SLSDNELCKLISICWKVW  625
            ++ F  C  A   W+     H I      F +  ++ FN    LS +++  +++I W +W
Sbjct  108  YHIFFHCRTAIDVWNTANVWHLIAPSLSQFDNAPDIIFNLLQKLSASQMESIVTIMWSIW  167

Query  624  DARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ----LshhqshvshqVET--------  481
             +RN K+W  +  SS  ++  A   L  W+ AN     L    S  + + +T        
Sbjct  168  KSRNLKLWQQVSESSVTILERAKHLLEGWRKANHKQGLLGQVHSPTNSRPQTHDSQNTDN  227

Query  480  ------WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEA  319
                  W KP  G LK N D +  ++S  +G+G+ + D+ G  V +K++ +  LC     
Sbjct  228  RYGNIRWRKPKSGRLKCNVDASFSTSSNKVGIGMCIRDSEGNHVRSKTMWFSPLCPVNIG  287

Query  318  EAIAIREALKWLKSLQLDKVQIESDCIKVIQAIN-STSLCSSFDLIINDIREIARDF-TN  145
            EA+ +  A +W+  LQL  V  E D   +    N +    + F  I+ +  +    F TN
Sbjct  288  EALGLYHATRWINELQLTNVDFEVDSKTIADYFNKARGDNTEFGSIMENTIQFCNIFLTN  347

Query  144  LSFHFVKRSANKVAHELAREAMF  76
                F +R AN+VAHELA+ A  
Sbjct  348  SHVEFTRRQANEVAHELAKAATL  370



>ref|XP_008229913.1| PREDICTED: uncharacterized protein LOC103329248 [Prunus mume]
Length=437

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/265 (28%), Positives = 111/265 (42%), Gaps = 4/265 (2%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWD---LFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDA  619
             +  V C  A   WD   L  H     C +  DW+     S +  +   +I++ W +W  
Sbjct  138  LHVLVMCPFAVATWDISMLTRHAHQVRCNTMKDWLREMLESTNKVQRDHIITLLWAIWGN  197

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSD  439
             N  +W  +  S HDVV  A  Y+ E+ + N      ++    V  W+    G LKLN D
Sbjct  198  PNALLWWGVQRSLHDVVVYAQQYVHEFITVNDTLSKVTNRVWNVVKWAALPSGRLKLNFD  257

Query  438  EALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKV  259
             A    S    +G+V  DA G FVAA +     +     A+ +A  E +    SL +   
Sbjct  258  GAFYPTSGRGDVGIVAKDADGGFVAAMAKLVREVQSVEHAKILAAPEGVTLALSLGIASP  317

Query  258  QIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
              E D   V+ A+  +  + S+   I+ D++ + + F    F F  R AN VAH LAR  
Sbjct  318  IFEGDSAVVVAALKQAGQIYSNIGTIVEDVKHLQKQFPGSLFQFTHREANGVAHRLARFG  377

Query  81   MFKADCMVCVSVPFPCIAHSLELDF  7
            +   D      VP   I  +L  D 
Sbjct  378  LHTVDNFTWFEVPPDLIQDALLCDL  402



>ref|XP_012089683.1| PREDICTED: uncharacterized protein LOC105648036 [Jatropha curcas]
Length=216

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 98/190 (52%), Gaps = 6/190 (3%)
 Frame = -1

Query  648  ISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKP  469
            +++CW++W++RN  +W     S+  +   A  ++ +W  A  +   +         W +P
Sbjct  3    LTVCWQIWNSRNNVIWKQQFPSAMAIWMRAWRFIEDWSKATAVVGRRLATVI---KWQRP  59

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
             + W+K+N D A        G G+V+ D+ G  +  K   +     P EAEA+A++EAL 
Sbjct  60   ELNWVKVNVDAAGTVGDSCAGFGVVVRDSNGAVLGLKIGRFGTGLRPKEAEAMAVKEALS  119

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSLCSS--FDLIINDIREI-ARDFTNLSFHFVKRS  118
            WL+     K+ +ESD + VI A+N  S      F  II  I +I +R  + + F  + RS
Sbjct  120  WLEGKGWSKLVVESDNLMVINALNDKSYLDGTVFGDIIYSICQISSRIRSEVKFRHIYRS  179

Query  117  ANKVAHELAR  88
            +N++AH LA+
Sbjct  180  SNEIAHGLAQ  189



>gb|ABN09176.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=260

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 99/202 (49%), Gaps = 8/202 (4%)
 Frame = -1

Query  636  WKVWDARNEKVWNNIVISSHDVVSGALSYLLEW---QSANQLshhqshvshqVETWSKPL  466
            W +W  RN K+W+N+   S  V + A   L EW   Q AN L    +H +     W KP 
Sbjct  51   WSLWKCRNSKLWDNVDTPSLVVCNRARDTLYEWSYMQHANNLVQEITHDAL----WEKPP  106

Query  465  VGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
            +  +K N + AL +N+  MG GL   D+ G F+   S        P EAEA  + EA+K 
Sbjct  107  LTVVKCNVECALFNNNSIMGYGLCFRDSMGHFLPGMSNYEFLRVTPSEAEATGLLEAVKL  166

Query  285  LKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
              +  +  V  +SDC  V+ A+NS+ +  +    II   +++     N S  FV+R ANK
Sbjct  167  AIARGMQSVIFKSDCKIVVDAVNSSVNPHNELGDIIFYCKQLLSLHANFSVRFVRRQANK  226

Query  108  VAHELAREAMFKADCMVCVSVP  43
            VAH +AR ++      +   VP
Sbjct  227  VAHNIARASLSHPSPHIFFDVP  248



>ref|XP_003598902.1| hypothetical protein MTR_3g023170 [Medicago truncatula]
Length=274

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 117/259 (45%), Gaps = 28/259 (11%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFE--HTIPHHCVSFMDWVELQFNSLSDNELCKLIS-ICWKVWDAR  616
            + F  CS +  CW      HTI          V L  +S +D    +L + I W +W  R
Sbjct  30   HLFFECSKSVVCWQQVGLWHTIQQ--------VRLPTSSCADIPQQQLFAVILWSLWKHR  81

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqV--ETWSKPLVGWLKLNS  442
            N KVWNN+  ++      A+++L  W++A  + +  ++ +     ++W KP  G  K N 
Sbjct  82   NNKVWNNVTETAQQTGERAMNFLSSWKNAQDVRNQNTNRNTHGVIDSWEKPSPGRFKCNV  141

Query  441  DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDK  262
            D +  +    +G G  + DA G FV A++  W  L L +             +  L +  
Sbjct  142  DASFSTTLNKVGFGACIRDAEGNFVIART-AWTTLLLDVN------------MGELNMVH  188

Query  261  VQIESDCIKVIQAINSTSLCSSFDLIINDIRE-IARDFTNLSFHFVKRSANKVAHELARE  85
            +  E++   V   I      S F  IIND R  ++ +  N    F++R  N VAH LA+E
Sbjct  189  MDFETNSKVVADRIYGKEGVSDFMAIINDCRHLLSTNLVNSDVKFIRRQVNGVAHSLAKE  248

Query  84   AMFKADCMVCVSVPFPCIA  28
            A+  A   + +++P  CI+
Sbjct  249  ALHHASLHIRLNIPH-CIS  266



>ref|XP_002532007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30380.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 74/132 (56%), Gaps = 1/132 (1%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W+ P+ GWLK N D  +   +  +G G +  +  G F AA +    G   P  AEA+++R
Sbjct  129  WTCPVEGWLKCNIDVVVFVANNRLGFGFIFQNDSGTFRAATNGLISGPLDPQVAEALSLR  188

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIREIARDFTNLSFHFVK  124
            E L W+K L L+ V  ESDC+ ++ A+N   + SS F L+I D R   ++  +    FVK
Sbjct  189  EDLCWVKGLDLNYVVSESDCLTLVNAVNKVGVNSSLFGLLIGDCRSFLKEMNHAHIVFVK  248

Query  123  RSANKVAHELAR  88
            R  N+VAH LAR
Sbjct  249  RFGNRVAHLLAR  260



>ref|XP_010670097.1| PREDICTED: uncharacterized protein LOC104887199 [Beta vulgaris 
subsp. vulgaris]
Length=180

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 77/131 (59%), Gaps = 2/131 (2%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            WSKP  G++K+N D          G+G+V  D YG+ +AA +  +     P  AEA AI 
Sbjct  22   WSKPSSGFIKVNVDAGFVGEMG-CGLGVVFRDEYGEVLAAGTYQFHVAWEPRIAEAKAIF  80

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIREIARDFTNLSFHFVK  124
              +K  K +    +++ESD +  IQA+ S    SS F+LI++D+ ++AR F N+ + FVK
Sbjct  81   HGVKLAKEMSYSHIEVESDSLLAIQALRSGKGGSSEFNLILDDVLDLARSFDNVIWCFVK  140

Query  123  RSANKVAHELA  91
            RS NKVAH LA
Sbjct  141  RSGNKVAHMLA  151



>ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula]
Length=1723

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 17/203 (8%)
 Frame = -1

Query  642   ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
             + W +W  RN+ +W N V+++  V    L+ L  WQ+A  +             W KP  
Sbjct  1523  VMWSIWKQRNDCIWRNEVMTTAAVRDRGLNLLTGWQNAQDI-------------WRKPDE  1569

Query  462   GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPM-EAEAIAIREALKW  286
             G  K N D A    S  +G+G+ + D  G+ V A++  W  L L + E EAI +  A++W
Sbjct  1570  GHFKCNVDAAFFKESNRVGIGICIRDDSGRLVKART-SWSTLLLDVPEGEAIGLLYAIRW  1628

Query  285   LKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIR-EIARDFTNLSFHFVKRSAN  112
              K   L+ +  E D  +V+ +  N+ +  S    II + R   +  FTN    F++R AN
Sbjct  1629  AKEQNLNNITFELDSKRVVYSFHNTRNDVSDLGAIIRECRTTFSSFFTNSRVEFIRRQAN  1688

Query  111   KVAHELAREAMFKADCMVCVSVP  43
             +V H LAR A F A       +P
Sbjct  1689  EVVHSLARAATFYASIHYFTVLP  1711



>ref|XP_010687523.1| PREDICTED: uncharacterized protein LOC104901631 [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 97/208 (47%), Gaps = 17/208 (8%)
 Frame = -1

Query  711  SFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQS  532
            S  DW    F  L   ++C++++I W +W +R + +  N        +  A     E   
Sbjct  113  SVGDWWAGSFERLEGEKMCEMLTIAWAIWGSRCKMLMANEEGHPRATIEYAKKICKELLE  172

Query  531  ANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSI  352
            A+Q               ++P  G +KLN D A  +     G+G V  D  G  +AA S 
Sbjct  173  ASQ---------------ARPTAGHVKLNVD-AGKTGVGGCGLGAVFRDVDGVVLAAGSF  216

Query  351  PWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIIND  175
                   P  AEA AI   +K  K L    V++ESD +  IQA+ N  + CS F LII+D
Sbjct  217  QCHDTWEPRVAEAKAIYFGIKLAKELGYRLVEVESDSLLAIQALKNGRTGCSEFHLIIDD  276

Query  174  IREIARDFTNLSFHFVKRSANKVAHELA  91
            I      F N+S+ FVKRS N+VAH LA
Sbjct  277  ILAFVGCFDNVSWSFVKRSGNRVAHLLA  304



>gb|AAP44645.1| putative reverse transcriptase [Oryza sativa Japonica Group]
Length=404

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 118/255 (46%), Gaps = 9/255 (4%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHT----IPHHCVSFMDWVELQFNSLSDNELCKLISIC-WKVWD  622
            + F+ C  A + W+  +      +  +  S M      F     +    L+++  W +W+
Sbjct  137  HVFLFCPFAAQIWEEIKRKCAVKLGRNGFSTMRHWIFDFLKRGSSHTNTLLAVTFWHIWE  196

Query  621  ARNEKVWNNIVISSHDVVSGALSY--LLEWQSANQLshhqshvshqVETWSKPLVGWLKL  448
            ARN    NN  +    VV   LSY  ++   +   +   +   +  +  W     G   +
Sbjct  197  ARNNTKNNNGTVHPQRVVIKILSYVDMILKHNTKTVDGQRGENTQAIPRWQPLPAGVWMI  256

Query  447  NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQL  268
            NSD A+ S+SR MG+G ++ D  G+ + A S     + LP  AEA+AIR AL   K   L
Sbjct  257  NSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGL  316

Query  267  DKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
              + + SDC+ VI+ I ++    S    +I DI+++A  F   SF  V R +N  AH LA
Sbjct  317  QHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLA  376

Query  90   REAMFKADCMVCVSV  46
            R A   + C V  SV
Sbjct  377  RNAEL-STCTVYRSV  390



>ref|XP_006471930.1| PREDICTED: uncharacterized protein LOC102617744 [Citrus sinensis]
Length=294

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 112/245 (46%), Gaps = 8/245 (3%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSD---NELCKLISICWKVWDAR  616
            +A   C  A+K W+L   T     V   D      N  S+   NE   +I  CW +W AR
Sbjct  29   HALFECKAARKTWNLAPSTFELQNVPGQDIFSYAQNLCSNSRRNEAELMIMYCWAIWFAR  88

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQLsh--hqshvshqVETWSKPLVGWLKLNS  442
            N+ ++    I      + A S L  +Q   +       +      + WS P    LKLN 
Sbjct  89   NKLIFERKKIEPIVSAAKAESMLEAYQRVRKTGTLHISNTREESQQRWSPPPTNVLKLNV  148

Query  441  DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPME-AEAIAIREALKWLKSLQLD  265
            D A +S  + +G+G VL D+ G+ VAA  I        +  AEA AI+  L+  K     
Sbjct  149  DAATNSKDQKVGLGAVLRDSNGRVVAA-GIKQASFRKDVSFAEAEAIQWGLQIAKKAAAA  207

Query  264  KVQIESDCIKVIQAINSTSLCSSFDL-IINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
             + +E+DC  V + +N+T    S    II++I+   R+F  + F+FV R  N  AH LA+
Sbjct  208  SLIVETDCKDVAELVNNTKGSRSEIFWIISEIQTQKREFQRIHFNFVPRFCNAHAHSLAK  267

Query  87   EAMFK  73
             A+ K
Sbjct  268  HALRK  272



>ref|XP_008346598.1| PREDICTED: uncharacterized protein LOC103409561 [Malus domestica]
Length=216

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 85/167 (51%), Gaps = 1/167 (1%)
 Frame = -1

Query  561  ALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDA  382
             L   ++    +QL    +     ++ WS P  G LKLN D A    +   G+GL+ WD+
Sbjct  28   GLXTFVDQNRGDQLQATSAQRHAPIQKWSCPPPGRLKLNVDGAWCKETNLGGVGLIFWDS  87

Query  381  YGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSL-  205
             G FVAA S  +  +  P+  EA+AIRE L       +  + +ESD +++I A+  +SL 
Sbjct  88   NGTFVAATSRRFGDIFSPIHIEALAIREGLLMAIERGVQSISLESDSLQIISALKESSLN  147

Query  204  CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADC  64
             S+ + II D   +    T  + + V+  AN VAH LAR A++   C
Sbjct  148  VSTIEPIIEDTISLLLLVTEATAYNVRHQANFVAHRLARFALYGXGC  194



>ref|XP_010684219.1| PREDICTED: putative ribonuclease H protein At1g65750 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 98/187 (52%), Gaps = 3/187 (2%)
 Frame = -1

Query  645  SICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ-LshhqshvshqVETWSKP  469
            ++ W +W  RN  ++    +S  D++  A+ + +E+Q+A + +           + W +P
Sbjct  180  NLLWGIWLRRNAWIFKRKQVSVKDLIDKAMRFTIEYQAAKESVKDGLRSEGPGKKKWHRP  239

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
              G LKLN+D A+ +    +G G V+ D+ G+   A     DG   P  AEA+AIRE L 
Sbjct  240  REGSLKLNTDAAVLAGGM-IGFGGVVRDSMGEVRLACCGRMDGRFAPDIAEAMAIREVLA  298

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
               +    ++ +E+DC+K+I  +    L  SSF  I+ DI +  + F  +SF+ + RS N
Sbjct  299  IAGAAGFREIILENDCLKLISQLKKHVLENSSFGNIVKDILDYVQAFNVVSFNHICRSGN  358

Query  111  KVAHELA  91
             VAH LA
Sbjct  359  TVAHNLA  365



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 100/200 (50%), Gaps = 4/200 (2%)
 Frame = -1

Query  636   WKVWDARNEKVWNNIVISSHDVVSGALSY--LLEWQSANQLshhqshvshqVETWSKPLV  463
             W +W+ARN    NN  +    VV   LSY  ++   +   +   +   +  +  W  P  
Sbjct  1127  WHIWEARNNTKNNNGTVHPQRVVIKILSYVDMILKHNTKTVDGQRGGNTQAIPRWQPPPA  1186

Query  462   GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
                 +NSD A+ S+SR MG+G ++ D  G+ + A S     + LP  AEA+AIR AL   
Sbjct  1187  SVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLA  1246

Query  282   KSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
             K   L+ + + SDC+ VI+ I ++    S    +I DI+++A  F   SF  V R +N  
Sbjct  1247  KEEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLA  1306

Query  105   AHELAREAMFKADCMVCVSV  46
             AH LAR A   + C V  SV
Sbjct  1307  AHSLARNAEL-STCTVYRSV  1325



>ref|XP_003605496.1| hypothetical protein MTR_4g032310 [Medicago truncatula]
Length=283

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/225 (29%), Positives = 103/225 (46%), Gaps = 9/225 (4%)
 Frame = -1

Query  675  LSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSAN------QLsh  514
            LS ++     S+ W +W +RN ++W N+  +S  ++  A   L  W++AN      Q   
Sbjct  53   LSHDQAELFASVLWSLWKSRNLRLWQNVRETSQAILECAKQILANWRTANRNTAVQQTET  112

Query  513  hqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLC  334
              S        W KP    LK N D +       +G G  + + +G  + AK++  + + 
Sbjct  113  ATSRAQAVQSFWQKPAHCRLKCNVDVSFSEALNCVGFGFCIRNEFGNLIKAKTMWSNPVF  172

Query  333  LPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIAR  157
                 EA+ +  A++W+  LQL  +  E D  KV+   N+ S   S F  I+ + R    
Sbjct  173  ASDVGEALGLSNAIRWVHELQLLNINFELDAKKVVDYFNNGSNDISEFGSIVEECRRSHN  232

Query  156  -DFTNLSFHFVKRSANKVAHELAREAMFKADCMVCVSVPFPCIAH  25
              F N    F +R AN+VAH LA+EA   A       VPF CI++
Sbjct  233  FYFANSKVEFSRRQANEVAHTLAQEATSLASPHNFNDVPF-CISN  276



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 100/200 (50%), Gaps = 4/200 (2%)
 Frame = -1

Query  636   WKVWDARNEKVWNNIVISSHDVVSGALSY--LLEWQSANQLshhqshvshqVETWSKPLV  463
             W +W+ARN    NN  +    VV   LSY  ++   +   +   +   +  +  W  P  
Sbjct  1170  WHIWEARNNTKNNNGTVHPQRVVIKILSYVDMILKHNTKTVDGQRGGNTQAIPRWQPPPA  1229

Query  462   GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
                 +NSD A+ S+SR MG+G ++ D  G+ + A S     + LP  AEA+AIR AL   
Sbjct  1230  SVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLA  1289

Query  282   KSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
             K   L+ + + SDC+ VI+ I ++    S    +I DI+++A  F   SF  V R +N  
Sbjct  1290  KEEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLA  1349

Query  105   AHELAREAMFKADCMVCVSV  46
             AH LAR A   + C V  SV
Sbjct  1350  AHSLARNAEL-STCTVYRSV  1368



>emb|CDP14369.1| unnamed protein product [Coffea canephora]
Length=347

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 95/194 (49%), Gaps = 4/194 (2%)
 Frame = -1

Query  648  ISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE----T  481
            +++ W++W +RN + + +  +    VV+ A     E+Q A  +       +   +     
Sbjct  122  VNVLWQIWKSRNRRQFEDKGMDPMTVVNKATREWREFQEAQDVDGGNGSHTTNGKEGLGG  181

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W +P VGW+K+NSD A+   +   G G++  D  G  + A ++P        + EA+A+R
Sbjct  182  WREPEVGWVKINSDAAVQQKAERAGWGMIARDCLGNALGAWAVPDTCCSSAKQEEALALR  241

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKR  121
             A+   K     +V  ESDC ++I +INS    S    I+ DI  +  +F    F F +R
Sbjct  242  SAMLMAKQQGWRRVVFESDCKQLIDSINSGDGDSDIATILLDIVSLKSNFYKCCFSFTRR  301

Query  120  SANKVAHELAREAM  79
              N V+H LA+ A+
Sbjct  302  MNNSVSHSLAKLAL  315



>ref|XP_009122880.1| PREDICTED: uncharacterized protein LOC103847539 [Brassica rapa]
Length=245

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 101/188 (54%), Gaps = 4/188 (2%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            I W++W ARN+ V+NN +I   +V+S A++   EW  +   +   S  +   ++ S P V
Sbjct  49   IAWQLWVARNQLVFNNRIIKVEEVISKAIASAREWGHSQGCTTQTSKPAIYSQSASTPGV  108

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
              +K  SD A     +  G+G  +  A     ++ SIP   +  P+ AE +A+REA+   
Sbjct  109  YLVK--SDAAWSETQQSAGLGWTI--AINDRTSSYSIPARNVASPLAAEGLALREAILKC  164

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
            K L L K++ ES    +++A+ S S  +    I+ D++ +A  F  +SF+++ R  N VA
Sbjct  165  KELGLSKIKCESHSAILVKALKSGSSLAGLYGILADLKSLASSFDVISFNWISRERNTVA  224

Query  102  HELAREAM  79
              LA++++
Sbjct  225  DSLAKQSL  232



>ref|XP_012092464.1| PREDICTED: uncharacterized protein LOC105650199 [Jatropha curcas]
Length=207

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 104/209 (50%), Gaps = 6/209 (3%)
 Frame = -1

Query  717  CVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEW  538
              S  +W+   F   +D ++   +++CW++W ARN+ +W+    S   +   A S+L +W
Sbjct  2    AASLQEWMGKIFAIFNDKDVVVAMTVCWQIWSARNDVIWSQKHSSPMVIWHRASSFLSDW  61

Query  537  QSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAK  358
              A   +         V  W K  + W+KLN D A+ +     G G VL D+    +  K
Sbjct  62   LKA---AAGSGRTPSAVSKWQKSELNWVKLNVDAAVYTGGTGAGYGAVLRDSDAVLLGVK  118

Query  357  SIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL--I  184
               ++    P+EAEA+AI+EAL WLK     ++ +ESD + +I A+  + L     L  I
Sbjct  119  VGKFEASLRPIEAEAMAIKEALSWLKGRGWHQIVVESDNLSIINALQGSGLMYGSILGDI  178

Query  183  INDIREIA-RDFTNLSFHFVKRSANKVAH  100
            I  IR+++ +      F  V RS+N+ AH
Sbjct  179  IVSIRQLSLQSGCIFKFKHVYRSSNEFAH  207



>gb|AAU89136.1| F-box domain containing protein [Oryza sativa Japonica Group]
Length=855

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 118/255 (46%), Gaps = 9/255 (4%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHT----IPHHCVSFMDWVELQFNSLSDNELCKLISIC-WKVWD  622
            + F+ C  A + W+  +      +  +  S M      F     +    L+++  W +W+
Sbjct  588  HVFLFCPFAAQIWEEIKRKCAVKLGRNGFSTMRHWIFDFLKRGSSHTNTLLAVTFWHIWE  647

Query  621  ARNEKVWNNIVISSHDVVSGALSY--LLEWQSANQLshhqshvshqVETWSKPLVGWLKL  448
            ARN    NN  +    VV   LSY  ++   +   +   +   +  +  W     G   +
Sbjct  648  ARNNTKNNNGTVHPQRVVIKILSYVDMILKHNTKTVDGQRGENTQAIPRWQPLPAGVWMI  707

Query  447  NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQL  268
            NSD A+ S+SR MG+G ++ D  G+ + A S     + LP  AEA+AIR AL   K   L
Sbjct  708  NSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGL  767

Query  267  DKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
              + + SDC+ VI+ I ++    S    +I DI+++A  F   SF  V R +N  AH LA
Sbjct  768  QHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLA  827

Query  90   REAMFKADCMVCVSV  46
            R A   + C V  SV
Sbjct  828  RNAEL-STCTVYRSV  841



>gb|EEC75888.1| hypothetical protein OsI_12930 [Oryza sativa Indica Group]
Length=834

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 117/262 (45%), Gaps = 23/262 (9%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEH------------TIPHHCVSFMDWVELQFNSLSDNELCKLIS  643
            + F+ C  A + W+  +             T+ H    F+       N+L       L  
Sbjct  567  HVFLFCPFAAQIWEEIKRKCAVKLGRNGFSTMRHWIFDFLKRGSSHTNTL-------LAV  619

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSY--LLEWQSANQLshhqshvshqVETWSKP  469
              W +W+ARN    NN  +    VV   LSY  ++   +   +   +   +  +  W   
Sbjct  620  TFWHIWEARNNTKNNNGTVHPQRVVIKILSYVDMILKHNTKTVDGQRGENTQAIPRWQPL  679

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
              G   +NSD A+ S+SR MG+G ++ D  G+ + A S     + LP  AEA+AIR AL 
Sbjct  680  PAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALG  739

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
              K   L  + + SDC+ VI+ I ++    S    +I DI+++A  F   SF  V R +N
Sbjct  740  LAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSN  799

Query  111  KVAHELAREAMFKADCMVCVSV  46
              AH LAR A   + C V  SV
Sbjct  800  LAAHSLARNAEL-STCTVYRSV  820



>gb|EEE59647.1| hypothetical protein OsJ_12023 [Oryza sativa Japonica Group]
Length=1145

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 117/262 (45%), Gaps = 23/262 (9%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLFEH------------TIPHHCVSFMDWVELQFNSLSDNELCKLIS  643
             + F+ C  A + W+  +             T+ H    F+       N+L       L  
Sbjct  878   HVFLFCPFAAQIWEEIKRKCAVKLGRNGFSTMRHWIFDFLKRGSSHTNTL-------LAV  930

Query  642   ICWKVWDARNEKVWNNIVISSHDVVSGALSY--LLEWQSANQLshhqshvshqVETWSKP  469
               W +W+ARN    NN  +    VV   LSY  ++   +   +   +   +  +  W   
Sbjct  931   TFWHIWEARNNTKNNNGTVHPQRVVIKILSYVDMILKHNTKTVDGQRGENTQAIPRWQPL  990

Query  468   LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
               G   +NSD A+ S+SR MG+G ++ D  G+ + A S     + LP  AEA+AIR AL 
Sbjct  991   PAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALG  1050

Query  288   WLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
               K   L  + + SDC+ VI+ I ++    S    +I DI+++A  F   SF  V R +N
Sbjct  1051  LAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSN  1110

Query  111   KVAHELAREAMFKADCMVCVSV  46
               AH LAR A   + C V  SV
Sbjct  1111  LAAHSLARNAEL-STCTVYRSV  1131



>ref|XP_002531249.1| hypothetical protein RCOM_0494170 [Ricinus communis]
 gb|EEF31146.1| hypothetical protein RCOM_0494170 [Ricinus communis]
Length=329

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 96/199 (48%), Gaps = 4/199 (2%)
 Frame = -1

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE--TWSKPLVGWLKLN  445
            RN  +W   +      V  ALS+L +W SA  L  + +     +E  T   P  G++K N
Sbjct  120  RNLCLWEGQLQQPAQTVFCALSFLCDWASACSLQRNGNEARVMLEVLTCCPPQPGFVKCN  179

Query  444  SDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLD  265
             D A+ + S   G G+V+ D+ G FV        GL     AEAI +REA++W+ SL   
Sbjct  180  VDGAVFTASGRSGFGMVIRDSAGSFVMGADGSSPGLFNVKLAEAIGLREAVQWVLSLGRS  239

Query  264  KVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
             V  E D   V+ A+ S +     F  +I D R + +   N S  F+++ AN VAH LAR
Sbjct  240  NVIFEYDAKVVVDAVLSGAADLFEFGAVIADCRLLLQHGCNYSVQFIRKQANLVAHSLAR  299

Query  87   EAMFKADCMVCVSVPFPCI  31
             +  + D     SVP  CI
Sbjct  300  ASHLQ-DGFNMFSVPPDCI  317



>ref|XP_008376986.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=341

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 95/194 (49%), Gaps = 5/194 (3%)
 Frame = -1

Query  786  YAFVSCSLAQKCW---DLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
            +  + C  A+  W    L   ++ H  +    W+    +++S      ++ + W +W AR
Sbjct  136  HIMLRCFHAKAIWSSSPLGSQSMQHGDMGLKGWLARVSSNISKERFDLVLVMLWNIWKAR  195

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDE  436
            N+  W   V+   D+   + ++L E +  N         S  V+ W KP  GWLK N D 
Sbjct  196  NDLFWKGSVLPPQDIPIKSHTWLNELKKWN--VSQPKPKSLDVQKWRKPDEGWLKCNFDG  253

Query  435  ALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQ  256
            A D +     +G+VL D  G+FVAA +   +G+  P+ AE IA REA  +++  +L KV 
Sbjct  254  AWDEHGAVGAVGIVLRDGAGEFVAATAFKVEGISSPLLAETIAAREAALFVQQWRLQKVI  313

Query  255  IESDCIKVIQAINS  214
            +E D + VI AI +
Sbjct  314  LEGDALLVIAAIQN  327



>ref|XP_012069272.1| PREDICTED: uncharacterized protein LOC105631710 [Jatropha curcas]
Length=759

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 106/230 (46%), Gaps = 22/230 (10%)
 Frame = -1

Query  765  LAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVI  586
            L+  CW++F     H   +F +                 +   W VW +RNE  WN +  
Sbjct  525  LSYNCWNIFTR---HGRTNFFE---------------SFVMGLWSVWLSRNELKWNQVEE  566

Query  585  SSHDVVSGALSYLLEWQSANQLshhq--shvshqVETWSKPLVGWLKLNSDEALDSNSR*  412
              + VV+ A S L  WQ A + S        +     W  PLVG LK+N D  L  +   
Sbjct  567  GPYQVVTRARSMLASWQKAQRTSPGSGIGPGTPVSSQWLPPLVGTLKINFDATLHPSIGY  626

Query  411  MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLD-KVQIESDCIK  235
              +G V+ +    FV+  +    G       EA A+R  L WL S   + K+QIE+DC++
Sbjct  627  GAVGAVISNCNRGFVSTATSSLQGCSSLAVVEAQALRTVLSWLLSGYSNLKIQIETDCLQ  686

Query  234  VIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
            V  A+ NS    S F ++I++ + +     N++  +++R AN +AH LA+
Sbjct  687  VYCAMRNSVQDWSEFGIVISEYKLLLVQLPNVTLAWIRRQANDIAHVLAK  736



>ref|XP_008228453.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=658

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 95/198 (48%), Gaps = 1/198 (1%)
 Frame = -1

Query  702  DWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ  523
            DWV    + LS   L     I W +W+ARN K+WNN         S A   LL++  A  
Sbjct  453  DWVLSCIDHLSYANLDLFFVIGWAIWEARNGKLWNNQTPKPEFTSSSAAVRLLDFVRARP  512

Query  522  LshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWD  343
                     +  + W+KP  G LK+N D +  + +   G+G+V+ D+ G+FVA +++  D
Sbjct  513  QGTALGRGCYAPQPWTKPCAGSLKINVDGSWTAGNTYGGVGIVVRDSNGKFVAGRALHVD  572

Query  342  GLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIRE  166
             +   ++ EA+A RE          +    ESD ++++ AI S+S+  S+   ++ D + 
Sbjct  573  NVFSALQVEAMAAREGAILAVEGDFNNAIFESDSLQIMSAIRSSSVDRSNVGPVVEDTKA  632

Query  165  IARDFTNLSFHFVKRSAN  112
            +    T   F  ++R A 
Sbjct  633  LLTQITGDGFTHIRRVAT  650



>ref|XP_010688579.1| PREDICTED: uncharacterized protein LOC104902491 [Beta vulgaris 
subsp. vulgaris]
Length=1325

