BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1165

Length=974
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757722.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    201   3e-55   Nicotiana sylvestris
ref|XP_009757720.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    201   4e-55   Nicotiana sylvestris
ref|XP_006363554.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    197   1e-53   Solanum tuberosum [potatoes]
ref|XP_010319484.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    195   3e-53   Solanum lycopersicum
ref|XP_004237064.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    195   4e-53   Solanum lycopersicum
ref|XP_009598395.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    192   4e-52   Nicotiana tomentosiformis
ref|XP_009598401.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    192   4e-52   Nicotiana tomentosiformis
ref|XP_009760348.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    175   8e-46   Nicotiana sylvestris
ref|XP_006348640.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    173   4e-45   Solanum tuberosum [potatoes]
ref|XP_009609153.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    171   1e-44   Nicotiana tomentosiformis
emb|CDP00486.1|  unnamed protein product                                171   2e-44   Coffea canephora [robusta coffee]
ref|XP_004239016.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    168   2e-43   Solanum lycopersicum
ref|XP_002514582.1|  inositol or phosphatidylinositol kinase, put...    167   5e-43   Ricinus communis
ref|XP_002316001.1|  phosphatidylinositol 3- and 4-kinase family ...    165   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011009383.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    164   3e-42   Populus euphratica
ref|XP_006484264.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    160   1e-40   Citrus sinensis [apfelsine]
gb|KDO70262.1|  hypothetical protein CISIN_1g006461mg                   160   1e-40   Citrus sinensis [apfelsine]
ref|XP_006437843.1|  hypothetical protein CICLE_v10030931mg             160   1e-40   Citrus clementina [clementine]
ref|XP_011070894.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    159   3e-40   Sesamum indicum [beniseed]
ref|XP_007045737.1|  Phosphoinositide 4-kinase gamma 7, gamma 7,u...    158   5e-40   
ref|XP_002267025.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    157   1e-39   Vitis vinifera
gb|KJB50515.1|  hypothetical protein B456_008G175000                    156   4e-39   Gossypium raimondii
ref|XP_008243790.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    155   7e-39   Prunus mume [ume]
ref|XP_012080475.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    153   3e-38   Jatropha curcas
gb|KDP31411.1|  hypothetical protein JCGZ_11787                         152   4e-38   Jatropha curcas
ref|XP_007226954.1|  hypothetical protein PRUPE_ppa002719mg             152   1e-37   Prunus persica
ref|XP_011101959.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    148   2e-37   Sesamum indicum [beniseed]
gb|KJB80446.1|  hypothetical protein B456_013G098100                    149   9e-37   Gossypium raimondii
ref|XP_011079569.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    149   9e-37   Sesamum indicum [beniseed]
gb|AJR30359.1|  phosphatidylinositol 4-kinase 2                         149   1e-36   Gossypium hirsutum [American cotton]
gb|ADK78996.1|  phosphatidylinositol 4-kinase                           148   2e-36   Gossypium barbadense [Egyptian cotton]
gb|KEH17526.1|  phosphatidylinositol 3- and 4-kinase                    147   5e-36   Medicago truncatula
ref|XP_010091640.1|  putative phosphatidylinositol 4-kinase type ...    146   8e-36   Morus notabilis
ref|XP_004490265.1|  PREDICTED: probable phosphatidylinositol 4-k...    146   8e-36   Cicer arietinum [garbanzo]
ref|XP_008339749.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    145   1e-35   
ref|XP_009355550.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    146   1e-35   
gb|AJR30358.1|  phosphatidylinositol 4-kinase 1                         144   5e-35   Gossypium hirsutum [American cotton]
ref|XP_007153462.1|  hypothetical protein PHAVU_003G037500g             143   1e-34   Phaseolus vulgaris [French bean]
ref|XP_009356466.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    143   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_011021071.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    143   1e-34   Populus euphratica
emb|CBI27403.3|  unnamed protein product                                140   3e-34   Vitis vinifera
ref|XP_003518796.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    140   1e-33   Glycine max [soybeans]
ref|XP_011657466.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    140   2e-33   Cucumis sativus [cucumbers]
ref|XP_004297194.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    139   3e-33   Fragaria vesca subsp. vesca
ref|XP_004509953.1|  PREDICTED: probable phosphatidylinositol 4-k...    139   4e-33   Cicer arietinum [garbanzo]
ref|XP_008445412.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    138   6e-33   Cucumis melo [Oriental melon]
gb|KHN29938.1|  Putative phosphatidylinositol 4-kinase type 2-beta      138   6e-33   Glycine soja [wild soybean]
ref|XP_006573180.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    138   7e-33   Glycine max [soybeans]
ref|XP_008367029.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    136   3e-32   
ref|XP_010066800.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    135   6e-32   Eucalyptus grandis [rose gum]
ref|XP_002311415.2|  phosphatidylinositol 3- and 4-kinase family ...    134   2e-31   
ref|XP_010261269.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    131   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_003628725.1|  Phosphatidylinositol kinase family-like protein    130   3e-30   Medicago truncatula
gb|AFK40506.1|  unknown                                                 120   8e-30   Lotus japonicus
ref|XP_010065365.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    129   1e-29   Eucalyptus grandis [rose gum]
ref|XP_004135137.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    127   7e-29   Cucumis sativus [cucumbers]
ref|XP_008446479.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    126   9e-29   Cucumis melo [Oriental melon]
ref|XP_010460328.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    124   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006306992.1|  hypothetical protein CARUB_v10008568mg             123   1e-27   Capsella rubella
ref|NP_564242.1|  putative phosphatidylinositol 4-kinase type 2-beta    123   1e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDY16149.1|  BnaA09g28830D                                          123   1e-27   Brassica napus [oilseed rape]
ref|XP_009115351.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    122   2e-27   Brassica rapa
ref|XP_010257911.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    122   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010499062.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    122   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010257910.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    122   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_007032901.1|  Phosphoinositide 4-kinase gamma 7, gamma 7,u...    122   2e-27   
ref|XP_010477874.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    122   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006415909.1|  hypothetical protein EUTSA_v10007061mg             121   6e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010681152.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    121   7e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009109913.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    120   1e-26   Brassica rapa
emb|CDY36079.1|  BnaA08g19690D                                          120   1e-26   Brassica napus [oilseed rape]
ref|XP_006430968.1|  hypothetical protein CICLE_v10011271mg             120   1e-26   Citrus clementina [clementine]
gb|KDO72317.1|  hypothetical protein CISIN_1g006592mg                   120   2e-26   Citrus sinensis [apfelsine]
ref|XP_006482449.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    120   2e-26   Citrus sinensis [apfelsine]
gb|KDO72313.1|  hypothetical protein CISIN_1g006592mg                   120   2e-26   Citrus sinensis [apfelsine]
ref|XP_006482445.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    119   2e-26   Citrus sinensis [apfelsine]
emb|CDX85013.1|  BnaC05g20420D                                          119   3e-26   
ref|XP_002890668.1|  phosphatidylinositol 3-and 4-kinase family p...    119   3e-26   
emb|CDY34563.1|  BnaC03g56630D                                          118   6e-26   Brassica napus [oilseed rape]
gb|EYU22584.1|  hypothetical protein MIMGU_mgv1a002776mg                116   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_008379465.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    115   1e-24   Malus domestica [apple tree]
ref|XP_008379464.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    114   1e-24   Malus domestica [apple tree]
ref|XP_008230310.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    114   1e-24   Prunus mume [ume]
ref|XP_007214928.1|  hypothetical protein PRUPE_ppa002721mg             114   2e-24   
gb|KCW62794.1|  hypothetical protein EUGRSUZ_G00381                     114   2e-24   Eucalyptus grandis [rose gum]
ref|XP_011467854.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    112   8e-24   Fragaria vesca subsp. vesca
ref|XP_008353512.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    112   9e-24   
ref|XP_009373758.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    111   1e-23   
gb|KHF99882.1|  hypothetical protein F383_17303                         110   3e-23   Gossypium arboreum [tree cotton]
gb|KJB48256.1|  hypothetical protein B456_008G060400                    110   3e-23   Gossypium raimondii
dbj|BAF01661.1|  hypothetical protein                                   102   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532452.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    104   3e-21   Tarenaya hassleriana [spider flower]
ref|XP_006290717.1|  hypothetical protein CARUB_v10016815mg             104   3e-21   
ref|XP_006290718.1|  hypothetical protein CARUB_v10016815mg             103   4e-21   Capsella rubella
ref|XP_010032574.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    103   6e-21   Eucalyptus grandis [rose gum]
ref|NP_973413.1|  phosphoinositide 4-kinase gamma 7                     102   1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514157.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    102   1e-20   
ref|XP_010502409.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    102   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010551350.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    102   1e-20   Tarenaya hassleriana [spider flower]
ref|XP_002875236.1|  phosphatidylinositol 3-and 4-kinase family p...    102   1e-20   
ref|XP_007037675.1|  Phosphoinositide 4-kinase gamma 7, gamma 7,u...    102   2e-20   
ref|NP_565307.1|  phosphoinositide 4-kinase gamma 7                     102   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002267822.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    102   2e-20   Vitis vinifera
ref|XP_002281918.2|  PREDICTED: phosphatidylinositol 4-kinase gam...    102   2e-20   
ref|XP_010425186.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    101   4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010942262.1|  PREDICTED: phosphatidylinositol 4-kinase gam...    100   6e-20   Elaeis guineensis
ref|XP_009407937.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  99.0    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407938.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  99.0    2e-19   
ref|XP_010943329.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  98.6    3e-19   Elaeis guineensis
ref|XP_006395665.1|  hypothetical protein EUTSA_v10003797mg           98.2    4e-19   Eutrema salsugineum [saltwater cress]
emb|CBI15360.3|  unnamed protein product                              95.5    1e-18   Vitis vinifera
gb|EYU28896.1|  hypothetical protein MIMGU_mgv1a003628mg              96.7    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_004299269.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  96.3    2e-18   Fragaria vesca subsp. vesca
ref|XP_008797596.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  95.9    2e-18   Phoenix dactylifera
gb|KDP24324.1|  hypothetical protein JCGZ_25620                       95.1    4e-18   Jatropha curcas
ref|XP_012088103.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  95.1    4e-18   Jatropha curcas
ref|XP_009391284.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  95.1    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS72797.1|  hypothetical protein M569_01959                       94.7    6e-18   Genlisea aurea
ref|XP_006373417.1|  hypothetical protein POPTR_0017s13590g           94.4    7e-18   
ref|XP_006485717.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  94.0    8e-18   Citrus sinensis [apfelsine]
ref|XP_010928120.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  94.0    9e-18   Elaeis guineensis
ref|XP_008788927.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  94.0    1e-17   Phoenix dactylifera
emb|CDX83526.1|  BnaC07g22660D                                        92.4    3e-17   
ref|XP_009152139.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  92.4    3e-17   Brassica rapa
emb|CBI16921.3|  unnamed protein product                              92.0    3e-17   Vitis vinifera
ref|XP_006440828.1|  hypothetical protein CICLE_v10019356mg           92.0    3e-17   
ref|XP_003621581.1|  Phosphatidylinositol 4-kinase type 2-beta        92.0    4e-17   Medicago truncatula
ref|XP_007139389.1|  hypothetical protein PHAVU_008G025300g           91.3    7e-17   Phaseolus vulgaris [French bean]
ref|XP_008809667.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  91.3    7e-17   Phoenix dactylifera
emb|CDY48067.1|  BnaA06g33610D                                        90.9    9e-17   Brassica napus [oilseed rape]
ref|XP_008240066.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  90.9    1e-16   
ref|XP_009381646.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  90.9    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003531889.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  90.1    2e-16   
ref|XP_009410293.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  90.1    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB08119.1|  hypothetical protein B456_001G066500                  89.4    3e-16   Gossypium raimondii
ref|XP_010528004.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  89.0    4e-16   Tarenaya hassleriana [spider flower]
ref|XP_006665104.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  89.0    5e-16   Oryza brachyantha
ref|XP_010528002.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  88.6    5e-16   Tarenaya hassleriana [spider flower]
ref|XP_010101631.1|  putative phosphatidylinositol 4-kinase type ...  88.2    7e-16   
gb|KHN45095.1|  Putative phosphatidylinositol 4-kinase type 2-beta    88.6    7e-16   Glycine soja [wild soybean]
gb|EEC80404.1|  hypothetical protein OsI_22556                        87.8    9e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001057397.1|  Os06g0283400                                     87.8    9e-16   
gb|KHG01930.1|  hypothetical protein F383_21230                       87.4    1e-15   Gossypium arboreum [tree cotton]
ref|XP_003552619.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  87.0    2e-15   
gb|KHN13767.1|  Putative phosphatidylinositol 4-kinase type 2-beta    87.0    2e-15   Glycine soja [wild soybean]
ref|XP_004491949.1|  PREDICTED: probable phosphatidylinositol 4-k...  86.7    2e-15   Cicer arietinum [garbanzo]
ref|XP_007210230.1|  hypothetical protein PRUPE_ppa015565mg           86.7    2e-15   
gb|ABR25357.1|  phosphatidylinositol 3- and 4-kinase family protein   80.1    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010694275.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  84.7    9e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010495469.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  84.7    9e-15   Camelina sativa [gold-of-pleasure]
dbj|BAJ95204.1|  predicted protein                                    84.7    9e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009337827.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  84.3    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_002448727.1|  hypothetical protein SORBIDRAFT_06g032160        84.0    2e-14   Sorghum bicolor [broomcorn]
ref|XP_010554259.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  83.6    2e-14   
ref|NP_563930.1|  phosphatidylinositol 4-kinase gamma 6               83.2    3e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAF81291.1|AC027656_8  Strong similarity to an unknown protein...  83.2    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892764.1|  phosphatidylinositol 3-and 4-kinase family p...  83.2    3e-14   
ref|XP_008393261.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  82.8    4e-14   
gb|ACF22722.1|  phosphatidylinositol kinase family-like protein       81.6    8e-14   Brachypodium distachyon [annual false brome]
ref|XP_010227761.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  82.0    8e-14   
ref|XP_002462528.1|  hypothetical protein SORBIDRAFT_02g027450        81.6    1e-13   Sorghum bicolor [broomcorn]
ref|XP_010476371.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  81.6    1e-13   Camelina sativa [gold-of-pleasure]
gb|EMT25946.1|  Phosphatidylinositol 4-kinase type 2-alpha            81.3    1e-13   
ref|XP_010238261.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  81.3    2e-13   Brachypodium distachyon [annual false brome]
emb|CDY56175.1|  BnaC05g49350D                                        80.9    2e-13   Brassica napus [oilseed rape]
ref|XP_010458817.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  80.9    2e-13   Camelina sativa [gold-of-pleasure]
gb|AEV41104.1|  phosphatidylinositol 3- and 4-kinase family protein   80.9    2e-13   Oryza officinalis
ref|XP_006652988.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  80.5    2e-13   
gb|EEC84748.1|  hypothetical protein OsI_31747                        80.5    2e-13   Oryza sativa Indica Group [Indian rice]
gb|EAZ45098.1|  hypothetical protein OsJ_29736                        80.5    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063457.1|  Os09g0474800                                     80.5    2e-13   
ref|XP_006417104.1|  hypothetical protein EUTSA_v10007082mg           80.1    3e-13   Eutrema salsugineum [saltwater cress]
ref|NP_001288372.1|  uncharacterized protein LOC103632899             79.7    4e-13   Zea mays [maize]
ref|NP_001151804.1|  phosphatidylinositol 3- and 4-kinase family ...  79.7    4e-13   
gb|ACL53462.1|  unknown                                               79.7    4e-13   Zea mays [maize]
emb|CDX98118.1|  BnaA06g08690D                                        78.6    5e-13   
gb|AEV41011.1|  phosphatidylinositol 3- and 4-kinase family protein   79.3    6e-13   Oryza minuta
ref|NP_001054197.1|  Os04g0668700                                     78.6    9e-13   
gb|AEV41058.1|  phosphatidylinositol 3- and 4-kinase family protein   78.6    9e-13   Oryza minuta
gb|EEC78215.1|  hypothetical protein OsI_17848                        78.6    9e-13   Oryza sativa Indica Group [Indian rice]
gb|AEV40961.1|  phosphatidylinositol 3- and 4-kinase family protein   78.6    1e-12   Oryza punctata
gb|EEE61869.1|  hypothetical protein OsJ_16555                        78.6    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960221.1|  PREDICTED: probable phosphatidylinositol 4-k...  77.0    3e-12   Setaria italica
emb|CDO98537.1|  unnamed protein product                              77.0    4e-12   Coffea canephora [robusta coffee]
ref|XP_006307009.1|  hypothetical protein CARUB_v10008594mg           75.9    7e-12   Capsella rubella
ref|XP_006660740.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  75.9    8e-12   Oryza brachyantha
ref|XP_002438242.1|  hypothetical protein SORBIDRAFT_10g010450        75.9    9e-12   Sorghum bicolor [broomcorn]
ref|XP_008670267.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  75.5    1e-11   Zea mays [maize]
ref|XP_004965234.1|  PREDICTED: probable phosphatidylinositol 4-k...  75.1    2e-11   Setaria italica
gb|EMT13521.1|  Phosphatidylinositol 4-kinase type 2-beta             73.2    5e-11   
ref|XP_004957104.1|  PREDICTED: probable phosphatidylinositol 4-k...  73.6    5e-11   Setaria italica
ref|XP_008659457.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  73.2    7e-11   Zea mays [maize]
dbj|BAK02490.1|  predicted protein                                    73.2    7e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT31973.1|  Phosphatidylinositol 4-kinase type 2-beta             72.0    2e-10   
gb|AHF50148.1|  PI4KIIgamma                                           70.5    5e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003580777.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  70.1    6e-10   Brachypodium distachyon [annual false brome]
tpg|DAA61913.1|  TPA: hypothetical protein ZEAMMB73_755135            69.3    8e-10   
ref|XP_004973762.1|  PREDICTED: probable phosphatidylinositol 4-k...  68.9    2e-09   Setaria italica
ref|XP_006844080.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  68.6    2e-09   Amborella trichopoda
ref|XP_010549980.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  66.2    1e-08   Tarenaya hassleriana [spider flower]
ref|NP_001062108.1|  Os08g0489800                                     66.2    1e-08   
ref|XP_003574681.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  64.7    4e-08   Brachypodium distachyon [annual false brome]
ref|XP_002525951.1|  hypothetical protein RCOM_0791550                59.7    5e-08   
ref|XP_009398745.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  63.5    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001757033.1|  predicted protein                                53.9    1e-04   
gb|ACF79538.1|  unknown                                               48.1    5e-04   Zea mays [maize]