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 71/246 (29%), Positives = 122/246 (50%), Gaps = 22/246 (9%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLFEHT-----IPHHC--VSFMDWVELQFNSLSDNELCKLISICWKV  628
             +A   C  A+  W +  +      +P     VSF +W+ ++    S ++L  + ++ W  
Sbjct  1061  HALFDCPQAKAIWQVSAYATLIADVPRSSFDVSF-EWLVIK---CSKDDLSVVCTLMWAA  1116

Query  627   WDARNEKVWNNIVISSHDVVSGALSYLLEW-QSANQLshhqshvshqVETWSKPLVGWLK  451
             W  RN+ ++ +  +   +V S  +  +LE+ + A ++  H +  +     WS P  GWLK
Sbjct  1117  WFCRNKFIFESQALCGMEVASNFVKMVLEYGEYAGRVFRHVAGGAPSPTNWSFPAEGWLK  1176

Query  450   LNSDEALDSNSR*MGMGLVLWDAYG--QFVAAKSIP--WDGLCLPMEAEAIAIREALKWL  283
             +N D  ++ N   +G+G V+ D+ G  +F A K +   WD       AEA+A + A++  
Sbjct  1177  VNFDAHVNGNGE-IGLGAVMRDSAGVVKFAATKRVEARWDATL----AEAMAAKFAVEVT  1231

Query  282   KSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
               L  D V  E D ++V+QA+ N++   +    +  DIR +   F   SF  VKR+ N V
Sbjct  1232  LRLGYDNVLFEGDALEVVQAVKNNSEGVAPLFRVFYDIRRLVSSFVAFSFLHVKRTGNVV  1291

Query  105   AHELAR  88
             AH LAR
Sbjct  1292  AHLLAR  1297



>ref|XP_006480206.1| PREDICTED: uncharacterized protein LOC102628543 [Citrus sinensis]
Length=163

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 74/143 (52%), Gaps = 4/143 (3%)
 Frame = -1

Query  768  SLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIV  589
            S A+ CW         +C +F+DW+   F   S +E    + ICW++W  RN K WNN  
Sbjct  5    SFAKSCWISSSVGFVGYCSTFLDWLAHVFTRCSKDECNIAMMICWRIWVNRNNKAWNNTA  64

Query  588  ISSHDVVSGALSYLLEWQSANQ----LshhqshvshqVETWSKPLVGWLKLNSDEALDSN  421
             S   +++ A  +L +WQ+A Q    ++     + H    W KP  GW+K N D A+ + 
Sbjct  65   SSVCQILNSAGQFLYQWQAAKQQVFDINDDTHKLVHGALCWEKPKFGWVKCNVDAAVFTP  124

Query  420  SR*MGMGLVLWDAYGQFVAAKSI  352
               +G+G V+ ++ G F+AA+ +
Sbjct  125  QGKIGIGCVIRNSQGGFLAARCV  147



>ref|XP_011468628.1| PREDICTED: uncharacterized protein LOC105352716 [Fragaria vesca 
subsp. vesca]
Length=234

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 97/209 (46%), Gaps = 4/209 (2%)
 Frame = -1

Query  702  DWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ  523
            DW+      L  ++   L+ + W  W  RN ++W+N V S + V     S++L   S  Q
Sbjct  3    DWLITCSELLPIDDFQLLLVMIWAGWKERNSRLWDNKVNSLNKVFYQVRSFILLLHSVTQ  62

Query  522  LshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWD  343
                +       + W+ PLVGWLK N D A     +  G+G++L D  G  V    +  D
Sbjct  63   ---KKMCRRRVFKPWTPPLVGWLKANIDGAFQVEMKQGGVGVLLRDLDGHVVGGICMKVD  119

Query  342  GLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIRE  166
             +  P   EA+A R A + +    L  V  ESDC+K+++  +S+    S+F  ++ DI++
Sbjct  120  TIASPDTVEALAGRAACELVAEFNLSPVIFESDCLKLVKTCSSSVEDDSTFGQVVADIKD  179

Query  165  IARDFTNLSFHFVKRSANKVAHELAREAM  79
                     F  + R  N    +LA+ A+
Sbjct  180  KFSTMPCSFFLHIFRETNSAVDKLAKLAL  208



>ref|XP_012089877.1| PREDICTED: uncharacterized protein LOC105648176 [Jatropha curcas]
Length=182

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 72/129 (56%), Gaps = 2/129 (2%)
 Frame = -1

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
            P +   K N D A+ SNSR  GMG+++ D+     A K +       P   EA+  R+AL
Sbjct  38   PKLAEYKCNVDMAILSNSR-FGMGMIIRDSTSSSYAGKLLIQPSYSDPQIREALCFRDAL  96

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIREIARDFTNLSFHFVKRSA  115
             WLKSL    + +E+DC  ++ A+ +    SS F LI+ND   + R+   +S  F+++SA
Sbjct  97   SWLKSLPYFPICVETDCQILVHALRAPQFLSSYFALIVNDCMALLRELQFISLAFIRKSA  156

Query  114  NKVAHELAR  88
            N+VAH + R
Sbjct  157  NQVAHTIVR  165



>ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis]
Length=483

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 111/241 (46%), Gaps = 5/241 (2%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFE-HTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDA  619
             + +  V C +  + W     +       + ++     F    D+ +   + + W +W  
Sbjct  234  TIMHILVLCDVTTQSWKYVNLYQFLSQVSNLLEGARSVFEHFDDSIVASFVVLWWSLWTN  293

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET---WSKPLVGWLKL  448
             N+ VWN   +S   V S A S+L +W  A +L+ +     H       W KP  G  KL
Sbjct  294  MNDVVWNGKKLSWRAVASRASSFLFQWGKARKLTDYHQLGRHFAGGDCLWQKPATGKYKL  353

Query  447  NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQL  268
            N D +  +     G   VL D  G ++    I    +  P  AEA A++EAL W+ +  +
Sbjct  354  NVDASSSAERGKSGASFVLRDNAGIWITGVLIIRPYIANPDVAEAWALKEALSWIHAKGM  413

Query  267  DKVQIESDCIKVIQAINSTSLCSSFDL-IINDIREIARDFTNLSFHFVKRSANKVAHELA  91
            ++VQIE+DC++ I+ +      +S+ L ++ D +++ R     +  FV  SAN VAH ++
Sbjct  414  EEVQIETDCLRNIELLEEELHPNSYLLCLLKDCQDLLRVLNRCNLVFVYGSANTVAHMIS  473

Query  90   R  88
            +
Sbjct  474  K  474



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 110/234 (47%), Gaps = 6/234 (3%)
 Frame = -1

Query  774   SCSLAQKCW---DLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLI-SICWKVWDARNEK  607
              C  + + W    L  HT      SF  WVE   ++  D E   L   ICW +W  RN+ 
Sbjct  1108  GCDESSRAWYISPLRIHTGNIEAGSFRIWVESLLDTHKDTEWWALFWMICWNIWLGRNKW  1167

Query  606   VWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALD  427
             V+    ++  +VV  A+  ++E++     +     ++     WS P VG +KLN D A+ 
Sbjct  1168  VFEKKKLAFQEVVERAVRGVMEFEEECAHTSPVETLNTHENGWSVPPVGMVKLNVDAAVF  1227

Query  426   SNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIES  247
              +   +GMG V+ DA G  + A       +  P  AEA ++R  LK         + +E 
Sbjct  1228  KHVG-IGMGGVVRDAEGDVLLATCCGGWAMEDPAMAEACSLRYGLKVAYEAGFRNLVVEM  1286

Query  246   DCIKV-IQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
             DC K+ +Q     S  + F  +++DI  +A   +N+ F  VKR  NKVAH LA+
Sbjct  1287  DCKKLFLQLRGKASDVTPFGRVVDDILYLASKCSNVVFEHVKRHCNKVAHLLAQ  1340



>gb|EPS69206.1| hypothetical protein M569_05560, partial [Genlisea aurea]
Length=474

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 109/240 (45%), Gaps = 7/240 (3%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFEHTIPHHCVSFM---DWVELQFNSLSDNELCKLISICWKVWDA  619
            F+AF+SCS +Q  W L   ++    +  +   DW+  +F+ L   +   L+   W +W  
Sbjct  212  FHAFISCSFSQAVWRLGGFSMDMAGLESLHPGDWILSRFHQLHTEQFAGLLVTLWSIWRH  271

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQ-LshhqshvshqVETWSKPLVGWLKLNS  442
            R +   N I +           Y+    SA+Q             + W +P  G++KLN 
Sbjct  272  RLDHRHNQITLDPLRTHHLIRYYMDSSVSASQEQLDPPPLPPLPQQGWERPPAGFVKLNF  331

Query  441  DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDK  262
            D    + S   G+G ++ D  G+  A  S  +D    P   EA+A R+ L+   +++  +
Sbjct  332  DSGRCTPST-TGLGGLIRDDQGRCKAWFSYEYDTQLSPEVGEAMAARKILELAVAMKFPR  390

Query  261  VQIESDCIKVIQAI--NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
            V +E DC+ VIQA+   S+SL SS   +++D   +   F        +R  N  AH LA+
Sbjct  391  VFVEGDCLLVIQALTDTSSSLFSSLGNVLHDSATLMAQFEVCRISHTRRQNNAAAHHLAK  450



>ref|XP_012082598.1| PREDICTED: uncharacterized protein LOC105642390 [Jatropha curcas]
Length=190

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 82/145 (57%), Gaps = 2/145 (1%)
 Frame = -1

Query  459  WLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLK  280
            ++++N+D +    S  +G+G+V+ ++  +F+A K+  + G      AEAIA+REAL W+K
Sbjct  40   YIRMNTDASTGVASGYVGIGIVVRNSTSEFIAGKAWRFPGFFTAKVAEAIAVREALSWIK  99

Query  279  SLQLDKVQIESDCIKVIQAIN--STSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
                + + +E+D   V  AIN  +T+  S+F LII D + +  +   +  +FV RSAN  
Sbjct  100  DHGWNYILLETDSQSVANAINDDTTNDSSAFGLIIQDCKSLLSEIPVVKCNFVYRSANVA  159

Query  105  AHELAREAMFKADCMVCVSVPFPCI  31
            AH LA     +A   V  SVP P +
Sbjct  160  AHTLAVGTHSEAGLGVWNSVPPPVL  184



>ref|XP_006483194.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=765

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 117/257 (46%), Gaps = 7/257 (3%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTI---PHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
            +  + C  A+K WDL    +     H   F   ++  ++  S  E   +I  CW +W AR
Sbjct  499  HVLIECKAARKIWDLAPLIVQPSKDHNQDFFSAIQEMWSRSSTAEAELMIVYCWVIWSAR  558

Query  615  NEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshq--VETWSKPLVGWLKLNS  442
            N+ ++      S  + + A S L  +Q  ++  +           + W  P    LKLN 
Sbjct  559  NKFIFEGKKSDSRFLAAKADSVLKAYQRVSKPGNVHGAKDRGIDQQKWKPPSQNVLKLNV  618

Query  441  DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDK  262
            D A+ +  + +G+G ++ DA G+ +A              AEA AI   L+    +    
Sbjct  619  DAAVSTKXQKVGLGAIVRDAEGKILAVGIKQAQFRERVSLAEAEAIHWGLQVANQISSSS  678

Query  261  VQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELARE  85
            + +ESDC +V++ +N+T    +    I++D+R  ++DF  + F F+ R+ N  AH LA+ 
Sbjct  679  LIVESDCKEVVELLNNTKGSRTEIHWILSDVRRESKDFKQVQFSFIPRTCNTYAHALAKF  738

Query  84   AMFKADCMVCVSVPFPC  34
            A+  +   V V   FP 
Sbjct  739  ALRNSSTDVWVGT-FPA  754



>ref|XP_012084642.1| PREDICTED: uncharacterized protein LOC105644005 [Jatropha curcas]
Length=232

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 104/218 (48%), Gaps = 13/218 (6%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSL----SDNELCKLISICWKV  628
             L +A V C  A+ CW  F   +  +  +F +++++ F  L      +     I   W V
Sbjct  15   TLAHAIVECPKARFCWQFF--GVQPNISNFPNFLQM-FEHLHKVWESDFFESFIMGLWSV  71

Query  627  WDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshh---qshvshqVETWSKPLVGW  457
            W +RNE  WN +    + VV+GA S L  W+ A QL          +     W  P  G 
Sbjct  72   WLSRNELKWNQVDEGPYHVVTGARSMLASWKKA-QLKLSGSDTGISASAGSQWFPPPTGT  130

Query  456  LKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKS  277
             K+N D AL  ++    +G VL + +G FV+A +    G   P  AEA A+R+ L W+ S
Sbjct  131  FKINFDAALLPSAGHGAVGAVLSNCHGGFVSAATSSLHGCSSPAIAEAQALRKVLSWVLS  190

Query  276  LQLD-KVQIESDCIKVIQAIN-STSLCSSFDLIINDIR  169
                  +Q+E+DC++V  A+  S    S F ++I++ +
Sbjct  191  GHPTLTIQVETDCLQVYHAMRISVHDWSEFGVVISECK  228



>ref|XP_012067550.1| PREDICTED: uncharacterized protein LOC105630354 [Jatropha curcas]
Length=1197

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 125/252 (50%), Gaps = 5/252 (2%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEK  607
             +   +C  A+  W +    +P   +SF  + E  + +L  ++   + +I WK+W +RN+ 
Sbjct  935   HVLFACPRARDVWRISRFILPSGMLSFNQFFEQVYLNLGRDKAATVATIAWKIWASRNDM  994

Query  606   VWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPL---VGWLKLNSDE  436
             +W+N  +    +V  A  YL  + +A         ++    + S P+   V WL   +D 
Sbjct  995   LWSNKWLPPALIVRLASDYLHSFVAAQSFPASSPSLTVGRASTSAPMVEGVDWLGF-TDG  1053

Query  435   ALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQ  256
             A+  +S  +G G +  D  G F  A S   +G   P  AEA+A+R+ L +         +
Sbjct  1054  AIFPSSDFVGFGCLFEDGEGSFSLAVSGFHEGGHDPAIAEALALRQGLLYAVDAFPGPGR  1113

Query  255   IESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAM  79
             + +DC+ ++QA+ +S+S  S F  I+ D + I     ++S  +V+RS+N+ AH LAR ++
Sbjct  1114  MFTDCLCLVQALYSSSSDFSDFGSIVMDCKAILLTRPDISVSWVRRSSNRGAHLLARASI  1173

Query  78    FKADCMVCVSVP  43
                   V VS+P
Sbjct  1174  RYDRFKVWVSMP  1185



>ref|XP_006487438.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=335

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 130/269 (48%), Gaps = 12/269 (4%)
 Frame = -1

Query  792  LFYAFVSCSLAQKCWDLFEHTIPHHCVS----FMDWVELQFNSLSDNELCKLISICWKVW  625
            + +  V+C  A+K W         H +     F +  +LQ  SLS+++   L+ + W +W
Sbjct  68   ILHVLVTCKAAKKVWQRSPVADAVHKIDSSNLFGELTKLQ-RSLSNDDFELLLVLLWIIW  126

Query  624  DARNEKVWNNIVISSHDVVSGALSYLLEWQSAN--QLshhqshvshqVETWSKPLVGWLK  451
             ARN+ V+  + I     V+ A +    ++     ++   ++ +  +   W+ P   W+K
Sbjct  127  YARNKFVFEGMKIDPGISVAKAEAIKEAYKRTQFPEMLVGKNSLRQEQNKWAPPPPRWVK  186

Query  450  LNSDEALDSNSR*MGMGLVLWDAYGQ-FVAA-KSIPWDGLCLPMEAEAIAIREALKWLKS  277
            +N D A+D+ S+  G+G V+ D  G+ FVAA KS+   G  L  EAEA      L   + 
Sbjct  187  INVDAAIDAKSKCSGLGAVIKDPSGKCFVAAVKSVTSKGDVLLAEAEADEWGTYLAKEEG  246

Query  276  LQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAH  100
            +Q   V +E+D    +  IN+  +  +    II+DI+ +   F++    F+ RS N  AH
Sbjct  247  MQA--VILETDSKATVDLINNNGNYMTEVHWIISDIQSLMSQFSHFVAKFIPRSCNTCAH  304

Query  99   ELAREAMFKADCMVCVSVPFPCIAHSLEL  13
            +LA+ A+ K D  V      P I H + L
Sbjct  305  KLAKIALGKTDSFVWKGNFPPEIEHVVSL  333



>ref|XP_007225095.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
 gb|EMJ26294.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
Length=925

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 88/196 (45%), Gaps = 7/196 (4%)
 Frame = -1

Query  585  SSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MG  406
            S HDVV  A  Y+ E+ +AN      +        W+ P  G LK N D A D  S    
Sbjct  695  SPHDVVGFAQQYVHEFITANDTPSKVTDRVRDPVRWAAPSSGRLKFNFDGAFDPTSGRGA  754

Query  405  MGLVLWDAYGQFVAA--KSIPWDGLCLPME-AEAIAIREALKWLKSLQLDKVQIESDCIK  235
            +G+V  DA G FVAA  KS+   G  L  E AE +A RE +    SL       E D   
Sbjct  755  VGVVARDADGGFVAAVAKSV---GEVLSAEHAEILAAREGVALALSLGTASPIFEGDSAV  811

Query  234  VIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADCMV  58
            V+ A+       S+   I+ D++ + + F +  F F  R AN V H LAR  ++  D  +
Sbjct  812  VVSAVKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREANGVVHRLARFGLYNVDNFI  871

Query  57   CVSVPFPCIAHSLELD  10
               VP   I  +L  D
Sbjct  872  WFEVPPDLIQDALLYD  887



>ref|XP_012079594.1| PREDICTED: uncharacterized protein LOC105640000 [Jatropha curcas]
Length=1244

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 125/252 (50%), Gaps = 5/252 (2%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEK  607
             +   +C  A+  W +    +P   +SF  + E  + +L  ++   + +I WK+W +RN+ 
Sbjct  982   HVLFACPRARDVWRISRFILPSGMLSFNQFFEQVYLNLGRDKAATVATIAWKIWASRNDM  1041

Query  606   VWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPL---VGWLKLNSDE  436
             +W+N  +    +V  A  YL  + +A         ++    + S P+   V WL   +D 
Sbjct  1042  LWSNKWLPPALIVRLASDYLHSFVAAQSFPASSPSLTVGRASTSAPMVEGVDWLGF-TDG  1100

Query  435   ALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQ  256
             A+  +S  +G G +  D  G F  A S   +G   P  AEA+A+R+ L +         +
Sbjct  1101  AIFPSSDFVGFGCLFEDGEGSFSLAVSGFHEGGHDPAIAEALALRQGLLYAVDAFPGPGR  1160

Query  255   IESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAM  79
             + +DC+ ++QA+ +S+S  S F  I+ D + I     ++S  +V+RS+N+ AH LAR ++
Sbjct  1161  MFTDCLCLVQALYSSSSDFSDFGSIVMDCKAILLTRPDISVSWVRRSSNRGAHLLARASI  1220

Query  78    FKADCMVCVSVP  43
                   V VS+P
Sbjct  1221  RYDRFKVWVSMP  1232



>ref|XP_010675644.1| PREDICTED: uncharacterized protein LOC104891627 [Beta vulgaris 
subsp. vulgaris]
Length=286

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 112/244 (46%), Gaps = 18/244 (7%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHT-----IPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWD  622
            +A   C+ A+  W + + +     +P    SF++  E   + +S+ EL KL ++ W VW 
Sbjct  22   HALYDCTHAKAIWQVSDFSPLIDDVPR--TSFVESFEWLVSKVSNTELSKLCALLWAVWY  79

Query  621  ARNEKVWNNIVISSHDVVSGALSYLLEWQS-ANQLshhqshvshqVETWSKPLVGWLKLN  445
             RN  ++ +  +   +V S  +  + E+ + A  +            +W+ P  G++K N
Sbjct  80   CRNMSIFESQTLRGVEVASSFVKLVEEYDTYAASVFRSVRCGDPSPTSWNPPATGFVKAN  139

Query  444  SDEALDSNSR*MGMGLVLWDAYG--QFVAAKSIP--WDGLCLPMEAEAIAIREALKWLKS  277
             D  + +N   +GMG+VL D +G  + +A K +   WD       A   A+  AL+    
Sbjct  140  FDAHVSANGE-IGMGVVLRDCHGVVKLMATKRVGARWDAALAEAMAARFAVEVALR----  194

Query  276  LQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAH  100
            L    V  E D + V+  + N     +    + NDI  +   F + SF  VKR+ N VAH
Sbjct  195  LGFVNVLFEGDALVVVNVVKNHADGVAPIFRVFNDIHRLLSSFESFSFMHVKRAGNVVAH  254

Query  99   ELAR  88
             LAR
Sbjct  255  MLAR  258



>gb|EEC72753.1| hypothetical protein OsI_06384 [Oryza sativa Indica Group]
Length=556

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 90/185 (49%), Gaps = 2/185 (1%)
 Frame = -1

Query  636  WKVWDARNEKVWNNIVISSHDVVSGALSYL-LEWQSANQLshhqshvshqVETWSKPLVG  460
            W +W+ARN    N   +    VV   ++Y+ +  Q     +  +      + +W  P  G
Sbjct  345  WHIWEARNNAKNNVETLHPRRVVQKIVAYVEMIMQHYGPGNVSRPAERISLPSWVPPPAG  404

Query  459  WLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLK  280
               +N+D A+    R MG+G+V+ D +G  + A +  + G+  P  AEA AIR AL   K
Sbjct  405  VFLINTDAAVFQAERQMGVGVVIRDQHGNCLLAANTRFMGITDPETAEACAIRHALWLAK  464

Query  279  SLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
                  V +  DC+ VIQ +NS     S    ++ DI+++  +F ++SF  V   +N  A
Sbjct  465  EEGFHNVIVACDCLSVIQKLNSPGRDRSKIGCLVEDIKKLGVEFISVSFIHVSHCSNVAA  524

Query  102  HELAR  88
            H LAR
Sbjct  525  HTLAR  529



>ref|XP_008383144.1| PREDICTED: uncharacterized protein LOC103445866 [Malus domestica]
Length=256

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/213 (27%), Positives = 97/213 (46%), Gaps = 10/213 (5%)
 Frame = -1

Query  711  SFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNI---VISSHDVVSGALSYLLE  541
            S M+W+      +S      ++ + W +W  RN  +WN     ++  H  +   L    +
Sbjct  32   SLMEWIAAIAGLMSSESFDLVMVLIWCIWTERNAMLWNGKALELLEMHCKLQTWLHEFHK  91

Query  540  WQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAA  361
            W    +     +      +    P   W++ N D A D+     G+G+V+ +  G+F+  
Sbjct  92   WHGPRK-----NTNVVTGQPRKCPENEWIQSNFDAAWDAQLEIGGVGVVIRNNKGEFMVI  146

Query  360  KSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSL--CSSFDL  187
             ++  +G+  P+  E +A REAL + +  Q   V++E D + V   +    L   S F  
Sbjct  147  VAMRVEGVGSPLLVEIMAAREALIFSQHQQTTHVEVEGDALMVSTTLQHEGLNDSSPFGH  206

Query  186  IINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
            II +IR+I  DF+     F +RS NKV H LAR
Sbjct  207  IITNIRQILNDFSQCKVTFGRRSTNKVVHRLAR  239



>ref|XP_004305978.1| PREDICTED: uncharacterized protein LOC101292333 [Fragaria vesca 
subsp. vesca]
Length=258

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 103/208 (50%), Gaps = 9/208 (4%)
 Frame = -1

Query  666  NELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqV  487
            ++L K+I +CW++W  R   ++ N + S H VV+GA ++     S    S   +  S+ +
Sbjct  45   DKLSKIILLCWQIWQKRKNVIFRNEIFSPHAVVAGAAAFTRRLNSQTNTSSCVAAHSNNI  104

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
            + WS P  G++KLN D  +  ++     G VL D  G  + A +       +P+ AE +A
Sbjct  105  K-WSLPSSGYVKLNFDGYVFQHNSNFASGFVLRDDSGCPLIAYTRRIGKTDVPI-AEVVA  162

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHF  130
            +R+ L   ++  + +V  E D   VI  I S TS+ S    I+ DI  IA  F ++SF  
Sbjct  163  LRDGLLSARNRNISRVIAEGDSQLVINCIKSTTSIPSKLSSIVKDIIHIATRFEHISFSH  222

Query  129  VKRSANKVAHELAREA------MFKADC  64
              + AN +A+ +A  +       F A C
Sbjct  223  TFQEANFIANVVANHSHVLGFKFFSAGC  250



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score = 85.1 bits (209),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/245 (27%), Positives = 119/245 (49%), Gaps = 12/245 (5%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQF---NSLSDNELCKLISICWKVWDAR  616
             +A + C  A+K W     ++        D +E  +   ++    +  + I+ CW +W AR
Sbjct  1069  HALLDCKAARKIWYHATSSVQISNAQNQDILEFIYEVWSTWGKTKAEQTIAFCWAIWFAR  1128

Query  615   NEKVWNNIVISSHDVVSGALSYLLEWQSANQ--LshhqshvshqVETWSKPLVGWLKLNS  442
             N++++           + A S L  +  A +   SH  +      + W  P   +LK+N 
Sbjct  1129  NKRIFEGKKSDPRASAAKAESLLEAYHRARKPDASHIHNVKRIVQKKWEPPPGNFLKVNV  1188

Query  441   DEALDSNSR*MGMGLVLWDAYGQFVAA--KSIPW-DGLCLPMEAEAIAIREALKWLKSLQ  271
             D A+++  +  G+G V+ D  G+ VAA  K +P  +G+     AEA A+   L+  + L 
Sbjct  1189  DAAINNRDQVAGLGAVIKDPSGKIVAAGTKQVPLREGVSF---AEAEAMEWGLQIARELS  1245

Query  270   LDKVQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFHFVKRSANKVAHEL  94
             L  + +E+DC +V+  +N+T    +    +I+DI+E  RDF  + F  + R+ N  AH L
Sbjct  1246  LSALIMETDCKEVVDLLNNTKGSRTGISWVISDIQEQRRDFKEVKFRHIPRTCNTCAHSL  1305

Query  93    AREAM  79
             A+ A+
Sbjct  1306  AKLAV  1310



>ref|XP_009130307.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=552

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 98/194 (51%), Gaps = 7/194 (4%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSA-NQLshhqshvshqVETWSKPL  466
            +CW +W ARN++++ N V    D+ S A+S   EW +A + L       + Q     +PL
Sbjct  360  VCWVIWTARNKRIFENRVFEPKDIFSKAISTAKEWNNAQDSLLSPPVPRNLQNRQVHRPL  419

Query  465  VGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
               L   +D A  S +R  G G  +    G  +   S  ++ +   M AEA+AIR AL  
Sbjct  420  TE-LSCFTDAAWTSTNR-AGCGWYIMSLEGNVLLKGSCVFEFITSAMMAEALAIRSALVH  477

Query  285  LKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL--IINDIREIARDFTNLSFHFVKRSAN  112
                 + K+ I+SDC  +I AI+ST  C S +L  I  DI  ++  F+ +SF F+ RS N
Sbjct  478  ASEAGISKICIKSDCQALIAAISST--CHSVELYGIFRDIENLSLRFSCISFSFISRSLN  535

Query  111  KVAHELAREAMFKA  70
             +A  LA+  +  A
Sbjct  536  CMADSLAKSVLRSA  549



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 66/257 (26%), Positives = 117/257 (46%), Gaps = 7/257 (3%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLFEHTI---PHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
             +  + C  A+K WDL    +     H   F   ++  ++  S  E   +I  CW +W AR
Sbjct  1186  HVLIECKAARKIWDLAPLIVQPSKDHNQDFFSAIQEMWSRSSTAEAELMIVYCWVIWSAR  1245

Query  615   NEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshq--VETWSKPLVGWLKLNS  442
             N+ ++      S  + + A S L  +Q  ++  +           + W  P    LKLN 
Sbjct  1246  NKFIFEGKKSDSRFLAAKADSVLKAYQRVSKPGNVHGAKDRGIDQQKWKPPSQNVLKLNV  1305

Query  441   DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDK  262
             D A+ +  + +G+G ++ DA G+ +A              AEA AI   L+    +    
Sbjct  1306  DAAVSTKDQKVGLGAIVRDAEGKILAVGIKQAQFRERVSLAEAEAIHWGLQVANQISSSS  1365

Query  261   VQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELARE  85
             + +ESDC +V++ +N+T    +    I++D+R  +++F  + F F+ R+ N  AH LA+ 
Sbjct  1366  LIVESDCKEVVELLNNTKGSRTEIHWILSDVRRESKEFKQVQFSFIPRTCNTYAHALAKF  1425

Query  84    AMFKADCMVCVSVPFPC  34
             A+  +   V V   FP 
Sbjct  1426  ALRNSSTDVWVGT-FPA  1441



>gb|ABN06159.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=266

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/236 (28%), Positives = 108/236 (46%), Gaps = 8/236 (3%)
 Frame = -1

Query  711  SFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQS  532
            S  D+V   + S S + + ++  +  ++W ARN+ +WN+   +S  +    L    +WQ 
Sbjct  25   SLADFVFDIYCSESRDIVGRVALLLLQIWTARNDVIWNDAHRTSTSIGRTTLEAWQQWQE  84

Query  531  ANQ------LshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQF  370
             ++      + H  + V      W KP   WLK N D      +        + D+ GQF
Sbjct  85   VHKQHSPPVVQHMHNRVQGNNSVWEKPSETWLKCNVDAVFHDRNHITSFACCVRDSRGQF  144

Query  369  VAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLC-SSF  193
            + A++         +E EA+A+ EA+    + + ++V  ESD   ++QA++S     S F
Sbjct  145  IRAQTKWQRANMTVLEGEAVALLEAIHSADANRWNRVVFESDSSTLVQALSSPGHGDSEF  204

Query  192  DLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADCMVCVSVPFPCIAH  25
              I++ I       +N    FV+R AN VAH LAR     A   +  S PF CI H
Sbjct  205  SAIVSSIIYQLSLHSNFEVKFVRRQANMVAHTLARADCSWASHRIFYSYPF-CIEH  259



>ref|XP_002525921.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36441.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 75/135 (56%), Gaps = 2/135 (1%)
 Frame = -1

Query  483  TWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAI  304
            +W KP   +LK+N D  +       G G+V+ +     VAA+++   G+     AEA+A+
Sbjct  52   SWRKPHNEYLKINEDAGIFQAQNRTGYGMVVRNHAANLVAARALIIHGVYEANLAEAMAV  111

Query  303  REALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVK  124
            REAL W+K +   +V I+ D + V  A+ S +L  SF LII+  + +  +  + +F  ++
Sbjct  112  REALSWIKHMNWSRVSIDMDSLGVCVALTSDNL--SFGLIIDGCKHVVANIHDAAFTCIR  169

Query  123  RSANKVAHELAREAM  79
            RS N  AH LAR ++
Sbjct  170  RSTNHCAHMLARASV  184



>ref|XP_008337941.1| PREDICTED: uncharacterized protein LOC103401016 [Malus domestica]
Length=298

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/213 (24%), Positives = 99/213 (46%), Gaps = 1/213 (0%)
 Frame = -1

Query  723  HHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLL  544
            +H  SFM W++   + +        + + W +W ARN K+W   +       + A+ + L
Sbjct  82   NHPPSFMIWIDEVADLIPKARFNVFLMVYWTLWRARNMKLWEEKLEPPEVCTNRAIQWWL  141

Query  543  EWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVA  364
            E+         Q         WS    G +K+N D + +      G G ++ D+ G FVA
Sbjct  142  EFTRTKNAGSEQDSRLRNTPRWSVLPHGRIKMNIDGSWNVGRLIAGFGAIIRDSDGCFVA  201

Query  363  AKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDL  187
             ++  +  +C P+ +EA+A++  L W        + IE+D +++++A+   +L  S    
Sbjct  202  TRTGSFKDICSPLLSEAMAMKVGLLWAIDRGYQFLIIETDSLQIVEALRDLTLNLSIIGQ  261

Query  186  IINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
            ++ D + +    T  +  ++ R+AN  AH LA+
Sbjct  262  VVEDYKALLNTITEANITYIHRNANAAAHYLAK  294



>ref|XP_002529689.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32700.1| conserved hypothetical protein [Ricinus communis]
Length=119

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = -1

Query  363  AKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLI  184
            A  IP  G   P EAEAI+IREAL WLK    ++  IESD ++VI+A+ + S  S F LI
Sbjct  6    ADRIP--GNYTPREAEAISIREALSWLKQQIFEECIIESDALQVIEALKAPSSQSCFHLI  63