>ref|XP_009757722.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X2 [Nicotiana sylvestris]
Length=627

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            CED  Y+  PK+   +FM RN F F  GGNG +PLSKLDES +EEE  EEE +  T  P 
Sbjct  460  CEDAGYDYSPKLISQDFMNRNPFHFPIGGNGCFPLSKLDESIEEEESEEEEEKSFTCVPA  519

Query  793  VTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVS  614
              NN    +  LS SLKNTSLGEKKL  P  SGTKPENGYLA SSSG+RSA+EQLPASVS
Sbjct  520  PANNV-TTMSKLSMSLKNTSLGEKKLKFPKFSGTKPENGYLAGSSSGHRSANEQLPASVS  578

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVKLADM D EWA FLEKF+ELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  579  FVKLADMNDSEWALFLEKFEELLYPAFAKRKSITLGQRQRQRLGTSCQF  627



>ref|XP_009757720.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009757721.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X1 [Nicotiana sylvestris]
Length=639

 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            CED  Y+  PK+   +FM RN F F  GGNG +PLSKLDES +EEE  EEE +  T  P 
Sbjct  472  CEDAGYDYSPKLISQDFMNRNPFHFPIGGNGCFPLSKLDESIEEEESEEEEEKSFTCVPA  531

Query  793  VTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVS  614
              NN    +  LS SLKNTSLGEKKL  P  SGTKPENGYLA SSSG+RSA+EQLPASVS
Sbjct  532  PANNV-TTMSKLSMSLKNTSLGEKKLKFPKFSGTKPENGYLAGSSSGHRSANEQLPASVS  590

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVKLADM D EWA FLEKF+ELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  591  FVKLADMNDSEWALFLEKFEELLYPAFAKRKSITLGQRQRQRLGTSCQF  639



>ref|XP_006363554.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Solanum 
tuberosum]
Length=640

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 126/169 (75%), Gaps = 2/169 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            CED  YE  PK+   +F  RN F    GGNG +PLSKLDES +E E  EE+ +     P 
Sbjct  474  CEDSGYESSPKLISQDFTNRNPFHLPIGGNGCFPLSKLDESIEEVERDEEDEKSFNYVPA  533

Query  793  VTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVS  614
               N  I +  LS SLKNTSLGEKKL  PN SGTKPENGYLA SSSG+RSA+EQLPASV+
Sbjct  534  PARN--IAVSKLSMSLKNTSLGEKKLKYPNISGTKPENGYLASSSSGHRSANEQLPASVT  591

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVK++DM D EW  FLEKF+ELLYPAFAKR+S+T+G++Q+QRLGTSCQF
Sbjct  592  FVKVSDMDDVEWGLFLEKFEELLYPAFAKRKSITLGQRQMQRLGTSCQF  640



>ref|XP_010319484.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X2 [Solanum lycopersicum]
Length=627

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 124/169 (73%), Gaps = 2/169 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            CED  YE  PK    +F  RN F    GGNG +PLSKLDES +E E   E+ +     P 
Sbjct  461  CEDSGYEASPKSIPRDFTNRNPFHLPIGGNGCFPLSKLDESIEEVESDGEDEKSFNYVPA  520

Query  793  VTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVS  614
               N  I +  LS SLKNTSLGEKKL  PN SGTKPENGYLA SSSG+RSA+EQLPASV+
Sbjct  521  PAKN--IAVSKLSMSLKNTSLGEKKLKYPNISGTKPENGYLASSSSGHRSANEQLPASVT  578

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVKL+DM D EW  FL+KF+ELLYPAFAKR+S+T+G++Q+QRLGTSCQF
Sbjct  579  FVKLSDMNDVEWGLFLDKFEELLYPAFAKRKSITLGQRQMQRLGTSCQF  627



>ref|XP_004237064.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like isoform 
X1 [Solanum lycopersicum]
Length=640

 Score =   195 bits (496),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 124/169 (73%), Gaps = 2/169 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            CED  YE  PK    +F  RN F    GGNG +PLSKLDES +E E   E+ +     P 
Sbjct  474  CEDSGYEASPKSIPRDFTNRNPFHLPIGGNGCFPLSKLDESIEEVESDGEDEKSFNYVPA  533

Query  793  VTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVS  614
               N  I +  LS SLKNTSLGEKKL  PN SGTKPENGYLA SSSG+RSA+EQLPASV+
Sbjct  534  PAKN--IAVSKLSMSLKNTSLGEKKLKYPNISGTKPENGYLASSSSGHRSANEQLPASVT  591

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVKL+DM D EW  FL+KF+ELLYPAFAKR+S+T+G++Q+QRLGTSCQF
Sbjct  592  FVKLSDMNDVEWGLFLDKFEELLYPAFAKRKSITLGQRQMQRLGTSCQF  640



>ref|XP_009598395.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009598397.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X1 [Nicotiana tomentosiformis]
Length=639

 Score =   192 bits (489),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            CED   +  PK+   +FM RN F F  GGNG +PLSKLDE+ +EEE  EEE +  T  P 
Sbjct  472  CEDAGCDYSPKLISQDFMNRNPFHFPIGGNGCFPLSKLDENIEEEESEEEEEKSFTSVPA  531

Query  793  VTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVS  614
              NN    +  LS SLK TSLGEKKL  P  SGTKPENGY+A SSSG+RSA+EQLPASVS
Sbjct  532  PANN-ITTMSKLSMSLKYTSLGEKKLKFPKFSGTKPENGYMAGSSSGHRSANEQLPASVS  590

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVKLADM D EWA FLEKF+ELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  591  FVKLADMNDCEWALFLEKFEELLYPAFAKRKSITLGQRQRQRLGTSCQF  639



>ref|XP_009598401.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X2 [Nicotiana tomentosiformis]
Length=627

 Score =   192 bits (488),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            CED   +  PK+   +FM RN F F  GGNG +PLSKLDE+ +EEE  EEE +  T  P 
Sbjct  460  CEDAGCDYSPKLISQDFMNRNPFHFPIGGNGCFPLSKLDENIEEEESEEEEEKSFTSVPA  519

Query  793  VTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVS  614
              NN    +  LS SLK TSLGEKKL  P  SGTKPENGY+A SSSG+RSA+EQLPASVS
Sbjct  520  PANN-ITTMSKLSMSLKYTSLGEKKLKFPKFSGTKPENGYMAGSSSGHRSANEQLPASVS  578

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVKLADM D EWA FLEKF+ELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  579  FVKLADMNDCEWALFLEKFEELLYPAFAKRKSITLGQRQRQRLGTSCQF  627



>ref|XP_009760348.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Nicotiana 
sylvestris]
Length=640

 Score =   175 bits (443),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 124/176 (70%), Gaps = 18/176 (10%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            ED  Y   P MA  +FMTRN FQF FGG NG+  L KLDES +EEE  EE+         
Sbjct  475  EDAGYAFSPNMASEDFMTRNPFQFPFGGGNGRTQLFKLDESIEEEESEEED---------  525

Query  793  VTNNEHIPIPI-------LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADE  635
             T+  ++P P        LS SLKN SLG+KK   PN SGTKPENG LA +SSG+RSA+E
Sbjct  526  -TSFNYVPAPAKNVSESKLSMSLKNISLGDKKQKHPNFSGTKPENGNLARASSGHRSANE  584

Query  634  QLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            QLP S SF+KLADM +EEW  FLEKFQELLYPAF KR+SVTVG++Q+QRLGTSCQF
Sbjct  585  QLPVSSSFLKLADMNEEEWRLFLEKFQELLYPAFDKRKSVTVGQRQIQRLGTSCQF  640



>ref|XP_006348640.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Solanum 
tuberosum]
Length=640

 Score =   173 bits (438),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 123/176 (70%), Gaps = 17/176 (10%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            ED  Y   PKMA  +F++RN FQF FGG NG+  L KLDES +EEE  EEE         
Sbjct  474  EDAGYGFSPKMASEDFVSRNPFQFPFGGGNGRTQLFKLDESIEEEESEEEED--------  525

Query  793  VTNNEHIPIPI-------LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADE  635
             TN  ++P P        LS SLKN SLG+K    P  SGTKPEN YLA SSSG+RSA+E
Sbjct  526  -TNFNYVPAPAKNVAESKLSMSLKNISLGDKNQKHPYFSGTKPENAYLANSSSGHRSANE  584

Query  634  QLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            QLP S SFVKLADM +EEW  FLEKFQELLYPAFAKR+SV +G++Q+QRLGTSCQF
Sbjct  585  QLPVSSSFVKLADMGEEEWRLFLEKFQELLYPAFAKRKSVALGQRQIQRLGTSCQF  640



>ref|XP_009609153.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Nicotiana 
tomentosiformis]
Length=639

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 123/176 (70%), Gaps = 18/176 (10%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            ED  Y+  P MA   FMTRN FQF FGG NG+  L KLDES +EEE  EEE         
Sbjct  474  EDAGYDFGPNMASENFMTRNPFQFPFGGGNGRTQLFKLDESIEEEESEEEE---------  524

Query  793  VTNNEHIPIPI-------LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADE  635
             T+  ++P P        LS SLKN SL +KK   PN SGT+PENG LA +SSG+RSA+E
Sbjct  525  -TSFNYVPAPTKNVSESKLSMSLKNISLSDKKQKHPNFSGTRPENGDLARASSGHRSANE  583

Query  634  QLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            QLP S SF+KLADM +EEW  FLEKFQELLYPAF KR+SVTVG++Q+QRLGTSCQF
Sbjct  584  QLPVSSSFLKLADMNEEEWRLFLEKFQELLYPAFDKRKSVTVGQRQIQRLGTSCQF  639



>emb|CDP00486.1| unnamed protein product [Coffea canephora]
Length=641

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 119/170 (70%), Gaps = 1/170 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGN-GQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED  Y+  PKM   +FM  + F F FGG  G+ PLSKL+ES +EE+ES+ E E      
Sbjct  472  CEDDIYKIDPKMVSEDFMVGSPFHFGFGGVIGRSPLSKLEESVEEEDESDVEEEEDDFVG  531

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
            V+    +  I  LS SLKNTS GEK       SGTKPE GYL  SSSG+RSA+EQLP S 
Sbjct  532  VLGPARNSNISKLSMSLKNTSFGEKNQKFSKLSGTKPEYGYLTSSSSGHRSANEQLPVSA  591

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFVKLADM DEEWA FLEKFQELLYPAFA R+S+T+G +Q QRLGTSCQF
Sbjct  592  SFVKLADMNDEEWAMFLEKFQELLYPAFADRKSITLGHRQRQRLGTSCQF  641



>ref|XP_004239016.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Solanum 
lycopersicum]
Length=640

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 120/169 (71%), Gaps = 3/169 (2%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            E+  Y   PKMA  +F++RN FQF FGG NG+  L KLDES +EEE  EEE       P 
Sbjct  474  EEAGYGSSPKMASEDFVSRNPFQFPFGGGNGRTQLFKLDESIEEEESEEEEDTSVNCVPA  533

Query  793  VTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVS  614
               N  +    LS SLKN SLG+K    P  SGTKPEN +LA SSSG+RSA+EQLP S S
Sbjct  534  PAKN--VEELKLSMSLKNISLGDKNQKHPYFSGTKPENAHLANSSSGHRSANEQLPVSSS  591

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVKLADM +EEW  FLEKFQELLYPAFAKR+SV +G++Q+QRLGTSCQF
Sbjct  592  FVKLADMGEEEWRLFLEKFQELLYPAFAKRKSVALGQRQIQRLGTSCQF  640



>ref|XP_002514582.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis]
 gb|EEF47688.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis]
Length=647

 Score =   167 bits (423),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 127/175 (73%), Gaps = 6/175 (3%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGG-  800
            C +  ++  PKM   ++M +  FQF  G GNG+ PLSKL+ES +EE+E EEE      G 
Sbjct  473  CGEIDFDFTPKMTTEDYMIKTPFQFGSGVGNGRSPLSKLEESIEEEDEDEEEDRDEEDGK  532

Query  799  ---PVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQ  632
                V+   E +P +  LS SLK+TSLGEKK      SG+KPENGY A +SSG+RSA+EQ
Sbjct  533  GGFSVLPMPERLPTMSKLSMSLKSTSLGEKKQKCQKFSGSKPENGYYANTSSGHRSANEQ  592

Query  631  LPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            LPASVSFV+LADM+D+EW  FLEKFQELLYPAF KR+SVT+G++Q QRLGTSCQF
Sbjct  593  LPASVSFVELADMSDDEWTLFLEKFQELLYPAFNKRKSVTLGQRQRQRLGTSCQF  647



>ref|XP_002316001.1| phosphatidylinositol 3- and 4-kinase family protein [Populus 
trichocarpa]
 gb|EEF02172.1| phosphatidylinositol 3- and 4-kinase family protein [Populus 
trichocarpa]
Length=640

 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 128/170 (75%), Gaps = 4/170 (2%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            C++ +Y+   K+   ++M R+ FQF  G G+G++PLSKL+ES +E+EESE E E      
Sbjct  474  CDETQYDFTAKLTADDYMIRSPFQFGIGSGSGRFPLSKLEESIEEDEESEGEEEQEGFAA  533

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
            + T  +   I  LS SLK+T+LG+K   L   SGTKPENG L+  SSG+RSA+EQLPAS+
Sbjct  534  LRTLEKLPTISKLSMSLKSTTLGDKNQKL---SGTKPENGCLSNRSSGHRSANEQLPASI  590

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFV+LADMT+EEW  FLEKFQELLYPAFAKR+SVT+G++Q QRLGTSCQF
Sbjct  591  SFVELADMTEEEWTLFLEKFQELLYPAFAKRKSVTLGQRQRQRLGTSCQF  640



>ref|XP_011009383.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Populus 
euphratica]
 ref|XP_011009391.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Populus 
euphratica]
 ref|XP_011009400.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Populus 
euphratica]
Length=640

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 128/170 (75%), Gaps = 4/170 (2%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            C++ +Y+   K+   ++M R+ FQF  G G+G++PLSKL+ES +E+EESE E E      
Sbjct  474  CDETQYDFTAKLTADDYMIRSPFQFGIGSGSGRFPLSKLEESIEEDEESEGEEEQEGFAA  533

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
            + T  +   I  LS SLK+T+LG+K   L   SGTKPENG L+  SSG+RSA+EQLPAS+
Sbjct  534  LRTLEKLPTISKLSMSLKSTTLGDKHQKL---SGTKPENGCLSNRSSGHRSANEQLPASI  590

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFV+LADMT+EEW  FLEKFQELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  591  SFVELADMTEEEWTLFLEKFQELLYPAFAKRKSITLGQRQRQRLGTSCQF  640



>ref|XP_006484264.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Citrus 
sinensis]
Length=644

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED  ++  PKMA  ++M+R  F    G GNG++ LSKLDES +E EESE E E      
Sbjct  475  CEDAAFDFTPKMAADDYMSRAQFHLGIGFGNGRFALSKLDESIEELEESEGEEEQEGFS-  533

Query  796  VVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPAS  620
             +   E IP I  LS SLK T LG+K       SG+KPENG L+ +SSG+RSA+EQLPA 
Sbjct  534  TLPAPERIPSISKLSMSLKTTCLGDKNQKYQKFSGSKPENGCLSNTSSGHRSANEQLPAC  593

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            VSFVKLAD+ ++EW  FLEKFQELLYPAFA R+SVTVG +Q QRLGTSCQF
Sbjct  594  VSFVKLADLGEDEWTLFLEKFQELLYPAFAARKSVTVGLRQRQRLGTSCQF  644



>gb|KDO70262.1| hypothetical protein CISIN_1g006461mg [Citrus sinensis]
Length=644

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED  ++  PKMA  ++M+R  F    G GNG++ LSKLDES +E EESE E E      
Sbjct  475  CEDAAFDFTPKMAADDYMSRAQFHLGIGFGNGRFALSKLDESIEELEESEGEEEQEGFS-  533

Query  796  VVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPAS  620
             +   E IP I  LS SLK T LG+K       SG+KPENG L+ +SSG+RSA+EQLPA 
Sbjct  534  TLPAPERIPSISKLSMSLKTTCLGDKNQKYQKFSGSKPENGCLSNTSSGHRSANEQLPAC  593

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            VSFVKLAD+ ++EW  FLEKFQELLYPAFA R+SVTVG +Q QRLGTSCQF
Sbjct  594  VSFVKLADLGEDEWTLFLEKFQELLYPAFAARKSVTVGLRQRQRLGTSCQF  644



>ref|XP_006437843.1| hypothetical protein CICLE_v10030931mg [Citrus clementina]
 gb|ESR51083.1| hypothetical protein CICLE_v10030931mg [Citrus clementina]
Length=644

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED  ++  PKMA  ++M+R  F    G GNG++ LSKLDES +E EESE E E      
Sbjct  475  CEDAAFDFTPKMAADDYMSRAQFHLGIGFGNGRFALSKLDESIEELEESEGEEEQEGFS-  533

Query  796  VVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPAS  620
             +   E IP I  LS SLK T LG+K       SG+KPENG L+ +SSG+RSA+EQLPA 
Sbjct  534  TLPAPERIPSISKLSMSLKTTCLGDKNQKYQKFSGSKPENGCLSNTSSGHRSANEQLPAC  593

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            VSFVKLAD+ ++EW  FLEKFQELLYPAFA R+SVTVG +Q QRLGTSCQF
Sbjct  594  VSFVKLADLGEDEWTLFLEKFQELLYPAFAARKSVTVGLRQRQRLGTSCQF  644



>ref|XP_011070894.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Sesamum indicum]
Length=639

 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 115/170 (68%), Gaps = 3/170 (2%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED  YE  PK+   +F     F F FG  NG+ PLSKL+ES +EE    EE +     P
Sbjct  472  CEDGGYEVTPKLTSEDFGMGMPFHFGFGSVNGRAPLSKLEESVEEEGSEGEEEKGLISIP  531

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
             +     I    LS SLKNTSLGEK       SGTKP++GYLA SSSG+RSA+EQLP S 
Sbjct  532  ALAKCPSISK--LSMSLKNTSLGEKNQKFTKFSGTKPDHGYLASSSSGHRSANEQLPPSA  589

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFVKLADM + +W  FLEKFQELL PAFAKR+S+T+G++Q QRLGTSC+F
Sbjct  590  SFVKLADMNEVQWGLFLEKFQELLNPAFAKRKSITLGQRQRQRLGTSCKF  639



>ref|XP_007045737.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
 ref|XP_007045738.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
 gb|EOY01569.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
 gb|EOY01570.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
Length=641

 Score =   158 bits (400),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 120/178 (67%), Gaps = 18/178 (10%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CE+   +  PKM   +FMTR  FQ   G  N ++PLSKL+E  +E+E+        + G 
Sbjct  473  CEELESDFAPKMGNEDFMTRAPFQLGNGFMNNRFPLSKLEECFEEDED--------SEGE  524

Query  796  VVTNN-------EHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSA  641
            V   N       + IP I  LS SLK+TSLG+K       SGTK ENGYL  SSSG+RSA
Sbjct  525  VEQENFSAFKALQRIPTISKLSMSLKDTSLGDKSQKYSKFSGTKQENGYLT-SSSGHRSA  583

Query  640  DEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EQLPASVSFVKLADM +EEWA FLEKFQELLY AF KR+SVT+G+KQ QRLGTSCQF
Sbjct  584  NEQLPASVSFVKLADMNEEEWAYFLEKFQELLYAAFEKRKSVTLGQKQRQRLGTSCQF  641



>ref|XP_002267025.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Vitis vinifera]
 ref|XP_010654115.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Vitis vinifera]
 ref|XP_010654121.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Vitis vinifera]
 emb|CAN76598.1| hypothetical protein VITISV_005885 [Vitis vinifera]
Length=640

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CE+ R+   PKM    FM R    F  GG NG++ LSKL+ES +EEEESE E E      
Sbjct  474  CEEDRFYFTPKMGADAFMNRGPLHFGIGGANGRFQLSKLEESIEEEEESEREGEQEDFAG  533

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
            + T  E   I  LS SLK+TSLGEK          KPE+ YLA +SSG+RSA+EQLP S+
Sbjct  534  IPTPAEVSTISKLSMSLKDTSLGEKSQKYLE---AKPESSYLANTSSGHRSANEQLPTSM  590

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFVKLADM +EEW  FLEKFQELLYPAFAKR+SVT+G++Q QRLGTSCQF
Sbjct  591  SFVKLADMNEEEWVLFLEKFQELLYPAFAKRKSVTLGQRQRQRLGTSCQF  640



>gb|KJB50515.1| hypothetical protein B456_008G175000 [Gossypium raimondii]
Length=643

 Score =   156 bits (394),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 125/173 (72%), Gaps = 6/173 (3%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG---GNGQWPLSKLDestqeeeeseeeaeiSTG  803
            CE+   E +PKMA  + MTR +FQF  G    + + PLSKL+E  +E+EESE EAE +  
Sbjct  473  CEEPESEFIPKMATDDSMTRASFQFGNGFVNNHHRLPLSKLEECFEEDEESELEAEQNGF  532

Query  802  GPVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
             P     E IP I  LS SL++T LG+K       SGTK ENGYL  SSSG+RSA+EQLP
Sbjct  533  SPF-EALERIPSISKLSMSLRDTCLGDKSQKYSKFSGTKQENGYLT-SSSGHRSANEQLP  590

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            ASVSFVKLAD+ +EEW  FLEKFQELL PAF+KR+SVTVG+KQ+QRLGTSCQF
Sbjct  591  ASVSFVKLADLNEEEWNFFLEKFQELLKPAFSKRKSVTVGQKQMQRLGTSCQF  643



>ref|XP_008243790.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Prunus 
mume]
Length=640

 Score =   155 bits (391),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 128/171 (75%), Gaps = 6/171 (4%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED   +   K+A  ++ +R  FQF  G G+G+ PLSKL+ES +EEE+SE E + +    
Sbjct  474  CEDTELDYTLKLAADDYASRTPFQFGNGSGHGRSPLSKLEESIEEEEDSEVEEQEALAS-  532

Query  796  VVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPAS  620
             + + E +P +  LS SLKNT LGEK       +GT+ ENGY+A +SSG+RSA+EQLPAS
Sbjct  533  -LRSPERVPSVSKLSMSLKNTVLGEK--SHLKYTGTRAENGYMANTSSGHRSANEQLPAS  589

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +SFVKLADM++++WA FLEKFQ+L+YPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  590  MSFVKLADMSEDDWAWFLEKFQDLMYPAFAKRKSITLGQRQRQRLGTSCQF  640



>ref|XP_012080475.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Jatropha 
curcas]
Length=649

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 124/180 (69%), Gaps = 14/180 (8%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGG--  800
            C++  Y+  PK+   E+ TR  FQF  G   ++PLSKL+ES +EEEE EE+ E   G   
Sbjct  473  CDETEYDFTPKI-MEEYTTRTPFQF--GSGARFPLSKLEESIEEEEEEEEQEEEEEGSTE  529

Query  799  --------PVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYR  647
                     V+T  E  P +  LS SLKN SLG+KK    N SG K ENGY + +SSG+R
Sbjct  530  DGGGKKGFSVLTLPERSPTMSKLSMSLKNISLGDKKQKCQNFSGAKQENGYFSNTSSGHR  589

Query  646  SADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SA+EQLPAS +FVKLADM++EEW+ FLEKFQELL+PAFAKR+SVT  ++Q QRLGTSCQF
Sbjct  590  SANEQLPASATFVKLADMSEEEWSLFLEKFQELLHPAFAKRKSVTFSQRQRQRLGTSCQF  649



>gb|KDP31411.1| hypothetical protein JCGZ_11787 [Jatropha curcas]
Length=637

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 124/180 (69%), Gaps = 14/180 (8%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGG--  800
            C++  Y+  PK+   E+ TR  FQF  G   ++PLSKL+ES +EEEE EE+ E   G   
Sbjct  461  CDETEYDFTPKI-MEEYTTRTPFQF--GSGARFPLSKLEESIEEEEEEEEQEEEEEGSTE  517

Query  799  --------PVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYR  647
                     V+T  E  P +  LS SLKN SLG+KK    N SG K ENGY + +SSG+R
Sbjct  518  DGGGKKGFSVLTLPERSPTMSKLSMSLKNISLGDKKQKCQNFSGAKQENGYFSNTSSGHR  577

Query  646  SADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SA+EQLPAS +FVKLADM++EEW+ FLEKFQELL+PAFAKR+SVT  ++Q QRLGTSCQF
Sbjct  578  SANEQLPASATFVKLADMSEEEWSLFLEKFQELLHPAFAKRKSVTFSQRQRQRLGTSCQF  637



>ref|XP_007226954.1| hypothetical protein PRUPE_ppa002719mg [Prunus persica]
 gb|EMJ28153.1| hypothetical protein PRUPE_ppa002719mg [Prunus persica]
Length=640

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 128/171 (75%), Gaps = 6/171 (4%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED   +   K+A  ++++R  FQF  G G+G+ PLSKL+ES +EEE+SE E + +    
Sbjct  474  CEDTELDYPLKLAADDYVSRTPFQFGNGSGHGRSPLSKLEESIEEEEDSEVEEQEALAS-  532