Query  183  INDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
            I+D + + + F  + F FV+RSAN  A  +AR A
Sbjct  64   IDDCKHLVQHFRQVHFQFVRRSANTAAQIVARGA  97



>ref|XP_010241360.1| PREDICTED: uncharacterized protein LOC104585986 [Nelumbo nucifera]
Length=265

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 110/235 (47%), Gaps = 14/235 (6%)
 Frame = -1

Query  753  CWDLFEHTIPHHCVS--FMDWVELQFNSLSDNELC-KLISICWKVWDARNEKVWNNIVIS  583
            C  L     P+  +S    DW  L  N  S+N +  +  SI W +W ARNE ++N    S
Sbjct  7    CLGLHISKFPNKTLSDWIADWSNLNDNEDSENNMIWRCFSIIWNIWLARNELIFNQKSWS  66

Query  582  SHDVVSGALSYLLEWQSANQLshhqshvshqVET-----WSKPLVGWLKLNSDEALDSNS  418
               +++   S  L  QS + L    ++            W KP +G LKLN D A  ++ 
Sbjct  67   PEMIINKENSLFLS-QSIHNLQISSANTQPTSTRVLQNLWVKPSLGSLKLNFDGANSTSE  125

Query  417  R*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCI  238
               G+GL++ D +G+ V A++IP +        EA A+ E +K    L L+ +  E D  
Sbjct  126  S--GIGLIIRDGFGEVVVARAIPVEANS-ASTTEAFALFEGIKLALQLDLNLIIFEGDAK  182

Query  237  KVIQAINSTSLCS--SFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAM  79
             +I ++   +     S  ++++  + +     + S  F  RS NKVAH+LAR A+
Sbjct  183  ILIDSLLEINPNPPWSLRVLLSSCKNLLDRLPDYSVTFTPRSGNKVAHKLARFAL  237



>ref|XP_002447811.1| hypothetical protein SORBIDRAFT_06g016240 [Sorghum bicolor]
 gb|EES12139.1| hypothetical protein SORBIDRAFT_06g016240 [Sorghum bicolor]
Length=342

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 110/244 (45%), Gaps = 9/244 (4%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHCVSF-----MDWVELQFNSLSDNELCKLISICWKVWD  622
            ++ + C +A+  W L    I  H  +        W+     +L   +L +++   W +W 
Sbjct  73   HSLIDCHMAKCVWALEREDITEHLCTIPAQDARGWLHTIITTLKHEDLTRVLVTLWAIWY  132

Query  621  ARNEKVWNNIV---ISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLK  451
            A+ + V+ N     +S+H  V   +S L   + A        H + Q   W  P  G +K
Sbjct  133  AKRQAVYENSFQSPLSTHCFVKSFMSDLELVKQAAPPGASHQHQNAQKAPWIPPPAGVMK  192

Query  450  LNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQ  271
            +N D A+  NS       V  D+ G FV A  +  +G+  P   EA+A RE+L     L 
Sbjct  193  INVDAAISKNSSKASASAVARDSSGMFVGASVVVTEGISDPEIMEAVACRESLALASDLL  252

Query  270  LDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
            L K+++  D I V++ I       S+  +I +I+     FT++ F +  R +N  AH LA
Sbjct  253  LQKIRVACDNITVVRNIRGKGF-GSYGHVIQEIKARGDSFTSVEFVYEGRMSNGDAHRLA  311

Query  90   REAM  79
            R ++
Sbjct  312  RGSL  315



>ref|XP_009137723.1| PREDICTED: uncharacterized protein LOC103861768 [Brassica rapa]
Length=251

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 89/189 (47%), Gaps = 1/189 (1%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            +CW +W ARN  ++ N V S   VV+ AL    EW  A ++             +  PL 
Sbjct  54   LCWNLWTARNRLIFENRVTSHAAVVTNALVNAREWNQAQKIPSPPGPTPTSAPLYHAPLP  113

Query  462  GWLKL-NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
                L NSD +    S   G+G +L +         S   + +  P  AEA+AIRE L+ 
Sbjct  114  PDTSLCNSDASWSQQSLQAGLGWILVNETLPQALFGSSCCNYVTSPFLAEALAIRECLRA  173

Query  285  LKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
             ++ Q+ KV + SD   +I+AINS +       ++ DI  ++  F  + F F+ R+ N  
Sbjct  174  ARTAQVTKVWMRSDSQSLIRAINSKTYPMELFGVLMDIELLSSTFGFILFTFIPRAQNSG  233

Query  105  AHELAREAM  79
            A  LA+ A+
Sbjct  234  ADSLAKSAL  242



>ref|XP_002465515.1| hypothetical protein SORBIDRAFT_01g040340 [Sorghum bicolor]
 gb|EER92513.1| hypothetical protein SORBIDRAFT_01g040340 [Sorghum bicolor]
Length=778

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 117/266 (44%), Gaps = 23/266 (9%)
 Frame = -1

Query  777  VSCSLAQKCWDLFEHTIPHHCVSFMDW-----VELQFNSLSDNELCKLISICWKVWDARN  613
            V C +A+  W L +  +  H     D      +   F++L  ++  ++    W +W AR 
Sbjct  516  VQCHMAKCVWALEKEELVEHVCRTQDADARGCLTRWFDTLPHDDAVRVAVTLWAIWYARR  575

Query  612  EKVWNNIV---ISSHDVVSGALSYLLEWQ-SANQLshhqshvshqVETWSKPLVGWLKLN  445
            + +   I    +S+H+ ++    Y  + Q S  Q        + +  TW  P  G +K+N
Sbjct  576  KVIHEGIFQSPLSTHNFIN---EYCDQLQVSKPQKQPKLGGQAGRCSTWIPPAAGQVKIN  632

Query  444  SDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLD  265
             D AL  NSR + +  +  D  G+++ A  + ++G+  P  AE +A RE L     L + 
Sbjct  633  VDAALSKNSRRIAVAAIARDCEGKYLGASGLVFEGITEPEIAEILACREGLDLASDLLVT  692

Query  264  KVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELARE  85
             +++ SDC   I+++    +   +  I+ +I + AR F+ + F    R  N  AH +AR 
Sbjct  693  SLRLASDCDNAIRSLKGDGM-GPYGQIVKEINDRARVFSAVEFVHENRQVNIDAHCIARS  751

Query  84   AMF----------KADCMVCVSVPFP  37
             +           +  C VC  V  P
Sbjct  752  LVLAETDRHVWFVEPPCGVCNYVNLP  777



>ref|XP_010666374.1| PREDICTED: uncharacterized protein LOC104883530 [Beta vulgaris 
subsp. vulgaris]
Length=283

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 112/240 (47%), Gaps = 7/240 (3%)
 Frame = -1

Query  792  LFYAFVSCSLAQKCWD---LFEHTIPHHCVSFMDWVELQFNSLSDNELCKLI-SICWKVW  625
            + +A   C +AQ  W    L          SFMDWV+      +D+    L  S+ W +W
Sbjct  32   ILHALFLCPIAQLVWKVSPLRLEVFVGLGESFMDWVKFFALKFTDDLWWALFWSLLWGIW  91

Query  624  DARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET-WSKPLVGWLKL  448
              +N  V+ N  + + +VV  A+S + E+ +AN+     + V    E  W  P  GW ++
Sbjct  92   LNKNAWVFENRNLEAVNVVERAISKMGEFNAANENVKLDTLVIRGGEKRWQAPRDGWFQV  151

Query  447  NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQL  268
            NSD A+    + +G G V+ D+ G  + A     DG     EAEA+A+R A+K      L
Sbjct  152  NSDAAVFEEGK-IGCGWVMRDSVGDVMVATMCLMDGGMAVDEAEAVALRHAVKIAIEAGL  210

Query  267  DKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
                  SD +K+I  +       +SF  I+ DI ++      + F+ V    N+VAH+LA
Sbjct  211  LDFVAGSDNLKLIDHLKKGLKENTSFGNIVADILDVVYVCRRVVFNHVCMDGNRVAHKLA  270



>ref|XP_007217321.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
Length=1275

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 87/196 (44%), Gaps = 7/196 (4%)
 Frame = -1

Query  585   SSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MG  406
             S H+VV  A  Y+ E+ +AN      +        W+ P  G LK N D A D  S    
Sbjct  1064  SPHEVVGFAQQYVHEFITANDTPSKVTDRVRDPVRWAAPPSGRLKFNFDGAFDPTSGREA  1123

Query  405   MGLVLWDAYGQFVAA--KSIPWDGLCLPME-AEAIAIREALKWLKSLQLDKVQIESDCIK  235
             +G+V  DA G FVAA  KS+   G  L  E AE +  RE +    SL       E D   
Sbjct  1124  VGVVARDADGGFVAAVAKSV---GEVLSAEHAEILVAREGVALALSLGTASPIFEGDSAV  1180

Query  234   VIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADCMV  58
             V+ AI       S+   I+ D++ + + F +  F F  R AN VAH LAR  +   D  +
Sbjct  1181  VVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREANGVAHRLARFGLHNVDNFI  1240

Query  57    CVSVPFPCIAHSLELD  10
                VP   I  +L  D
Sbjct  1241  WFEVPPDLIQDALLCD  1256



>ref|NP_001047170.1| Os02g0566300 [Oryza sativa Japonica Group]
 dbj|BAF09084.1| Os02g0566300 [Oryza sativa Japonica Group]
Length=288

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 112/260 (43%), Gaps = 11/260 (4%)
 Frame = -1

Query  786  YAFVSCSLAQKCW-----DLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWD  622
            +A + C++++  W     DL E     +     DW+    + L   +  KL+  CW +W 
Sbjct  19   HALLHCTMSKCVWALMDNDLAELIATTNIKDPKDWLFYMLDVLKPGDRTKLLVSCWAIWR  78

Query  621  ARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ---LshhqshvshqVETWSKPLVGWLK  451
            AR   + +    S    +    SYL +    N    L   +     +V  W  P    +K
Sbjct  79   ARRRVLHDEFYESPLTRMHFIKSYLADMDLINIPLCLQDKKHLTYPKVPVWMPPPEDCVK  138

Query  450  LNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQ  271
            +N D A+        +G V     G+FVAA ++ W+GL      EA+   E L       
Sbjct  139  INVDAAISRWGNKGAVGAVCHTVSGEFVAASAMVWEGLSDSATLEALGCNEGLAIAMGCN  198

Query  270  LDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
            + +V I SDC++VI++I+    C  +  ++NDI    + F  + F    ++ N  AH LA
Sbjct  199  MSEVCIASDCLEVIRSISKKPRC-QYLAVLNDIEARRKHFAKVEFRHENQACNFDAHNLA  257

Query  90   REA-MFKADCMVCVSVPFPC  34
            + A   +  C +  S P PC
Sbjct  258  KFASTLQEGCYLWFSNP-PC  276



>ref|XP_008358038.1| PREDICTED: uncharacterized protein LOC103421772 [Malus domestica]
Length=244

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 70/135 (52%), Gaps = 1/135 (1%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W+KP  G +KLN D A D+     G   ++ D+ G F+A  S     +  P   EAIA+R
Sbjct  86   WTKPRQGQVKLNXDGAWDATHLVGGXRAIIXDSDGNFLAGLSKSSLYISSPFFXEAIAVR  145

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVK  124
            E L    S     + +ESD  +++QA+  S+   S   LI  D R IA   T +SF  ++
Sbjct  146  EGLALAYSRGFQNIIVESDSXQIVQALCYSSPDLSXVGLIXEDSRAIAXAITGVSFTHIR  205

Query  123  RSANKVAHELAREAM  79
            R AN+VAH  AR + 
Sbjct  206  RQANEVAHRXARYSF  220



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score = 81.6 bits (200),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 97/210 (46%), Gaps = 3/210 (1%)
 Frame = -1

Query  702  DWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLL-EWQSAN  526
            DWV      LS  +    + + W +W+ARN  +WNN   S H+ VS   S  L ++   +
Sbjct  758  DWVCRCAEQLSSQDFATFLMVGWAIWEARNGLLWNN-KKSRHEQVSLHASLRLHDFLRVS  816

Query  525  QLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPW  346
                 QS      + W  P    LK+N D A    +   G+G+V+ D+ G+FVA  +   
Sbjct  817  NCLGSQSRQGQIKQMWQPPHENSLKINVDGAWKPGTTEGGVGVVVRDSTGKFVAGCATKL  876

Query  345  DGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIR  169
              +    + EA+A R             V  ESD ++++ A+ + S+  S    ++ D +
Sbjct  877  TNVFSAPQVEALAARTNTILAMERGYQNVVFESDALQIVTALRNHSIDRSVIGPVVEDTK  936

Query  168  EIARDFTNLSFHFVKRSANKVAHELAREAM  79
             +    T   F  ++R+AN VAH LAR A+
Sbjct  937  SLLTQITGEGFTHIRRTANGVAHRLARFAL  966



>ref|XP_010673863.1| PREDICTED: uncharacterized protein LOC104890171 [Beta vulgaris 
subsp. vulgaris]
Length=200

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 84/164 (51%), Gaps = 3/164 (2%)
 Frame = -1

Query  573  VVSGALSYLLEWQSAN-QLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGL  397
            V+  A++ + E+Q+A  +            + W  P  G  K+NSD A+  +   +G G 
Sbjct  6    VIEKAVNIVNEYQAARAEPKEVPPAAGGGQKIWQAPTSGTFKINSDAAVYGDGT-LGFGG  64

Query  396  VLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAIN  217
            ++ D  G+ + A    ++G C    AEA+A R A+K      L  + +ESDC+K+I  + 
Sbjct  65   IVRDEMGEVMLATCDVYEGGCDTDVAEAMAARHAVKVAVEAGLRNIVLESDCLKLITHLK  124

Query  216  STSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
               L  S F LI+ DI        +L+F+ V+R  N+VAH+LA+
Sbjct  125  KGLLENSGFSLIVKDILLFRSSNVSLAFNHVRREGNRVAHQLAQ  168



>ref|XP_004292499.1| PREDICTED: uncharacterized protein LOC101304542 [Fragaria vesca 
subsp. vesca]
Length=202

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 99/197 (50%), Gaps = 7/197 (4%)
 Frame = -1

Query  666  NELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLE-WQSANQLshhqshvshq  490
            N   K+  +CW+ W  RN+ V+ +I++++  VV+ A SY  E   + + +    +  +  
Sbjct  10   NLFEKVFILCWQTWKTRNDIVFKDIIVTTSKVVAIATSYQNEVLLTDDVIEEGINQTTPT  69

Query  489  VETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAI  310
               WS  L   +K+N D ++  NS  +  G V  +  G  + +         +P  AEA+
Sbjct  70   TIGWSPALNSHIKINFDGSVQGNS--VAGGYVFRNHEGNVIISGVKRLGRTTIPT-AEAV  126

Query  309  AIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL--IINDIREIARDFTNLSF  136
            A+R++L   K      +Q+ESD   VI  +N   + + + L  II DI+ IAR F+++SF
Sbjct  127  ALRDSLVKAKEQGYHNIQVESDSKLVIDVVNG-RISTPWRLLKIIQDIKNIARSFSSISF  185

Query  135  HFVKRSANKVAHELARE  85
            + V    N VA  +A E
Sbjct  186  NHVYGETNFVADAMAHE  202



>ref|XP_012081305.1| PREDICTED: uncharacterized protein LOC105641392 [Jatropha curcas]
Length=233

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 82/161 (51%), Gaps = 1/161 (1%)
 Frame = -1

Query  561  ALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDA  382
            A S+L EW++A     + S     V TW+ P  G +K N D A+ +         ++ + 
Sbjct  48   ATSFLREWKNAQISRRNSSSPPASVLTWAPPPTGIVKCNFDAAIHTTEGRSSYAGLIRNE  107

Query  381  YGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINST-SL  205
             GQF+AA +  + G+  P   EAI +RE L WL +     V +E+DC+++ QA+ +    
Sbjct  108  VGQFLAACTGHFAGVLQPHITEAIGLREVLSWLLARSFGSVLLETDCLRLFQAVTAGFEP  167

Query  204  CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
             S +  ++ +I+ +     +    +V+R  NK AH LAR A
Sbjct  168  YSDWAPVLEEIKHLLSQIPSCELIWVRRQVNKPAHALARVA  208



>ref|XP_009148205.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=541

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 119/254 (47%), Gaps = 19/254 (7%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLIS------------  643
            + F++C  A++ W+    T  H+ ++ +D  + Q  +L D++  + +             
Sbjct  289  HLFLTCPFARQIWN---QTPIHNVMNIIDSADFQ-RALKDSKKARNLPPIGMRMGSLFPW  344

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPL-  466
            ICW +W ARN K++ N    + +V+S A++  LEWQ+A + S               P  
Sbjct  345  ICWNLWIARNHKIFQNRCFEAKEVLSKAIADALEWQTAQEQSITGLATEQNTIVQRPPPQ  404

Query  465  --VGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
                 + +N+D A   + +  G+  +  D  G+ +A  +     +  P+ AE +A+REAL
Sbjct  405  MNPDIITVNTDAAWKESEQKAGLAWLFSDNTGRILARGTSLELYVPSPLVAEGMALREAL  464

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
               ++L  +K+ I+SD   +I+AIN          I+ DI  ++   +  SF F+ R  N
Sbjct  465  LHAQALGFNKLCIKSDAQIIIRAINRRDPIKELCGILQDILNLSCYLSVSSFIFISRKDN  524

Query  111  KVAHELAREAMFKA  70
              A  LA+  + + 
Sbjct  525  MAADALAKRVLVET  538



>ref|XP_012065949.1| PREDICTED: uncharacterized protein LOC105629045 [Jatropha curcas]
Length=335

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 105/230 (46%), Gaps = 13/230 (6%)
 Frame = -1

Query  813  CAM*R*VLFYAFVSCSLAQKCWDLFEHTIP--------HHCVSFMDWVELQFNSLSDNEL  658
            C +    L +  V CS A+ CW     ++P           VSF DW+      L+ + L
Sbjct  109  CGLPAEFLLHLLVDCSFARDCWSC---SVPGVVDIVDLQMDVSFQDWLLNTVRVLTASYL  165

Query  657  CKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET-  481
                 + W +W  RN+ +W  +  S H ++S +  + + WQ+A      Q      V T 
Sbjct  166  EFFFLVTWIIWRNRNQVLWTWVRSSIHHLLSSSKDWFMAWQAAQLRRSSQVKHGPHVSTV  225

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            WS P  G+ K N D AL  NS  MG G VL DA G  +    +   G   P  AE ++ R
Sbjct  226  WSLPSAGYFKCNFDAALRPNSSQMGAGWVLRDADGLLLHTCQVLIRGSYCPQVAETLSFR  285

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL-IINDIREIARD  154
            EAL W+K      V  ESD   ++QA    ++ +S+ + I+ D R + ++
Sbjct  286  EALNWIKGKSCANVVFESDSQLLVQAKQRRAVENSYFMSIVLDCRLLYKN  335



>ref|NP_187562.1| RNase H domain-containing protein [Arabidopsis thaliana]
 gb|AAF23283.1|AC016661_8 putative non-LTR reverse transcriptase [Arabidopsis thaliana]
 gb|AEE74775.1| RNase H domain-containing protein [Arabidopsis thaliana]
Length=484

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/247 (26%), Positives = 108/247 (44%), Gaps = 16/247 (6%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVE--------LQFNSLSDNELCKLISICWK  631
            +A  +C  A   W L + ++  + +   D+ E        +Q  ++SD      + + W+
Sbjct  212  HALFTCPFATMAWRLSDSSLIRNQLMSNDFEENISNILNFVQDTTMSDFHKLLPVWLIWR  271

Query  630  VWDARNEKVWNNIVISSHDVVSGALSYLLEW----QSANQLshhqshvshqVETWSKPLV  463
            +W ARN  V+N    S    V  A +   +W    QS  +       ++     W  P  
Sbjct  272  IWKARNNVVFNKFRESPSKTVLSAKAETHDWLNATQSHKKTPSPTRQIAENKIEWRNPPA  331

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK--  289
             ++K N D   D        G ++ + YG  ++  S+       P+EAE  A+  AL+  
Sbjct  332  TYVKCNFDAGFDVQKLEATGGWIIRNHYGTPISWGSMKLAHTSNPLEAETKALLAALQQT  391

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
            W++     +V +E DC  +I  IN  S  SS    + DI   A  F ++ F F++R  NK
Sbjct  392  WIRGYT--QVFMEGDCQTLINLINGISFHSSLANHLEDISFWANKFASIQFGFIRRKGNK  449

Query  108  VAHELAR  88
            +AH LA+
Sbjct  450  LAHVLAK  456



>ref|XP_009115865.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=574

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 95/196 (48%), Gaps = 13/196 (7%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEW--------QSANQLshhqshvshqV  487
            +CW +W ARN  ++     +  +V + A+    EW        QS N L H       + 
Sbjct  381  VCWALWTARNTLLFEKRTFTPTEVATKAIRLAREWINAQDHQTQSTNGLPHPNRKHQFRS  440

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
             T   P        SD A D+ SR  G+  ++    G+ +  +S   + +  P+ AEA+A
Sbjct  441  ATGGTPTC-----KSDAAYDAQSRRAGLAWIINKPSGRMIHQESRTQNFVPSPLVAEALA  495

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFV  127
            +R  L     L+L K+++ SD   +++AIN+ +       IINDI++I+  F  +SF  +
Sbjct  496  LRAGLIDAVKLELPKLRMLSDNSTLVRAINNDAQAKEIFGIINDIQQISSAFVEISFTHI  555

Query  126  KRSANKVAHELAREAM  79
             RS N+ A  LA+ ++
Sbjct  556  SRSFNEDADRLAKSSL  571



>ref|XP_010236322.1| PREDICTED: uncharacterized protein LOC104583970 [Brachypodium 
distachyon]
Length=284

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 119/267 (45%), Gaps = 13/267 (5%)
 Frame = -1

Query  786  YAFVSCSLAQKCW-----DLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWD  622
            ++ + C++++  W      L+EH           W+    +SL   EL +     W +W 
Sbjct  18   HSLIECNMSRCIWALAPESLWEHMERTSEPDAKQWIFTMIDSLPHEELTRCFVTLWAIWY  77

Query  621  ARNEKVWNNIV---ISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLK  451
            AR + +  +     +S+H  +   L + L+  + ++     +      + W  P V   K
Sbjct  78   ARRKVLHEDRYQSPLSTHAFIDSFL-HDLKISTPSREITRGAGAPAPTKRWLPPPVDHAK  136

Query  450  LNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQ  271
            +N D A+        +  V  D  G+F+ A +    G+  P   E +A REAL   + LQ
Sbjct  137  INVDAAVAKQVCAGAITAVCRDMDGRFLGASAQVIAGINDPGTLETLACREALSLAEDLQ  196

Query  270  LDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
            L  +++ SDC++VI A+   +L   F L++ +I+     F ++ F    R++N  AH LA
Sbjct  197  LAHLRVASDCLEVIMALMGDNL-GRFALVLQEIKRCYPRFASVEFVHEGRASNMEAHTLA  255

Query  90   REAMFKADCMVC--VSVPFP-CIAHSL  19
            R +  + +      V  P P CI H L
Sbjct  256  RASTSRQEGRYIWLVESPDPHCIPHLL  282



>ref|XP_012065097.1| PREDICTED: uncharacterized protein LOC105628309 [Jatropha curcas]
Length=232

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 94/181 (52%), Gaps = 4/181 (2%)
 Frame = -1

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQ--LshhqshvshqVETWSKPLVGWLKLN  445
            RNE  W+ +  + + VV+ A S L  W+ A    L     + +     W  P  G  K+N
Sbjct  28   RNELEWDRVDEAPYHVVTRARSMLASWKKAQLKLLDSDTGNNASADSQWFPPPTGTFKMN  87

Query  444  SDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLD  265
             D AL  ++    +G VL + +G FV+A +    G   P+ AEA A+R+ L W+ S    
Sbjct  88   FDAALLPSAGHGAVGAVLSNCHGGFVSAATSSMHGCSSPVVAEAQALRKVLSWVLSGHPT  147

Query  264  -KVQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELA  91
              +Q+E++ ++V  A+ S+    S F ++I++ + +    +N++  ++ R AN +AH LA
Sbjct  148  LTIQVETNRLQVYHAMRSSVHDWSEFGVVISECKLLIVQLSNVTLAWIGRQANDIAHVLA  207

Query  90   R  88
            +
Sbjct  208  K  208



>ref|XP_012072005.1| PREDICTED: uncharacterized protein LOC105633915 [Jatropha curcas]
Length=194

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 78/142 (55%), Gaps = 2/142 (1%)
 Frame = -1

Query  450  LNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQ  271
            +N+D +    S  +G+G+V+ ++  +F+A K+  + G       EAIA+REAL W+K   
Sbjct  47   VNTDASTGVASGYVGIGIVVRNSTSEFIAGKAWRFSGFFTAKVVEAIAVREALSWIKDHG  106

Query  270  LDKVQIESDCIKVIQAIN--STSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHE  97
             + + +E+D   V  AIN  +T+  S+F LII + + +  +   +  +FV RSAN  AH 
Sbjct  107  WNYILLETDSQSVANAINDDTTNDSSAFGLIIQNCKSLLSEIPVVKCNFVYRSANVAAHT  166

Query  96   LAREAMFKADCMVCVSVPFPCI  31
            LA     +A   V  SVP P +
Sbjct  167  LAVGTHSEAGLGVWNSVPPPVL  188



>ref|XP_008352570.1| PREDICTED: uncharacterized protein LOC103416078 [Malus domestica]
Length=251

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 94/207 (45%), Gaps = 9/207 (4%)
 Frame = -1

Query  720  HCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLE  541
            H  SF+ W+    + +        + ICW +W ARN+K+W + ++S      GA+ + LE
Sbjct  36   HPPSFLLWLNEIVDLIPKASFDVFMMICWALWGARNKKLWEDKLVSPEICTVGAIQWWLE  95

Query  540  WQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAA  361
            +         Q         W  P  G LKLN D + ++     G G ++ D  G FVAA
Sbjct  96   FTRLTIPGAEQDSKLRSTPRWKVPPQGRLKLNVDGSWNAEKLVAGFGAIIRDGDGLFVAA  155

Query  360  KSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLI  184
                ++ +  P+ +EA+A+R  L W        + IE+D +++++A+    L  S  D++
Sbjct  156  SIGSFEDIASPLLSEAMAMRAGLLWAIDRVYQFLIIETDSLQIVEAVRDPILNLSPIDML  215

Query  183  --------INDIREIARDFTNLSFHFV  127
                    I  +++I+  F  +    +
Sbjct  216  WRIAKRYSIQSLKQISPIFVEMQTRLL  242



>ref|XP_007214838.1| hypothetical protein PRUPE_ppa018217mg, partial [Prunus persica]
 gb|EMJ16037.1| hypothetical protein PRUPE_ppa018217mg, partial [Prunus persica]
Length=320

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 74/136 (54%), Gaps = 1/136 (1%)
 Frame = -1

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
             TW+KP  G LK+N D +  + +   G+G+V+ D+ G+FVA +++  D +   ++ EA A
Sbjct  144  HTWTKPCAGGLKINLDGSWTAGNTYGGVGIVVRDSNGRFVAGRALRVDNVFSALQVEASA  203

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHF  130
             RE          + V  ESD ++++ AI S+S+  S+   ++ D + +    T   F  
Sbjct  204  AREGAILAVERDFNNVIFESDSLQILSAIRSSSVDRSNVGQVVEDTKALLTQITGDGFTH  263

Query  129  VKRSANKVAHELAREA  82
            ++R AN  AH LAR A
Sbjct  264  IRRVANGAAHRLARYA  279



>ref|XP_009139324.1| PREDICTED: uncharacterized protein LOC103863319 [Brassica rapa]
Length=375

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 112/248 (45%), Gaps = 36/248 (15%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHC----VSFMDWVE-LQFNSLSDNELCKLIS-------  643
            + F++C+ A + W L     P HC     +  D+   LQ +  S N   + +        
Sbjct  145  HMFLACNFATEVWSL----APIHCGDNLANARDFTAALQASKASPNLPPRGMVKGSLFPW  200

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            I W +W  RN++V+ NI  S+ +V+  A+    EW+ A                      
Sbjct  201  IVWTIWKTRNQRVFENIHFSTVEVIHKAVIEAREWEEAQ--------------------A  240

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
              + +N+D A    ++  G+  +  D+ GQ +   ++  + +  P+ AE +AIREAL   
Sbjct  241  DTITVNTDAAWREETKTAGLAWIFTDSNGQILQQGAMTEEWVISPLVAEGLAIREALFQA  300

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
             ++ ++K+ I+SD   +I+AIN          I+ DI  +    + +SF  + RS N  A
Sbjct  301  HAIGINKLDIKSDAQIIIRAINGRESIKGRFGILQDIHNLTCCLSVISFSHIPRSNNNAA  360

Query  102  HELAREAM  79
              LA+ A+
Sbjct  361  DSLAKRAL  368



>ref|XP_012069339.1| PREDICTED: uncharacterized protein LOC105631774 [Jatropha curcas]
Length=666

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 103/210 (49%), Gaps = 5/210 (2%)
 Frame = -1

Query  657  CKLISICWKVWDA-RNEKVWNNIVISSHDVVSGALSYLLEWQSANQ--LshhqshvshqV  487
            C     CW+ +   RNE  W+ +  + + VV+ A S L  W+ A    L     + +   
Sbjct  448  CPKARFCWQFFGLNRNELEWDRVDEAPYHVVTRARSMLASWKKAQLKLLDSDTGNNASAD  507

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
              W  P  G  K+N D AL  ++    +G VL + +G FV+A +    G   P+ AEA A
Sbjct  508  SQWFPPPTGTFKMNFDAALLPSASHGAVGAVLSNCHGGFVSAATSSMHGCSSPVVAEAQA  567

Query  306  IREALKWLKSLQLD-KVQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFH  133
            +R+ L W+ S      +Q+E++ ++V  A+ S+    S F ++I++ + +    +N++  
Sbjct  568  LRKVLSWVLSGHPTLTIQVETNRLQVYHAMRSSVHDWSEFGVVISECKLLIVQLSNVTLA  627

Query  132  FVKRSANKVAHELAREAMFKADCMVCVSVP  43
            ++ R AN +AH LA+     A      SVP
Sbjct  628  WIGRQANDIAHVLAKSVPSGACFQTWDSVP  657



>ref|XP_009105592.1| PREDICTED: uncharacterized protein LOC103831463 [Brassica rapa]
Length=419

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/257 (27%), Positives = 120/257 (47%), Gaps = 25/257 (10%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPH---HCVSFMDWVELQFNSLSDNELCKLISI----C  637
             L + F SC+ A+  W+L   T P     C SF + +E+ F+ ++   +    +I    C
Sbjct  82   TLEHIFFSCAPAKAVWELCPWTEPMDPLSCTSFRNTLEISFSKVNLPPIGTSANIFAWVC  141

Query  636  WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGW  457
            W +W  RN+  + N   +  D++S A++ L EW+ A        ++         PL+  
Sbjct  142  WSLWINRNQFTFENKSTAPRDILSKAIALLKEWEFAQPPPAQSPNI-------PPPLIP-  193

Query  456  LKLNS--------DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
             +++S        D A   +S   G+  +     G+ ++        +   + AEA+A+R
Sbjct  194  TQISSSATIICCSDAAWKKDSGEAGLAWIFKKHTGEEISRGCRHDYHVSSALMAEALAVR  253

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFH--FV  127
             AL+   SL L+ + + SDC ++IQAINST        ++ DI  I     + SFH  F+
Sbjct  254  AALEHAFSLNLNIIWLRSDCKRLIQAINSTQGSVELYGVLADIESIIASSPSFSFHASFI  313

Query  126  KRSANKVAHELAREAMF  76
             R+ N  A  LA+ ++F
Sbjct  314  PRALNGPADLLAKSSLF  330



>ref|XP_009123637.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=300

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 98/194 (51%), Gaps = 15/194 (8%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            + W VW ARN+ V+   V    +V+S +++   EW++AN       H   +    S PL 
Sbjct  110  LLWNVWTARNKVVFEGKVFQVTEVISKSIADAREWEAAN------LHQELKQTKKSGPL-  162

Query  462  GWLKLNS------DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
              L+L+S      D A    S+  GMG ++ +A G+ +   S   + +C  + AEA+AIR
Sbjct  163  --LRLHSVPMCWTDGAWQEISKSGGMGWIIKNAEGEVLMRGSSNREFVCSALMAEALAIR  220

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKR  121
            +AL   K L L  +Q+ SD   ++ A+ S         ++ DIR +A  F  LSF F+ R
Sbjct  221  DALIKAKELNLHSIQLFSDSQVLVSALRSGLDVIEIAGVLLDIRNLATLFCPLSFIFIPR  280

Query  120  SANKVAHELAREAM  79
              N+ A  LAR A+
Sbjct  281  LENRQADSLARAAL  294



>ref|XP_009378152.1| PREDICTED: uncharacterized protein LOC103966680 [Pyrus x bretschneideri]
Length=224

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 81/155 (52%), Gaps = 5/155 (3%)
 Frame = -1

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
            +TW +P  GW K N D A D ++   G+G++  +A G F+AA ++   G+  P  AE  A
Sbjct  42   QTWRRPEEGWFKCNFDGAWDEHAAVDGVGIISKNAAGDFIAALAMKMTGIASPTHAEIAA  101

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSLC--SSFDLIINDIREIARDFTNLSFH  133
             REA  +    + +++  E D + VI AI + ++     F L++ D R I + F      
Sbjct  102  AREAAVFALQWRTERIIFEGDALLVIAAIQNNAVVNHGPFGLLLEDTRRILQSFKKWKAS  161

Query  132  FVKRSANKVAHELAREAMFKADCMVCVSVPFPCIA  28
            FV+R AN VAH LAR   F+A   V   +P   ++
Sbjct  162  FVRRDANSVAHRLAR---FRAGLDVLRQLPLDPVS  193



>ref|XP_009123828.1| PREDICTED: uncharacterized protein LOC103848744 [Brassica rapa]
Length=468

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 94/193 (49%), Gaps = 13/193 (7%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEW--------QSANQLshhqshvshqV  487
            +CW +W ARN  ++     +  +V + A+    EW        QS N L H +     + 
Sbjct  275  VCWALWTARNTLLFEKRTFTPTEVATKAIRLAREWINAQAHQTQSTNVLPHPKRKHQFRS  334

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
             T   P        SD A D+ SR  G+  ++    G+ +  +S   + +  P+ AEA+A
Sbjct  335  ATGDTPTC-----KSDAAYDAQSRRAGLAWIINKPSGRMIHQESRTQNFVPSPLVAEALA  389

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFV  127
            +R  L     L+L K+++ SD   +++AIN+ +       IINDI++I+  F  +SF  +
Sbjct  390  LRAGLIDAVKLELPKLRMLSDNSTLVRAINNDAQAKEIFGIINDIQQISSAFVEISFTHI  449

Query  126  KRSANKVAHELAR  88
             RS N+ A  LA+
Sbjct  450  SRSFNEDADRLAK  462



>gb|AFK38936.1| unknown [Medicago truncatula]
Length=297

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 90/192 (47%), Gaps = 3/192 (2%)
 Frame = -1

Query  654  KLISIC-WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETW  478
            +L  +C WK+W  RN+ ++N +V     V + A  ++ E+  AN  +     +    + W
Sbjct  82   QLFCVCLWKIWFFRNQAIFNQVVFEPRMVAASAHDFVSEFNLANP-TRSVDRLQIPAQVW  140

Query  477  SKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIRE  298
              P   +LK N D   D + + +  GLV+ +   + + A +   D +  P+  E + +R 
Sbjct  141  IAPPTDFLKANIDAGRDKHGK-VTWGLVIRNHESEVLFAATQSPDIMADPLLVETLGLRW  199

Query  297  ALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRS  118
             ++ +  LQL  V  E D   V++  N  S  +S    I+D  ++       S  FV RS
Sbjct  200  GIQTVLELQLSNVMFELDASVVVKCFNGLSTIASISPFISDCHDLFGSLVGSSVSFVNRS  259

Query  117  ANKVAHELAREA  82
             N  AHELA+ A
Sbjct  260  CNVAAHELAQVA  271



>ref|XP_003594556.1| hypothetical protein MTR_2g030550 [Medicago truncatula]
Length=152

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 71/145 (49%), Gaps = 3/145 (2%)
 Frame = -1

Query  456  LKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKS  277
            LK N D A  S+   +G G+ + D  GQFVAAK++    +C     EA+ +  A++W+  
Sbjct  5    LKCNLDAAFSSSLNVIGFGMCIRDEVGQFVAAKTLRSSPICDSSIGEALGLSYAIQWVHE  64

Query  276  LQLDKVQIESDCIKVIQ-AINSTSLCSSFDLIINDIREIARD-FTNLSFHFVKRSANKVA  103
            LQL  V  E D  + +   I  ++  S F  II+D R      F N    F +R AN VA
Sbjct  65   LQLTNVDFEMDAKRAVDYYIKGSNDISEFGAIIDDCRRRCCSWFENSKIEFNRRQANIVA  124

Query  102  HELAREAMFKADCMVCVSVPFPCIA  28
            H +AREA+          VP  CI 
Sbjct  125  HTIAREAILLTSSQTFNVVP-SCIG  148



>ref|XP_003588770.1| hypothetical protein MTR_1g012560 [Medicago truncatula]
Length=214

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 72/153 (47%), Gaps = 3/153 (2%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            WSKP  G  K N D +  S+   +G+G+   D  G+FV+AK   +  LC     EA+   
Sbjct  55   WSKPAYGRYKCNIDTSFSSSMNMVGIGICFRDDRGEFVSAKIDCFPPLCDVAVGEAVGFH  114

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREIAR-DFTNLSFHFV  127
              LKW+  L  D V    D   V+    S+    S F  I+ D +++    F N    F 
Sbjct  115  TKLKWMAELHYDNVDFALDSKIVVDHFRSSLEDDSEFGCIMYDCKQLFEISFQNSHVEFN  174

Query  126  KRSANKVAHELAREAMFKADCMVCVSVPFPCIA  28
            +R AN VAHEL R A   A   V  +VP  CI+
Sbjct  175  RRQANGVAHELVRVAPSHASSHVYGNVP-SCIS  206



>ref|XP_002512628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50080.1| conserved hypothetical protein [Ricinus communis]
Length=223

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 82/181 (45%), Gaps = 21/181 (12%)
 Frame = -1

Query  630  VWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLK  451
            VW  RN  +W          +S ALS+L +W+ +   S                      
Sbjct  32   VWKQRNNLLWTGACTPVLVSLSNALSFLHQWRRSRATSTV--------------------  71

Query  450  LNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQ  271
            L S     +N   +GM  V+ D+ G FVA  +    GL  P  AEA+A++EA++W   ++
Sbjct  72   LGSTRTQGTNEMKIGMAAVVSDSNGTFVACMAHAVLGLFEPRLAEAVALKEAIRWAIQMR  131

Query  270  LDKVQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFHFVKRSANKVAHEL  94
               V  ESD    + AI S +   S F +II++ R +     N   +FVKR AN VAH L
Sbjct  132  FSLVVFESDSKIAVDAIRSLAADWSEFGIIIDECRSLLSLGLNFQVYFVKRQANMVAHVL  191

Query  93   A  91
            A
Sbjct  192  A  192



>ref|XP_012083900.1| PREDICTED: uncharacterized protein LOC105643399 [Jatropha curcas]
Length=1056

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 102/219 (47%), Gaps = 6/219 (3%)
 Frame = -1

Query  711   SFMDWVELQFNSLSDNELCK-LISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQ  535
             +F+  +E   + L +NE  +  +   W VW +RNE  WN +    + VV  A S L  W+
Sbjct  837   TFLQLLE-HLHKLWENEFFESFVMGLWSVWSSRNELKWNQVEEGPYHVVPRARSMLASWK  895

Query  534   SAN--QLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAA  361
              A            +     W  P VG  K+N D  L  +     +G ++ +    FV+A
Sbjct  896   KAQLKPPGPSTGTDAPAGSQWFPPPVGTFKINFDATLLPSVGHGAVGAIISNCNSGFVSA  955

Query  360   KSIPWDGLCLPMEAEAIAIREA-LKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDL  187
              +    G   P  AEA A+R      L S    K+QIE+DC++V  A+ NS    S F +
Sbjct  956   ATSSLQGCSTPAVAEAQALRTVLSWLLSSYSSLKIQIETDCLQVYCAMRNSVQDWSEFGV  1015

Query  186   IINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKA  70
             +I++ + +     N++  +++R AN +AH LA+     A
Sbjct  1016  VISECKLLLVQLPNVTLVWIRRQANDIAHVLAKSVPHGA  1054



>ref|XP_009121392.1| PREDICTED: uncharacterized protein LOC103846249 [Brassica rapa]
Length=253

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 93/198 (47%), Gaps = 10/198 (5%)
 Frame = -1

Query  648  ISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET----  481
            I I W++W +RN  V+        +++S A S   EW++     ++ S       T    
Sbjct  28   IWILWRLWKSRNVLVFQQRDFHWKNILSVARSDAREWRNIETQDNNASDGHRISPTIRSS  87

Query  480  --WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
              W  P   WLK N D +          G ++ D +G +  A  +  + +C P+E+E  A
Sbjct  88   QRWKAPPNQWLKCNVDASFIDTREPSSAGWIIRDEHGIYKGAVQVQGNMICSPLESELQA  147

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLI--INDIREIARDFTNLSFH  133
            I  A+++  +   +K+ IESDC K I  +N   L   FD      +IR  A    N+SF 
Sbjct  148  ILMAVQFCWTKGYNKIIIESDCRKAIDILNDLVL--HFDSFNWKREIRWWAEKIQNISFQ  205

Query  132  FVKRSANKVAHELAREAM  79
            +VKR ANKVA  LAR  +
Sbjct  206  WVKREANKVADSLARTPL  223



>ref|XP_006493122.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=765

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/258 (23%), Positives = 120/258 (47%), Gaps = 6/258 (2%)
 Frame = -1

Query  813  CAM*R*VLFYAFVSCSLAQKCWDL--FEHTIPH-HCVSFMDWVELQFNSLSDNELCKLIS  643
            C   R  +F++   C  ++K W L  FE  +    C   +  +    +  S  E+  +++
Sbjct  494  CRSHRETIFHSLFDCKASRKIWKLTTFEEEVKALKCKDVLSLLLALADRRSKTEMELIVA  553

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSAN--QLshhqshvshqVETWSKP  469
            +CW +W +RN  ++ N        V+GA + +  ++     QL           + W  P
Sbjct  554  VCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKRIQMPQLQAFSDQDLVSHKHWKCP  613

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
              GW K+N D A+   ++ +G+G+V+ ++ G+F+ A   P   +     AEA A R  L+
Sbjct  614  PAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWIDRVDYAEAEATRFGLE  673

Query  288  WLKSLQLDKVQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
              +S     + +E+D  +V   +++  S  +    I++++++  +   ++      R+ N
Sbjct  674  VAESAGCLPLIVETDSKEVTDLVSARKSTKAEIFWIVSEVQDTMKRLKHVKLQHSPRACN  733

Query  111  KVAHELAREAMFKADCMV  58
              AH LA+ A+   DC++
Sbjct  734  GFAHTLAKLALDYTDCVI  751



>ref|XP_009140658.1| PREDICTED: uncharacterized protein LOC103864645 [Brassica rapa]
Length=225

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 91/191 (48%), Gaps = 3/191 (2%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEW---QSANQLshhqshvshqVETWSK  472
            ICW +W ARN+ ++++      ++ +  L+  LEW   QS +QL  +Q            
Sbjct  23   ICWSLWTARNKLIFDDKTAQPLEIATKGLAAALEWDLAQSTDQLKRNQVFPQAPSRRQIP  82

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
             +  +     D A D++S   G+     +  G      S   D +  P+ AE++A+R+ +
Sbjct  83   GIQSYPSCFVDAAWDASSNRAGIAWHFTNDLGTNSPPGSQIIDNVASPLMAESLALRQGI  142

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
            K   SL    V   SDC  +I+AI++ S       ++ DI+ ++ +F  + F  + RS N
Sbjct  143  KEALSLGKKSVSFHSDCATLIRAISTQSQIKEIYGVLQDIKHLSANFDRIQFLHISRSQN  202

Query  111  KVAHELAREAM  79
            + A  LA+ A+
Sbjct  203  READYLAKVAL  213



>ref|XP_012065988.1| PREDICTED: uncharacterized protein LOC105629078 [Jatropha curcas]
Length=611

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 80/142 (56%), Gaps = 2/142 (1%)
 Frame = -1

Query  450  LNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQ  271
            +N+D +    S  +G+G+V+ ++  +F+A K+  + G      AEAIA+REAL W+K+  
Sbjct  464  VNTDASTGVASGYVGIGIVVRNSTSEFIAGKAWRFPGFFTAKVAEAIAVREALSWIKNHG  523

Query  270  LDKVQIESDCIKVIQAIN--STSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHE  97
             + + +E+D   V  AIN  +T+  S+F LII D + +  +   +  +FV RSAN  AH 
Sbjct  524  WNYILLETDSQSVANAINDDTTNDSSAFGLIIQDCKSLLSEIPVVKCNFVYRSANVAAHT  583

Query  96   LAREAMFKADCMVCVSVPFPCI  31
            LA     +A   V  SVP P +
Sbjct  584  LAVGTHSEAGLGVWNSVPPPVL  605



>ref|XP_010682926.1| PREDICTED: uncharacterized protein LOC104897688 [Beta vulgaris 
subsp. vulgaris]
Length=265

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 93/186 (50%), Gaps = 2/186 (1%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            +CW +W  RN  V+  ++     ++  A+  +LE    N     +    + V  W+ P+ 
Sbjct  51   LCWSIWIGRNAWVFEGVLREPRVIIEKAVQGMLELGRINDAVERRVGSLNYVARWTAPME  110

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
            G  KLNSD A+   ++ +G+G V+ D  G  + A     +G+     AEA++ R  +K  
Sbjct  111  GVYKLNSDAAMFGGNQ-IGLGSVVCDFEGDVMMAMCDRMNGITDVALAEALSARNGIKLA  169

Query  282  KSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
                   + +E D  ++ +++ + T+  S F  II DIR+ A   +++SF  V+R  N V
Sbjct  170  LEAGFVNLVLEVDNWRLYKSLKDGTAEPSQFGSIIRDIRQYAVKCSHISFSHVRRLGNSV  229

Query  105  AHELAR  88
            AH LA+
Sbjct  230  AHCLAK  235



>ref|XP_010696574.1| PREDICTED: uncharacterized protein LOC104909083 [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 69/134 (51%), Gaps = 2/134 (1%)
 Frame = -1

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
            + W  PL  + K+NSD A   + R  G+G ++ D  G  + A     +G      AEA+A
Sbjct  12   QRWEPPLRDYCKINSDAACFEDGR-YGLGGIMRDEVGDIMVATCTVVNGNKNAEIAEALA  70

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHF  130
             R AL       L +V +E D +KV   + N T   S F  I+NDIR +AR  +++ F  
Sbjct  71   ARHALTTAIEAGLSRVILEVDNMKVYAHLKNGTKEQSCFGFIMNDIRALARQCSDIKFSH  130

Query  129  VKRSANKVAHELAR  88
            V R+ N  AHELA+
Sbjct  131  VGRNGNVAAHELAK  144



>ref|XP_010462877.1| PREDICTED: uncharacterized protein LOC104743503 [Camelina sativa]
Length=307

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 96/205 (47%), Gaps = 4/205 (2%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLs---hhqshvshqVETWSK  472
            + W++W +RN+ V+N       D+V  A++  +EW +   L+    + +    + +TW+K
Sbjct  91   VLWRLWKSRNDLVFNKKTTRQEDLVKLAINDTIEWMTCLNLTEEYRNTTGAQSRRDTWTK  150

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
            P  GW+K N D +    +   G+  ++ D+ G  +      + G     E+E  A+  A+
Sbjct  151  PPPGWIKCNYDASHIEGNNISGLSWIIRDSNGFLLHCGMGKFQGRTTIEESECTALIWAI  210

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
            +  + L   KV  E D I + Q +N+ S        ++ I     DF  ++F F  R  N
Sbjct  211  QSTRGLGYRKVIFEGDNINITQQVNNRSSKLRLKHYLDTIEGWKADFETVAFSFRHREQN  270

Query  111  KVAHELAREAMFK-ADCMVCVSVPF  40
              A +LA++A+    D  +  S PF
Sbjct  271  HCADKLAKQAIVSLNDYDLYHSCPF  295



>ref|XP_006483704.1| PREDICTED: uncharacterized protein LOC102620092 [Citrus sinensis]
Length=340

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 2/126 (2%)
 Frame = -1

Query  459  WLKLNSDEALDSNSR*M-GMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
            WLK+ S +A  ++SR M  +G V+  A   F+AAKS  + G     EAEAI +REAL WL
Sbjct  196  WLKVGSVDAAITSSRGMFSLGAVIRSAQCDFIAAKSDFFPGRVEAREAEAIEVREALSWL  255

Query  282  KSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
            K      V ++ D ++V  A+ + TS  + F  II+D R + R    + F FV+ SAN  
Sbjct  256  KKFAFYSVILDMDSLQVFNALHDKTSYFNGFGSIIDDCRALVRSLGEVVFSFVRGSANSA  315

Query  105  AHELAR  88
            A  +A+
Sbjct  316  AFTVAQ  321



>ref|XP_006493121.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=968

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/258 (23%), Positives = 120/258 (47%), Gaps = 6/258 (2%)
 Frame = -1

Query  813  CAM*R*VLFYAFVSCSLAQKCWDL--FEHTIPH-HCVSFMDWVELQFNSLSDNELCKLIS  643
            C   R  +F++   C  ++K W L  FE  +    C   +  +    +  S  E+  +++
Sbjct  697  CRSHRETIFHSLFDCKASRKIWKLTTFEEEVKALKCKDVLSLLLALADRRSKTEMELIVA  756

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSAN--QLshhqshvshqVETWSKP  469
            +CW +W +RN  ++ N        V+GA + +  ++     QL           + W  P
Sbjct  757  VCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKRIQMPQLQAFSDQDLVSHKHWKCP  816

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
              GW K+N D A+   ++ +G+G+V+ ++ G+F+ A   P   +     AEA A R  L+
Sbjct  817  PAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWIDRVDYAEAEATRFGLE  876

Query  288  WLKSLQLDKVQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
              +S     + +E+D  +V   +++  S  +    I++++++  +   ++      R+ N
Sbjct  877  VAESAGCLPLIVETDSKEVTDLVSARKSTKAEIFWIVSEVQDTMKRLKHVKLQHSPRACN  936

Query  111  KVAHELAREAMFKADCMV  58
              AH LA+ A+   DC++
Sbjct  937  GFAHTLAKLALDYTDCVI  954



>ref|XP_008340805.1| PREDICTED: uncharacterized protein LOC103403753 [Malus domestica]
Length=433

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 97/210 (46%), Gaps = 8/210 (4%)
 Frame = -1

Query  699  WVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQL  520
            WV    + +S       + + W +W ARNE +W    +   D+   A ++LLE++  N +
Sbjct  207  WVAQMASLMSRESFDLJLMLMWNIWKARNELLWQGSTLPPQDLQIQAHTWLLEFKKWNVV  266

Query  519  shhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDG  340
                  V    + W +P VGWLK N D A D  +   G  L++ D    FVA   +P +G
Sbjct  267  QPKPKVVEV--DKWRRPEVGWLKCNFDGAWDEPNNRGGAXLIIRDTDXDFVATMXLPLEG  324

Query  339  LCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAI--NSTSLCSSFDLIINDIRE  166
            +   + AE  A REA  +L      KV +E D + VI AI  NS     +   I+ D R 
Sbjct  325  ITSALMAEVAAAREAALFLXKWSRAKVLLEGDALLVIAAIQNNSEVNYGALGHILTDTRR  384

Query  165  IARDFTNLSFHFVKRSANKVAHELAREAMF  76
            + +        FV+  AN VAH LA   ++
Sbjct  385  LLQ----WKAMFVRCGANAVAHRLAHHGLY  410



>ref|XP_012066908.1| PREDICTED: uncharacterized protein LOC105629874 [Jatropha curcas]
Length=345

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 100/196 (51%), Gaps = 5/196 (3%)
 Frame = -1

Query  660  LCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET  481
            LC+   +CW +     +    +   +    +    S+L EW++A     + S  S  V T
Sbjct  127  LCEQARLCWTLIGIPLDGSATSFSDTLLGFIDRPTSFLREWKNAQIDRSNSSVSSASVPT  186

Query  480  WSKPLVGWLKLNSDEALD-SNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAI  304
            W+ P  G +K N D A+  +  R    GLV  +A GQF+ A +  + G+  P  A+AI +
Sbjct  187  WAPPPTGVVKCNVDAAVHMTEGRSSYAGLVRNEA-GQFLVACTGHFAGVLKPHIAKAIGL  245

Query  303  REALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFD--LIINDIREIARDFTNLSFHF  130
            RE L WL +  + +V +E+DC ++ QA+ +TS  S  D   ++ +I+++     +    +
Sbjct  246  REVLSWLLTRSIGRVLVETDCQRLFQAV-TTSFDSFSDWAPVLEEIKQLLSQIPSSELVW  304

Query  129  VKRSANKVAHELAREA  82
            V+R  NK+ H LAR A
Sbjct  305  VRRQGNKLVHALARMA  320



>ref|XP_009124894.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=448

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 61/247 (25%), Positives = 112/247 (45%), Gaps = 10/247 (4%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVEL-----QFNSLSDNELCKLIS--ICWK  631
             + F +C  AQK W L       H  +  D+ +      +   L    +   I   +CW 
Sbjct  194  MHIFFNCPFAQKVWKLIPLRQGVHLATETDFKKAVIACRRLICLPPTGVSTTILPWMCWV  253

Query  630  VWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLK  451
            +W ARN  ++    ++  ++ + A+ +  EW +A       +    Q     +       
Sbjct  254  LWTARNTLLFEKRTLTPEEIATKAVRFAREWINAQPQKLPTTQGLTQARRTHRIQTNEEA  313

Query  450  L---NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLK  280
            +    SD A D+ S+  G+  ++ +  G  ++  S P   +  P+ AEA+A+R  +    
Sbjct  314  IPTCKSDAAFDTLSKKAGLAWIIREESGTTISQGSKPQGRVNSPLIAEALALRAGIIDAV  373

Query  279  SLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAH  100
             L+L K+++ SD   +I+AIN+ +       I+ DI+E++  F  +SF  V RS+N  A 
Sbjct  374  KLELSKLRMLSDNSTLIRAINNDAQVKEIFGIVKDIQELSSVFVEISFAHVPRSSNVEAD  433

Query  99   ELAREAM  79
             LA+ A+
Sbjct  434  RLAKLAL  440



>ref|XP_012076717.1| PREDICTED: uncharacterized protein LOC105637737 [Jatropha curcas]
Length=1025

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 94/187 (50%), Gaps = 10/187 (5%)
 Frame = -1

Query  633  KVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWL  454
            ++W  RN+ +W+    S   V   A S+L +W    +++   S     V  W K  + W+
Sbjct  817  QIWSVRNDIIWSQKHSSPMAVWHKASSFLSDWL---KVAAGSSRTPSVVSKWQKSELNWV  873

Query  453  KLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSL  274
            KLN D A+ ++    G   VLWD+    +  K   ++    P+EAEA+AI+EAL WL+  
Sbjct  874  KLNVDAAVYTDGTSAGYRAVLWDSDAVLLGVKIGKFEVSLRPIEAEAMAIKEALSWLEGR  933

Query  273  QLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLS-----FHFVKRSANK  109
               ++ +ESD + +I A+  + L   +  I+ DI    R  ++ S     F  V  S+N+
Sbjct  934  GWHQIVVESDNLSIINALQGSGLV--YGSILGDIIVSIRQLSSQSGCVFKFKHVYHSSNE  991

Query  108  VAHELAR  88
             AH LA+
Sbjct  992  FAHRLAQ  998



>gb|EEE56566.1| hypothetical protein OsJ_05904 [Oryza sativa Japonica Group]
Length=420

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 70/133 (53%), Gaps = 1/133 (1%)
 Frame = -1

Query  483  TWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAI  304
            +W  P  G   +N+D A+    R MG+G+V+ D +G  + A +  + G+  P  AEA AI
Sbjct  261  SWVPPPAGVFLINTDAAVFQAERQMGVGVVIRDQHGNCLLAANTRFMGITDPETAEACAI  320

Query  303  REALKWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFV  127
            R AL   K      V +  DC+ VIQ +NS     S    ++ DI+++  +F ++SF  V
Sbjct  321  RHALWLAKEEGFHNVIVACDCLSVIQKLNSPGRDRSKIGCLVEDIKKLGVEFISVSFIHV  380

Query  126  KRSANKVAHELAR  88
               +N  AH LAR
Sbjct  381  SHCSNVAAHTLAR  393



>ref|XP_002525294.1| hypothetical protein RCOM_0581330 [Ricinus communis]
 gb|EEF37122.1| hypothetical protein RCOM_0581330 [Ricinus communis]
Length=199

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 97/196 (49%), Gaps = 6/196 (3%)
 Frame = -1

Query  660  LCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET  481
            +CKL  I W+ W  RN  + + ++I   D V  A+++L E+ + N+     +        
Sbjct  1    MCKLAVIPWRSWFRRNSFIHSRLLIPDEDFVGWAVNFLEEYNTENR---KPARFKRDYHC  57

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPME-AEAIAI  304
            W  P  G LKL++D A+  +    G+G+VL D  G      S P     LP+E  EA+AI
Sbjct  58   WKPPDYGLLKLDTDAAVHFDKNISGLGMVLRDHKGCVKLVGSYPMKQ-GLPVEVVEAMAI  116

Query  303  REALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFV  127
            +  L    S  L    +ESD ++V+ AI N   + S    ++++I  +     +  F F+
Sbjct  117  KCGLSVASSHGLWPSVVESDSLQVVNAICNREVIFSELAAVLSEIFAMLSLNFSCDFKFI  176

Query  126  KRSANKVAHELAREAM  79
             R  N++A+ L++ A+
Sbjct  177  FRECNQMANALSKSAL  192



>ref|XP_009102167.1| PREDICTED: uncharacterized protein LOC103828310 [Brassica rapa]
Length=451

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 104/248 (42%), Gaps = 14/248 (6%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWD----------LFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISI  640
             + F  C  A+K WD              T       F     L    ++ N    +  +
Sbjct  202  MHTFFLCEFARKVWDNVPLKDTVHIAVGETFKAAITRFRKATCLPPRGVTTN---IMPWV  258

Query  639  CWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqs-hvshqVETWSKPLV  463
            CW +W  RN  ++    +    V + AL    EW++A Q    +   +    +  S P  
Sbjct  259  CWSIWKDRNSLIFEEKCLGPSKVAAKALGLAREWKNAQQAHQTREHGLPQMRQNQSTPAQ  318

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
              ++  +D A +   R  G+  V            S   D +  P+ AEA+A+R  L   
Sbjct  319  NLIECRTDAAWNKEQRRAGLAWVFKGVTLPSPDRGSTTQDFVNSPLIAEALAVRSGLCMA  378

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
             +L+L K+++ SD   +I AIN+         I+ DI+EI+ DF ++SF  + R  N+ A
Sbjct  379  ATLELPKLKVCSDNSTLIAAINNKHQMKEIVGIVRDIQEISSDFVSISFFHIPRKNNEEA  438

Query  102  HELAREAM  79
              LA++A+
Sbjct  439  DLLAKQAL  446



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 69/249 (28%), Positives = 111/249 (45%), Gaps = 20/249 (8%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLF------EHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVW  625
             + F  C+ A + WDL        H +    V  +    +++N L    + K   + W +W
Sbjct  1267  HVFFDCTHASQLWDLVGCKEMTRHDVGEEMVDLI----IRWNDLDKKLVQKGSYLMWNLW  1322

Query  624   DARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ-----LshhqshvshqVETWSKPLVG  460
               +N+ V+ N    SH  V  A     + +  N+         Q  V      W+ P  G
Sbjct  1323  TEKNKIVFENC---SHPPVVVAQRVGRQVEEFNEHITRIYGGGQQRVMASSSRWTTPPDG  1379

Query  459   WLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLK  280
             ++KLNSD ++  +   +G+G+V  D+ G+ + +          P  AE  A+  A++  K
Sbjct  1380  FVKLNSDASIGDDG-WIGLGVVARDSQGKILFSAVRRTKAYWPPEVAECKAVHFAIRLAK  1438

Query  279   SLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
             S  L  V IESD   V   ++  +L  S  D I+ D+  + R F +++F  VKR  N VA
Sbjct  1439  SHGLQSVVIESDSQIVTTRLSRAALFYSDLDSILGDVLALCRSFNSVNFMHVKRDGNTVA  1498

Query  102   HELAREAMF  76
             H LAR   F
Sbjct  1499  HNLARVVPF  1507



>ref|XP_006464882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=769

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/258 (23%), Positives = 120/258 (47%), Gaps = 6/258 (2%)
 Frame = -1

Query  813  CAM*R*VLFYAFVSCSLAQKCWDL--FEHTIPH-HCVSFMDWVELQFNSLSDNELCKLIS  643
            C   R  +F++   C  ++K W L  FE  +    C   +  +    +  S  E+  +++
Sbjct  494  CRSHRETIFHSLFDCKASRKIWKLTTFEEEVKALKCKDVLSLLLALADRRSKTEMELIVA  553

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSAN--QLshhqshvshqVETWSKP  469
            +CW +W +RN  ++ N        V+GA + +  ++     QL    +      + W  P
Sbjct  554  VCWSIWHSRNLFIFQNKKEDFQLSVAGAEAIVQSYKRIQMPQLQAFSNQDLVSHKHWKCP  613

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
              GW K+N D A+   ++ +G+G+V+ ++ G+F+ A   P   L     AEA A R  L+
Sbjct  614  PAGWFKVNVDAAIKLENQRVGLGIVIRNSEGKFITAAIKPSKWLDRVDYAEAEATRFGLE  673

Query  288  WLKSLQLDKVQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
              +S     + +E+D  +V   +++  S  +    I++++++  +   ++      R+ N
Sbjct  674  VAESAGCLPLIVETDSKEVTDLVSARKSTKAEIFWIVSEVQDTMKRLKHVKIQHSPRTCN  733

Query  111  KVAHELAREAMFKADCMV  58
              AH LA+  +   DC++
Sbjct  734  GFAHTLAKLVLDYTDCVI  751



>ref|XP_010686173.1| PREDICTED: uncharacterized protein LOC104900455 [Beta vulgaris 
subsp. vulgaris]
Length=225

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 95/197 (48%), Gaps = 3/197 (2%)
 Frame = -1

Query  675  LSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvs  496
            + ++E     +  W +W AR + +         + +S AL    E  SA+ +++    V 
Sbjct  1    MEEDEWGAFWTTVWAIWGARFKWLMEGDQREPTETLSYALKINNEVSSASPIANTSGVVL  60

Query  495  hqVET-WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEA  319
                T WSKP   ++K+N+D A    S   G+G+V  D +G+ +A  +        P  A
Sbjct  61   LPFPTGWSKPKASYVKVNTD-AGQIGSLGCGIGVVCRDEFGEVLATGTFEHQVESEPRVA  119

Query  318  EAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIREIARDFTNL  142
            EA AI   +K    L    V++ESD +  IQA+ S    SS F+LII+D+  +   F N+
Sbjct  120  EAKAIFYGMKLALELGYSCVEVESDSLMAIQALRSDKGGSSEFNLIIDDVLALVSSFNNV  179

Query  141  SFHFVKRSANKVAHELA  91
               FVKR  NKV H L 
Sbjct  180  IRSFVKRLRNKVTHMLT  196



>ref|XP_008372934.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=961

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 92/204 (45%), Gaps = 12/204 (6%)
 Frame = -1

Query  636  WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSAN---------QLshhqshvshqVE  484
            W +W  RN+ ++  +     D++   +  L E++ A           +       + +  
Sbjct  736  WHLWKNRNDLIFKGVTHQPLDILGLWMRNLDEYREAGLQRTNDDQPTVGLASPAPAGRTG  795

Query  483  TWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEA-EAIA  307
             W KP  G +K+N+D A    +   G+G V  D  G   AA       LC   +A E +A
Sbjct  796  QWKKPGFGTIKVNTDAAWRKETSCAGVGWVARDFAGLLQAAGGTGGR-LCHSADAAEMLA  854