Query  796  VVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPAS  620
             + + E +P +  LS SLKNT LGEK       +GT+ ENGY+A +SSG+RSA+EQLPAS
Sbjct  533  -LRSPERVPSVSKLSMSLKNTVLGEK--SHLKYTGTRAENGYMANTSSGHRSANEQLPAS  589

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +SFVKLADM++++WA FLEKFQ+L+YPAFAKR+ +T+G++Q QRLGTSCQF
Sbjct  590  MSFVKLADMSEDDWAWFLEKFQDLMYPAFAKRKFITLGQRQRQRLGTSCQF  640



>ref|XP_011101959.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like, partial 
[Sesamum indicum]
Length=376

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 115/177 (65%), Gaps = 20/177 (11%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeae------  815
            CED   E  P    +E +    F F FG  NG+ PLSKL+E  +EEEE  E  E      
Sbjct  212  CEDGGREPNP----SEGLVATPFHFGFGSVNGRNPLSKLEECIEEEEEEGEGEEKGLVSL  267

Query  814  -iSTGGPVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSAD  638
                 GP ++         LS SLKNTSLG K    P  +G KP+NGYLA SSSG+ SA+
Sbjct  268  PTLAKGPSISK--------LSMSLKNTSLGGKNQKFPKFAGAKPDNGYLASSSSGHISAN  319

Query  637  EQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EQLPASVSFVKLADM +EEW  FLEKFQELL+PAFA+R+ +T+G++Q QRLGTSCQF
Sbjct  320  EQLPASVSFVKLADMNEEEWGLFLEKFQELLHPAFAERKCITLGQRQRQRLGTSCQF  376



>gb|KJB80446.1| hypothetical protein B456_013G098100 [Gossypium raimondii]
Length=641

 Score =   149 bits (376),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 115/173 (66%), Gaps = 9/173 (5%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGGNG----QWPLSKLDestqeeeeseeeaeiSTG  803
            E+   +  PKMA  +FM+R  FQ    GNG     +PLSKL+E  +E+EE  EE      
Sbjct  473  EEPELDLNPKMATDDFMSRAPFQL---GNGFVSNHFPLSKLEECFEEDEEESEEETEQPC  529

Query  802  GPVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
                   E IP    LS S KNTSLG+K       SGTK ENGYL  +SSG+RSA+EQLP
Sbjct  530  FSTFKALERIPSTSKLSMSFKNTSLGDKSQKYSKFSGTKQENGYLN-NSSGHRSANEQLP  588

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             +VSFVKLADM +EEW  FLEKFQELLYP F KR+SVT+G+KQ+QRLGTSCQF
Sbjct  589  GNVSFVKLADMNEEEWTLFLEKFQELLYPGFEKRKSVTLGQKQIQRLGTSCQF  641



>ref|XP_011079569.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Sesamum 
indicum]
 ref|XP_011102030.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Sesamum 
indicum]
Length=636

 Score =   149 bits (375),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 115/177 (65%), Gaps = 20/177 (11%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeae------  815
            CED   E  P    +E +    F F FG  NG+ PLSKL+E  +EEEE  E  E      
Sbjct  472  CEDGGREPNP----SEGLVATPFHFGFGSVNGRNPLSKLEECIEEEEEEGEGEEKGLVSL  527

Query  814  -iSTGGPVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSAD  638
                 GP ++         LS SLKNTSLG K    P  +G KP+NGYLA SSSG+ SA+
Sbjct  528  PTLAKGPSISK--------LSMSLKNTSLGGKNQKFPKFAGAKPDNGYLASSSSGHISAN  579

Query  637  EQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EQLPASVSFVKLADM +EEW  FLEKFQELL+PAFA+R+ +T+G++Q QRLGTSCQF
Sbjct  580  EQLPASVSFVKLADMNEEEWGLFLEKFQELLHPAFAERKCITLGQRQRQRLGTSCQF  636



>gb|AJR30359.1| phosphatidylinositol 4-kinase 2 [Gossypium hirsutum]
Length=641

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 115/173 (66%), Gaps = 9/173 (5%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGGNG----QWPLSKLDestqeeeeseeeaeiSTG  803
            E+   +  PKMA  +FM+R  FQ    GNG     +PLSKL+E  +E+EE  EE      
Sbjct  473  EEPELDLNPKMATDDFMSRAPFQL---GNGFVSNHFPLSKLEECFEEDEEESEEETEQPC  529

Query  802  GPVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
                   E IP    LS S KNTSLG+K       SGTK ENGYL  +SSG+RSA+EQLP
Sbjct  530  FSTFKALERIPSTSKLSMSFKNTSLGDKSQKYSKFSGTKQENGYLN-NSSGHRSANEQLP  588

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             +VSFVKLADM +EEW  FLEKFQELLYP F KR+SVT+G+KQ+QRLGTSCQF
Sbjct  589  GNVSFVKLADMNEEEWNLFLEKFQELLYPGFEKRKSVTLGQKQIQRLGTSCQF  641



>gb|ADK78996.1| phosphatidylinositol 4-kinase [Gossypium barbadense]
Length=641

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 114/173 (66%), Gaps = 9/173 (5%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGGNG----QWPLSKLDestqeeeeseeeaeiSTG  803
            E+   +  PKMA  +FM+R  FQ    GNG     +PLSKL+E  +E+EE  EE      
Sbjct  473  EEPELDLNPKMATDDFMSRAPFQL---GNGFVSNHFPLSKLEECFEEDEEESEEETEQPC  529

Query  802  GPVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
                   E IP    LS S KNTSLG+K       SGTK ENGYL  +SSG+RSA EQLP
Sbjct  530  FSTFKALERIPSTSKLSMSFKNTSLGDKSQKYSKFSGTKQENGYLN-NSSGHRSATEQLP  588

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             +VSFVKLADM +EEW  FLEKFQELLYP F KR+SVT+G+KQ+QRLGTSCQF
Sbjct  589  GNVSFVKLADMNEEEWTLFLEKFQELLYPGFEKRKSVTLGQKQIQRLGTSCQF  641



>gb|KEH17526.1| phosphatidylinositol 3- and 4-kinase [Medicago truncatula]
Length=640

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 117/170 (69%), Gaps = 6/170 (4%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            C++   +  PKMA  + + R  FQ A G G+ + PLSKLDES +EEE+  +E      G 
Sbjct  476  CDEGGSDSTPKMAMEDPLIREIFQHAPGNGHMRSPLSKLDESIEEEEDENDEESPQEFGT  535

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
                 +   IP ++ SLKNT L EKK      SG K +NGY   +SSG+RSA+EQLPAS+
Sbjct  536  FSAQEKVATIPEITVSLKNTMLAEKK---QKHSGGKLDNGYF--TSSGHRSANEQLPASI  590

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFV LADMT+++W  FLEKFQELLYPAFAKR+S+T+G+KQ QRLGTSCQF
Sbjct  591  SFVMLADMTEDDWTLFLEKFQELLYPAFAKRKSITLGQKQRQRLGTSCQF  640



>ref|XP_010091640.1| putative phosphatidylinositol 4-kinase type 2-beta [Morus notabilis]
 gb|EXB44906.1| putative phosphatidylinositol 4-kinase type 2-beta [Morus notabilis]
Length=642

 Score =   146 bits (369),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 122/176 (69%), Gaps = 17/176 (10%)
 Frame = -2

Query  967  DYRYECMPKMAFAE-FMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGG--  800
            ++  +  PKM+  E F+TR  F F  G G+G+  L KL+E  +EEEE++EE +       
Sbjct  475  EWELDETPKMSAEEDFVTRTPFHFGNGSGHGRPQLPKLEERGEEEEENDEEEKEVFANFR  534

Query  799  -----PVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADE  635
                 P ++N        +S SLK+TSLGEKK   P  +G+KPENGY+  +S+G+RSA+E
Sbjct  535  ASEKKPTISN--------ISMSLKDTSLGEKKQKFPKFTGSKPENGYMLNTSAGHRSANE  586

Query  634  QLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            QLPASVSFVKLAD++++EW  FLEKF +LLYPAFAKR+S  +G++Q QRLGTSCQF
Sbjct  587  QLPASVSFVKLADLSEDEWTLFLEKFHDLLYPAFAKRKSAILGQRQRQRLGTSCQF  642



>ref|XP_004490265.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like [Cicer arietinum]
Length=638

 Score =   146 bits (369),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 114/162 (70%), Gaps = 8/162 (5%)
 Frame = -2

Query  946  PKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIP  770
            PKMA  + +TR  FQ + G G+ + PLSKL+ES +EEE   E  +        +  E +P
Sbjct  483  PKMAMDDLLTRATFQPSLGNGHVRSPLSKLEESIEEEESDGESPQEFG---TFSTQEKVP  539

Query  769  -IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADM  593
             IP ++ SLKNT L E K      SG K +NGY   +SSG+RSA EQLP+S+SF+KLADM
Sbjct  540  TIPEITVSLKNTMLAETK---QKHSGGKLDNGYFVNTSSGHRSASEQLPSSISFIKLADM  596

Query  592  TDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            T++EW  FL+KFQELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  597  TEDEWTLFLDKFQELLYPAFAKRKSITLGQRQRQRLGTSCQF  638



>ref|XP_008339749.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Malus 
domestica]
Length=641

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 125/172 (73%), Gaps = 7/172 (4%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNA-FQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGG  800
            CED   +   K A  +++ R++ F FA G G+G+  LSKL+ES +EEE+SE E + +   
Sbjct  474  CEDAEEDYTSKFAADDYLNRSSSFPFANGSGHGRSLLSKLEESIEEEEDSEVEEQEALA-  532

Query  799  PVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA  623
              +   E +P +  LS SLKNT LGEK        G+KPENGY+A +S G+RSA+EQLPA
Sbjct  533  -YMPTPEKVPSVSKLSMSLKNTVLGEK--SHLKYKGSKPENGYMANTSLGHRSANEQLPA  589

Query  622  SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            S+SFVKLADM+++EW  FLEKFQ+LLYPAFAKR+SVT+G++Q QRLGTSCQF
Sbjct  590  SMSFVKLADMSEDEWTLFLEKFQDLLYPAFAKRKSVTLGQRQRQRLGTSCQF  641



>ref|XP_009355550.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-kinase 
gamma 7 [Pyrus x bretschneideri]
Length=684

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 124/172 (72%), Gaps = 7/172 (4%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNA-FQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGG  800
            CED   +   K A  +++ R++ F FA G G+G+  LSKL+ES +EEE+SE E + +   
Sbjct  517  CEDTEEDYTSKFAADDYLNRSSSFPFANGSGHGRSLLSKLEESIEEEEDSEVEEQEALA-  575

Query  799  PVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA  623
              +   E +P +  LS SLKNT LGEK        G+KPENGY A +SSG+RSA+EQLPA
Sbjct  576  -YMPTPEKVPTVSKLSMSLKNTVLGEK--SRLKYKGSKPENGYTANTSSGHRSANEQLPA  632

Query  622  SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            S+SFVKLADM ++EW  FLEKFQ+LLYPAFAKR+SVT+G++Q QRLGTSCQF
Sbjct  633  SMSFVKLADMREDEWTLFLEKFQDLLYPAFAKRKSVTLGQRQRQRLGTSCQF  684



>gb|AJR30358.1| phosphatidylinositol 4-kinase 1 [Gossypium hirsutum]
Length=703

 Score =   144 bits (364),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 110/165 (67%), Gaps = 9/165 (5%)
 Frame = -2

Query  946  PKMAFAEFMTRNAFQFAFGGNG----QWPLSKLDestqeeeeseeeaeiSTGGPVVTNNE  779
            PKMA  +FM+R  FQ    GNG     +PLSKL+E  +E+EE  EE              
Sbjct  543  PKMATDDFMSRAPFQL---GNGFVSNHFPLSKLEECFEEDEEESEEETEQLCFSTFKALG  599

Query  778  HIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKL  602
             IP    LS S KNTSLG+K       SGTK ENGYL  +SSG+RSA EQLP +VSFVKL
Sbjct  600  RIPSTSKLSMSFKNTSLGDKSQKYSKFSGTKQENGYLN-NSSGHRSATEQLPGNVSFVKL  658

Query  601  ADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            ADM +EEW  FLEKFQELLYP F KR+SVT+G+KQ+QRLGTSCQF
Sbjct  659  ADMNEEEWTLFLEKFQELLYPGFEKRKSVTLGQKQIQRLGTSCQF  703



>ref|XP_007153462.1| hypothetical protein PHAVU_003G037500g [Phaseolus vulgaris]
 gb|ESW25456.1| hypothetical protein PHAVU_003G037500g [Phaseolus vulgaris]
Length=642

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 112/162 (69%), Gaps = 4/162 (2%)
 Frame = -2

Query  946  PKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIP  770
            PK+A  + +TR  FQ A G G  + PLSKLDE  +EE E+E E+         +  E IP
Sbjct  483  PKLAIDDPLTRATFQPALGNGYARNPLSKLDECIEEEGEAEGESPQEF--VTYSAEEKIP  540

Query  769  -IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADM  593
             +  LS  LKNT L  K       SG K ++GY A SSSG++SA+EQLPAS+SFV +ADM
Sbjct  541  TVSELSVQLKNTILDGKNQNQQKYSGGKVDSGYFANSSSGHKSANEQLPASISFVDVADM  600

Query  592  TDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            TD+EW  FLEKFQELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  601  TDDEWTLFLEKFQELLYPAFAKRKSITLGQRQRQRLGTSCQF  642



>ref|XP_009356466.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Pyrus 
x bretschneideri]
Length=642

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 126/172 (73%), Gaps = 6/172 (3%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTR-NAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGG  800
            CE+   +C  K A  +++TR ++F FA G G+G+  LSKL+ES +EEE++E E + +   
Sbjct  474  CEEAEEDCTLKFAADDYLTRASSFPFANGSGHGRSLLSKLEESIEEEEDNEVEEQGALA-  532

Query  799  PVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA  623
              +   E +P +  LS SLKNT L  +K  L +  G+KP NGY+  +SSG+RSA EQLPA
Sbjct  533  -TLPTPEKVPSVSKLSMSLKNTVLVGEKSHLKH-MGSKPGNGYMVNTSSGHRSASEQLPA  590

Query  622  SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            S+SFVKLADM++++W  FLEKFQ++LYPAFAKR+SVT+G++Q QRLGTSCQF
Sbjct  591  SMSFVKLADMSEDDWTLFLEKFQDMLYPAFAKRKSVTLGQRQRQRLGTSCQF  642



>ref|XP_011021071.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Populus 
euphratica]
 ref|XP_011021079.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Populus 
euphratica]
Length=640