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHF  130
            IR AL +   L    V IESD   +IQ I N T+L  S +  + DI  +AR   +++F F
Sbjct  855  IRSALDFCVRLGFKSVAIESDAKNIIQMIRNETTLDCSLECTLGDIATLARGLESVTFDF  914

Query  129  VKRSANKVAHELAREAMFKADCMV  58
            V R +N+ AH +A+    +    V
Sbjct  915  VSRESNRAAHSVAKYVFLEGKDFV  938



>gb|AAD20714.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1750

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 108/247 (44%), Gaps = 16/247 (6%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVE--------LQFNSLSDNELCKLISICWK  631
             +A  +C  A   W L + ++  + +   D+ E        +Q  ++SD      + + W+
Sbjct  1478  HALFTCPFATMAWRLSDSSLIRNQLMSNDFEENISNILNFVQDTTMSDFHKLLPVWLIWR  1537

Query  630   VWDARNEKVWNNIVISSHDVVSGALSYLLEW----QSANQLshhqshvshqVETWSKPLV  463
             +W ARN  V+N    S    V  A +   +W    QS  +       ++     W  P  
Sbjct  1538  IWKARNNVVFNKFRESPSKTVLSAKAETHDWLNATQSHKKTPSPTRQIAENKIEWRNPPA  1597

Query  462   GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK--  289
              ++K N D   D        G ++ + YG  ++  S+       P+EAE  A+  AL+  
Sbjct  1598  TYVKCNFDAGFDVQKLEATGGWIIRNHYGTPISWGSMKLAHTSNPLEAETKALLAALQQT  1657

Query  288   WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
             W++     +V +E DC  +I  IN  S  SS    + DI   A  F ++ F F+++  NK
Sbjct  1658  WIRGYT--QVFMEGDCQTLINLINGISFHSSLANHLEDISFWANKFASIQFGFIRKKGNK  1715

Query  108   VAHELAR  88
             +AH LA+
Sbjct  1716  LAHVLAK  1722



>ref|XP_009109961.1| PREDICTED: uncharacterized protein LOC103835530 [Brassica rapa]
Length=427

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 110/250 (44%), Gaps = 16/250 (6%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWV----------ELQFNSLSDNELCKLISIC  637
            + F+ CS A K W++       +  S   +            L    L+D  L   I  C
Sbjct  172  HLFLHCSFATKVWEMAPLLHVQYITSATTFTTALKESKRTSPLPPTGLADGHLFPWI--C  229

Query  636  WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSA---NQLshhqshvshqVETWSKPL  466
            W +W  RN+ ++ N V S  + ++ A+    EWQ A    ++      V ++    +   
Sbjct  230  WTIWTTRNQLIFENRVFSPLETLTKAICLAREWQEAQLHGKVQDSTIPVLNRRSNATNTF  289

Query  465  VGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
             G + + +D +    S   G+G +  D  G  +  +S   + +  P+ AE +AIREAL  
Sbjct  290  AG-VSVYTDASWKEGSNNAGLGWIFTDHLGSIIIKESKLEEFVSSPLMAEGLAIREALLQ  348

Query  285  LKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
             +      + + SD   +++AIN          II+DI +++ +F+ +SF ++ R  N  
Sbjct  349  ARRQGYSTLTVFSDAQTLVRAINDRKPLKELFGIIHDILQLSLEFSVISFVYISRLNNSA  408

Query  105  AHELAREAMF  76
            A  LA+ A+ 
Sbjct  409  ADALAKGALL  418



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 66/196 (34%), Positives = 88/196 (45%), Gaps = 7/196 (4%)
 Frame = -1

Query  585   SSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MG  406
             S H+VV  A  Y+ E+ +AN      +        W+ P  G LK N D A D  S    
Sbjct  1544  SPHEVVGFAQQYVHEFITANDTPSKVTDRVRDPVRWAAPPSGRLKFNFDGAFDPTSGRGA  1603

Query  405   MGLVLWDAYGQFVAA--KSIPWDGLCLPME-AEAIAIREALKWLKSLQLDKVQIESDCIK  235
             +G+V  DA G FVAA  KS+   G  L  E AE +A RE +    SL       E D   
Sbjct  1604  VGVVARDADGGFVAAVAKSV---GEVLSAEHAEILAAREGVALALSLGTASPIFEGDSAV  1660

Query  234   VIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKADCMV  58
             V+ AI       S+   I+ D++ + + F +  F F  R AN VAH LAR  +   D  +
Sbjct  1661  VVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREANGVAHRLARFGLHNVDNFI  1720

Query  57    CVSVPFPCIAHSLELD  10
                VP   I  +L  D
Sbjct  1721  WFEVPPDLIQDALLCD  1736



>ref|XP_009145301.1| PREDICTED: uncharacterized protein LOC103869012 [Brassica rapa]
Length=395

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 87/194 (45%), Gaps = 0/194 (0%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            I W +W ARN K++ N   S  + ++ A++   EWQ A Q+         Q       L 
Sbjct  202  IIWSIWTARNLKIFENRSFSPSETLTKAIADAREWQDAQQMIPPTLPQLQQPSRHPSGLN  261

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
                + +D A    S   G+     D +G  V   S P   +     AE +AIREAL   
Sbjct  262  TRFTIFTDAAWRKESLTAGLAWSCTDNHGNIVFQGSTPEPWVESAQLAEGLAIREALLQA  321

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
            ++  L+ + I+SD   +++AIN+          ++DI  ++ D   +SF F+ R+ N  A
Sbjct  322  QAQGLNNITIKSDAQIIVRAINNRESIKELFGTLHDIHRLSCDLDVVSFIFIPRTENSTA  381

Query  102  HELAREAMFKADCM  61
              LA+ A+     M
Sbjct  382  DALAKRALLNYSLM  395



>gb|ABN08583.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=207

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 83/196 (42%), Gaps = 23/196 (12%)
 Frame = -1

Query  684  FNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSAN-------  526
              +L  N   ++ +ICW +W  +N K+W N+  SS  VV  A   + +WQ AN       
Sbjct  2    LQNLPPNIQQRIAAICWSLWKHQNLKIWENVTESSAQVVERARHIIEDWQEANLPSQTAP  61

Query  525  ---------------QLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVL  391
                            +    S     V  W  P  G  K N D       +  G+ + L
Sbjct  62   LQEAAQQQAANTLQHSVQPQNSPTGPAVPQWFPPSRGRFKCNIDADFSEQFQRTGIRMCL  121

Query  390  WDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINS-  214
             D  G FV AK +P+D + L    EA+ +  A++W++ +Q D +  E D      A +S 
Sbjct  122  RDDSGTFVLAKVMPFDQVYLVAVGEALGLYHAIQWMQDMQFDNIDFELDSKITRDAFHSI  181

Query  213  TSLCSSFDLIINDIRE  166
             +  + F  II++ RE
Sbjct  182  MTDITKFGNIIDECRE  197



>ref|XP_009147334.1| PREDICTED: uncharacterized protein LOC103870904 [Brassica rapa]
Length=214

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 100/188 (53%), Gaps = 5/188 (3%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            + W +W ARN  ++NN +++  +V+S A+S   EWQ+A      +     ++E    P  
Sbjct  23   LVWSIWIARNNLIFNNKIVTIEEVISRAISAAKEWQNAQGQDEPKKTPKRKIE--DVPHC  80

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
              + L +D A    +R  G+G  +  A      + S  +  +  P+ AE++A+REA+K  
Sbjct  81   DTV-LQTDAAWTETTRTAGLGWAIKTARETQRFSNSTTF--VTSPLMAESLAMREAIKKS  137

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
            K L + +++ ESD  ++I+A+NS+S       II+DIR  A  F  +SF ++ R  N  A
Sbjct  138  KELGIRRLRCESDFSELIKALNSSSEPLEIYGIISDIRIEASSFDVISFVWIPRERNVEA  197

Query  102  HELAREAM  79
              LA+ A+
Sbjct  198  DCLAKAAL  205



>ref|XP_010683805.1| PREDICTED: uncharacterized protein LOC104898417 [Beta vulgaris 
subsp. vulgaris]
Length=293

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 103/233 (44%), Gaps = 13/233 (6%)
 Frame = -1

Query  681  NSLSDNELCKLISICWKVWDARNEKVWNNIV-ISSHDVVSGALSYLLEW--QSANQLshh  511
              L   EL    SI W  W ARN+ ++     I++ ++  G +   +++         H 
Sbjct  65   GKLQKTELATFASIAWAAWFARNKVIFEGEENINALNIAVGFVKMKVDYCMYKDKVCMHP  124

Query  510  qshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAK----SIPWD  343
                   V +W  P   ++KLN D  +      +  G+V+ D +G  +A       + W 
Sbjct  125  CGLREPAVSSWCPPPTSFVKLNVDAHVSQGGG-VSFGMVVRDEWGSLLAVGVRRMGVNWT  183

Query  342  GLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIRE  166
                P  AEA A R  L+ ++SL   KV +E D I V++AI N  +  +   L+ +DI E
Sbjct  184  ----PDVAEAGAARFGLEVVRSLGYTKVVLECDAIGVVRAIVNRKTGAAPIFLLFDDILE  239

Query  165  IARDFTNLSFHFVKRSANKVAHELAREAMFKADCMVCVSVPFPCIAHSLELDF  7
            I+  F+N     VKRS N VAH +AR         VC  +    I   +ELD 
Sbjct  240  ISSSFSNFKCVHVKRSGNTVAHSVARWEAVVDSTYVCTDLFPQSIQTLVELDL  292



>gb|KHN00089.1| hypothetical protein glysoja_046125, partial [Glycine soja]
Length=147

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 72/147 (49%), Gaps = 1/147 (1%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W  P +G LK N   A         + + + D  GQFV A S       L  E +A+A+ 
Sbjct  1    WEPPPLGTLKCNIGVAFVKEENSFKLVVFIRDDRGQFVMALSHTSPFKLLIHERKALAML  60

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVK  124
             AL+WLK L++D + IESDC++V   + N  S  S + +I+++ R + RD  N    FV 
Sbjct  61   VALQWLKDLEIDDIIIESDCLQVENEVYNCRSDKSKYGVILSNCRIMLRDLQNFWVCFVG  120

Query  123  RSANKVAHELAREAMFKADCMVCVSVP  43
            R AN V H L R    + D      VP
Sbjct  121  RQANSVTHSLDRALNSQVDPHYFRHVP  147



>ref|XP_010419203.1| PREDICTED: uncharacterized protein LOC104704888 [Camelina sativa]
Length=836

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 114/250 (46%), Gaps = 17/250 (7%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFEHTIP----------HHCVSFMDWVELQFNSLSDNELCKLISI  640
             + F  C  A + W L     P          H   +    + L    L +  L   I  
Sbjct  582  LHLFFQCPFATQVWSLTPFKNPFIPSRISSLFHGIETLQRQISLPPVGLGETPLAPWI--  639

Query  639  CWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVG  460
             W +W +RN+K++ +  IS+ + ++ A+    EW SA QL    +   +   +  +PL  
Sbjct  640  LWHLWTSRNKKLFEDRQISAAETLTTAIVQAKEW-SAAQLVKPSTTRVN--PSVPRPLAD  696

Query  459  --WLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
                 + +D A  S+++  G G  +     Q    +      +   + AEA+AI +A+  
Sbjct  697  PDLTTIFTDVAWRSDTQDAGFGWAISYPGSQTDLRRQSSARHVRSALMAEAMAIHQAILH  756

Query  285  LKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
             K + + K  + SD ++VI+AINS +  +    I++DI  ++ DF +  F FV R  N V
Sbjct  757  AKDIGITKFSLASDSLQVIKAINSAAPQTELHGILHDILLLSSDFEDAQFRFVSRKDNCV  816

Query  105  AHELAREAMF  76
            AH+LA+ ++F
Sbjct  817  AHDLAKSSLF  826



>ref|XP_009102722.1| PREDICTED: uncharacterized protein LOC103828828 [Brassica rapa]
Length=399

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 113/257 (44%), Gaps = 20/257 (8%)
 Frame = -1

Query  792  LFYAFVSCSLAQKCWDLFEHTIPHHC-VSFMDWVELQFN-----SLSDNELCKLIS----  643
            + + F  C  AQ+ W    H  P +  + F   ++L  +     SL       +IS    
Sbjct  142  ILHLFFQCGFAQRVW----HLAPLNTDMDFRGIIDLMSSWETLCSLKCLPPAGIISGSLT  197

Query  642  --ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKP  469
              + W +W ARN+ V+     S  + +SGA+    EW +  +               + P
Sbjct  198  PWLFWSIWKARNKFVFEGHSASPEETLSGAIVLAREWNTEVKKEPLTGIRQLSAPVLTHP  257

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
                ++  SD A    S   G+G VL    G    +  +P   +  P+ AE +A+REA++
Sbjct  258  EATVIR--SDAAWAPGSNIAGLGWVLLSHSGN--QSFKVPLKSVASPLLAEGLALREAVR  313

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
               +L L+ V  ESD + +I+A+      +    +I DI   A  F  +SF ++ R  N 
Sbjct  314  SCATLGLNYVAFESDSLNLIKAVKLEVTIAELYSVIADITSFASVFEFVSFSWISREKNV  373

Query  108  VAHELAREAMFKADCMV  58
            +A  LA+EA+  +D +V
Sbjct  374  LADCLAKEALNVSDTLV  390



>gb|AAD24831.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1524

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/247 (26%), Positives = 108/247 (44%), Gaps = 16/247 (6%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVE--------LQFNSLSDNELCKLISICWK  631
             +A  +C  A   W L + ++  + +   D+ E        +Q  ++SD      + + W+
Sbjct  1252  HALFTCPFATMAWWLSDSSLIRNQLMSNDFEENISNILNFVQDTTMSDFHKLLPVWLIWR  1311

Query  630   VWDARNEKVWNNIVISSHDVVSGALSYLLEW----QSANQLshhqshvshqVETWSKPLV  463
             +W ARN  V+N    S    V  A +   +W    QS  +       ++     W  P  
Sbjct  1312  IWKARNNVVFNKFRESPSKTVLSAKAETHDWLNATQSHKKTPSPTRQIAENKIEWRNPPA  1371

Query  462   GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK--  289
              ++K N D   D        G ++ + YG  ++  S+       P+EAE  A+  AL+  
Sbjct  1372  TYVKCNFDAGFDVQKLEATGGWIIRNHYGTPISWGSMKLAHTSNPLEAETKALLAALQQT  1431

Query  288   WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
             W++     +V +E DC  +I  IN  S  SS    + DI   A  F ++ F F++R  NK
Sbjct  1432  WIRGYT--QVFMEGDCQTLINLINGISFHSSLANHLEDISFWANKFASIQFGFIRRKGNK  1489

Query  108   VAHELAR  88
             +AH LA+
Sbjct  1490  LAHVLAK  1496



>ref|XP_009139688.1| PREDICTED: uncharacterized protein LOC103863688 [Brassica rapa]
Length=395

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 86/189 (46%), Gaps = 0/189 (0%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            I W +W ARN K++ N   S  + ++ A++   EWQ A Q+         Q       L 
Sbjct  202  IIWSIWTARNLKIFENRSFSPSETLTKAIADAREWQDAQQMIPPTLPQLQQPSRHPSGLN  261

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
                + +D A    S   G+     D +G  V   S P   +     AE +AIREAL   
Sbjct  262  TRFTIFTDAAWRKESLTAGLAWSCTDNHGNIVFQGSTPEPWVESAQLAEGLAIREALLQA  321

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
            ++  L+ + I+SD   +I+AIN+          ++DI  ++ D   +SF F+ R+ N  A
Sbjct  322  QAQGLNNITIKSDAQIIIRAINNRESIKELFGTLHDIHRLSCDLDVVSFIFIPRTENSTA  381

Query  102  HELAREAMF  76
              LA+ A+ 
Sbjct  382  DALAKRALL  390



>ref|XP_003599995.1| hypothetical protein MTR_3g050230 [Medicago truncatula]
Length=240

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 86/194 (44%), Gaps = 21/194 (11%)
 Frame = -1

Query  684  FNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ------  523
               L+ ++   + ++ W +W +RN +VW N   ++  +V  A   L  WQ AN+      
Sbjct  15   LRELTQDQSQMVATLLWSIWKSRNLRVWQNTTDTTQAIVERARFLLYNWQLANKEKQQGA  74

Query  522  --------------LshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWD  385
                              ++ V      W KPL G LK N D         +G GL + D
Sbjct  75   AVGASVAQPISVQTAGTTRNAVLPVQNRWQKPLQGRLKCNVDADFFETLNCVGFGLCIRD  134

Query  384  AYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAIN-STS  208
             +G+F+ AK++  + +C     EA+ +  A++W++ LQL  V  E D  KV+   N   +
Sbjct  135  EFGEFIKAKTLWSNPICSSDIGEALGLSHAIQWVQELQLPNVDFELDAKKVVDYFNRGRN  194

Query  207  LCSSFDLIINDIRE  166
              S F  I+++ + 
Sbjct  195  DISEFGAIVDECKR  208



>ref|XP_003607468.1| hypothetical protein MTR_4g078340 [Medicago truncatula]
Length=181

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 66/136 (49%), Gaps = 2/136 (1%)
 Frame = -1

Query  483  TWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAI  304
            TW   + G  K N D A  S+     +G+ + DA G FV AK++ +         EA+ +
Sbjct  21   TWQPHVAGRYKCNIDAAFTSHVNCTCIGICVRDAEGTFVLAKTMTYPCTVSVDVGEALGM  80

Query  303  REALKWLKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREI-ARDFTNLSFHF  130
              AL+WL  +Q D V  E+D      A  ST +  S F  II   R + +  F+N    F
Sbjct  81   HSALQWLSDMQFDNVDFETDSKLTADAFLSTMNDLSEFGCIIFSCRSLFSTSFSNFRVEF  140

Query  129  VKRSANKVAHELAREA  82
            V++ AN VAH L RE 
Sbjct  141  VRQQANVVAHALTRET  156



>emb|CDY12378.1| BnaC08g08270D [Brassica napus]
Length=698

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 99/194 (51%), Gaps = 6/194 (3%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSA-NQLshhqshvshqVETWSKPL  466
            +CW +W ARN++++ N V    ++ S A+S   EW +A + L       + Q     +PL
Sbjct  505  VCWVIWTARNQRIFENRVFEPKEIFSKAISTAKEWNNAQDSLLSPPVPRNLQNLPLHRPL  564

Query  465  VGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
               L   +D A  +++   G G  +    G  +   S  ++ +   M AEA+AIR AL  
Sbjct  565  T-ELSCFTDAAWIASTYRAGCGWCIMSLEGDVLLKGSGVFEFIPSAMMAEALAIRSALVH  623

Query  285  LKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL--IINDIREIARDFTNLSFHFVKRSAN  112
                 + K+ I+SDC  +I AI+ST  C S +L  II DI  ++  F+ +SF F+ RS N
Sbjct  624  AAEAGISKICIKSDCQALIAAISST--CHSVELYGIIRDIENLSFRFSCISFSFISRSLN  681

Query  111  KVAHELAREAMFKA  70
             +A  LA+  +  A
Sbjct  682  CMADSLAKSLLRSA  695



>ref|XP_009113626.1| PREDICTED: uncharacterized protein LOC103838926 [Brassica rapa]
Length=278

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/254 (26%), Positives = 109/254 (43%), Gaps = 10/254 (4%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQ--FNSL-----SDNELCKLISICWKV  628
            + F  C  A++ W L    +P H     D   +   F SL     +      L  ICW +
Sbjct  18   HIFFHCPFAKEVWRLIPLNVPVHLADDADIKSIMVIFRSLLCLPPTGITTPVLPWICWSL  77

Query  627  WDARNEKVWNNIVISSHDVVSGALSYLLEW-QSANQLshhqshvshqVET--WSKPLVGW  457
            W ARN+ ++ N      +V +  LS  LEW Q+   L+        +  T      L   
Sbjct  78   WTARNKLIFENKTAQPTEVATRGLSSALEWVQAQVPLTTSSKRSLPRNSTRRQGPNLQST  137

Query  456  LKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKS  277
              +  D A   +S   G+  +L +         S+    +  P+ AE++A+R+ +     
Sbjct  138  PSVFVDAAWKVSSNQAGIAWILTENLSIEPITGSLIITEVASPLMAESLALRQGISEALR  197

Query  276  LQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHE  97
            L L  + + SDC  +I+AI+S S       ++ DI+ ++  F ++SF  V RS N  A E
Sbjct  198  LGLTSISVYSDCATLIRAISSDSQIKEIYGVLQDIKNLSSHFHSISFLHVDRSQNIAADE  257

Query  96   LAREAMFKADCMVC  55
            LA+ A+  +    C
Sbjct  258  LAKRALKASSVSSC  271



>ref|XP_009107615.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=526

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 93/189 (49%), Gaps = 2/189 (1%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            +CW +W ARN  ++ N  +  +D++  AL    EWQ A  + H ++         +    
Sbjct  336  VCWCIWTARNLIIFENRTLDPNDIIFNALRLAREWQEAQPIKHIETRNLSNRSIHTS--T  393

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
            G   L +D A  +  +  G G +++  + +     +     +  P+ AEA+A+REAL  +
Sbjct  394  GLTTLYTDAAWRAQDKTAGCGWIIYTPHSEDARKVATTEMFVATPLMAEALAVREALLQV  453

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
            K+  L  +  +SD   +I+A+NS         I  DI ++A  F+++ F +V R+ N  A
Sbjct  454  KAEHLSNICCKSDNQVLIKALNSNQHPVELYGINLDIEKLASSFSSIVFSYVPRNLNFAA  513

Query  102  HELAREAMF  76
              LA+ A++
Sbjct  514  DALAKSALY  522



>ref|XP_003589347.1| Eukaryotic translation initiation factor 3 subunit C [Medicago 
truncatula]
Length=1087

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 9/135 (7%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W+KP  G +K N D AL +N+  MG G+   D+ GQF+  KS         MEAEAI + 
Sbjct  6    WTKPQHGVIKCNVDRALFNNNSLMGYGMCFRDSMGQFLFGKSNWLHYRVTTMEAEAIGLL  65

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAIN-STSLCSSFDLIINDIREIARDFTNLSFHFVK  124
            EA+K      +  V+ E+DC  V  A++  T+  +  DLI N+        ++    FV 
Sbjct  66   EAIKTAIEKGMHYVEFETDCKPVADALSLPTAPHNELDLIANN--------SDYVVSFVP  117

Query  123  RSANKVAHELAREAM  79
            R ANKVAH +AR ++
Sbjct  118  RQANKVAHSIARASL  132



>ref|XP_006596580.1| PREDICTED: uncharacterized protein LOC102666294 [Glycine max]
Length=216

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 4/137 (3%)
 Frame = -1

Query  681  NSLSDNELC-KLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqs  505
            NS+ + +LC K  +  W +W  +N+K W N V  +   +  A  +L EW+ A Q      
Sbjct  35   NSVHEEDLCNKFATGLWCIWRQQNDKFWRNQVQPTQITIQQAFQHLEEWKDARQQQSQSH  94

Query  504  hvshqVET--WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCL  331
             +        W KP  G+LK N D  + +  +  G G+ + D  GQF+ AK+  + G+  
Sbjct  95   VMQILDNQCEWKKPSFGYLKCNVDATIFNQDQQFGNGMCIRDHNGQFIQAKTW-FQGVSD  153

Query  330  PMEAEAIAIREALKWLK  280
            P  AEA  + +A++WLK
Sbjct  154  PTIAEACGLYQAMEWLK  170



>ref|XP_010680467.1| PREDICTED: uncharacterized protein LOC104895604 [Beta vulgaris 
subsp. vulgaris]
Length=349

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 109/250 (44%), Gaps = 16/250 (6%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTI-------PHHCVSFMDWVELQFNSLSDNELCKLISICWKV  628
            + F SCS++ K W+     +          C + + W E+  N +      K   I W V
Sbjct  68   HLFYSCSMSLKLWEELGCYVLLQGVEDEAMCDTLVRWSEMDANMVQ-----KGCYILWNV  122

Query  627  WDARNEKVWNNIVISSHDVVSGALSYLLEWQ--SANQLshhqshvshqVETWSKPLVGWL  454
            W  RN+KV+ N    +  V    +  + ++   +       +S  +     W  P  G +
Sbjct  123  WGERNKKVFENTSHPATVVCQRIMRQVDDFNCYAVRIYGGMRSITAPSPPRWYAPPAGVI  182

Query  453  KLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSL  274
            KLN+D +L ++   +G+G+V  D+ G+   A +        P  AE  AI  A +  K+ 
Sbjct  183  KLNTDASL-ADEGWVGLGVVARDSEGKVCFAATKRVRAFWPPEVAECKAIYMATRLAKAH  241

Query  273  QLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHE  97
                V  ESD +   + +   ++  S  D I+ DI  +   F+++SF  V+R  N VAH 
Sbjct  242  GYGDVIFESDSLVATKRLTKAAIFFSDLDAILGDILSMCNAFSSVSFSHVRRDGNSVAHN  301

Query  96   LAREAMFKAD  67
            LAR   F  +
Sbjct  302  LARVVPFGVE  311



>ref|XP_006603254.1| PREDICTED: uncharacterized protein LOC102660201 [Glycine max]
Length=214

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (51%), Gaps = 1/134 (1%)
 Frame = -1

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
            E W  P  G++K N D A     +  G G+ + D  G FV A      G+    E EA+ 
Sbjct  68   EEWKPPGPGFVKCNIDVAYFQEQQWWGKGMCIQDDKGWFVRATMNIRHGMPEVHEGEALV  127

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHF  130
            + + L WLK++    V++ESDC ++  +++   +  S F +I+N  + I   F N     
Sbjct  128  LLQTLTWLKNMDYQYVEVESDCKRLTDSLDRNIMDDSEFGMILNKCKRILMSFPNHKVSL  187

Query  129  VKRSANKVAHELAR  88
            +++ AN +AH LAR
Sbjct  188  IRKQANCIAHSLAR  201



>ref|XP_007206269.1| hypothetical protein PRUPE_ppa016210mg [Prunus persica]
 gb|EMJ07468.1| hypothetical protein PRUPE_ppa016210mg [Prunus persica]
Length=186

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 83/189 (44%), Gaps = 15/189 (8%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            + W +W+ARN  +WNN       V   A   L ++   N     QS      + W  P  
Sbjct  2    VGWAIWEARNGLLWNNKKSRPEQVSLHASLRLQDFLRVNNCLGSQSRQGQIKQMWQPPHE  61

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
              LK+N D A    +   G+G+V+ D+ G+FVA               EA+A R      
Sbjct  62   NSLKINVDGAWKPGTTEGGVGVVVKDSTGKFVAV--------------EALAARTGTILA  107

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIREIARDFTNLSFHFVKRSANKV  106
                   V  ESD ++++ A+ + S+  S    ++ D + +    T   F  ++R+AN V
Sbjct  108  MERGYQNVVFESDALQIVTALRNHSIDRSVIGPVVEDTKSLLTQITGEGFTHIRRTANGV  167

Query  105  AHELAREAM  79
            AH LAR A+
Sbjct  168  AHRLARFAL  176



>ref|XP_006473914.1| PREDICTED: uncharacterized protein LOC102629934 [Citrus sinensis]
Length=304

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 112/251 (45%), Gaps = 6/251 (2%)
 Frame = -1

Query  813  CAM*R*VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQ---FNSLSDNELCKLIS  643
            C   R  + +    C ++++ W L    +        D   L        +  E+  +++
Sbjct  29   CKKTRETVCHMLFECKVSKQIWRLTPFVVDSQLGKVRDVFSLLQDLTTKRTKAEMELIVA  88

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSAN--QLshhqshvshqVETWSKP  469
            +CW +W +RN  ++ N    SH  V+ A + +  ++     Q+S          + WS P
Sbjct  89   VCWSIWHSRNLAIFKNKREDSHLSVAAAEALVQSYKRIQMPQMSKSPPTSLAIQQKWSYP  148

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
              GW K+N D A+    +  G+G+V+ ++ G+ +AA   P   L     AEA A +  L+
Sbjct  149  PEGWFKVNVDAAVKMEQQRTGLGIVIRNSEGKVMAAAMKPSKFLSKVDAAEAEAAKFGLE  208

Query  288  WLKSLQLDKVQIESDCIKVIQAIN-STSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
              +++    + IESD  +V++ I+   S  +    +I++I++  +    +      R  N
Sbjct  209  IAENVGCFPLIIESDSKEVVELISLKKSTRTEIFWVISEIQDRMKRLKKVKIQHTPRGCN  268

Query  111  KVAHELAREAM  79
             +AH LA  A+
Sbjct  269  SLAHSLANLAL  279



>emb|CDY45862.1| BnaC02g22580D [Brassica napus]
Length=371

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 64/250 (26%), Positives = 111/250 (44%), Gaps = 16/250 (6%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDL--FEHTI--------PHHCVSFMDWVELQFNSLSDNELCKLISI  640
             + F  C  AQ+ W+L   +H I            V+F   V L    +S+N L     I
Sbjct  121  MHTFFRCPFAQEVWNLIPLKHVIHLATGGSFRDAIVAFRQAVCLPPTGVSNNTLP---WI  177

Query  639  CWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVG  460
            CW +W ARN  ++ N  +SS +V +  +    EW  A        +   ++    +  V 
Sbjct  178  CWAIWTARNLAIFENRTLSSMEVATKGIRLAREWNMAQDKEKATKNTLPRLHRPPRASVS  237

Query  459  WLKLN---SDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
               L    SD A D+ S   G+     D+ G  +   S   D +  P+ AEA+A+R A+ 
Sbjct  238  PAVLTIGKSDAAFDNRSHRAGLAWNFTDSAGTRINQGSRIQDFIGSPLIAEALALRSAIL  297

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
               + ++  +++ SD   +++AI + +  S    I+ DI+++   F  +SF  + R  N 
Sbjct  298  SAVNSEVTHLKMFSDNTTLVRAITNDTQASEIFGIVKDIQQMTSAFVEISFSHLPRLQNI  357

Query  108  VAHELAREAM  79
             A  LA++ +
Sbjct  358  DADLLAKQTL  367



>emb|CAN76892.1| hypothetical protein VITISV_005356 [Vitis vinifera]
Length=1793

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 88/216 (41%), Gaps = 30/216 (14%)
 Frame = -1

Query  654   KLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWS  475
             K+++  W+V  ARN    N  +  S  VV+   + L  W  AN+       V      W 
Sbjct  1606  KILNFAWRV--ARNCLPRNGRIRHSQQVVNSCFTMLESWFHANETLATAVTVLSYSSKWQ  1663

Query  474   KPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREA  295
             KP  GW+ +N D A                           P+    L    EA+ +RE 
Sbjct  1664  KPDYGWIXINVDGA---------------------------PFPHQTLXEVVEALGVREV  1696

Query  294   LKWLKSLQLDKVQIESDCIKVIQAINSTSLCS-SFDLIINDIREIARDFTNLSFHFVKRS  118
             L W+      ++ +E+DC+ V+QAI   S  + SF  II D  ++ +   ++   + +RS
Sbjct  1697  LSWIHERSRSRIVVETDCLLVVQAIQHKSCPNMSFGFIIADCLDVLQHLVDVQVVYARRS  1756

Query  117   ANKVAHELAREAMFKADCMVCVSVPFPCIAHSLELD  10
             AN  AH LA+ A       +    P  CI   L  D
Sbjct  1757  ANSAAHCLAKGAGSFTSLHIWGYTPPQCILSCLHYD  1792



>ref|XP_008231575.1| PREDICTED: uncharacterized protein LOC103330748 [Prunus mume]
Length=307

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/221 (29%), Positives = 104/221 (47%), Gaps = 6/221 (3%)
 Frame = -1

Query  657  CKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ---LshhqshvshqV  487
            C +   C  +W +RN  V++         +   LS + E  + N    +       S   
Sbjct  78   CIIAVTCLIIWKSRNRFVFDQCKPQPLLAIKTILSQVEELAALNNKRNVRRLYEGPSPNP  137

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
             +W+ P    +K+N D A  ++S   G GL+  +A G+FV AK + +    + M AEAIA
Sbjct  138  TSWTTPEAHVIKVNFDAAWLASSGKAGAGLIARNANGEFVGAKCLSFQADSMIM-AEAIA  196

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL--IINDIREIARDFTNLSFH  133
              E  KW   L L +V  ESD  +++Q++        ++L  +I+ IRE    F+N ++ 
Sbjct  197  GLEGCKWASELGLSEVCFESDSKELVQSVKGNIKRGRWNLYPLISRIRECNSIFSNCNWA  256