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 120/174 (69%), Gaps = 12/174 (7%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            C++  Y+  PK+   +++TR+ FQF  G G+G++ LSKL+ES +EEE   EE +      
Sbjct  474  CDETHYDFSPKLTADDYLTRSPFQFGIGSGSGRFLLSKLEESIEEEESEGEEEQEG----  529

Query  796  VVTNNEHIPIPILSKSLKN----TSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQL  629
                   + +P +SK   +    T+LG+K       SGTKPENGY +  SSG+RSA+EQL
Sbjct  530  FTALRTPVKLPAISKLSMSLKSSTTLGDKNRKF---SGTKPENGYRSNRSSGHRSANEQL  586

Query  628  PASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            PAS+SFV+LADMT+EEW  F+EKFQELLYPAFAKR+SVT G++Q  RLGTSCQF
Sbjct  587  PASMSFVELADMTEEEWTLFMEKFQELLYPAFAKRKSVTFGQRQRLRLGTSCQF  640



>emb|CBI27403.3| unnamed protein product [Vitis vinifera]
Length=392

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 95/169 (56%), Gaps = 39/169 (23%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            CE+ R+   PKM    FM R    F  G                                
Sbjct  263  CEEDRFYFTPKMGADAFMNRGPLHFGIG--------------------------------  290

Query  793  VTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVS  614
                E   I  LS SLK+TSLGEK          KPE+ YLA +SSG+RSA+EQLP S+S
Sbjct  291  ----EVSTISKLSMSLKDTSLGEKSQKYLE---AKPESSYLANTSSGHRSANEQLPTSMS  343

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVKLADM +EEW  FLEKFQELLYPAFAKR+SVT+G++Q QRLGTSCQF
Sbjct  344  FVKLADMNEEEWVLFLEKFQELLYPAFAKRKSVTLGQRQRQRLGTSCQF  392



>ref|XP_003518796.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Glycine 
max]
Length=643

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 119/172 (69%), Gaps = 4/172 (2%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            +++  +  PKMA  + +TR  F  A G G  + PLSKLDE  +EEEE EEEAE  +    
Sbjct  472  DEFGSDFTPKMAIDDPLTRATFLPALGNGQSRNPLSKLDECIEEEEEEEEEAEGESPQGF  531

Query  793  VTN--NEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA  623
            VT+   E IP +  LS SLKNT L  K       SG K ENG+ A +SSG++SA+EQLP 
Sbjct  532  VTSAAEEKIPSVSELSVSLKNTMLDGKNQNQQKYSGGKVENGHFANTSSGHKSANEQLPP  591

Query  622  SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            S+SFV + +MT++EW  FLEKFQELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  592  SISFVDVTEMTEDEWPLFLEKFQELLYPAFAKRKSITLGQRQRQRLGTSCQF  643



>ref|XP_011657466.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Cucumis 
sativus]
 gb|KGN47773.1| hypothetical protein Csa_6G401430 [Cucumis sativus]
Length=645

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 109/149 (73%), Gaps = 4/149 (3%)
 Frame = -2

Query  907  FQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIP-IPILSKSLKNTSL  731
            F    G +G++PL KL      EEE++EE E   G   + ++E IP I  LS SLKNTSL
Sbjct  499  FSVGSGIHGRFPLRKL--EESIEEENDEEDERGGGFTNLLSSERIPTISKLSMSLKNTSL  556

Query  730  GEKKLGLPNPSGTKPENGYLAC-SSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQ  554
            GEK     N  GT+P+NGY+   +SSG+RSA+EQLPASV+FVKLADM ++ W+ FL+KFQ
Sbjct  557  GEKNKKHSNYFGTRPDNGYMMTNTSSGHRSANEQLPASVTFVKLADMNEDSWSLFLDKFQ  616

Query  553  ELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            ELL+PAFAKR+S T+G++Q QRLGTSCQF
Sbjct  617  ELLHPAFAKRKSATLGQRQRQRLGTSCQF  645



>ref|XP_004297194.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Fragaria 
vesca subsp. vesca]
Length=637

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 122/171 (71%), Gaps = 8/171 (5%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED   +   K A  +++TR A  F  G G+G+  LSKL+ES +EEE+SE E + +    
Sbjct  473  CEDAESDF--KFAAEDYVTRIASPFGNGSGHGRSLLSKLEESIEEEEDSEGEEQQALAS-  529

Query  796  VVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPAS  620
             +  ++HIP +  LS SLK TSLGEK    P   G K EN ++A +SSG+RSA+EQLPAS
Sbjct  530  -LPPSKHIPSVAKLSMSLKTTSLGEKNF--PKYIGAKTENVHMANTSSGHRSANEQLPAS  586

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +SFVKLADM +++W  FLEKFQ+LLYPAFAKR+SVT+G++Q  RLGTSCQF
Sbjct  587  MSFVKLADMNEDDWTLFLEKFQDLLYPAFAKRKSVTLGQRQRLRLGTSCQF  637



>ref|XP_004509953.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like [Cicer arietinum]
Length=639

 Score =   139 bits (349),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 107/154 (69%), Gaps = 3/154 (2%)
 Frame = -2

Query  922  MTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIP-IPILSKS  749
            + R+ FQ  FG G+G+ PLSKLDES +EEEE  +      G       E +P +  LS S
Sbjct  487  LARSPFQPGFGSGHGRNPLSKLDESIEEEEEEGDGKYPE-GFVTFPPQEKVPTVSKLSMS  545

Query  748  LKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATF  569
            LKNT L EK     N SG   +NGY   +SSG++SA+EQL AS SFVKLADMT++EW TF
Sbjct  546  LKNTMLSEKSQKHQNHSGGIADNGYYGNTSSGHKSANEQLLASTSFVKLADMTEDEWITF  605

Query  568  LEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            LEKFQELLYPAFAKR+ +T+G+KQ  RLGTSCQF
Sbjct  606  LEKFQELLYPAFAKRKLITLGQKQRLRLGTSCQF  639



>ref|XP_008445412.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Cucumis melo]
Length=645

 Score =   138 bits (348),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 113/158 (72%), Gaps = 6/158 (4%)
 Frame = -2

Query  928  EFMTRNAFQFAFGG--NGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIP-IPIL  758
            +F     + F+ G   +G++PL KL+ES +EE + E+E       P   ++E IP I  L
Sbjct  490  DFYPTTPYHFSVGSGIHGRFPLRKLEESIEEENDEEDERAGGFTNPF--SSERIPTISKL  547

Query  757  SKSLKNTSLGEKKLGLPNPSGTKPENGYLAC-SSSGYRSADEQLPASVSFVKLADMTDEE  581
            S SLKNTSLGEK        GT+P+NGY+   +SSG+RSA+EQLPASV+FVKLADM ++ 
Sbjct  548  SMSLKNTSLGEKNKKHSKYFGTRPDNGYMMTNTSSGHRSANEQLPASVTFVKLADMNEDS  607

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W+ FL+KFQELL+PAFAKR+S T+G++Q QRLGTSCQF
Sbjct  608  WSLFLDKFQELLHPAFAKRKSATLGQRQRQRLGTSCQF  645



>gb|KHN29938.1| Putative phosphatidylinositol 4-kinase type 2-beta [Glycine soja]
Length=640

 Score =   138 bits (348),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 112/170 (66%), Gaps = 3/170 (2%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            +++  +  PKMA  + +TR  F  A G G  + PLSKLDE  +EEEE  E      G   
Sbjct  472  DEFGSDFTPKMAIDDPLTRATFLPALGNGQSRNPLSKLDECIEEEEEEAEGESPQ-GFVT  530

Query  793  VTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
                E IP +  LS SLKNT L  K       SG K ENG+ A +SSG++SA+EQLP S+
Sbjct  531  SAAEEKIPSVSELSVSLKNTMLDGKNQNQQKYSGGKVENGHFANTSSGHKSANEQLPPSI  590

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFV + +MT++EW  FLEKFQELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  591  SFVDVTEMTEDEWPLFLEKFQELLYPAFAKRKSITLGQRQRQRLGTSCQF  640



>ref|XP_006573180.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Glycine 
max]
 gb|KHN28428.1| Putative phosphatidylinositol 4-kinase type 2-beta [Glycine soja]
Length=639

 Score =   138 bits (347),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 111/162 (69%), Gaps = 4/162 (2%)
 Frame = -2

Query  946  PKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIP  770
            PKMA  + +TR  FQ A G G+ + PLSKLDE  +EEEE  E      G    +  E IP
Sbjct  480  PKMAIDDPLTRATFQPALGNGHARNPLSKLDECIEEEEEEAEGESPK-GFVTSSTEEKIP  538

Query  769  -IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADM  593
             +  LS SLKNT L  K        G K +NG+ A +SSG++SA+EQLP S+SFV + +M
Sbjct  539  SVSELSVSLKNTMLDGKNQN-QQKYGGKVDNGHFANTSSGHKSANEQLPPSISFVDVTEM  597

Query  592  TDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            T++EW+ FLEKFQELLYPAFAKR+S+T+G++Q QRLGTSCQF
Sbjct  598  TEDEWSNFLEKFQELLYPAFAKRKSITLGQRQRQRLGTSCQF  639



>ref|XP_008367029.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Malus 
domestica]
Length=688

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 122/172 (71%), Gaps = 6/172 (3%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTR-NAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGG  800
            CE+   +C  K A  +++TR ++F FA G G+G+  LSKL+ES +EEE+SE E +     
Sbjct  520  CEEAEEDCTLKSAADDYLTRASSFPFANGSGHGRSLLSKLEESIEEEEDSEVEEQGXLA-  578

Query  799  PVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA  623
              +   E +P +  LS SLKNT L  +K  L +  G+KP NGY+  +S G+RSA+EQLPA
Sbjct  579  -TLPTLEKVPSVSKLSMSLKNTVLVGEKXHLKH-MGSKPGNGYMVNTSXGHRSANEQLPA  636

Query  622  SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            S+ FVKLADM+++ W  FLEKFQ++LYPAFAKR+S T+G++Q QRLGTSCQF
Sbjct  637  SMCFVKLADMSEDXWTLFLEKFQDMLYPAFAKRKSXTLGQRQRQRLGTSCQF  688



>ref|XP_010066800.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Eucalyptus 
grandis]
 ref|XP_010066801.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Eucalyptus 
grandis]
 ref|XP_010066802.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Eucalyptus 
grandis]
 gb|KCW64845.1| hypothetical protein EUGRSUZ_G02416 [Eucalyptus grandis]
 gb|KCW64846.1| hypothetical protein EUGRSUZ_G02416 [Eucalyptus grandis]
Length=638

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = -2

Query  928  EFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV-VTNNEHI-PIPILS  755
            ++M R  F F  G NG  PLS+L+E+++EEEESE E E        V   E + P+  LS
Sbjct  483  DYMHRERFDFGIGSNGWNPLSRLEEASEEEEESECEEEKKREDVAGVEAFERLPPVSKLS  542

Query  754  KSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWA  575
             SLKNT LG+K    P  SG   ENG++A SSSG+RSA+EQLP SVSFV LADM+++EW 
Sbjct  543  MSLKNTVLGKKSRKQPKYSGRMQENGFMANSSSGHRSANEQLPPSVSFVNLADMSEDEWL  602

Query  574  TFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             FLEKFQELL PAF  R+S T+G +Q  RLGTSCQF
Sbjct  603  LFLEKFQELLDPAFENRKSATLGHRQRLRLGTSCQF  638



>ref|XP_002311415.2| phosphatidylinositol 3- and 4-kinase family protein [Populus 
trichocarpa]
 gb|EEE88782.2| phosphatidylinositol 3- and 4-kinase family protein [Populus 
trichocarpa]
Length=642

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 120/174 (69%), Gaps = 10/174 (6%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            C++  Y+  PK+   +++TR+ FQF  G G+G++ LSKL+ES +EEE   EE +      
Sbjct  474  CDETHYDFTPKLTADDYLTRSPFQFGIGSGSGRFLLSKLEESIEEEESEGEEEQECFTA-  532

Query  796  VVTNNEHIPI--PILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA  623
             +   E  P    +      +T+LG+K       SGTKPENGYL+  SSG+RSA+EQLPA
Sbjct  533  -LRTPEKFPTISKLSMSLKSSTTLGDKNQKF---SGTKPENGYLSNRSSGHRSANEQLPA  588

Query  622  SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVG--RKQLQRLGTSCQF  467
            S+SFV+LADMT+EEW  F+EKFQELLYPAFAKR+SVT G  ++Q QRLGTSCQF
Sbjct  589  SMSFVELADMTEEEWTLFMEKFQELLYPAFAKRKSVTFGQRQRQRQRLGTSCQF  642



>ref|XP_010261269.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Nelumbo 
nucifera]
 ref|XP_010261276.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Nelumbo 
nucifera]
Length=635

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 112/173 (65%), Gaps = 14/173 (8%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAF-GGNGQWPLSKLDestqeeeeseeeaeiST---  806
            C++   +  PKMA+ +FM +  F F F  GNG+ PLSKL+ES +EEE   E+        
Sbjct  473  CDEAMVDSTPKMAY-DFMAKTPFNFGFRAGNGRNPLSKLEESIEEEESDGEKEPERLQDF  531

Query  805  GGPVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
              P+  N     I  +S SLK+  LGEK L   N   +K E      +SSG RSA+EQLP
Sbjct  532  ANPLALNRAPT-ISKVSMSLKSIGLGEKNLCYRN---SKAEG-----TSSGNRSANEQLP  582

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            ASVSFVKLADM +EEW  FL+KFQELL+PAF  R+SV++G++Q QRLGTSCQF
Sbjct  583  ASVSFVKLADMNEEEWTLFLDKFQELLHPAFDNRKSVSLGQRQRQRLGTSCQF  635



>ref|XP_003628725.1| Phosphatidylinositol kinase family-like protein [Medicago truncatula]
 gb|AET03201.1| phosphatidylinositol 3- and 4-kinase [Medicago truncatula]
Length=640

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 104/161 (65%), Gaps = 2/161 (1%)
 Frame = -2

Query  943  KMAFAEFMTRNAFQFAFG-GNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIPI  767
            KM   + +TR+      G GNG+ P SKL ES +EEEE  +       GP     +   +
Sbjct  480  KMTMDDPLTRSLSLPGLGSGNGRNPFSKLYESIEEEEEEGDGESPEGFGPFPCYEKTPVV  539

Query  766  PILSKSLKNTSLGEKKLGLPNPSGTKPENG-YLACSSSGYRSADEQLPASVSFVKLADMT  590
              LS SLKN  L E        SG K +NG Y   SSSG++SA+EQL AS SFVKLADMT
Sbjct  540  SKLSVSLKNIMLSETSQKYQKHSGGKADNGCYGNTSSSGHKSANEQLSASSSFVKLADMT  599