Query  132  FVKRSANKVAHELAREAMFKADCMVCVSVPFPCIAHSLELD  10
            +  R  N+ A+ LA  A+ ++   V VS P   + H L  D
Sbjct  257  WTSRKNNEAAYHLASLALSRSSPEVWVSRPPTSLVHILNRD  297



>ref|XP_009148188.1| PREDICTED: uncharacterized protein LOC103871664 [Brassica rapa]
Length=743

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 92/197 (47%), Gaps = 4/197 (2%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            + W +W ARN+ V+     S  + +SGA+    EW +  +               + P  
Sbjct  542  LLWSIWKARNKFVFEGHSASPEETLSGAIVLAREWNTEVKKEPLTGIRHLPAPILTHPEA  601

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
              ++  SD A    S   G+G VL    G    +  +P   +  P+ AE +A+REA++  
Sbjct  602  TVIR--SDAAWAPGSNIAGLGWVLLSHSGN--QSFKVPLKSVASPLLAEGLALREAVRSC  657

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
             +L L+ V  ESD + +I+A+      +    +I DI   A  F  +SF ++ R  N +A
Sbjct  658  ATLGLNYVAFESDSLNLIKAVKLEVTIAELYSVIADITSFASVFEFVSFSWISREKNVLA  717

Query  102  HELAREAMFKADCMVCV  52
              LA+EA+  +D +V V
Sbjct  718  DCLAKEALNVSDTLVLV  734



>ref|NP_194638.1| ribonuclease H-like protein [Arabidopsis thaliana]
 emb|CAB43923.1| putative protein [Arabidopsis thaliana]
 emb|CAB79667.1| putative protein [Arabidopsis thaliana]
 gb|AAY78807.1| putative reverse transcriptase/RNA-dependent DNA polymerase [Arabidopsis 
thaliana]
 gb|AEE85585.1| ribonuclease H-like protein [Arabidopsis thaliana]
Length=575

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 93/193 (48%), Gaps = 7/193 (4%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQ---SANQLshhqshvshqVETWSK  472
            + W++W  RNE V+     ++ +V+  A   L EW+    A                W  
Sbjct  363  LLWRLWKNRNELVFRGREFNAQEVLRRAEDDLEEWRIRTEAESCGTKPQVNRSSCGRWRP  422

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQ--FVAAKSIPWDGLCLPMEAEAIAIRE  298
            P   W+K N+D   + ++   G+G VL +  G+  ++ A+++P   L   +EAE  A+R 
Sbjct  423  PPHQWVKCNTDATWNRDNERCGIGWVLRNEKGEVKWMGARALP--KLKSVLEAELEAMRW  480

Query  297  ALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRS  118
            A+  L   Q + V  ESD   +I+ +N+  +  S    I D++ +   FT + F F+ R 
Sbjct  481  AVLSLSRFQYNYVIFESDSQVLIEILNNDEIWPSLKPTIQDLQRLLSQFTEVKFVFIPRE  540

Query  117  ANKVAHELAREAM  79
             N +A  +ARE++
Sbjct  541  GNTLAERVARESL  553



>ref|XP_006494016.1| PREDICTED: uncharacterized protein LOC102608298 [Citrus sinensis]
Length=1570

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 66/265 (25%), Positives = 128/265 (48%), Gaps = 18/265 (7%)
 Frame = -1

Query  795   VLFYAFVSCSLAQKCW------DLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICW  634
              +F+A V C + +K W      D  + ++    +S +  +EL+    S +++  L++I W
Sbjct  1003  TIFHALVGCKVVKKIWKITRFEDDLKDSVEQDMLSLL--IELKLRR-SKDDIELLVTILW  1059

Query  633   KVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhq---shvshqVETWSKPLV  463
              +W+A+N  ++  +  S H  VS A + +LE     QL          S +++ W  P  
Sbjct  1060  MIWNAQNSWIFKGVKDSPHVTVSKAEA-VLEAFRRTQLPAATHIDIQSSSKLKAWKPPQR  1118

Query  462   GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAA--KSIPWDGLCLPMEAEAIAIREALK  289
             G  K+N D A +S  +   +G V+ D  G  +AA  K   + G     EAEAI     L+
Sbjct  1119  GHFKVNVDAATNSEKQIASLGAVIRDEAGNVIAAAVKVSKFYGDVFIAEAEAIEW--GLR  1176

Query  288   WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL-IINDIREIARDFTNLSFHFVKRSAN  112
                +   + + +ESD  +V++ +N++  C S    II++++ + + F+++   +  RS++
Sbjct  1177  LAGNACTESLIVESDAQEVVKLVNNSQGCRSEIFWIISEVQRVLKSFSSVCVQYTHRSSS  1236

Query  111   KVAHELAREAMFKADCMVCVSVPFP  37
              +    A +A+ + D    +S   P
Sbjct  1237  AIVLPAAMQAVVELDVFEIISKAGP  1261



>gb|EPS63384.1| hypothetical protein M569_11402 [Genlisea aurea]
Length=254

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 95/206 (46%), Gaps = 10/206 (5%)
 Frame = -1

Query  684  FNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGAL---SYLLEWQSANQLsh  514
            F SL + +  KL+  CW +W  RNE   N I   S DV+  A    SYL    +A     
Sbjct  29   FKSLDETDFRKLLVGCWAIWTKRNETRHNLI---SPDVMEAAYFITSYLASCATALDCDR  85

Query  513  hqshvsh-qVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGL  337
                        W  P +G LK+N D     N      GL+  D  G+ +   S     +
Sbjct  86   PPPPHPPDATARWEPPAMGSLKINVDSGKIGNHT-TWAGLIR-DGRGRCIGWYSKSISPI  143

Query  336  CLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIA  160
              P   E +A +  L + + L +  + +E+DC+ ++ AI + T L  +   ++ DIR + 
Sbjct  144  LDPEHGEYLATKWGLIFARFLGISTITLEADCLALVSAITDDTMLNGTLQNLLTDIRVLL  203

Query  159  RDFTNLSFHFVKRSANKVAHELAREA  82
            ++F +    F++R+ANK AH LA+ +
Sbjct  204  QEFDSCQVIFIRRNANKAAHLLAKSS  229



>ref|XP_002446679.1| hypothetical protein SORBIDRAFT_06g020406 [Sorghum bicolor]
 gb|EES11007.1| hypothetical protein SORBIDRAFT_06g020406, partial [Sorghum bicolor]
Length=395

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/249 (22%), Positives = 110/249 (44%), Gaps = 21/249 (8%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTI-----------PHHCVSFMDWVELQFNSLSDNELCKLISI  640
            ++ + C++++  W L +  I           P H ++FM     Q + +      +++  
Sbjct  129  HSLLFCTMSKCVWALLDEDITNLISHLRISNPKHWITFMCCNIPQADGI------RVLVT  182

Query  639  CWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET---WSKP  469
            CW +W AR + +   +  S   ++      + E Q    +     + +   +    W  P
Sbjct  183  CWAIWQARRKAIHEGVFQSPFSIMVTINRQIEELQMIRGMELKGGNQNQSKQKTRLWKAP  242

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
              G  K+N D A++       +G+V  +  G+F+A  ++    +  P   E +A  EAL 
Sbjct  243  DQGKCKINVDAAVNRVGSKGAVGVVCRNDRGEFIAPSAMIIPNITEPETLEGMACLEALA  302

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
              +   + K+ + SDC+ +++ I+   LC ++ +I+ DI+E A+ F  + F    R  N+
Sbjct  303  LAEDCGIRKIIVASDCLNIVRNISEMPLC-TYVMILKDIQERAKSFDYVRFAHEGRECNR  361

Query  108  VAHELAREA  82
             A  L + A
Sbjct  362  EADRLVKYA  370



>ref|XP_009126346.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851256 
[Brassica rapa]
Length=1690

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 98/209 (47%), Gaps = 12/209 (6%)
 Frame = -1

Query  642   ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEW---QSANQLshhqshvshqVETWSK  472
             ICW +W ARN+ ++++      ++ +  L+  LEW   QS +QL  +Q            
Sbjct  1117  ICWSLWTARNKLIFDDKTAQPLEIATKGLAAALEWDLAQSTDQLKRNQVFPQAPSRRQIP  1176

Query  471   PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
              +  +     D A D++S   G+     +  G      S   D +  P+ AE++A+R+ +
Sbjct  1177  GIQSYPSCFVDAAWDASSNRAGIAWHFTNDLGTNSPPGSQIIDNVASPLMAESLALRQGI  1236

Query  291   KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
             K   SL    V   SDC  +I+AI++ S       ++ DI+ ++ +F  + F  + RS N
Sbjct  1237  KEALSLGKKSVSFHSDCATLIRAISTQSQIKEIYGVLQDIKHLSANFDRIQFLHISRSQN  1296

Query  111   KVAHELAREAMFKADCMVCVSVPFP-CIA  28
             + A  LA+ A+ KA        PFP C A
Sbjct  1297  READYLAKVAL-KAH-------PFPSCFA  1317



>ref|XP_011459685.1| PREDICTED: uncharacterized protein LOC105350038 [Fragaria vesca 
subsp. vesca]
Length=253

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 92/201 (46%), Gaps = 7/201 (3%)
 Frame = -1

Query  684  FNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqs  505
             ++LS  +L       W VW  RN  +W     +  ++   A+  L E++  +  +    
Sbjct  1    MDNLSMQQLEGFFMALWTVWTERNNMIWRGGSCNPSNMSVWAMQLLEEYKKVH--TKPSV  58

Query  504  hvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAA--KSIPWDGLCL  331
             +      W  P  G LKLN D A   + R  G+G+V+ + YG  VAA  + +P+    +
Sbjct  59   KMKRPRAKWCCPPSGRLKLNIDGAYLEDGRKGGIGVVVRNEYGNCVAALSRHVPYASSAM  118

Query  330  PMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREIARD  154
             MEAE  A+R +L        D+V+IE DC  V++A+ +T         I+ D R     
Sbjct  119  HMEAE--ALRASLLIAIHQGWDEVEIEGDCAIVMKALATTDGDVIEVSSILFDCRHYMEA  176

Query  153  FTNLSFHFVKRSANKVAHELA  91
            F  +    + R AN VAH LA
Sbjct  177  FRLILLRHIYREANGVAHRLA  197



>ref|XP_009121339.1| PREDICTED: uncharacterized protein LOC103846186 [Brassica rapa]
Length=199

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 94/191 (49%), Gaps = 3/191 (2%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            +CW +W ARN  ++    ++  ++ + A+ +  EW +A       +    Q     +   
Sbjct  1    MCWVLWTARNTLLFEKRTLTPEEIATKAVRFAREWINAQPQKLPTTQGLTQARRTHRIQT  60

Query  462  GWLKL---NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
                +    SD A D+ S+  G+  ++ +  G  ++  S P   +  P+ AEA+A+R  +
Sbjct  61   NEEAIPTCKSDAAFDTLSKKAGLAWIIREESGTTISQGSKPQGRVNSPLIAEALALRAGI  120

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
                 L+L K+++ SD   +I+AIN+ +       I+ DI+E++  F  +SF  V RS+N
Sbjct  121  IDAVKLELSKLRMLSDNSTLIRAINNDAQVKEIFGIVKDIQELSSVFVEISFAHVPRSSN  180

Query  111  KVAHELAREAM  79
              A  LA+ A+
Sbjct  181  VEADRLAKLAL  191



>ref|XP_002517933.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44451.1| conserved hypothetical protein [Ricinus communis]
Length=276

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 66/236 (28%), Positives = 101/236 (43%), Gaps = 21/236 (9%)
 Frame = -1

Query  792  LFYAFVSCSLAQKCWDLFEHTIPHHCVSFMD---WVELQFNSLSDNELCKLISICWKVWD  622
            L + F+      +CW+  +  +P  C+   D   W+E  FNS  +    K+  I W +W 
Sbjct  26   LQHLFIDYPFEMQCWNYCQ--VPVVCIHLSDFGCWIENMFNSGDNQHKEKVCMILWAIWG  83

Query  621  ARNEKVWNNIVISSHDVVSGALSYLLEWQSAN--QLshhqshvshqVETWSKPLVGWLKL  448
              N  +W N V   +  +   +  L  ++SAN  +++ H +   + +  W KP  G  KL
Sbjct  84   NCNAMLWKNKVYPVNACMESCMGLLYSFKSANASKVAGHMATSRNSILRWVKPTQGLCKL  143

Query  447  NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQL  268
            N            G+G+VL D   Q                 AEA  ++E L W+    L
Sbjct  144  NMTLPSCLVLTRWGLGMVLRDHRAQEARL-------------AEAPFLKETLSWICEQSL  190

Query  267  DKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
              V IESD   VI + +  +   S F  ++N  R IA    N+   FVKR AN +A
Sbjct  191  ANVIIESDAKMVIDSFHQFAFDISEFGCLVNTFRSIASFCVNVRVVFVKRQANAIA  246



>ref|XP_009146764.1| PREDICTED: uncharacterized protein LOC103870391 [Brassica rapa]
Length=985

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 96/205 (47%), Gaps = 11/205 (5%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEW---QSANQLshhqshvshqVETWSK  472
            ICW +W ARN+ ++++      ++ +  L+  LEW   QS +QL  +Q            
Sbjct  783  ICWSLWTARNKLIFDDKTAQPLEIATKGLAAALEWDLAQSTDQLKRNQVFPQAPSRRQIP  842

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
             +  +     D A D++S   G+     +  G      S   D +  P+ AE++A+R+ +
Sbjct  843  GIQSYPSCFVDAAWDASSNRAGIAWHFTNDLGTNSPPGSQIIDNVASPLMAESLALRQGI  902

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
            K   SL    V   SDC  +I+AI++ S       ++ DI+ ++ +F  + F  + RS N
Sbjct  903  KEALSLGKKSVSFHSDCATLIRAISTQSQIKEIYGVLQDIKHLSANFDRIQFLHISRSQN  962

Query  111  KVAHELAREAMFKADCMVCVSVPFP  37
            + A  LA+ A+ KA        PFP
Sbjct  963  READYLAKVAL-KAH-------PFP  979



>ref|XP_009102110.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=712

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 92/196 (47%), Gaps = 10/196 (5%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET------  481
            I W++W +RN  V+        +++S A S   EW++     ++ S       T      
Sbjct  489  ILWRLWKSRNVLVFQQRDFHWKNILSAARSDAREWRNIETQDNNASDGHSISPTSRSSQR  548

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W  P   WLK N D +          G V+ D +G +  A  +  + +C P+E+E  AI 
Sbjct  549  WKAPPNRWLKCNVDASFIDTREPSSAGWVIRDEHGIYKGAVQVQGNMVCSPLESELQAIL  608

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLI--INDIREIARDFTNLSFHFV  127
             A+++  +   +++ IESDC K I  +N   L   FD      +IR  A    N+SF +V
Sbjct  609  MAVQFCWTKGYNRIIIESDCRKAIDILN--DLVLHFDSFNWKREIRWWAEKIQNISFQWV  666

Query  126  KRSANKVAHELAREAM  79
            KR ANKVA  LAR  +
Sbjct  667  KREANKVADSLARTPL  682



>ref|XP_010688587.1| PREDICTED: uncharacterized protein LOC104902499 [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/211 (24%), Positives = 100/211 (47%), Gaps = 7/211 (3%)
 Frame = -1

Query  786  YAFVSCSLAQKCW---DLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLI-SICWKVWDA  619
            +  ++C ++++ W    L       +  SF  WV+     + D E  +   ++CW +W  
Sbjct  196  HLLLTCPMSKRIWYASPLRLKIEDDYRGSFKGWVDCLLGQIKDQEWWEAFWALCWSIWLG  255

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLsh-hqshvshqVETWSKPLVGWLKLNS  442
            RNE +++         +  A+  ++E+Q A +        + +    W+ P  G LKLN+
Sbjct  256  RNEWIFDKRRRDDLWRIDKAVGLVMEYQRAMEAEKIQPGSMKNGPRKWNAPPRGSLKLNT  315

Query  441  DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDK  262
            D A+  + + +G+G +L D  G  +AA   PW G C     EA+A+++ +K        +
Sbjct  316  DVAMGKDGK-VGLGAMLRDCEGDVLAALCEPWQGACEVDTGEALAVKQGIKVAMEAGFRQ  374

Query  261  VQIESDCIKVIQAINSTSL-CSSFDLIINDI  172
             ++E+D +++ QA+       S   +++ DI
Sbjct  375  FEVETDSLRICQALRKRKKELSPLGVVMQDI  405



>gb|EPS59181.1| hypothetical protein M569_15629, partial [Genlisea aurea]
Length=367

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 105/241 (44%), Gaps = 7/241 (3%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFEHTIPHH---CVSFMDWVELQFNSLSDNELCKLISICWKVWDA  619
            F+AF+SC  +Q  W L  +    H    +  +DW+      L + ++ +L+   W +W  
Sbjct  105  FHAFISCPFSQAVWRLGGYAWNIHDPEPLHPLDWLVSNQRQLQEEKMAELLVTLWCLWRH  164

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE-TWSKPLVGWLKLNS  442
            R +   N               ++    SA Q+           +  W +P   +LKLN 
Sbjct  165  RLDHRHNQATTDPLRTHHMIRCHIEASSSAFQVHIDPMQPPPLQQRQWERPPDDFLKLNF  224

Query  441  DEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDK  262
            D      +   GMG ++ D+ G+  A  S   +    P   EA+A R+ L+  +++Q+ K
Sbjct  225  DSGRCGAAG-TGMGGLIRDSDGRCQAWFSSFTEATLDPELGEALAARKILELARAMQIPK  283

Query  261  VQIESDCIKVIQAI--NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
            + +E DC+ VIQA+   S +  SS   I+ D   +  +F +      +R  N  AH LA+
Sbjct  284  IILEGDCLTVIQALADRSATYFSSLGNILQDSIRLMEEFDDCRLSHTRRQFNGAAHYLAK  343

Query  87   E  85
             
Sbjct  344  R  344



>ref|XP_006450894.1| hypothetical protein CICLE_v10010478mg, partial [Citrus clementina]
 gb|ESR64134.1| hypothetical protein CICLE_v10010478mg, partial [Citrus clementina]
Length=250

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 113/248 (46%), Gaps = 22/248 (9%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFN---SLSDNELCKLISICWKVWDA  619
             +A + C + +K W+L          SF D+     N   SL   +    +++ W +W  
Sbjct  2    LHALLRCKMTRKVWELSNVAEIFDKNSFTDFYSASLNLHTSLPKEKFEGFVALAWSMWRT  61

Query  618  RNEKVWN--NIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLN  445
            RN  ++    + ISS  + +  +S   +      +    + +    E W  P   W +LN
Sbjct  62   RNLTLFTKEGMDISSTLIKADRVSQAYKDAQETCIKSIGAPLVITEERWFSPDKNWFRLN  121

Query  444  SDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLD  265
            SD A++      G+G+V+ ++ G+F              M+A   AI E +K ++ L L 
Sbjct  122  SDAAINEVDGLAGLGVVIRNSKGEF--------------MDASTSAILEGIKLVEELGLI  167

Query  264  KVQIESDCIKVIQAINSTSLCSSFDL--IINDIREIARDFTNLSFHFVKRSANKVAHELA  91
             + +ESD + VI+ + S  + S+ ++  +I ++RE     +  +   + RS N  AH +A
Sbjct  168  PLVVESDSLNVIRLM-SKRISSNLEIDWVITEVREFIYKNSVFAVKHISRSRNSAAHNVA  226

Query  90   REAMFKAD  67
            + A+ +++
Sbjct  227  KIALARSE  234



>ref|XP_002466618.1| hypothetical protein SORBIDRAFT_01g011130 [Sorghum bicolor]
 gb|EER93616.1| hypothetical protein SORBIDRAFT_01g011130 [Sorghum bicolor]
Length=463

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/238 (24%), Positives = 115/238 (48%), Gaps = 7/238 (3%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLF----EHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDA  619
            + F  C +A++ W+L     E  +  +  + +D VE    +    +L  ++++ W  W  
Sbjct  195  HLFFKCGMARQVWELLGLSTEREVLANFYTPIDVVEFILRASESRKLMMIVAL-WYTWSE  253

Query  618  RNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSD  439
            RN     +   S   +      Y+ E ++    ++  ++   Q   WSKP V  LKLN D
Sbjct  254  RNAIREEDRRRSPQTLARCVELYVQEMRTTETTANPTANQEQQQYKWSKPPVDILKLNCD  313

Query  438  EALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKV  259
             +    +R    G+++ D  G  + +     + L  PM+AE IA  + ++   +L + ++
Sbjct  314  GSFSPETRAGSWGVLIRDHEGDVIMSGRGRVNHLMTPMQAELIACLQGVQLAANLGIGRL  373

Query  258  QIESDCIKVIQAINSTSL-CSSFDLIINDIRE-IARDFTNLSFHFVKRSANKVAHELA  91
             +E+D ++V++AI +++   ++   ++ +I+  I  +F ++   F  R  N+ AHELA
Sbjct  374  ILETDALEVVKAIKTSAYNYAAVGYLVEEIKSLIELNFISVECVFACRICNRAAHELA  431



>ref|XP_004306193.1| PREDICTED: uncharacterized protein LOC101291367 [Fragaria vesca 
subsp. vesca]
Length=228

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 93/205 (45%), Gaps = 3/205 (1%)
 Frame = -1

Query  774  SCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNN  595
            +C  AQ+ W            +  D V     S+   +  +++ + W +W   N ++W N
Sbjct  22   NCPYAQEAWIAASLQPVVGTTNMKDHVLAISQSVPKEKFAQVLMVLWSIWTNMNSQLWEN  81

Query  594  IVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR  415
                  D V     +  ++   N      +   HQ+  W KP +GW+K NSD A  S +R
Sbjct  82   KRHRPMDAVLLNFGWHNDFIKTN--GSEAAAQPHQIMHWIKPELGWVKCNSDGAFISGTR  139

Query  414  *MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIK  235
              G G+V+ +  G F+A    P          E +A+ E +K  ++L   K+  E+DC+ 
Sbjct  140  RGGCGVVIRNESGDFMAGAPKPCRQWTSSFHVELLALLEGMKLAETLNYPKIIFETDCLL  199

Query  234  VIQAINS-TSLCSSFDLIINDIREI  163
            ++ A+N  T+  SS  LI+ + +EI
Sbjct  200  LVHALNQETADISSLGLILAEAKEI  224



>ref|XP_012071990.1| PREDICTED: uncharacterized protein LOC105633896 [Jatropha curcas]
Length=127

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 2/120 (2%)
 Frame = -1

Query  438  EALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKV  259
            E   SN    G+G+++ D  G   AAK +   G   P   EA+  REAL W KS+     
Sbjct  6    ENFTSNGA-YGLGMLVGDGQGYRCAAKLVVKPGFNDPQVGEALCFREALSWFKSMHFFPN  64

Query  258  QIESDCIKVIQAINSTS-LCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREA  82
             + +D   V+ A NS     S F ++I D + + +D   +S+ FV++S N+VA+ + R A
Sbjct  65   HVGTDSQVVVHASNSRHDFSSYFSMVIKDCKALLQDLRFVSYAFVRKSVNQVAYAITRAA  124



>ref|XP_010696345.1| PREDICTED: uncharacterized protein LOC104908875 [Beta vulgaris 
subsp. vulgaris]
Length=647

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 102/218 (47%), Gaps = 17/218 (8%)
 Frame = -1

Query  714  VSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWN----NIVISSHDVVSGALSYL  547
            VSF D  E     LS +EL    S+ W  W  RN+ ++     ++ + +   V     Y 
Sbjct  410  VSFADLFEWFVEHLSYDELRIFCSLTWAAWYCRNKFIFEQQSVDVQVMACHFVKLTHDYG  469

Query  546  LEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFV  367
            L    A ++    + V      W+KP VG LK N D  +  N   +G+G+V+ D+ G+ V
Sbjct  470  L---YAKKVFMASNRVCTAAAKWNKPPVGLLKANFDAHMGPNGE-VGLGVVVRDSNGKMV  525

Query  366  AA----KSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCS  199
                  ++  WD       AEA+A   A++ +      +V +E D + VI  + +  +  
Sbjct  526  LGGVRRRAANWD----VSTAEAMAGLFAVELVHRFGYTRVVMEGDSLVVISGLKNKPVGG  581

Query  198  SFDL-IINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
            S    + NDI  +  +F+ +SF  VKR+ N VAH LAR
Sbjct  582  SPIFHVFNDISRVCLNFSEISFSHVKRAGNVVAHLLAR  619



>gb|ADK92871.1| retrotransposon protein [Hypericum perforatum]
Length=593

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 81/157 (52%), Gaps = 4/157 (3%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W+ P  G+ K+N D  L +  R   +G+V+ D  G FV A +  +  L  P   E  A+ 
Sbjct  436  WNAPTAGFYKINVDAGLRA-ERGGQVGIVVRDDTGAFVMATTRSFPNLVHPTLLEGQAVY  494

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL--IINDIREIARDFTNLSFHFV  127
              L++  +L L++V++ESDC+ V+  + S       DL  II+D + +  +F  +    V
Sbjct  495  TGLEFANALGLERVELESDCLPVVMQL-SKGYTDRSDLSNIIDDCKMLLSNFQQVRIAHV  553

Query  126  KRSANKVAHELAREAMFKADCMVCVSVPFPCIAHSLE  16
            +R AN+ AHE+A+  +     ++  S P  CI   +E
Sbjct  554  RREANQAAHEMAKMTIPPDRELLVFSWPPDCICSIIE  590



>ref|XP_009121338.1| PREDICTED: uncharacterized protein LOC103846184 [Brassica rapa]
Length=1285

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/247 (25%), Positives = 111/247 (45%), Gaps = 10/247 (4%)
 Frame = -1

Query  789   FYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVEL-----QFNSLSDNELCKLIS--ICWK  631
              + F +C  AQK W L       H  +  D+ +      +   L    +   I   +CW 
Sbjct  1031  MHIFFNCPFAQKVWKLIPLRQVVHLATETDFKKAVIACRRLICLPPTGVSTTILPWMCWV  1090

Query  630   VWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLK  451
             +W ARN  ++    ++  ++ + A+    EW +A       +    Q     +       
Sbjct  1091  LWTARNTLLFEKRTLTPEEIATKAVRLAREWINAQPQKIPTTQGLTQARRTHRIQTNEEA  1150

Query  450   L---NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLK  280
             +    SD A D+ S+  G+  ++ +  G  ++  S P   +  P+ AEA+A+R  +    
Sbjct  1151  IPTCKSDAAFDTLSKKAGLAWIIREESGTTISQGSKPQGRVNSPLIAEALALRAGIIDAV  1210

Query  279   SLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAH  100
              L+L K+++ SD   +I+AIN+ +       I+ DI+E++  F  +SF  V RS+N  A 
Sbjct  1211  KLELSKLRMLSDNSTLIRAINNDAQVKEIFGIVKDIQELSSVFVEISFAHVPRSSNVEAD  1270

Query  99    ELAREAM  79
              LA+ A+
Sbjct  1271  RLAKLAL  1277



>ref|XP_010318134.1| PREDICTED: uncharacterized protein LOC101246115 [Solanum lycopersicum]
Length=191

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 71/140 (51%), Gaps = 1/140 (1%)
 Frame = -1

Query  708  FMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSA  529
            F+ W E Q  S +  ++ + + I W +W+ARN   WNN   +    +  A   L EW+SA
Sbjct  51   FVAWFEEQRKSNAKMKMEEAVMILWSLWEARNNLCWNNKQSAPAATLYSAKKELKEWRSA  110

Query  528  NQ-LshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSI  352
            N          +  V  W +PL+  +K N D + + N+   G+G+VL D  GQF+A K +
Sbjct  111  NSGAEMTVVAATKMVAKWEQPLLNTIKCNIDASYEINTGLAGIGMVLRDHLGQFIARKFL  170

Query  351  PWDGLCLPMEAEAIAIREAL  292
                +  P+ AE I + EAL
Sbjct  171  ILCRVASPLLAEIIGVHEAL  190



>ref|XP_006292284.1| hypothetical protein CARUB_v10018494mg [Capsella rubella]
 gb|EOA25182.1| hypothetical protein CARUB_v10018494mg [Capsella rubella]
Length=282

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 94/190 (49%), Gaps = 3/190 (2%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            I W +W ARN+ ++  I I  +D ++ A+    EW  A  ++H  +  +       KP  
Sbjct  89   ILWAIWSARNQLIFKKISIPGYDSLTLAIIGAKEWHEAQGMTHGSAPPTRNQPCGIKPPP  148

Query  462  GWLKLNSDEA-LDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
              + +++D A +DS     G+G +  D+  +  +  S+    +  P+ AEA+A   A++ 
Sbjct  149  DTVTIHTDAAWMDSGQ--AGLGWIFTDSQNRTCSTGSMACRHVRSPLMAEALATLTAVRV  206

Query  285  LKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
                 L  V   SD + +++A+N          I++DI E++ +F++  F F+ R  N+ 
Sbjct  207  ATESGLSNVLFASDSLILVKALNLVLPSKELHGILHDILELSSNFSSCFFTFISRELNRR  266

Query  105  AHELAREAMF  76
               LA++A+F
Sbjct  267  DDTLAKDALF  276



>ref|XP_009152173.1| PREDICTED: uncharacterized protein LOC103875407 [Brassica rapa]
Length=319

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/195 (26%), Positives = 91/195 (47%), Gaps = 6/195 (3%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEW---QSANQLshhqshvshqVETWSK  472
            I W +W ARN  V+ N V +  ++++  +    EW   Q++        H      T + 
Sbjct  126  ITWGIWTARNYYVFENRVFTPTEIIANVIRLAREWNIAQTSPNSIPSPHHNRTLPPTLTS  185

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
            P V  L   +D A  + S+  G G +L D    ++   +  ++    P+ AEA+A+R AL
Sbjct  186  PFVVCL---TDAAWQAGSKKAGCGWILMDHRDAWLKQGTSTFNYTSSPLMAEALAVRTAL  242

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
                 +   ++ I+SDC+ ++  I+S    +    I  DI  ++  F  +SF F+ R+ N
Sbjct  243  LNALEVGYTRICIKSDCLALVAIISSKQRPADLHGITRDIEHLSLSFDCISFVFISRNLN  302

Query  111  KVAHELAREAMFKAD  67
              A  L + +++ A 
Sbjct  303  SAADALVKSSLYSAP  317



>ref|XP_012090789.1| PREDICTED: uncharacterized protein LOC105648899 [Jatropha curcas]
Length=548

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 92/202 (46%), Gaps = 12/202 (6%)
 Frame = -1

Query  795  VLFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVEL--QFNSLSDNELCK-LISICWKVW  625
             L +A V C  A  CW  F   I  +   F +++++    + + + E  +  I   W +W
Sbjct  351  TLVHALVECPRASFCWQFF--GIQLNIGIFPNFLQMLEHLHKVWEIEFFESFIMGLWSIW  408

Query  624  DARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLN  445
             +RNE  WN +    + V++ A S L  W+ A   S            W  P  G  K+N
Sbjct  409  LSRNELKWNQVAEGPYHVITRARSMLASWKKAQLKSSDSGIDVFAGNQWLPPPAGTFKIN  468

Query  444  SDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL----KS  277
             D AL  +      G V+ + + +F++A +    G   P  AEA A+R  L WL     S
Sbjct  469  FDAALLPSVGHGAFGAVISNCHDKFLSASASSLRGCSSPALAEAQALRNVLSWLLSDYSS  528

Query  276  LQLDKVQIESDCIKVIQAINST  211
            LQ    Q+E+DC++V  A+ S+
Sbjct  529  LQF---QVETDCLQVYYAMRSS  547



>ref|XP_009140657.1| PREDICTED: uncharacterized protein LOC103864646 [Brassica rapa]
Length=263

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 107/260 (41%), Gaps = 15/260 (6%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDL--FEHTIPHHCVSFMDWVELQFNS---LSDNELCKLIS--ICWK  631
             + F +C  A+K W+       IP      +  + ++F     L    +   I   I W 
Sbjct  1    MHIFFNCPFARKVWEAVPLRQAIPTSAEDTITSMMVKFRRALCLPPTGVQNPILPWILWS  60

Query  630  VWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLK  451
            +W ARN+ ++ +  +   ++ SG      EW  A +  +      +  E           
Sbjct  61   IWTARNKLLFEDRNMLPEEITSGGFRLAREWNQAQEPRNSPKKPVYVPEVSIDGRTMPRN  120

Query  450  LNSDEAL--------DSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREA  295
             + D A+        D+ S+  G+  +  +  G      S     +  P+ AEA+AIR  
Sbjct  121  HSDDSAIICTTDASWDATSKRAGLAWIFRENNGTIATQGSEIQHSVSSPLMAEALAIRST  180

Query  294  LKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSA  115
            L      +   ++I SD + +I+AIN+         I+ DI +I+  F ++SF F+ RS 
Sbjct  181  LVMAAEHEFPNLRIYSDSLTLIRAINTKMQDKEIYGILCDIHQISSVFGSISFSFLPRSK  240

Query  114  NKVAHELAREAMFKADCMVC  55
            N+ A ELA+  +     M C
Sbjct  241  NREADELAKRCLRSFSFMSC  260



>ref|XP_011463604.1| PREDICTED: uncharacterized protein LOC105351321 [Fragaria vesca 
subsp. vesca]
Length=256

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 95/192 (49%), Gaps = 9/192 (5%)
 Frame = -1

Query  654  KLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET--  481
            KLI+ICW+VW  RN+ ++     +    ++ A+S+L    SAN  +   +  +++ +   
Sbjct  31   KLITICWQVWKTRNDTIFRGKQPNPRSTLAVAMSHL--QNSANLCTVGSAESNYENDKMI  88

Query  480  -WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAI  304
             WS P    +KLN D ++ S+      G +  +  G  +AA +  +    +P+ AEA+++
Sbjct  89   RWSPPPNDRVKLNFDGSVKSSY--AAGGFIFRNPLGGPLAAAAFNFGSTTVPV-AEALSL  145

Query  303  REALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL-IINDIREIARDFTNLSFHFV  127
            R  L   K     KV++E D   VI  IN  S      L +  DI+ +   F  +SF  V
Sbjct  146  RNGLIDAKRRGFKKVEVEGDSKLVIDVINGVSTPPRRLLKLCQDIKSLRSSFEFISFKHV  205

Query  126  KRSANKVAHELA  91
             R AN VA+ +A
Sbjct  206  FREANFVANAIA  217



>ref|XP_011468594.1| PREDICTED: uncharacterized protein LOC101299608 [Fragaria vesca 
subsp. vesca]
Length=314

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 97/212 (46%), Gaps = 2/212 (1%)
 Frame = -1

Query  723  HHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLL  544
            H   +  +W+E   + L+  E+  L    W +W+ RN  +WN    +   V   ++  L 
Sbjct  33   HEASNLWEWLEGMVHILNKEEVDMLFMFLWAIWEERNRLLWNGGSFNPRHVAMWSMKLLQ  92

Query  543  EWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVA  364
            E+Q  + LS +    S   + W  P  G LKLN D A + N+   G+G+++    G FVA
Sbjct  93   EYQFWHPLSGNWKLRSRS-QKWVAPPSGRLKLNCDGAYNINTGCGGVGMIIRGVGGTFVA  151

Query  363  AKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTS-LCSSFDL  187
            A S  +  L   + +E  A R +L+         +++ESD + ++ A+N+   L      
Sbjct  152  AWSKHFSHLRSALHSEVEACRASLQIAIDQGWRNIEMESDSVAIVTALNNREFLPYEVSR  211

Query  186  IINDIREIARDFTNLSFHFVKRSANKVAHELA  91
            I+ D   + + F       + R AN VA  LA
Sbjct  212  ILEDCIVMIQSFEFFRIWHIHRKANGVADRLA  243



>ref|XP_009118883.1| PREDICTED: uncharacterized protein LOC103843855 [Brassica rapa]
Length=1293

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 60/242 (25%), Positives = 110/242 (45%), Gaps = 11/242 (5%)
 Frame = -1

Query  771   CSLAQKCWDLFEHTIPHHC---VSFMDWVELQFNSLSDNELCKLIS----ICWKVWDARN  613
             C+ A+K W     + P      ++F D +   FN ++   +    +    ICW +W ARN
Sbjct  1044  CAFAKKVWTFGLWSTPREAGDLMTFKDTLRASFNWINLPPMGVTTNLFPWICWNLWTARN  1103

Query  612   EKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEA  433
              + + N  IS  +VV  A+    EW+ A   +      S      ++     +  N+D A
Sbjct  1104  LRTFENRTISPQEVVLKAIRASKEWEVAQPCNRPTPSPSTTQRHAAETPPMTIFCNTDAA  1163

Query  432   LDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQI  253
               S+++  G+G +  D  G  +   S     +   + AE +A+REAL    +L L K+ +
Sbjct  1164  WKSDTKAAGLGWIFTDENGHELTRGSSAQHHVSSALMAETLAVREALIHAATLNLTKIYL  1223

Query  252   ESDCIKVIQAINSTSLCSSFDLIINDIREIA----RDFTNLSFHFVKRSANKVAHELARE  85
              +D  ++I+AI +    S    +++D+  +A      F    F F+ R+ N+ A  LA+ 
Sbjct  1224  RTDSQELIRAITTGRRPSDLFGVLSDVDSLASPPTSPFAFCRFVFISRAFNESADSLAKA  1283

Query  84    AM  79
             ++
Sbjct  1284  SL  1285



>ref|XP_010693629.1| PREDICTED: uncharacterized protein LOC104906557 [Beta vulgaris 
subsp. vulgaris]
Length=330

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 103/246 (42%), Gaps = 21/246 (9%)
 Frame = -1

Query  786  YAFVSCSLAQKCWD---LFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDAR  616
            +    CSL    W+      +       SFMD+     + L   +L   +++ W  W  R
Sbjct  65   HTIFRCSLVSSIWENSSFIHYVRDGPSSSFMDFFVWLRSKLEKQDLLSFMALAWASWSYR  124

Query  615  N----EKVWNNIVISSHDVVSGALSYLLEWQ--SANQLshhqshvshqVETWSKPLVGWL  454
            N     + W+N+ +S    V G L  + E++  +A+               W  P  G++
Sbjct  125  NAVTFNEPWSNVPVS----VVGFLKLVNEYKNYAASVFRAPAGLDFTSRSCWMGPRAGYV  180

Query  453  KLNSDEALDSNSR*MGMGLVLWDAYGQ--FVAAKSIPWDGLCLPME-AEAIAIREALKWL  283
            ++N D A+      +G+G V+ D  G    VA K      +C P+  AEA+  R  L+  
Sbjct  181  RINIDAAMLGEGS-VGVGAVVRDEAGTVLLVAVKRYQ---VCWPVSLAEAMGARFGLEVA  236

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFHFVKRSANKV  106
            K    D V++E D   + +AI       S  +L+I DI  I    +N     VKR  N V
Sbjct  237  KHHGFDAVELECDATTITKAIARRQFGRSPLNLVIEDICLIGDSLSNFHVSHVKRGGNTV  296

Query  105  AHELAR  88
            A  +AR
Sbjct  297  ARLVAR  302



>ref|XP_009113456.1| PREDICTED: uncharacterized protein LOC103838755 [Brassica rapa]
Length=1143

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/267 (24%), Positives = 115/267 (43%), Gaps = 21/267 (8%)
 Frame = -1

Query  795   VLFYAFVSCSLAQKCWDLF----------EHTIPHHCVSFMDWVELQFNSLSDNELCKLI  646
              + + F +C+ A+K W+            E TI    V F   + L    + +  L    
Sbjct  874   TVMHIFFNCTFARKVWEAVPLRQAIPISAEDTITSMMVKFRRALCLPPTGVQNPILP---  930

Query  645   SICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE------  484
              I W +W ARN+ ++ +  +   ++ SG +    EW  A +  +         E      
Sbjct  931   WILWSIWTARNKLLFEDRNMPPEEIASGGIRLAREWNQAQEPKNSPKKSVSAPEVSIDGR  990

Query  483   TWSKPLVGWLKL--NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAI  310
             T S+   G   +   +D + D+ S+  G+  +  +  G      S     +  P+ AEA+
Sbjct  991   TTSRNHSGDSAIICTTDASWDATSKRAGLAWIFRENNGTIAIQGSEIQHSVSSPLMAEAL  1050

Query  309   AIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHF  130
             AIR +L      ++  ++I SD + +I+AIN+         I+ DI +I+  F ++SF F
Sbjct  1051  AIRSSLVMAVEHEIPNLRIYSDSLTLIRAINTKMHDKEIYGILCDIHQISSVFGSISFSF  1110

Query  129   VKRSANKVAHELAREAMFKADCMVCVS  49
             + RS N+ A ELA+  +       C+ 
Sbjct  1111  LPRSKNREADELAKRCLRSFSFKSCIG  1137



>gb|EPS73861.1| hypothetical protein M569_00896, partial [Genlisea aurea]
Length=1651

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 64/253 (25%), Positives = 110/253 (43%), Gaps = 17/253 (7%)
 Frame = -1

Query  813   CAM*R*VLFYAFVSCSLAQKCWDLFEHTIPHHCVSF-----MDWVELQFNSLSDNELCKL  649
             C M R   ++AF++C  +Q  W L    IP   V       +DW+  +F  L   +   L
Sbjct  1399  CEMDRESWYHAFLTCPFSQAVWRL--GGIPMDSVGREPLFPVDWLIARFQQLRAEQFSGL  1456

Query  648   ISICWKVWDARNEKVWNNIVIS---SHDVVSGALSYLLEWQSA-NQLshhqshvshqVET  481
             +   W +W  R +   N + +    +H ++     Y+    SA ++            + 
Sbjct  1457  LVTLWCIWRHRMDHRHNQVTLDPLRTHHLIR---YYVDSSGSAFSEQLDPPLLPPLLQQR  1513

Query  480   WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
             W  P VG++KLN D    + S   G+G ++ D  G+  A  S   D    P   EA+A R
Sbjct  1514  WECPPVGFVKLNFDSGRCTPSS-TGLGGLIRDDQGRCQAWFSYQLDTELDPEAGEALAAR  1572

Query  300   EALKWLKSLQLDKVQIESDCIKVIQAI--NSTSLCSSFDLIINDIREIARDFTNLSFHFV  127
             + L+   ++   +V +E DC+ V+QA+   + +L +S   ++ D   +   F        
Sbjct  1573  KILELALAMGFTRVIVEGDCLTVLQALADQAVTLFASLGNVLQDSLRLMEQFEACRLSHT  1632

Query  126   KRSANKVAHELAR  88
             +R  N  AH LA+
Sbjct  1633  RRQFNAAAHHLAK  1645



>ref|XP_009130450.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=635

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 116/257 (45%), Gaps = 29/257 (11%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDL---FEHTIPHHCVSFMD-------WVELQFNSLSDNELCKLISIC  637
            +  V C+ A++ W++        P H V+F +       W+ L    +  N +  L   C
Sbjct  382  HILVHCTFAKEVWEVGPWLHQPNPLHFVNFKELLQASHTWINLPPYGILGNFIPWL---C  438

Query  636  WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPL---  466
            W +W +RN+ ++ N   +   VV+ A+S   EW+SA       +       T S PL   
Sbjct  439  WTLWISRNQLLFENRTCTPQAVVTKAISLCREWESAQ------TPERSAPHTHSLPLQSS  492

Query  465  ---VGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREA  295
                  +  N+D A  S+ +  G+G +  D     +   S     +     AEA+AIREA
Sbjct  493  VIDSSTVICNTDAAWRSDQKAAGLGWIFSDQDSVELNRASRLHHHVSSACMAEALAIREA  552

Query  294  LKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIA----RDFTNLSFHFV  127
            L    SL ++++ + +D   +++AI+S S       +++DI  +A      F+N  F F+
Sbjct  553  LLHASSLNINQICLRTDSQVLVRAISSRSRTMDLHGVLSDIDSLAFSPSSSFSNCFFQFI  612

Query  126  KRSANKVAHELAREAMF  76
             R+ N  A  LA+  +F
Sbjct  613  PRAQNGPADSLAKSCLF  629



>ref|XP_010681661.1| PREDICTED: uncharacterized protein LOC104896591 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 76/136 (56%), Gaps = 2/136 (1%)
 Frame = -1

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
            + W  P+ G  K+N+D A+  + R +G+G V+ DA G+ + A  +  +      EAEA A
Sbjct  33   KVWKPPVEGSYKINADAAIFKD-RTVGLGGVMRDAAGEVMGATCMHLEVELGVDEAEACA  91

Query  306  IREALKWLKSLQLDKVQIESDCIKVI-QAINSTSLCSSFDLIINDIREIARDFTNLSFHF  130
             R AL+    + L  + +ESD +KVI   +      SSF  ++ DI  +   F+++SF+ 
Sbjct  92   ARHALQTAVEMGLRHIVLESDSLKVISHLLTKKGDESSFGNVVEDILWLGGFFSSISFNH  151

Query  129  VKRSANKVAHELAREA  82
            V+R  N+VAH +A+ +
Sbjct  152  VRREGNRVAHTIAQRS  167



>ref|XP_002527468.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34866.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 77/187 (41%), Gaps = 38/187 (20%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            ICW +W +RNE +W      +  ++ G L+    W +A +     S  S  +  W KP +
Sbjct  2    ICWSIWSSRNELIWEGKRKGNSQILQGELNLFTNWLAATETYQPSSATSSPLLPWQKPQL  61

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
            G+LK N D A   N R  G G VL D  G          D   L    EA+ +RE L WL
Sbjct  62   GYLKYNVDAA-TFNGR-TGFGFVLRDHAGLLFQQLM---DLRRLRPHTEAMGLRETLSWL  116

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
            K                     + S C+  +L+            N+S  FV RS N+VA
Sbjct  117  K---------------------ANSHCNVLELV------------NVSVPFVARSVNRVA  143

Query  102  HELAREA  82
            H L R +
Sbjct  144  HVLPRAS  150



>ref|XP_009103761.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=502

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 118/264 (45%), Gaps = 24/264 (9%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFEHTIPHH--------------CVSFMDWVELQFNSLSDNELCK  652
             + F  CS A++ W +    IP H               V+F   + L  + ++   L  
Sbjct  246  MHIFFECSFAREVWKM----IPLHKEVPLATQTDFKDAIVAFRKIISLPPSGITGTILP-  300

Query  651  LISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSK  472
               +CW +W ARN  ++    +S  +V + A+    EW  A       +    +     +
Sbjct  301  --WVCWVLWTARNTLIFEGRTLSQQEVTTKAIRSAREWNLAQDHKEKTNQSIPESGVGRR  358

Query  471  -PLVGWLKL-NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIRE  298
             P+     +  SD A + N+   G+G ++ D  G  V  +S   D +  P+ AEA+A+R 
Sbjct  359  SPIQNQTVICKSDAAWEKNTNRGGLGWIISDRTGAIVKKRSTIQDHVSSPIVAEALALRL  418

Query  297  ALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRS  118
             L    +L L  +++ SD   +I+AIN+ +       I++DI++I+  F ++SF  + R 
Sbjct  419  GLIAAVNLNLTSIRMISDNQTLIRAINNDTQAKEIYGIVHDIQQISSVFVDISFSHLSRK  478

Query  117  ANKVAHELAREAMFKADCMVCVSV  46
             N V  +L  ++  K   ++  +V
Sbjct  479  -NFVEVDLLAKSTLKGHHVITPAV  501



>gb|EEC72520.1| hypothetical protein OsI_05906 [Oryza sativa Indica Group]
Length=175

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 70/134 (52%), Gaps = 4/134 (3%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKS--IPWDGLCLPMEAEAIA  307
            W KP  G L +N D A D +S   G G+VL D  G  V A    +P+  L  P  AEA A
Sbjct  25   WKKPPEGMLMINVDAAFDIDSGSGGTGVVLRDHLGACVTASQAFLPYV-LDAPTMAEAFA  83

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL-IINDIREIARDFTNLSFHF  130
            +R+ L   + +    V +++DC++V+  +      ++  + + +D + +   F  +S   
Sbjct  84   LRDGLALAQHIGAKNVIVQTDCMQVVSTMMDGGFSATAAMSVFDDCKLMWDGFGTISIEH  143

Query  129  VKRSANKVAHELAR  88
              R++N+VAHELAR
Sbjct  144  CNRNSNQVAHELAR  157



>ref|XP_003636511.1| hypothetical protein MTR_043s0014 [Medicago truncatula]
Length=132

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 54/101 (53%), Gaps = 1/101 (1%)
 Frame = -1

Query  387  DAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTS  208
            +A G F  A +  +D    P+EAEA+ +++ + WL  L L  VQIE DC  V+ +I   S
Sbjct  5    NAQGHFFKALTKWFDYYPTPLEAEALGLKDTIVWLGELGLSMVQIELDCKLVVDSIMENS  64

Query  207  LCSS-FDLIINDIREIARDFTNLSFHFVKRSANKVAHELAR  88
               S F  II+  R +   F N    FV+R AN VAH L R
Sbjct  65   NNQSDFGNIISSCRSLLNQFRNFKISFVRRQANYVAHTLTR  105



>ref|NP_180979.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AAC27408.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
 gb|ABE65469.1| hypothetical protein At2g34320 [Arabidopsis thaliana]
 gb|AEC08958.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=292

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 89/193 (46%), Gaps = 7/193 (4%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE---TWSK  472
            + W++W +RNE ++      + +V+  A+    EW +  +L    S    +      W  
Sbjct  80   LLWRLWKSRNELMFKGKEYDAPEVLRRAMEDFEEWSTRRELEGKASGPQVERNLSVQWKA  139

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQ--FVAAKSIPWDGLCLPMEAEAIAIRE  298
            P   W+K N+D      +   G+G +L +  G   ++ A+++P     L  EAE  A+R 
Sbjct  140  PPYQWVKCNTDATWQLENPRCGIGWILRNESGGVLWMGARALPRTKNVL--EAELEALRW  197

Query  297  ALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRS  118
            A+  +      ++  ESD   ++  +NS     +    + DI+++   F  + F F  R 
Sbjct  198  AVLTMSRFNYKRIIFESDAQALVNLLNSDDFWPTLQPALEDIQQLLHHFEEVKFEFTPRG  257

Query  117  ANKVAHELAREAM  79
             NKVA  +ARE++
Sbjct  258  GNKVADRIARESI  270



>gb|KJB23230.1| hypothetical protein B456_004G088300 [Gossypium raimondii]
Length=281

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 97/208 (47%), Gaps = 5/208 (2%)
 Frame = -1

Query  699  WVELQFNSLSDNELCKLISIC-WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ  523
            W+ L+F + S NE CK+ +I  W +W   N      I   +H++V    +Y  E     +
Sbjct  45   WLALEFENYS-NEACKIRAISFWALWYNCNRISHEGIRERAHEIVRFINAYYSEITQMGE  103

Query  522  LshhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWD  343
            +  ++         W  P+   +K+N D + +  SR     ++  +  G  +A+ +  W+
Sbjct  104  ILKNRQETKRF--VWEPPVDDAVKINFDASFNQYSRISCSLVIARNKEGLVMASCTYSWE  161

Query  342  GLCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIRE  166
             +  P+ AEA+A  +A+   + +    + +E D + VI+ +NST    S    +I +I  
Sbjct  162  NISDPVIAEAMACLQAVTMAEEIGFQDICVEGDALTVIRKLNSTKEDRSCISSMIQEING  221

Query  165  IARDFTNLSFHFVKRSANKVAHELAREA  82
               +F  + F FV R ANK  H +A E 
Sbjct  222  RTPNFRRMCFRFVPREANKAVHGMAMEG  249



>ref|XP_009145555.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=900

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 92/206 (45%), Gaps = 6/206 (3%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQS------ANQLshhqshvshqVET  481
            + W++W +RN  ++    I    ++  A     EW+          L   QSH   +   
Sbjct  680  LLWRIWKSRNTLIFRQKEIPWRSLLRYAREDAKEWKQLDNKGEEGHLRRRQSHHLTECLH  739

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W KP++GW+K N+D A +S       G V+ D  G +  +           +E E  AI 
Sbjct  740  WKKPMIGWIKCNTDGAYNSTQHQTSAGWVIRDENGIYKGSAQARGRTRNDALECELQAIL  799

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKR  121
             AL+   SL   K+ +ESDC K I  IN   L  ++     +I+  A  F ++SF + +R
Sbjct  800  MALQHCWSLGYRKIIMESDCQKAIDIINKKRLHFAYYNWKREIQWWANKFQDISFQWTRR  859

Query  120  SANKVAHELAREAMFKADCMVCVSVP  43
            SANKVA  LA+      D      VP
Sbjct  860  SANKVADLLAKRLEDGVDFSFHYYVP  885



>ref|XP_008234850.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=1009

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 89/186 (48%), Gaps = 4/186 (2%)
 Frame = -1

Query  636  WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE---TWSKPL  466
            W++W ARN  V++ +     + V   L  + E+++A Q    Q+          +W KP 
Sbjct  790  WRIWKARNLAVFDGVQADPIEAVLLLLKQVSEFRTAKQDLQPQALQPVSSPAPLSWCKPP  849

Query  465  VGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKW  286
             G LK+N D A  +     G+G V+ D++G  + A           +  E +AIR AL  
Sbjct  850  PGLLKVNCDAAWSAQRLGGGVGWVIRDSFGLLLCAGGQGDLHGSSALMMELLAIRHALSE  909

Query  285  LKSLQLDKVQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
              +  L  + +ESD  K I  +N   S+ S  + I+ DIR++    + +SF F  RS N+
Sbjct  910  CANFHLTDIIVESDSQKGIFMLNGRVSVDSDLEGIVFDIRQLVASLSRVSFVFAPRSCNR  969

Query  108  VAHELA  91
             AH +A
Sbjct  970  AAHSVA  975



>ref|XP_006492749.1| PREDICTED: uncharacterized protein LOC102612946 [Citrus sinensis]
Length=589

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/270 (26%), Positives = 131/270 (49%), Gaps = 15/270 (6%)
 Frame = -1

Query  792  LFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSD---NELCKLISICWKVWD  622
            +F+A + C +A+K W           V   D + +   ++++   +E+  + +I W  W 
Sbjct  322  VFHALMECRVARKIWKCTHLENEVKSVIREDMLSVMIGAMNNWAKSEVDYVATIWWVAWH  381

Query  621  ARNEKVWNNIVISSHDVVSGALSYL--LEWQSANQLshhqshvshqVETWSKPLVGWLKL  448
            ARN+ ++    +     V+   + +   + Q   +   H++ V  +++ W+ P    +K+
Sbjct  382  ARNKLLFQGKKLDPIGSVAKGKTVMEVYQAQQVKERESHRNTVKGKMQIWTPPPNNKVKV  441

Query  447  NSDEALDSNSR*MGMGLVLWDAYGQFVAA--KSIPWDGLCLPMEAEAIAIREALKWLKSL  274
            N D A+  + +  G+G+V+ +  GQ +AA  KS+ + G      AEA A++  ++  K L
Sbjct  442  NVDAAVKEDRKSAGLGVVIRNHRGQVLAAAVKSMNFQGNI--AIAEAHAVKWGMEVAKDL  499

Query  273  QLDKVQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHE  97
             L  V IE+DC  V    N   S  +     ++DI +  +DF  +SF  V R  N  AH 
Sbjct  500  SLSSVIIETDCKNVADLANKKVSNRTEILWTMSDIHKSTQDFQLISFQHVPRKCNDFAHF  559

Query  96   LAREAMFKADCMVCVSVPFP----CIAHSL  19
            LA+ A+  ++ ++  +  FP    C+A SL
Sbjct  560  LAKRALCSSESVIWRN-NFPADGLCMAESL  588



>gb|ABK28206.1| unknown [Arabidopsis thaliana]
Length=293

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 89/193 (46%), Gaps = 7/193 (4%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE---TWSK  472
            + W++W +RNE ++      + +V+  A+    EW +  +L    S    +      W  
Sbjct  80   LLWRLWKSRNELMFKGKEYDAPEVLRRAMEDFEEWSTRRELEGKASGPQVERNLSVQWKA  139

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQ--FVAAKSIPWDGLCLPMEAEAIAIRE  298
            P   W+K N+D      +   G+G +L +  G   ++ A+++P     L  EAE  A+R 
Sbjct  140  PPYQWVKCNTDATWQLENPRCGIGWILRNESGGVLWMGARALPRTKNVL--EAELEALRW  197

Query  297  ALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRS  118
            A+  +      ++  ESD   ++  +NS     +    + DI+++   F  + F F  R 
Sbjct  198  AVLTMSRFNYKRIIFESDAQALVNLLNSDDFWPTLQPALEDIQQLLHHFEEVKFEFTPRG  257

Query  117  ANKVAHELAREAM  79
             NKVA  +ARE++
Sbjct  258  GNKVADRIARESI  270



>ref|XP_003593283.1| hypothetical protein MTR_2g009730 [Medicago truncatula]
Length=268

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 90/209 (43%), Gaps = 13/209 (6%)
 Frame = -1

Query  654  KLISICWKVWDARNEKVWNN---IVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE  484
            +L ++   +W  RN +VW+N   I ++  +  S A +    W      +           
Sbjct  59   RLTTVFGSIWKYRNLRVWDNATEISVTVLECASIAFTDTGCWGFYYGTTCCYFV------  112

Query  483  TWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAI  304
                P  G  K N D    S  +  G+ + + D+   FV AK++ +  +      EA+ +
Sbjct  113  --EAPYSGRYKCNIDATFSSRFKRTGIDICVRDSDSTFVLAKTVTYPCIVSVDVGEALGL  170

Query  303  REALKWLKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREI-ARDFTNLSFHF  130
              AL+WL  +Q D V  E+D      A  ST +  S F  II+  R + +  F+N    F
Sbjct  171  HSALQWLSDMQFDSVDFETDSKVTSDAFLSTRNDTSEFGSIISSCRLLFSSFFSNSKVEF  230

Query  129  VKRSANKVAHELAREAMFKADCMVCVSVP  43
            V+R  N V H LARE    A+  V   +P
Sbjct  231  VRRQTNTVTHALARETTLLANPAVYYDIP  259



>ref|XP_009103764.1| PREDICTED: uncharacterized protein LOC103829819 [Brassica rapa]
Length=349

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/248 (25%), Positives = 102/248 (41%), Gaps = 11/248 (4%)
 Frame = -1

Query  786  YAFVSCSLAQK-----CWDLFEHTIPHHCVSFMDWV---ELQFNSLSDNELCKLIS-ICW  634
            + F+ CS  ++     CW L  +  P  C SF +       Q N         L   +CW
Sbjct  101  HVFLHCSFTRQIWTAQCWKL--NFNPSDCTSFSEAFMASTRQINLPPPGVTGNLFPWLCW  158

Query  633  KVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWL  454
             +W ARN  ++ N      D+ S ++    EW  A   S        Q+ T        +
Sbjct  159  GIWTARNYHIFENRASLPVDITSRSIKNAREWTEAQLSSPPPPLGQSQMNTIPAGTTCMI  218

Query  453  KLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSL  274
               SD A  + +   G G +  D   + +   +  +D    P+ AEA+A+R AL      
Sbjct  219  SCCSDAAWQATTNRAGCGWIFTDHRDERLLQGTATFDHTVSPLMAEALAVRSALLHALEA  278

Query  273  QLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHEL  94
               ++ ++SDC  ++  I ST   +    I  DI  ++  F  + F F+ R+ N +A  L
Sbjct  279  GYSRICLKSDCQALVAIITSTHHPTELYGITRDIEHLSLSFDCIVFTFIPRNLNVMADSL  338

Query  93   AREAMFKA  70
            A+  ++ A
Sbjct  339  AKSVLYLA  346



>ref|XP_011459636.1| PREDICTED: uncharacterized protein LOC105350012 [Fragaria vesca 
subsp. vesca]
Length=1169

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 71/264 (27%), Positives = 115/264 (44%), Gaps = 11/264 (4%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWDARNEK  607
            +A   C  A     L +  I     + +DW+     + S +    L+ I W VW  +N+ 
Sbjct  698  HALRDCPHAAAFIQLVDVPIQLADTNALDWLVSSLEN-SPSTFATLMMIIWSVWRNQNDH  756

Query  606  VWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLVGWLKLNSDEALD  427
            VWNN    + +VV   L +  E++SA      +       + W  P  G++KLN D A +
Sbjct  757  VWNNNAKQATEVVPLTLRWWEEFKSA--FVKRRGRNVSPRDRWITPSSGYIKLNVDAAYN  814

Query  426  SNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEA---EAIAIREALKWLKSLQLDKVQ  256
            + S    +G V  D  G  +    +   GL     A   E +A+   ++      L  + 
Sbjct  815  NASCMASLGGVFRDHTGSCLG---VFMQGLFSAHSAHHSELMALLVGVQVAIHHNLYPLS  871

Query  255  IESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAM  79
            IE+DC+ ++ A+ S SL  S    +I D+R      T     F++RSAN+VAH +A+EA 
Sbjct  872  IETDCLVLVSALTSGSLDDSDLGFLIEDLRASLSTIT-APVRFMRRSANRVAHVIAKEAF  930

Query  78   FKADCMVCVSVPFPCIAHSLELDF  7
                 +V    P   +   L  D+
Sbjct  931  SGPANLVFTIDPSRAVRGMLSSDY  954



>ref|XP_012080215.1| PREDICTED: uncharacterized protein LOC105640496 [Jatropha curcas]
Length=145

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 75/158 (47%), Gaps = 16/158 (10%)
 Frame = -1

Query  477  SKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIRE  298
             K L  +LK N D  +   S   G   VL D             DG    M AEA++ RE
Sbjct  2    GKTLATFLKCNCDAVVHPTSPVAGTIWVLRDE------------DGF---MVAEALSFRE  46

Query  297  ALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSS-FDLIINDIREIARDFTNLSFHFVKR  121
            AL W+K   L +V  E+D + ++QA+  + + +S F  +I D + + ++  + S  + KR
Sbjct  47   ALSWVKGKGLQRVVFETDSLLLVQAMQHSKVNTSYFSCLILDCKALLKELPHCSVVYAKR  106

Query  120  SANKVAHELAREAMFKADCMVCVSVPFPCIAHSLELDF  7
            SANKV   LA  A F +D   C  +P   I  SL  D 
Sbjct  107  SANKVVDLLATNAYFMSDLKECGPIPPSIIVGSLLFDL  144



>gb|ABN07957.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=380

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 73/141 (52%), Gaps = 2/141 (1%)
 Frame = -1

Query  636  WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE--TWSKPLV  463
            W +W  RN KVWNNIV ++ ++   A+++L  W++A +     S  +   +   WSKP V
Sbjct  234  WSLWRHRNNKVWNNIVETTEEIGDRAVAFLNSWKAAQETRIRSSPANPHFDISKWSKPSV  293

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
            G  K N D A  ++   +G G  + DA G  V +++  +  L      EAI +  A++W 
Sbjct  294  GRFKCNVDAAFSASLHRVGFGACIRDANGNHVISRTECFTPLLDVEMGEAIGLLHAMRWA  353

Query  282  KSLQLDKVQIESDCIKVIQAI  220
            K L L  +  E+D   V++ I
Sbjct  354  KDLNLVNMDFETDSKVVVENI  374



>ref|XP_012065107.1| PREDICTED: uncharacterized protein LOC105628319 [Jatropha curcas]
Length=174

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W+KP +G  KLN D AL   +   G+G V  D++  F+AAK++  +GL    EAEAI I+
Sbjct  69   WTKPNIGCAKLNVDAALSLPNHRFGVGFVARDSHDNFLAAKNLQINGLFSAKEAEAIGIK  128

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTS  208
            E L WLK     +V  ESD  +VIQA+++ +
Sbjct  129  EVLSWLKLPGWSRVITESDAHEVIQALSNPN  159



>ref|XP_010665605.1| PREDICTED: uncharacterized protein LOC104882889 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 97/196 (49%), Gaps = 6/196 (3%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQS---ANQLshhqshvshqVETWSK  472
            + W +W  RN+ V+    +SSH ++   +  L+E Q    A    +  +        WS 
Sbjct  8    LAWCIWGERNQMVFRG-NLSSHHIILARVHRLVEEQGSYVARIYPNAAAKPVTSPNKWSS  66

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
            P  G +K+N+D +L+ +   +G+G++  ++ G  + + S        P  AEA AI  A+
Sbjct  67   PPPGMVKINADASLEVDG-WVGIGVIARNSDGDVLFSASRRIRAYWTPEIAEAKAIAVAV  125

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSA  115
            +  K     +V  ESDC  VI  ++S ++  S  D I+++I   +  F+ +++  VKR  
Sbjct  126  RLGKHFGFKEVIFESDCQVVINRLSSNAIFLSDLDSILHEILSSSTFFSYVAWSHVKRDG  185