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            ++ W  FLEKFQELLYPAFAKR+S+T+G+KQ+QRLGTSCQF
Sbjct  600  EDAWTMFLEKFQELLYPAFAKRKSITIGQKQIQRLGTSCQF  640



>gb|AFK40506.1| unknown [Lotus japonicus]
Length=86

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -2

Query  682  NGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGR  503
            +GY+  SSSG+++A+EQLPAS+SFVKLADMT++EW  FLEKFQELLYPAFAKR+S+T+G+
Sbjct  15   DGYVLNSSSGHKNANEQLPASISFVKLADMTEDEWTLFLEKFQELLYPAFAKRKSITLGQ  74

Query  502  KQLQRLGTSCQF  467
            + LQRLGTSCQF
Sbjct  75   RSLQRLGTSCQF  86



>ref|XP_010065365.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-kinase 
gamma 7-like [Eucalyptus grandis]
Length=637

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 103/162 (64%), Gaps = 7/162 (4%)
 Frame = -2

Query  949  MPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIP  770
            MPKM   + M R  F    G NG+ PLS+L++ ++EEEE + +         V   E IP
Sbjct  482  MPKMTMDDCMYRAHFDLGIGSNGRNPLSRLEKGSEEEEEKKRDDVAG-----VEAFERIP  536

Query  769  -IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADM  593
             +  LS  LKN  LG+K    P  SG   ENG++A +SSG+RSA+EQLPAS SFV L DM
Sbjct  537  SVSKLSMPLKNAVLGKKSPKQPKYSGMMQENGFMANTSSGHRSANEQLPASASFVNLVDM  596

Query  592  TDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             ++EW  FLE FQELL+PAF  R+S T+ ++Q  RLGTSCQF
Sbjct  597  REDEWLLFLEIFQELLHPAFDNRKSATLRQRQ-XRLGTSCQF  637



>ref|XP_004135137.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Cucumis sativus]
 ref|XP_004135138.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Cucumis sativus]
 gb|KGN52001.1| hypothetical protein Csa_5G606910 [Cucumis sativus]
Length=645

 Score =   127 bits (318),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 106/171 (62%), Gaps = 2/171 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGG--NGQWPLSKLDestqeeeeseeeaeiSTGG  800
            CED   +    MA  + +  + +QF   G  +G+ PLSKL+ES +EE E     E     
Sbjct  475  CEDGELDYSSGMAADQCLGWSHYQFGGLGSLHGRNPLSKLEESIEEEGEDSGGEEQGETA  534

Query  799  PVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPAS  620
              + +     +  LS SLKNT LG+K         TKPE GY+  +S+G+RSA+EQ P S
Sbjct  535  SFLPSEPVSVVSKLSMSLKNTILGDKNQKNQKYQVTKPEYGYITNTSAGHRSANEQFPPS  594

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            VSFVKL DM +EEW+ FL+KF ELL PAFAKR+S  +G++Q QRLGTSCQF
Sbjct  595  VSFVKLGDMNEEEWSIFLDKFPELLRPAFAKRKSAVLGQRQRQRLGTSCQF  645



>ref|XP_008446479.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Cucumis melo]
 ref|XP_008446480.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Cucumis melo]
Length=645

 Score =   126 bits (317),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 106/171 (62%), Gaps = 2/171 (1%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGG--NGQWPLSKLDestqeeeeseeeaeiSTGG  800
            CED   +    MA  + +  + +QF   G  +G+ PLSKL+ES +EE E     E     
Sbjct  475  CEDGELDYSSGMAADQCLGWSHYQFGGLGSLHGRNPLSKLEESIEEEGEDSGGEEQGETA  534

Query  799  PVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPAS  620
              + +     +  LS SLKNT LG+K         TKPE GY+  +S+G+RSA+EQ P S
Sbjct  535  AFLPSEPISVVSKLSMSLKNTILGDKNQKNQKYQVTKPEYGYITNTSAGHRSANEQFPPS  594

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            VSFVKL DM +EEW+ FL+KF ELL PAFAKR+S  +G++Q QRLGTSCQF
Sbjct  595  VSFVKLGDMNEEEWSLFLDKFPELLRPAFAKRKSAVLGQRQRQRLGTSCQF  645



>ref|XP_010460328.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Camelina sativa]
Length=630

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMT  590
            I  LS SLK+T LGEK        G + E+ Y   +SS +RSADEQ+P+S SFVKLADM+
Sbjct  533  ITKLSMSLKSTLLGEKSQKYQKHPGARVESAY---ASSAHRSADEQIPSSTSFVKLADMS  589

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EEW  FLEK+QELLYPA  KRRS+T+G+KQ QRLGTSCQF
Sbjct  590  EEEWTMFLEKYQELLYPAIEKRRSITLGQKQRQRLGTSCQF  630



>ref|XP_006306992.1| hypothetical protein CARUB_v10008568mg [Capsella rubella]
 gb|EOA39890.1| hypothetical protein CARUB_v10008568mg [Capsella rubella]
Length=632

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  781  EHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVK  605
            E +P I  LS SLK+T LGEK        G + E+ Y   +SS +RSADEQ+P+S SFVK
Sbjct  530  EKMPTITKLSMSLKSTLLGEKSQKYQKHPGARVESAY---ASSAHRSADEQIPSSTSFVK  586

Query  604  LADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            LADM++E+W  FLEK+QELLYPAF KR+S+T+G+KQ QRLGTSCQF
Sbjct  587  LADMSEEDWTMFLEKYQELLYPAFEKRKSITLGQKQRQRLGTSCQF  632



>ref|NP_564242.1| putative phosphatidylinositol 4-kinase type 2-beta [Arabidopsis 
thaliana]
 sp|Q9C671.1|P4KG5_ARATH RecName: Full=Phosphatidylinositol 4-kinase gamma 5; Short=AtPI4Kgamma5; 
Short=PI-4Kgamma5; Short=PI4K gamma 5 [Arabidopsis 
thaliana]
 gb|AAG50675.1|AC079829_8 hypothetical protein [Arabidopsis thaliana]
 gb|AAK59519.1| unknown protein [Arabidopsis thaliana]
 gb|AAL25584.1| At1g26270/F28B23_7 [Arabidopsis thaliana]
 gb|AAL77691.1| At1g26270/F28B23_7 [Arabidopsis thaliana]
 gb|AEE30670.1| putative phosphatidylinositol 4-kinase type 2-beta [Arabidopsis 
thaliana]
Length=630

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 78/105 (74%), Gaps = 3/105 (3%)
 Frame = -2

Query  781  EHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKL  602
            E +P   LS SLK+T LGEK        G + E+ Y   +SS +RSADEQ+P+S SFVKL
Sbjct  529  EKMPTIKLSMSLKSTLLGEKSQKYQKHPGARVESAY---ASSAHRSADEQIPSSTSFVKL  585

Query  601  ADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +DM++EEW  FLEK+QELLYPA  KR+S+T+G+KQ QRLGTSCQF
Sbjct  586  SDMSEEEWTIFLEKYQELLYPAIEKRKSITLGQKQRQRLGTSCQF  630



>emb|CDY16149.1| BnaA09g28830D [Brassica napus]
Length=608

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLK+T LGEK        G + E+GY   +SSG+RSA+EQ+PAS SFVKL+DM++EE
Sbjct  514  LSMSLKSTLLGEKSQKYQKHPGARAESGY---ASSGHRSAEEQIPASTSFVKLSDMSEEE  570

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLEK+QELLYPAFAKR+++T+G+   QRLGTSCQF
Sbjct  571  WKIFLEKYQELLYPAFAKRKAITLGQNLRQRLGTSCQF  608



>ref|XP_009115351.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Brassica rapa]
Length=620

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLK+T LGEK        G + E+GY   +SSG+RSA+EQ+PAS SFVKL+DM++EE
Sbjct  526  LSMSLKSTLLGEKSQKYQKHPGARAESGY---ASSGHRSAEEQIPASTSFVKLSDMSEEE  582

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLEK+QELLYPAFAKR+++T+G+   QRLGTSCQF
Sbjct  583  WKIFLEKYQELLYPAFAKRKAITLGQNLRQRLGTSCQF  620



>ref|XP_010257911.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 isoform X2 [Nelumbo 
nucifera]
Length=618

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAF-GGNGQWPLSKLDestqeeeeseeeaeiST---  806
            C+    +  PK+A+ +FMT+  F   F GGNG+  LSK++E  +EEE   EE  +     
Sbjct  461  CDVAEVDSTPKVAY-DFMTKMPFHVGFRGGNGRNLLSKVEECIEEEESEGEEEPVRRKEF  519

Query  805  GGPVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
              P+  N     I  LS SLKN  LGEK    P     KPE       +S  RSA+EQLP
Sbjct  520  ATPLALNRPPT-ISKLSMSLKNIGLGEKN---PFYRNAKPEG------TSANRSANEQLP  569

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            ASVSFVKLADM DEEW  FLEKFQELL+PAFA RRSV++G    QRLGTSCQF
Sbjct  570  ASVSFVKLADMNDEEWTLFLEKFQELLHPAFASRRSVSLG----QRLGTSCQF  618



>ref|XP_010499062.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Camelina 
sativa]
Length=629

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 3/101 (3%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMT  590
            I  LS SLK+T LGEK        G + E+ Y   +SS +RSADEQ+P+S SFVKLA+M+
Sbjct  532  ITKLSMSLKSTLLGEKSQKYQKHPGARVESAY---ASSAHRSADEQMPSSTSFVKLAEMS  588

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EEW  FLEK+QELLYPAF KR+S+T+G+KQ QRLGTSCQF
Sbjct  589  EEEWTMFLEKYQELLYPAFEKRKSITLGQKQRQRLGTSCQF  629



>ref|XP_010257910.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 isoform X1 [Nelumbo 
nucifera]
Length=630

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 106/173 (61%), Gaps = 19/173 (11%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAF-GGNGQWPLSKLDestqeeeeseeeaeiST---  806
            C+    +  PK+A+ +FMT+  F   F GGNG+  LSK++E  +EEE   EE  +     
Sbjct  473  CDVAEVDSTPKVAY-DFMTKMPFHVGFRGGNGRNLLSKVEECIEEEESEGEEEPVRRKEF  531

Query  805  GGPVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
              P+  N     I  LS SLKN  LGEK    P     KPE       +S  RSA+EQLP
Sbjct  532  ATPLALNRPPT-ISKLSMSLKNIGLGEKN---PFYRNAKPEG------TSANRSANEQLP  581

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            ASVSFVKLADM DEEW  FLEKFQELL+PAFA RRSV++G    QRLGTSCQF
Sbjct  582  ASVSFVKLADMNDEEWTLFLEKFQELLHPAFASRRSVSLG----QRLGTSCQF  630



>ref|XP_007032901.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
 ref|XP_007032902.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
 gb|EOY03827.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
 gb|EOY03828.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
Length=625

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMT  590
            +P LS S+KN S+GEK        G   ++GYLA +SSG RS +EQLP S SFVKLAD++
Sbjct  528  VPRLSMSMKNVSIGEKSW---RHEGAMQKSGYLAGTSSGNRSVNEQLPGSTSFVKLADIS  584

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EEW  +LE FQ LLYPAF+ R+SV+VG++Q QRLGTSCQF
Sbjct  585  EEEWVQYLENFQRLLYPAFSNRKSVSVGQRQRQRLGTSCQF  625



>ref|XP_010477874.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Camelina 
sativa]
 ref|XP_010477875.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Camelina 
sativa]
Length=628

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMT  590
            I  LS SLK+T LGEK        G + E+ Y   +SS +RSADEQ+P+S SFVKLADM+
Sbjct  531  ITKLSMSLKSTLLGEKSQKYQKHPGARVESAY---ASSAHRSADEQIPSSTSFVKLADMS  587

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EEW  FLEK+QELLYPA  KR+S+T+G+KQ QRLGTSCQF
Sbjct  588  EEEWTMFLEKYQELLYPAIEKRKSITLGQKQRQRLGTSCQF  628



>ref|XP_006415909.1| hypothetical protein EUTSA_v10007061mg [Eutrema salsugineum]
 gb|ESQ34262.1| hypothetical protein EUTSA_v10007061mg [Eutrema salsugineum]
Length=631

 Score =   121 bits (303),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  781  EHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVK  605
            E +P I  +S SLK+T LGEK        G + E+ Y   +SSG+RSA+EQ+PAS SFVK
Sbjct  529  EKMPAITKISMSLKSTLLGEKSQKYQKHPGVRAESAY---ASSGHRSAEEQIPASTSFVK  585

Query  604  LADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            L+DM++EEW  FLEK+QELLYPAFAKR+S+T+G+   QR+GTSCQF
Sbjct  586  LSDMSEEEWTIFLEKYQELLYPAFAKRKSITLGQNLRQRMGTSCQF  631



>ref|XP_010681152.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Beta vulgaris 
subsp. vulgaris]
Length=629

 Score =   121 bits (303),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 105/170 (62%), Gaps = 8/170 (5%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPV  794
            CED  ++  PKM   ++  R++  F  GG       +     ++E E  +      G  V
Sbjct  467  CEDPEWDYTPKMGGEDYFCRSSV-FGVGGKNPLSKLEESLEEEDESEDGDMEGEGKGFGV  525

Query  793  VTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
            +   E  P +  +S SLKNTSLGEK       +G K ENG+   SSSG+RSA+EQL AS 
Sbjct  526  LPVPEKFPSMSKISMSLKNTSLGEKSQKY---AGMKSENGF---SSSGHRSANEQLFASA  579

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFVK+A++ +EEW  FLEKF ELL PAFA+++SVT+G++Q QRLGTSCQF
Sbjct  580  SFVKVANINEEEWTLFLEKFHELLRPAFAQQKSVTLGQRQRQRLGTSCQF  629



>ref|XP_009109913.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Brassica rapa]
Length=618

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLK T LGEK        GT+ E+ Y   +SS +RSA+EQ+PAS SFVKL+DM++EE
Sbjct  524  LSMSLKTTLLGEKSQKYQKHPGTRAESAY---ASSAHRSAEEQIPASTSFVKLSDMSEEE  580

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLEK+QELLYPAFAKR+++T+G+   QRLGTSCQF
Sbjct  581  WTMFLEKYQELLYPAFAKRKAITLGQNLRQRLGTSCQF  618



>emb|CDY36079.1| BnaA08g19690D [Brassica napus]
Length=618

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLK T LGEK        GT+ E+ Y   +SS +RSA+EQ+PAS SFVKL+DM++EE
Sbjct  524  LSMSLKTTLLGEKSQKYQKHPGTRAESAY---ASSAHRSAEEQIPASTSFVKLSDMSEEE  580