Query  114  NKVAHELAREAMFKAD  67
            N VAH LA+   F  +
Sbjct  186  NCVAHHLAKLVPFGVE  201



>emb|CDY56143.1| BnaC06g41320D [Brassica napus]
Length=353

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 107/251 (43%), Gaps = 19/251 (8%)
 Frame = -1

Query  789  FYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQ------------FNSLSDNELCKLI  646
             + F++C  AQ  W L     P      +DW+++              N L       L+
Sbjct  17   LHLFLTCPFAQLVWRLAPFATP------VDWLDINTPHQALIRATSLLNLLPTGLTSDLV  70

Query  645  S-ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKP  469
            S I W +W ARN   + +   +S  V++ A+S   EW  A Q +  ++  +  +E     
Sbjct  71   SWILWGIWKARNLLSFEHRATTSPAVMTSAISGAREWSMAQQKNLPRTSTTRYMERPPTL  130

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
                L  NSD A    +   G+G V+  +    +         +  P+ AEA+A++  L 
Sbjct  131  PTTLLTCNSDAAWRKETNNAGLGWVIIGSQDGLIYEGQGHARFVSSPLMAEALAVKGMLL  190

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
                L +  V I SD +++I+AINS +       ++ DI  ++  F  + F  + RS N 
Sbjct  191  AASHLTITNVWIRSDSLELIRAINSNTYPMELYGVLKDIEFLSASFDFIYFSHISRSCNS  250

Query  108  VAHELAREAMF  76
             A  LA+ A+ 
Sbjct  251  RADSLAKNALL  261



>ref|XP_008240489.1| PREDICTED: uncharacterized protein LOC103338989 [Prunus mume]
Length=244

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 100/215 (47%), Gaps = 6/215 (3%)
 Frame = -1

Query  639  CWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQ---LshhqshvshqVETWSKP  469
            CW +W +RN  V++         +   LS + E  + N    +       S    +W+ P
Sbjct  21   CWIIWKSRNRFVFDQCKPQPLLAIKTILSQVEEMAALNNKRNVRRLYEGPSPNPTSWTTP  80

Query  468  LVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
                +K+N D A  ++S   G GL+  +A G+FV AK + +      M AEAIA  E  +
Sbjct  81   DAHVIKVNFDAAWLASSSKSGAGLIARNANGEFVGAKCLSFQAESAIM-AEAIAGLEGCE  139

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDL--IINDIREIARDFTNLSFHFVKRSA  115
            W   L L +V  ESD  ++++++        ++L  +I+ IRE    F+N  + +  R  
Sbjct  140  WASELGLSEVCFESDSKELVESVKGNIKRGRWNLYPLISRIRECNSIFSNCKWAWTGRKN  199

Query  114  NKVAHELAREAMFKADCMVCVSVPFPCIAHSLELD  10
            N+ A  LA  A+ ++   V VS P   + H L  D
Sbjct  200  NEAADHLASLALSRSSPEVWVSRPPTSLMHILNRD  234



>emb|CDP16895.1| unnamed protein product [Coffea canephora]
Length=226

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 104/217 (48%), Gaps = 6/217 (3%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQL----shhqshvshqVETWS  475
            I W +W+ RN  +++        +VS ++++L ++  AN                +  W 
Sbjct  7    ILWNLWNNRNGAIFDGPYRDPLSLVSLSIAFLNQFHEANSKDKCDMSTSLQSRLSIGHWI  66

Query  474  KPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAK-SIPWDGLCLPMEAEAIAIRE  298
            +P  G++K N D A+  + +  G+G+++ D  G F+A   S    G+  P   E+ A + 
Sbjct  67   RPNAGFVKANFDGAVFMDDKSSGVGVIIRDDTGSFIAGHYSKKILGILEPNVVESYAAKH  126

Query  297  ALKWLKSLQLDKVQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHFVKR  121
            A + L+SL  +K+ +E D  KVI+ +N   S  SS  L+I+D   + ++F      ++ R
Sbjct  127  AAQLLQSLGFNKIVLEGDSQKVIKMMNRLESDDSSCGLLIDDTIVLCQEFMCWEVSWISR  186

Query  120  SANKVAHELAREAMFKADCMVCVSVPFPCIAHSLELD  10
              N  AH  A+ A+  +D  +  + P   I  +L  D
Sbjct  187  LFNVPAHNFAKYAINLSDSCIWRNSPPSFICSALVAD  223



>ref|XP_010679712.1| PREDICTED: uncharacterized protein LOC104895014 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 3/143 (2%)
 Frame = -1

Query  486  ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
            + W  P+ G  K+NSD A+  +   +G+G V+ DA G  + A S+         EAEA A
Sbjct  33   KVWKPPVEGHYKVNSDAAIYKDCT-VGLGGVMRDANGDIMGATSMHLKLDMEVHEAEACA  91

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSLC-SSFDLIINDIREIARDFTNLSFHF  130
             R ALK         + +ESDC+K+I  +       +SF  I+ DI  +    +++SF  
Sbjct  92   ARHALKIAMEAGFRNIVLESDCLKLISHLKRKKRDDTSFGNIVEDILWLGNCCSSISFSH  151

Query  129  VKRSANKVAHELAREAMFKADCM  61
            V+R  N+VAH LA+ +  + DCM
Sbjct  152  VRREGNRVAHILAQRSK-EYDCM  173



>ref|XP_004298184.1| PREDICTED: uncharacterized protein LOC101290856 [Fragaria vesca 
subsp. vesca]
Length=241

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 93/209 (44%), Gaps = 3/209 (1%)
 Frame = -1

Query  699  WVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQL  520
            W++    +L   ++     + W +W  RN  VWN   +   + V   ++ L E++ A Q 
Sbjct  7    WIQDILENLQAPQMEVFFILLWSIWVERNYVVWNGSRVDPRETVRWVMALLDEYKRA-QP  65

Query  519  shhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDG  340
              ++   S Q E W  P  G LKLN D A   +    G G+++ D  G    A S+    
Sbjct  66   VANKGKRSRQEERWIFPPRGKLKLNLDGAYREDGS-GGAGMLVRDEKGIVKGAWSVHLTN  124

Query  339  LCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCS-SFDLIINDIREI  163
            L  P++AEA+A RE L+         + +ESDC  ++ A+N  +        II++ R  
Sbjct  125  LNSPLQAEAMACREGLRRAVEQGWLNIDVESDCEVLVAALNGENGGGLEVSRIIDNCRYY  184

Query  162  ARDFTNLSFHFVKRSANKVAHELAREAMF  76
                 N     + R AN  AH LA  A +
Sbjct  185  LILLNNSVVRHIYREANNGAHRLAHFASY  213



>ref|XP_009378422.1| PREDICTED: uncharacterized protein LOC103966921 [Pyrus x bretschneideri]
Length=377

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 86/206 (42%), Gaps = 40/206 (19%)
 Frame = -1

Query  699  WVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQL  520
            W+      LS +    L+ + W +W  R E +WN                  EWQ  +  
Sbjct  180  WLAHMAQLLSKDSFELLLVLLWSIWKVRKEFLWN------------------EWQKLD--  219

Query  519  shhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDG  340
                               GW+K N D   D      G+G+V+ ++ G+F+AA  +  +G
Sbjct  220  ------------------FGWIKCNLDVVWDEIGLHGGIGIVVRNSEGEFIAAMVVWENG  261

Query  339  LCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAIN--STSLCSSFDLIINDIRE  166
            +   + AEA+  R    + +    ++VQ E D + VI AI    T+    +  +  D R+
Sbjct  262  IRSVLHAEAVVARATAVFTRQWSTEQVQGEGDALMVISAIQNEGTAHQGPYGHLFADTRQ  321

Query  165  IARDFTNLSFHFVKRSANKVAHELAR  88
            I + F   +  F +R  NKVAH LAR
Sbjct  322  ILQSFKQWNVSFGRRDTNKVAHHLAR  347



>ref|XP_009787297.1| PREDICTED: uncharacterized protein LOC104235275 [Nicotiana sylvestris]
Length=201

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 101/231 (44%), Gaps = 35/231 (15%)
 Frame = -1

Query  699  WVELQFNSLSDNELCKLISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQL  520
            W   + ++L+  E+ + I ICW++W+ RN  +WN    +   ++  A+S++ EW +    
Sbjct  4    WFNKRNHTLNKKEIEEAIMICWEIWNYRNGVIWNQRTSTVDRILDKAISFINEWPN----  59

Query  519  shhqshvshqVETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDG  340
             +     + + + W  P    LK N D + +  +     G+V+ D + +F+  +S     
Sbjct  60   -YAHGQDNEENQKWKPPDGLALKCNIDASFNLATGEARAGMVVRDRHSEFLRGRSTYIGA  118

Query  339  LCLPMEAEAIAIREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIA  160
                M AEA+A++EAL WLK L  D  +I                            E+ 
Sbjct  119  TFSSMMAEALAVKEALSWLK-LHYDDTKI----------------------------ELE  149

Query  159  RDFTNLSFHFVKRSANKVAHELAREAMFKADCMVCVSVPFPCIAHSLELDF  7
             D   +  H++ RSAN+VA  LAR A   +  M   + P   I  +L  D 
Sbjct  150  MDSLFVKLHWI-RSANQVAQALARVADSMSGSMEWNASPPSFIVDALYFDL  199



>gb|EEC73134.1| hypothetical protein OsI_07152 [Oryza sativa Indica Group]
Length=647

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 75/135 (56%), Gaps = 3/135 (2%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLC-LPMEAEAIAI  304
            WS+P  GW+KLN D +        G+G VL +++G+ + + +  + G C   +E+E IA 
Sbjct  476  WSRPKPGWMKLNIDGSYGPQDGRGGIGAVLRESFGRVIFS-ACGFIGRCNGALESELIAC  534

Query  303  REALKWLKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREIARDFTNLSFHFV  127
            R+ L       L  + +ESDC+++IQ +NS   L S+   I+ +IR +      +SF  V
Sbjct  535  RDGLNLALQWTLLPIAVESDCLEIIQLLNSKEKLLSAEGFIVREIRFLMTGTKEVSFAKV  594

Query  126  KRSANKVAHELAREA  82
             R+ N+V+H LA + 
Sbjct  595  HRNQNRVSHFLANKG  609



>ref|XP_010430818.1| PREDICTED: uncharacterized protein LOC104715064 [Camelina sativa]
Length=392

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 98/199 (49%), Gaps = 5/199 (3%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLs-----hhqshvshqVETW  478
            I W++W +RN+ ++N I   +  V+  A   ++EW +A Q S      +   V      W
Sbjct  194  IGWQIWKSRNDLIFNKITWETSSVLLKATDDVVEWLAATQPSIQRPPRNSPTVHSPSSQW  253

Query  477  SKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIRE  298
            + P    +K+N D +  S++  +G+G ++    G ++ ++S        P+  E +A+  
Sbjct  254  TLPTTEVVKVNFDGSFHSHNGSIGVGWIIHGDKGTYLLSRSSKLKQASNPLWTERLALLH  313

Query  297  ALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRS  118
            A++        KV +E DC  +   ++  +   + + ++ DIR  A  F  +SF  V+R 
Sbjct  314  AIQSTWCCGYRKVILEGDCKALDDLLHRRTTSITMENLLVDIRSWADLFAEISFSLVRRE  373

Query  117  ANKVAHELAREAMFKADCM  61
             N+VA +LA+ A ++ + +
Sbjct  374  CNQVADKLAKSAHYQPETI  392



>emb|CDX98755.1| BnaA03g45400D [Brassica napus]
Length=354

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 97/191 (51%), Gaps = 11/191 (6%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            I W +W ARN+ ++NN V +  +V++ A++   EW +A      QS       T S    
Sbjct  166  IVWALWTARNKLIFNNKVYTVEEVITHAVAAAREWLNAQSKEQRQSPHPQACRTTSPQEA  225

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCL---PMEAEAIAIREAL  292
                + +D A   +SR  G+G  +    G+ +  +S+     C    P+ AE +A+REA+
Sbjct  226  ---VIQTDAAWKVDSRTAGLGWSI-RKTGETLNFQSVN----CFVSSPLIAEGLAMREAV  277

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
            K  K L L  +++ESD  ++I+A+ S         II+DIR     F  + F ++ R+ N
Sbjct  278  KKCKELGLRHIRLESDSAQLIKALRSKLEPPEIYGIISDIRINCLAFETVYFSWIPRAKN  337

Query  111  KVAHELAREAM  79
             VA  LA++A+
Sbjct  338  SVADGLAKQAL  348



>ref|XP_008367209.1| PREDICTED: uncharacterized protein LOC103430850 [Malus domestica]
Length=174

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = -1

Query  456  LKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKS  277
            +K N D A D      G G+V+ ++ G F+AAK+I  +G+   + AEA   R  + +L+ 
Sbjct  33   IKCNFDGAWDEKGSVGGFGIVVRNSEGGFMAAKAIKEEGVRSTLHAEAADARAVMLFLRK  92

Query  276  LQLDKVQIESDCIKVIQAIN--STSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
               ++VQ+  D + V  AI     +L   +  +  D R++ + F      F +R  NKV 
Sbjct  93   WGTERVQVAGDALLVTSAIQNAGAALSGHYGQLFEDTRQLLQGFKQWKVTFGRRETNKVV  152

Query  102  HELAR  88
            H LAR
Sbjct  153  HRLAR  157



>ref|XP_010456726.1| PREDICTED: uncharacterized protein LOC104738219 [Camelina sativa]
Length=308

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 87/188 (46%), Gaps = 1/188 (1%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            I W +W  RN+ V+    I+S DVVS A++Y  EW  A++LS        +  T S    
Sbjct  89   ILWILWKTRNKLVFEQKSIASMDVVSQAVAYAREWWIAHELSIKTPPSQLRQATRSVS-A  147

Query  462  GWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWL  283
               +  SD A +  ++  G+G V  D   Q     S     +   + AEA+A+  AL+  
Sbjct  148  DLTRCFSDAAWNEETKTAGLGWVFLDPITQVETKGSDTATHVNSSLIAEALALNRALQHA  207

Query  282  KSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVA  103
              L   K    SD   +I+A N          I++DI E +  F  +SF FV R  N+ A
Sbjct  208  SDLGYRKTSFASDSQTLIKATNLEIQHKEIHGILHDILERSLQFEEISFTFVSREMNRKA  267

Query  102  HELAREAM  79
             E+A+ A+
Sbjct  268  DEIAKNAL  275



>gb|KHN34964.1| hypothetical protein glysoja_004730, partial [Glycine soja]
Length=131

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 55/118 (47%), Gaps = 5/118 (4%)
 Frame = -1

Query  411  MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSLQLDKVQIESDC---  241
             G+G+ L D    +V A +    G   P E EA A+   + W+K L L  V IE+DC   
Sbjct  5    FGVGMGLRDCNRNYVKAMTSIVSGTPTPNEVEACALHSTIIWIKRLGLSNVVIETDCKTP  64

Query  240  IKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHELAREAMFKAD  67
            +   QA    S+   F +I N  R++    +N    FVKR  N V H L R + F  +
Sbjct  65   VDCFQADTKNSI--DFHVIFNSCRDLLSPISNFRVSFVKRHVNHVTHNLTRTSRFYVN  120



>ref|XP_009113016.1| PREDICTED: uncharacterized protein LOC103838337 [Brassica rapa]
Length=1257

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 111/257 (43%), Gaps = 18/257 (7%)
 Frame = -1

Query  786   YAFVSCSLAQKCWDLF----------EHTIPHHCVSFMDWVELQFNSLSDNELCKLISIC  637
             + F  C  AQ  WDL           + +       F   V L  + ++ N    L  +C
Sbjct  1002  HTFFFCPFAQGVWDLIPLQREIVIATDRSFKDAITRFRKAVCLPPSGITGN---ILPWVC  1058

Query  636   WKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqV----ETWSKP  469
             W VW ARN  ++ +   +  +  + AL    EW  A  L   +   + +      +  KP
Sbjct  1059  WTVWTARNTLIFEDQHNTPEETAARALRSAQEWSFAQGLKTQKPRCTEKPHIGCRSNHKP  1118

Query  468   LVGWLKL-NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
             +     +  SD A D +    G+  +  +  G      +   D +  P+  EA+A+R  +
Sbjct  1119  VSSMRVICKSDAAWDKSRNKAGLAWIFTNISGSCNHRGATTQDFVSSPLIEEALALRSGI  1178

Query  291   KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSAN  112
                 ++ +  +Q+ SD + +I+AIN+ +       I+ DI++I+ DF ++SF FV R  N
Sbjct  1179  ISAAAMGVTDLQMLSDNLTLIKAINNDTQNPEIYGIVKDIQKISSDFVDVSFSFVSREFN  1238

Query  111   KVAHELAREAMFKADCM  61
               A  LA+  + ++  M
Sbjct  1239  GEADALAKATLSRSSVM  1255



>ref|XP_010501661.1| PREDICTED: uncharacterized protein LOC104778957 [Camelina sativa]
Length=226

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 88/196 (45%), Gaps = 12/196 (6%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVET----WS  475
            I W++ + RN+ V+N    ++HD V  AL    EW   N+  H  +       T    W 
Sbjct  24   ILWRLMNCRNDYVFNGKDFNAHDTVEKALEDADEWNQRNESEHSTNEHPLPRRTEDAKWE  83

Query  474  KPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQ--FVAAKSIPWDGLCL--PMEAEAIA  307
             P   W+K N+D          G G VL + YG   +V A++I     C    ME E  A
Sbjct  84   PPPKDWVKCNTDGTWSRAGTISGTGWVLRNEYGDGLWVGAQAI----RCAISVMEVELEA  139

Query  306  IREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFV  127
            +R A+  +  L   +V  ESD + ++  +NS  +      ++ DI+ +   F      ++
Sbjct  140  MRAAISSMLRLNYGRVIFESDSLGMVNLLNSEEIWPISAPLLQDIKSLLPSFQAFQMVYM  199

Query  126  KRSANKVAHELAREAM  79
             R  N VA  +A+E++
Sbjct  200  PRVCNNVADRIAKESL  215



>ref|XP_010513219.1| PREDICTED: uncharacterized protein LOC104789182 [Camelina sativa]
Length=1754

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 54/195 (28%), Positives = 93/195 (48%), Gaps = 7/195 (4%)
 Frame = -1

Query  648   ISICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVE---TW  478
             I I W++W +RN   +     ++ +VVS A     EW  + ++                W
Sbjct  1536  IWIQWRLWKSRNAYQFEGKNQNAKEVVSRAKDDEEEWNLSKEMRSKPPIAPRPDSCNIKW  1595

Query  477   SKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQ--FVAAKSIPWDGLCLPMEAEAIAI  304
               P +GW+K N D A  S+S   G+G VL D   +  ++ A+++P   +  P++ E   +
Sbjct  1596  IPPPMGWVKCNVDGAWRSDSEQCGIGWVLRDEQKKVIWLGARALP--RVNKPLDVEVEGL  1653

Query  303   REALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVK  124
             R A+  L  +Q  KV  E+D   V+  I   +  + +  II DI ++++ F  +   F  
Sbjct  1654  RWAMLSLARIQYPKVIFETDSQLVLSLIKGNTESNHYAPIIQDINQLSQRFEKVKMVFTY  1713

Query  123   RSANKVAHELAREAM  79
             R  N VA  +A+EA+
Sbjct  1714  REGNGVADRVAKEAL  1728



>ref|XP_007198863.1| hypothetical protein PRUPE_ppa018328mg [Prunus persica]
 gb|EMJ00062.1| hypothetical protein PRUPE_ppa018328mg [Prunus persica]
Length=161

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = -1

Query  471  PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
            PL  + K+N D AL +N    G+G+V+ D   + +AA + P  G+  P   E  AIR  L
Sbjct  2    PLTQFFKINVDGALKTNDSMRGLGVVIRDDCEELIAATTKPVCGMFTPNITELFAIRFGL  61

Query  291  KWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFD-LIINDIREIARDFTNLSFHFVKRSA  115
            +    L L  + +ESD    IQ         S+D +++N+I+ +A  F +    F  R+ 
Sbjct  62   QLAMDLGLQHIYLESDAQAAIQMAFQCDADLSYDGILVNEIQVLANSFHSCFGKFRPRTC  121

Query  114  NKVAHELA  91
            N VAH LA
Sbjct  122  NHVAHSLA  129



>ref|XP_010666306.1| PREDICTED: uncharacterized protein LOC104883473 [Beta vulgaris 
subsp. vulgaris]
Length=1322

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 108/244 (44%), Gaps = 14/244 (6%)
 Frame = -1

Query  792   LFYAFVSCSLAQKCWDLFEHTIPHHCVSFMDWVELQF---NSLSDNELCKLISICWKVWD  622
             + +A   CS A+  W++       +      + EL     + LS ++L  + S+ W  W 
Sbjct  1056  IHHALFECSFAKAIWEVSPFVALLNMAPTSSFAELFIWLRDKLSSDDLRTVCSLAWASWY  1115

Query  621   ARNEKVWNNIVISSHDVVSGALSYLLEWQ-SANQLshhqshvshqVETWSKPLVGWLKLN  445
              RN+ ++    + +  V S  +  + ++   A ++    + +     +W +P  G +K N
Sbjct  1116  CRNKFIFEQQSVEASVVASNFVKLVDDYGLYAKKVLRGSTTMCTSEVSWQRPPAGLIKAN  1175

Query  444   SDEALDSNSR*MGMGLVLWDAYGQFVAAK----SIPWDGLCLPMEAEAIAIREALKWLKS  277
              D  +  N   +G+G+V+ D+ G+ V       +  WD       AEA+A   A++  + 
Sbjct  1176  FDAHVSPNGE-IGLGVVVRDSSGRIVVLGVRRMAASWDA----STAEAMAALFAVELAQR  1230

Query  276   LQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAH  100
                  V +E D + VI A+ N     S    I NDI  +   F   SF  +KR+ N VAH
Sbjct  1231  FGYGNVVVEGDSLMVISALKNKLPGGSPIFNIFNDIGRLCVSFNAFSFSHIKRAGNVVAH  1290

Query  99    ELAR  88
              LAR
Sbjct  1291  LLAR  1294



>ref|XP_010495244.1| PREDICTED: uncharacterized protein LOC104772312 [Camelina sativa]
Length=1200

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 96/224 (43%), Gaps = 14/224 (6%)
 Frame = -1

Query  642   ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEW--------QSANQLshhqshvshqV  487
             I WK+W +RN+ ++  I  +   ++  A     EW        +   Q+           
Sbjct  978   ILWKIWTSRNKLIFQKINHTWQRLLREAKQETDEWLAIIPPPSRVNPQVPCSTISSKRNS  1037

Query  486   ETWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIA  307
               W KP  GW+K N D +     R    G ++ D  G F  A  +    +    EAE  +
Sbjct  1038  SNWQKPPYGWVKCNYDGSFLDEDRQATSGWIVRDDQGHFKEAGQVTGAKVKSAFEAECQS  1097

Query  306   IREALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLI--INDIREIARDFTNLSFH  133
             +  A++         V  E DC  ++ AIN++SLC  FD+   I +I+  A  F N+ F 
Sbjct  1098  LIFAMQQTWRNGYTNVIFEGDCQSLVTAINNSSLC--FDIYNWIQEIKGWATRFNNVVFR  1155

Query  132   FVKRSANKVAHELAR-EAMFKADCMVCVSVPFPCIAHSLELDFY  4
             +  R +N +A +LA+ +     +  +  S+PF CI       FY
Sbjct  1156  WTSRQSNHLADQLAKVQRERNIESSLYFSIPF-CILADFNSVFY  1198



>ref|XP_009138122.1| PREDICTED: uncharacterized protein LOC103862171 [Brassica rapa]
Length=251

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 96/197 (49%), Gaps = 8/197 (4%)
 Frame = -1

Query  642  ICWKVWDARNEKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKPLV  463
            I W +W ARN+ V+     S  D ++ A+    EW     ++  +          ++P +
Sbjct  52   ILWTIWKARNKFVFEGFSASPEDTLTSAIVLAREWS----INCKEERSGPAGRVRAEPTM  107

Query  462  GWLKL--NSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALK  289
                L   +D A +S +   G+G  +     Q    +   W+ +  P+ AE +A+REA+ 
Sbjct  108  QGSHLISRTDGAWNSTNNVAGLGWCILSPLQQQEFHQR--WEFVTSPLMAEGLALREAVL  165

Query  288  WLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKRSANK  109
              ++  L +V+ ESD  ++I  ++S +  +    +++DI  +  +F ++SF ++ R  N 
Sbjct  166  SCRNQGLREVRFESDSSQLINCVSSGAGVAELHTVVSDILSLTEEFRSVSFVWISREKNA  225

Query  108  VAHELAREAMFKADCMV  58
            +A  LA+ AMF  + +V
Sbjct  226  LADSLAKSAMFVVEPLV  242



>ref|XP_010666976.1| PREDICTED: uncharacterized protein LOC104884079 [Beta vulgaris 
subsp. vulgaris]
Length=1268

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 114/256 (45%), Gaps = 31/256 (12%)
 Frame = -1

Query  750   WDLFEHTIPHHCVSFMD-----WVELQFNSLSDNE----LCKLISICWK-----------  631
             W   EH   +H + F       W++     + DN     +C L++  WK           
Sbjct  993   WGCGEHESTYHAIFFCPRFEELWMDSGCARMRDNSDCDTMCDLVAK-WKQLDSRIRVKGP  1051

Query  630   -----VWDARNEKVWNNIVISSHDVVSGALSYLLE--WQSANQLshhqshvshqVETWSK  472
                  +W  RN KV+NN  I+ + V+   +  L+E   + A  +   Q  V+  +  W+ 
Sbjct  1052  FLMLCIWGERNNKVFNN-KITPNSVLLRRVDRLVEEYGKYAVNIYRRQGVVTQSLRYWNP  1110

Query  471   PLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREAL  292
             P  G  K+N D +L +    +G+G++  D  G    A +        P  AEA AI   +
Sbjct  1111  PSPGCWKINVDASLATEG-WVGLGIIARDHLGGVRFATTRRTRAFWSPEIAEAKAIEMGV  1169

Query  291   KWLKSLQLDKVQIESDCIKVIQAINSTSL-CSSFDLIINDIREIARDFTNLSFHFVKRSA  115
             +  K   L  V IESDC+ VI  +  TS   S  D ++++I  ++ +F +L +  VKR  
Sbjct  1170  RLGKRFGLVNVVIESDCLTVINRLQKTSFYLSDLDNVLSNIFSMSSNFHSLGWSHVKRDG  1229

Query  114   NKVAHELAREAMFKAD  67
             N V+H LA+   F  +
Sbjct  1230  NFVSHHLAKLVPFGVE  1245



>ref|XP_012085846.1| PREDICTED: uncharacterized protein LOC105644944 [Jatropha curcas]
Length=182

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 78/157 (50%), Gaps = 3/157 (2%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W  P VG  K+N D  +  +     +G V+ +    FV+A +    G   P  AEA A+R
Sbjct  27   WFPPPVGTFKINFDATIFPSIGHGAVGAVISNCNRGFVSAATSSLQGCSSPAVAEAQALR  86

Query  300  EALKWL-KSLQLDKVQIESDCIKVIQAI-NSTSLCSSFDLIINDIREIARDFTNLSFHFV  127
              L WL  S    K+QIE+DC++V  A+ NS    S F ++I++ + +     N++  ++
Sbjct  87   TVLSWLISSYSSLKIQIETDCLQVYCAMRNSVQDWSEFGVVISECKLLLVQLPNVTLAWI  146

Query  126  KRSANKVAHELAREAMFKADCMVCVSVPFPCIAHSLE  16
            +R AN +AH LA+     A C     +   CIA  L 
Sbjct  147  RRQANDIAHVLAKSVPHGA-CFRTWDIVPTCIARFLS  182



>ref|XP_008377029.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=443

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 109/246 (44%), Gaps = 20/246 (8%)
 Frame = -1

Query  771  CSLAQKCW-----DLFEHTIPHHCVSFMDW--VELQFNSLSDNELCKLISICWKVWDARN  613
            C  A+  W          +IP  C S  +W    LQ + L  + +C ++   W++W  RN
Sbjct  178  CPFARATWFATPCSFLVDSIP--CGSVKEWFFTLLQNHHLDFDFMCMVV---WQLWQERN  232

Query  612  EKVWNNIVISSHDVVSGALSYLLEWQSANQLshhqshvshqVETWSKP---LVG----WL  454
            ++ W   + S   V    +++L E+Q    LS+       + E   +    L G    W 
Sbjct  233  DRTWKGKLGSPAVVAQRVVAWLQEFQGVANLSNGVPQRYTRDEHMVRGASVLEGVDENWA  292

Query  453  KLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIREALKWLKSL  274
            +L+ D A     R    G VL D  G F+AA++     +   ++AE +AI+  +     L
Sbjct  293  RLHVDGATKLEVRVGRAGAVLRDGQGSFLAAEACFLPMVYSALQAEMLAIKHGVDLALQL  352

Query  273  QLDKVQIESDCIKVIQAINS-TSLCSSFDLIINDIREIARDFTNLSFHFVKRSANKVAHE  97
               KV + SD  + I  +N+      + DL+  D+   A  FT   F FV R+ N +AH 
Sbjct  353  VYQKVLVHSDSSQAISIMNTCVDRALAMDLLAGDVLRSAYLFTASKFIFVSRNNNSIAHC  412

Query  96   LAREAM  79
            LA+ A+
Sbjct  413  LAKVAL  418



>ref|XP_003607370.1| LCR-like protein [Medicago truncatula]
Length=141

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 65/146 (45%), Gaps = 33/146 (23%)
 Frame = -1

Query  480  WSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEAEAIAIR  301
            W  P   +LK N D A+    R  G+G+ + D+ G F+ A +            +A+ +R
Sbjct  17   WQPPDADYLKCNVDAAIFEEQRSFGIGICIRDSRGNFIKAST------------KAMGLR  64

Query  300  EALKWLKSLQLDKVQIESDCIKVIQAINSTSLCSSFDLIINDIREIARDFTNLSFHFVKR  121
            +A+ WL  L L KVQIE D                        R + + F+N   +FV+ 
Sbjct  65   DAILWLGQLGLSKVQIELD---------------------RKCRSLLQQFSNFKINFVRI  103

Query  120  SANKVAHELAREAMFKADCMVCVSVP  43
             AN VAH LARE+   A   V  S+P
Sbjct  104  QANYVAHGLARESKLYARHHVFDSIP  129



>gb|EAZ03196.1| hypothetical protein OsI_25347 [Oryza sativa Indica Group]
Length=858

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 109/260 (42%), Gaps = 25/260 (10%)
 Frame = -1

Query  786  YAFVSCSLAQKCWDLFEHT-----IPHHCVSFMDWVELQFNSLSDNELCKLISICWKVWD  622
            +A   C  A+  W    ++     +P    +  DW+  Q   L + +    + + W+ W 
Sbjct  575  HALCRCPQAKFLWLALRNSNDIGFVPDGRWTGSDWILNQLEILVEPDRVMFLLLLWRAWH  634

Query  621  ARNEKVWNN---IVISSHDVVSGALSYLLEWQS------------ANQLshhqshvshqV  487
             RNE V       + +SH  +    + LLE +               Q+  H      Q 
Sbjct  635  IRNEVVHGKHAPPIEASHRFIVSYHTSLLEIKQFPKADLTKGKHVIGQMVGHSGRHQRQP  694

Query  486  E----TWSKPLVGWLKLNSDEALDSNSR*MGMGLVLWDAYGQFVAAKSIPWDGLCLPMEA  319
            E    TW KP  GW+KLN D +   +    G+G +L ++ G+ V A     +     +EA
Sbjct  695  ETLPYTWKKPDTGWMKLNVDGSFQEHDGSGGIGAILRNSAGEVVFASCGSMNRCGGALEA  754

Query  318  EAIAIREALKWLKSLQLDKVQIESDCIKVIQAINST-SLCSSFDLIINDIREIARDFTNL  142
            E +A R+ L  +    L  + IESDC++ IQ I S     S    +I +I+ +     ++
Sbjct  755  ELLACRDGLTLVLQWTLLPIVIESDCLQAIQLIQSKEEERSDLAFLIREIKHLMAGNRDI  814

Query  141  SFHFVKRSANKVAHELAREA  82
                + R+ N V+H LA + 
Sbjct  815  VIMKIHRNQNSVSHALAYKG  834



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1710808110896