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLEK+QELLYPAFAKR+++T+G+   QRLGTSCQF
Sbjct  581  WTMFLEKYQELLYPAFAKRKAITLGQNLRQRLGTSCQF  618



>ref|XP_006430968.1| hypothetical protein CICLE_v10011271mg [Citrus clementina]
 ref|XP_006430969.1| hypothetical protein CICLE_v10011271mg [Citrus clementina]
 ref|XP_006430970.1| hypothetical protein CICLE_v10011271mg [Citrus clementina]
 gb|ESR44208.1| hypothetical protein CICLE_v10011271mg [Citrus clementina]
 gb|ESR44209.1| hypothetical protein CICLE_v10011271mg [Citrus clementina]
 gb|ESR44210.1| hypothetical protein CICLE_v10011271mg [Citrus clementina]
Length=639

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLKN ++GEK        GT  +NGYLA +SSG  S  EQLPAS +FVKLADM +EE
Sbjct  545  LSMSLKNITIGEKSW---RHEGTMQKNGYLAGTSSGNMSVHEQLPASTTFVKLADMNEEE  601

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            WA +LEKFQ+LLYPAF   +SV+VG++Q QRLG SCQF
Sbjct  602  WAQYLEKFQKLLYPAFTNHKSVSVGQRQKQRLGASCQF  639



>gb|KDO72317.1| hypothetical protein CISIN_1g006592mg [Citrus sinensis]
Length=627

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLKN ++GEK        GT  +NGYLA +SSG  S  E LPAS SFVKLADM +EE
Sbjct  533  LSVSLKNITIGEKSW---RHEGTMQKNGYLAGTSSGNMSVHEHLPASTSFVKLADMNEEE  589

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            WA +LEKFQ+LLYPAF   +SV+VG++Q QRLG SCQF
Sbjct  590  WAQYLEKFQKLLYPAFTNHKSVSVGQRQKQRLGASCQF  627



>ref|XP_006482449.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X5 [Citrus sinensis]
Length=627

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLKN ++GEK        GT  +NGYLA +SSG  S  E LPAS SFVKLADM +EE
Sbjct  533  LSVSLKNITIGEKSW---RHEGTMQKNGYLAGTSSGNMSVHEHLPASTSFVKLADMNEEE  589

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            WA +LEKFQ+LLYPAF   +SV+VG++Q QRLG SCQF
Sbjct  590  WAQYLEKFQKLLYPAFTNHKSVSVGQRQKQRLGASCQF  627



>gb|KDO72313.1| hypothetical protein CISIN_1g006592mg [Citrus sinensis]
 gb|KDO72314.1| hypothetical protein CISIN_1g006592mg [Citrus sinensis]
 gb|KDO72315.1| hypothetical protein CISIN_1g006592mg [Citrus sinensis]
 gb|KDO72316.1| hypothetical protein CISIN_1g006592mg [Citrus sinensis]
Length=639

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLKN ++GEK        GT  +NGYLA +SSG  S  E LPAS SFVKLADM +EE
Sbjct  545  LSVSLKNITIGEKSW---RHEGTMQKNGYLAGTSSGNMSVHEHLPASTSFVKLADMNEEE  601

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            WA +LEKFQ+LLYPAF   +SV+VG++Q QRLG SCQF
Sbjct  602  WAQYLEKFQKLLYPAFTNHKSVSVGQRQKQRLGASCQF  639



>ref|XP_006482445.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X1 [Citrus sinensis]
 ref|XP_006482446.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X2 [Citrus sinensis]
 ref|XP_006482447.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X3 [Citrus sinensis]
 ref|XP_006482448.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X4 [Citrus sinensis]
Length=639

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLKN ++GEK        GT  +NGYLA +SSG  S  E LPAS SFVKLADM +EE
Sbjct  545  LSVSLKNITIGEKSW---RHEGTMQKNGYLAGTSSGNMSVHEHLPASTSFVKLADMNEEE  601

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            WA +LEKFQ+LLYPAF   +SV+VG++Q QRLG SCQF
Sbjct  602  WAQYLEKFQKLLYPAFTNHKSVSVGQRQKQRLGASCQF  639



>emb|CDX85013.1| BnaC05g20420D [Brassica napus]
Length=621

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLK+T LGEK        G + E+GY   +SSG+RSA+EQ+PAS SFVKL+DM++EE
Sbjct  527  LSMSLKSTLLGEKSQKYQKHPGARAESGY---ASSGHRSAEEQIPASTSFVKLSDMSEEE  583

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLEK+QELL PAFAKR+++T+G+   QRLGTSCQF
Sbjct  584  WKIFLEKYQELLCPAFAKRKAITLGQNLRQRLGTSCQF  621



>ref|XP_002890668.1| phosphatidylinositol 3-and 4-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66927.1| phosphatidylinositol 3-and 4-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=621

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = -2

Query  787  NNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSF  611
            N E +P I  LS SLK+T LGEK        G + E+ Y   +SS +RSADEQ+ +S SF
Sbjct  517  NLEKMPTITKLSMSLKSTLLGEKSQKYQKHPGARVESAY---ASSAHRSADEQILSSTSF  573

Query  610  VKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            VKL+DM++EEW  FLEK+QELLYPA  KR+SVT+G+KQ QRLGTSCQF
Sbjct  574  VKLSDMSEEEWTIFLEKYQELLYPAIEKRKSVTLGQKQRQRLGTSCQF  621



>emb|CDY34563.1| BnaC03g56630D [Brassica napus]
Length=618

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 74/101 (73%), Gaps = 3/101 (3%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMT  590
            I  LS SLK T LGEK        G + E+ Y   +SS +RSA+EQ+PAS SFV LADM+
Sbjct  521  ITKLSMSLKTTFLGEKSQKYQKHPGVRAESAY---ASSAHRSAEEQIPASTSFVNLADMS  577

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EEW  FLEK+QELLYPAFAKR+++T+G+   QRLGTSCQF
Sbjct  578  EEEWTMFLEKYQELLYPAFAKRKAITLGQNLRQRLGTSCQF  618



>gb|EYU22584.1| hypothetical protein MIMGU_mgv1a002776mg [Erythranthe guttata]
Length=639

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 106/161 (66%), Gaps = 10/161 (6%)
 Frame = -2

Query  919  TRNAFQ-FAFGG----NGQWPLSKLDestqeeeeseeeaeiST----GGPVVTNNEHIP-  770
            +++AF+ F FG     +G+ PL+KLDES +E E   EE E       G   VT     P 
Sbjct  479  SKSAFEDFGFGSFNHFHGRTPLAKLDESVEEVETEGEEEEEEEEQEKGLASVTALLRNPT  538

Query  769  IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMT  590
            +  LS SLKNTSLGEK    P   G K E  Y   SSSG+RSA+EQLPAS SFVK+ADM 
Sbjct  539  VTALSVSLKNTSLGEKSKKFPKFFGGKDEGSYAGSSSSGHRSANEQLPASASFVKVADMN  598

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EEW  FL+KFQ+LL PAFA+R+S+  G+KQ QRLGTSC+F
Sbjct  599  EEEWGLFLDKFQDLLNPAFAERKSLVFGQKQRQRLGTSCKF  639



>ref|XP_008379465.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X2 [Malus domestica]
Length=626

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 96/149 (64%), Gaps = 14/149 (9%)
 Frame = -2

Query  892  GGNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTN------NEHIP-IPILSKSLKNTS  734
            GGN ++ L+KL+ES +E+ E  E  E+    P+ TN       + IP +  LS SL+N S
Sbjct  485  GGNRRYTLTKLEESAEEDIEGLEGNEL----PLRTNECATVVQDQIPNVSKLSTSLRNIS  540

Query  733  LGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQ  554
            +GEK        G+  +NGYLA  SSG RS +EQLP S SFVKLADM +EEW  FLE FQ
Sbjct  541  IGEKSW---RHLGSTQKNGYLAGISSGNRSVNEQLPVSSSFVKLADMNEEEWMRFLENFQ  597

Query  553  ELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             LL PAFA R++   G++Q QRLGTSCQF
Sbjct  598  RLLRPAFANRKTGNAGQRQRQRLGTSCQF  626



>ref|XP_008379464.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X1 [Malus domestica]
Length=638

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 96/149 (64%), Gaps = 14/149 (9%)
 Frame = -2

Query  892  GGNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTN------NEHIP-IPILSKSLKNTS  734
            GGN ++ L+KL+ES +E+ E  E  E+    P+ TN       + IP +  LS SL+N S
Sbjct  497  GGNRRYTLTKLEESAEEDIEGLEGNEL----PLRTNECATVVQDQIPNVSKLSTSLRNIS  552

Query  733  LGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQ  554
            +GEK        G+  +NGYLA  SSG RS +EQLP S SFVKLADM +EEW  FLE FQ
Sbjct  553  IGEKSW---RHLGSTQKNGYLAGISSGNRSVNEQLPVSSSFVKLADMNEEEWMRFLENFQ  609

Query  553  ELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             LL PAFA R++   G++Q QRLGTSCQF
Sbjct  610  RLLRPAFANRKTGNAGQRQRQRLGTSCQF  638



>ref|XP_008230310.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Prunus 
mume]
Length=639

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 97/155 (63%), Gaps = 7/155 (5%)
 Frame = -2

Query  919  TRNAFQF-AFGGNGQWPLSKLDestqeeeeseeeaei--STGGPVVTNNEHIP-IPILSK  752
            T   F+F + GGNG++ LSKL+E  +E  +  E  E+   +   V    + IP +  LS 
Sbjct  488  TERTFRFGSKGGNGRYLLSKLEEGVEEGVDGHEGNELPPRSDDCVSVVRDQIPNVSKLST  547

Query  751  SLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWAT  572
            SLKN S+GEK        G+  +NGYLA +SSG RS +EQ P S +FV LADM +EEW  
Sbjct  548  SLKNISVGEKSW---RHLGSMQKNGYLAGTSSGNRSVNEQRPMSSNFVMLADMNEEEWMR  604

Query  571  FLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FLE FQ LL PAFA R +  VG++Q QRLGTSCQF
Sbjct  605  FLENFQRLLRPAFANRNAGNVGQRQRQRLGTSCQF  639



>ref|XP_007214928.1| hypothetical protein PRUPE_ppa002721mg [Prunus persica]
 gb|EMJ16127.1| hypothetical protein PRUPE_ppa002721mg [Prunus persica]
Length=640

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 97/155 (63%), Gaps = 7/155 (5%)
 Frame = -2

Query  919  TRNAFQF-AFGGNGQWPLSKLDestqeeeeseeeaei--STGGPVVTNNEHIP-IPILSK  752
            T   F+F + GGNG++ LSKL+ES +E  E  E  E+   +   V    + IP +  LS 
Sbjct  489  TERTFRFGSKGGNGRYLLSKLEESVEEGMEGHEGNELPPRSDDCVSVVQDRIPNVSKLST  548

Query  751  SLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWAT  572
            SLKN S GEK        G+  +NGYLA +SSG RS +EQ P S +FV LADM +EEW  
Sbjct  549  SLKNISFGEKSW---RHLGSMQKNGYLAGTSSGNRSVNEQRPMSSNFVILADMNEEEWMR  605

Query  571  FLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FLE FQ LL PAFA R +  VG++Q QRLGTSCQF
Sbjct  606  FLENFQRLLRPAFANRNAGNVGQRQRQRLGTSCQF  640



>gb|KCW62794.1| hypothetical protein EUGRSUZ_G00381, partial [Eucalyptus grandis]
Length=624

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 92/148 (62%), Gaps = 6/148 (4%)
 Frame = -2

Query  949  MPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIP  770
            MPKM   + M R  F    G NG+ PLS+L++ ++EEEE + +         V   E IP
Sbjct  482  MPKMTMDDCMYRAHFDLGIGSNGRNPLSRLEKGSEEEEEKKRDDVAG-----VEAFERIP  536

Query  769  -IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADM  593
             +  LS  LKN  LG+K    P  SG   ENG++A +SSG+RSA+EQLPAS SFV L DM
Sbjct  537  SVSKLSMPLKNAVLGKKSPKQPKYSGMMQENGFMANTSSGHRSANEQLPASASFVNLVDM  596

Query  592  TDEEWATFLEKFQELLYPAFAKRRSVTV  509
             ++EW  FLE FQELL+PAF  R+S T+
Sbjct  597  REDEWLLFLEIFQELLHPAFDNRKSATL  624



>ref|XP_011467854.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467855.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Fragaria 
vesca subsp. vesca]
Length=639

 Score =   112 bits (280),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMT  590
            +P LS S+KN S+GEK      P G+  ++ Y   +SSG RSA+EQLP S SFVKLADM+
Sbjct  542  VPQLSTSMKNISIGEKSW---RPVGSMQKSSYATGTSSGNRSANEQLPMSSSFVKLADMS  598

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EEW  FLE +Q+LL PAFA R+   +G++Q QRLGTSCQF
Sbjct  599  EEEWMQFLENYQKLLRPAFANRKVGNLGQRQRQRLGTSCQF  639



>ref|XP_008353512.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Malus 
domestica]
Length=638

 Score =   112 bits (279),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 96/160 (60%), Gaps = 12/160 (8%)
 Frame = -2

Query  928  EFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiST-----GGPVVTNNEHIP-I  767
            E   RN    + GGNG++ LSKL+ES + + +     E+ +      G V    + IP +
Sbjct  485  ETEKRNFHCGSKGGNGRYXLSKLEESVEXDMDGLNGNELPSRLDECAGVV---QDRIPNV  541

Query  766  PILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTD  587
              LS SL+N S+GEK        G K +NG  A SSSG RS +EQLP S SFVKLADM  
Sbjct  542  SKLSASLRNISIGEKSW---RHLGLKQKNGCWAGSSSGNRSVNEQLPVSSSFVKLADMNK  598

Query  586  EEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EEW  FLE FQ LL PAFA R++   G++Q QRLGTSCQF
Sbjct  599  EEWMQFLENFQRLLRPAFANRKAGNXGQRQRQRLGTSCQF  638



>ref|XP_009373758.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Pyrus 
x bretschneideri]
Length=638

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 97/155 (63%), Gaps = 10/155 (6%)
 Frame = -2

Query  916  RNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTG----GPVVTNNEHIP-IPILSK  752
            RN    + GGNG++ LSKL+ES +E+ +  +  E+ +       VV N   IP +  LS 
Sbjct  489  RNFHLGSKGGNGRYALSKLEESVEEDMDRLDGNELPSRLDECASVVQN--RIPNVSKLSA  546

Query  751  SLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWAT  572
            SL+N S+GEK        G+  +NG  A +SSG RS +EQLP S SFVKL DM +EEW  
Sbjct  547  SLRNISIGEKSW---RHLGSTQKNGCWAGTSSGNRSVNEQLPVSSSFVKLVDMNEEEWMQ  603

Query  571  FLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FLE FQ LL PAFA R++   G++Q QRLGTSCQF
Sbjct  604  FLENFQRLLRPAFADRKAGNAGQRQKQRLGTSCQF  638



>gb|KHF99882.1| hypothetical protein F383_17303 [Gossypium arboreum]
Length=623

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 3/101 (3%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMT  590
            +P LS S+KN S+G+K     N      +NGYL+ +SSG RS +EQL  S  FVKLADM+
Sbjct  526  VPRLSMSMKNVSIGDKSWKHEN---VMQKNGYLSGTSSGNRSVNEQLAGSTRFVKLADMS  582

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EEW  +LE FQ L+Y AF+ R+S +VG++Q QRLGTSCQF
Sbjct  583  EEEWVQYLENFQHLVYLAFSNRKSGSVGQRQRQRLGTSCQF  623



>gb|KJB48256.1| hypothetical protein B456_008G060400 [Gossypium raimondii]
Length=623

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMT  590
            +P LS S+KN S+G+K     N      +NGYL+ +SSG RS +EQ   S  FVKLADM+
Sbjct  526  VPRLSMSMKNVSIGDKSWKHEN---VMQKNGYLSGTSSGNRSVNEQFAGSTRFVKLADMS  582

Query  589  DEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +EEW  +LE FQ L+Y AF+ R+S +VG++Q QRLGTSCQF
Sbjct  583  EEEWVQYLENFQHLVYLAFSNRKSASVGQRQRQRLGTSCQF  623



>dbj|BAF01661.1| hypothetical protein [Arabidopsis thaliana]
Length=191

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 11/108 (10%)
 Frame = -2

Query  778  HIPIPILSK---SLKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSF  611
            H   P LSK   S+KNT L +     P P +  K EN     +SSG++SA+EQLP S SF
Sbjct  91   HDKAPSLSKLSTSMKNTHLSDTTRKNPKPLTRGKSEN-----TSSGHKSANEQLPVSASF  145

Query  610  VKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            VK+ADM ++EW  FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  146  VKVADMKEDEWVLFLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  191



>ref|XP_010532452.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Tarenaya 
hassleriana]
Length=628

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 101/176 (57%), Gaps = 27/176 (15%)
 Frame = -2

Query  964  YRYECMPKMAFAEFMTR--NAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGP--  797
            +  +C   +  ++ MT+  +   F FG NG  PLSKL      EEE EE+ E S GGP  
Sbjct  470  FHIDCEESILGSDLMTKLPSLHGFTFG-NGHLPLSKL--EETIEEEVEEDGEYSEGGPDH  526

Query  796  ---VVTNNEHIPIPILSK---SLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADE  635
               +  +     IP +SK   SLK+T L +K    P   G + E            SA+E
Sbjct  527  GVSIAPSAGQKRIPTISKLSMSLKSTVLSDKYQMYPKYPGARAE------------SANE  574

Query  634  QLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            QLP S SFVK++DM +EEW  FLEKFQELLYPAFAKR+S T  +KQ QRLGTSCQF
Sbjct  575  QLPTSTSFVKISDMNEEEWPMFLEKFQELLYPAFAKRKSFT--QKQKQRLGTSCQF  628



>ref|XP_006290717.1| hypothetical protein CARUB_v10016815mg [Capsella rubella]
 gb|EOA23615.1| hypothetical protein CARUB_v10016815mg [Capsella rubella]
Length=622

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS S+KNT L +     P P +  K EN     +SSG++SA+EQLP S SFVK+ADM ++
Sbjct  531  LSTSMKNTHLSDTARKHPKPLTRGKSEN-----TSSGHKSANEQLPVSASFVKVADMKED  585

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EWA FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  586  EWALFLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  622



>ref|XP_006290718.1| hypothetical protein CARUB_v10016815mg [Capsella rubella]
 gb|EOA23616.1| hypothetical protein CARUB_v10016815mg [Capsella rubella]
Length=650

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS S+KNT L +     P P +  K EN     +SSG++SA+EQLP S SFVK+ADM ++
Sbjct  559  LSTSMKNTHLSDTARKHPKPLTRGKSEN-----TSSGHKSANEQLPVSASFVKVADMKED  613

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EWA FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  614  EWALFLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  650



>ref|XP_010032574.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Eucalyptus 
grandis]
 ref|XP_010032575.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Eucalyptus 
grandis]
 ref|XP_010032576.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Eucalyptus 
grandis]
 gb|KCW51973.1| hypothetical protein EUGRSUZ_J01417 [Eucalyptus grandis]
Length=613

 Score =   103 bits (257),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            L KSLK    GEK        GT    GYLA +SSG RS +EQLPA+ +FVKLADM  EE
Sbjct  519  LYKSLKCVHNGEKSW---QHLGTWQGTGYLAGTSSGNRSVNEQLPANSNFVKLADMDKEE  575

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLE FQE+L  AFA RRS ++G  Q QRLGTSCQF
Sbjct  576  WDQFLENFQEMLLTAFASRRSASMGHMQRQRLGTSCQF  613



>ref|NP_973413.1| phosphoinositide 4-kinase gamma 7 [Arabidopsis thaliana]
 gb|AEC05764.1| phosphoinositide 4-kinase gamma 7 [Arabidopsis thaliana]
Length=530

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 71/99 (72%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS S+KNT L +     P P +  K EN     +SSG++SA+EQLP S SFVK+ADM ++
Sbjct  439  LSTSMKNTHLSDTTRKNPKPLTRGKSEN-----TSSGHKSANEQLPVSASFVKVADMKED  493

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EW  FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  494  EWVLFLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  530



>ref|XP_010514157.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Camelina sativa]
Length=650

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS S+KNT L +     P P +  + EN     +SSG++SA+EQLP S SFVK+ADM ++
Sbjct  559  LSTSMKNTHLSDTARKHPKPLTRGRSEN-----TSSGHKSANEQLPMSASFVKVADMKED  613

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EWA FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  614  EWALFLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  650



>ref|XP_010502409.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Camelina sativa]
Length=650

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS S+KNT L +     P P +  + EN     +SSG++SA+EQLP S SFVK+ADM ++
Sbjct  559  LSTSMKNTHLSDTARKHPKPLTRGRSEN-----TSSGHKSANEQLPMSASFVKVADMKED  613

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EWA FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  614  EWALFLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  650



>ref|XP_010551350.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Tarenaya 
hassleriana]
Length=625

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -2

Query  649  RSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQ  470
            RSA+EQ+PAS SFV+L+DM +EEWA FL+KFQELLYPAFAKRRS T+G+KQ  RLGTSCQ
Sbjct  565  RSANEQIPASASFVRLSDMDEEEWAVFLDKFQELLYPAFAKRRSFTMGQKQRLRLGTSCQ  624

Query  469  F  467
            F
Sbjct  625  F  625



>ref|XP_002875236.1| phosphatidylinositol 3-and 4-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51495.1| phosphatidylinositol 3-and 4-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=650

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 71/99 (72%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS S+KNT L +     P P +  K EN     +SSG++SA+EQLP S SFVK+ADM ++
Sbjct  559  LSTSMKNTHLSDTARKHPKPLTRGKSEN-----TSSGHKSANEQLPVSASFVKVADMKED  613

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EW  FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  614  EWVLFLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  650



>ref|XP_007037675.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
 ref|XP_007037676.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
 gb|EOY22176.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
 gb|EOY22177.1| Phosphoinositide 4-kinase gamma 7, gamma 7,ubdk gamma 7,pi4k 
gamma 7 isoform 1 [Theobroma cacao]
Length=633

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 67/98 (68%), Gaps = 5/98 (5%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLK  +LGEK     +  G K +   +  SS   RSA+E LP S SFVK ADM++EE
Sbjct  541  LSLSLKKVNLGEKGF---HYHGGKQKGKMIGYSSRMIRSANEHLPTSTSFVKFADMSEEE  597

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  F+EKF+ELLYPAFAKRRS T+   Q QRLGTSCQF
Sbjct  598  WNLFIEKFKELLYPAFAKRRSRTI--VQRQRLGTSCQF  633



>ref|NP_565307.1| phosphoinositide 4-kinase gamma 7 [Arabidopsis thaliana]
 sp|Q9SI52.2|P4KG7_ARATH RecName: Full=Phosphatidylinositol 4-kinase gamma 7; Short=AtPI4Kgamma7; 
Short=PI-4Kgamma7; Short=PI4K gamma 7; AltName: 
Full=Ubiquitin-like domain kinase gamma 7; Short=UbDK gamma 
7 [Arabidopsis thaliana]
 gb|AAL06989.1| At2g03890/T18C20.9 [Arabidopsis thaliana]
 gb|AAD24822.2| expressed protein [Arabidopsis thaliana]
 gb|AAO11612.1| At2g03890/T18C20.9 [Arabidopsis thaliana]
 gb|AEC05763.1| phosphoinositide 4-kinase gamma 7 [Arabidopsis thaliana]
Length=650

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 71/99 (72%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS S+KNT L +     P P +  K EN     +SSG++SA+EQLP S SFVK+ADM ++
Sbjct  559  LSTSMKNTHLSDTTRKNPKPLTRGKSEN-----TSSGHKSANEQLPVSASFVKVADMKED  613

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EW  FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  614  EWVLFLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  650



>ref|XP_002267822.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Vitis vinifera]
 ref|XP_010663505.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Vitis vinifera]
 ref|XP_010663506.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Vitis vinifera]
Length=629

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 105/174 (60%), Gaps = 21/174 (12%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGGN-GQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED   +  PK++  +++ + + Q  F G  G+ PLS+LDE ++E+E          GG 
Sbjct  472  CEDAEVDMPPKLS-RDYLKKGSSQNGFKGVPGRNPLSRLDECSEEDEIEV------DGG-  523

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKL----GLPNPSGTKPENGYLACSSSGYRSADEQL  629
             +  ++   +  LS S+K   LGE+ L    G+P   G +   G    SS   RSA+EQL
Sbjct  524  -LGWDQFQNVAKLSISMKKVGLGERNLWNYGGIP--KGARAGGG---TSSGNRRSANEQL  577

Query  628  PASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             A+ SFV LADM++EEW  FLE+F+ELLYPAFA R+S T+  +Q QRLG+SCQF
Sbjct  578  AATTSFVTLADMSEEEWNLFLERFKELLYPAFANRQSATL--RQRQRLGSSCQF  629



>ref|XP_002281918.2| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Vitis vinifera]
Length=659

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 100/173 (58%), Gaps = 14/173 (8%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAF-GGNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED  ++ +P     + +T+    F F   NG+ PLSKL     EE   EE A    G  
Sbjct  497  CEDEEFDLIPSKE-EKLVTKTTSHFGFTSANGRNPLSKL-----EENVEEEAAAEIEGNG  550

Query  796  VVTNNEHIPIPI---LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
            +++  E   +P    LS SL+NT +G+K        G   ++G LA  SSG  S +EQLP
Sbjct  551  MLSQVEGSQVPSALKLSLSLENTKVGKKTW---QHQGAMLKDGCLAGPSSGNWSVNEQLP  607

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            AS SF +L D+  E+W  FLE FQ+LL PAFA R+S ++G++Q QRLGTSCQF
Sbjct  608  ASTSF-ELTDINGEDWTQFLEIFQKLLRPAFATRKSTSLGQRQRQRLGTSCQF  659



>ref|XP_010425186.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010425187.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X2 [Camelina sativa]
Length=650

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS S+KNT L +     P P +  + EN     +SSG++SA+EQLP S SFVK+ADM ++
Sbjct  559  LSTSMKNTHLSDTARKHPKPLTRGRSEN-----TSSGHKSANEQLPMSASFVKVADMKED  613

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EWA FLE+F ELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  614  EWALFLERFHELLGPAFAKRKTATLSKR--QRLGTSCQF  650



>ref|XP_010942262.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Elaeis 
guineensis]
 ref|XP_010942263.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Elaeis 
guineensis]
Length=641

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 10/111 (9%)
 Frame = -2

Query  784  NEHIP-IPILSKSLKNTSLGEK----KLGLPNPSGTKPENGYLACSSSGYRSADEQLPAS  620
            +E IP I  LS SLK  S+ EK    ++ +P   GT  +      + +G  SA+EQLPAS
Sbjct  536  HERIPNISKLSVSLKGGSITEKTAWCQVEVPKGDGTASKK-----NGNGSTSANEQLPAS  590

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             SFVKLADM +EEW  FLEKFQELL+ AF  R+S   G++Q QRLGTSCQF
Sbjct  591  TSFVKLADMDEEEWVVFLEKFQELLHSAFHGRKSGAAGQRQKQRLGTSCQF  641



>ref|XP_009407937.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=651

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 95/183 (52%), Gaps = 18/183 (10%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDe-----stqeeeeseeeaeiST  806
            ED++++          M  +   F FG NG  P S L         +EE + E +    T
Sbjct  472  EDFQFQMECNEDDQHVMYNSLHSFDFGLNGGCPRSLLSRLEESMEEEEENDEENKESSVT  531

Query  805  GGPVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYL----------ACSSS  656
            G P V   + + +  LS SLK  S+  K     N  GT+  N Y              S 
Sbjct  532  GFPHVCE-KLLYVSELSASLKGVSITGKTR--RNQVGTQNRNTYSTGKAYNRDGGGIQSV  588

Query  655  GYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTS  476
              RSADE LP+SVSFV+LADM +EEWA FLE FQELL  AF  R+ +T G++Q+QRLGTS
Sbjct  589  NSRSADETLPSSVSFVRLADMDEEEWAVFLENFQELLPNAFQHRKCLTTGQRQMQRLGTS  648

Query  475  CQF  467
            CQF
Sbjct  649  CQF  651



>ref|XP_009407938.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=639

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 95/183 (52%), Gaps = 18/183 (10%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDe-----stqeeeeseeeaeiST  806
            ED++++          M  +   F FG NG  P S L         +EE + E +    T
Sbjct  460  EDFQFQMECNEDDQHVMYNSLHSFDFGLNGGCPRSLLSRLEESMEEEEENDEENKESSVT  519

Query  805  GGPVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYL----------ACSSS  656
            G P V   + + +  LS SLK  S+  K     N  GT+  N Y              S 
Sbjct  520  GFPHVCE-KLLYVSELSASLKGVSITGKTR--RNQVGTQNRNTYSTGKAYNRDGGGIQSV  576

Query  655  GYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTS  476
              RSADE LP+SVSFV+LADM +EEWA FLE FQELL  AF  R+ +T G++Q+QRLGTS
Sbjct  577  NSRSADETLPSSVSFVRLADMDEEEWAVFLENFQELLPNAFQHRKCLTTGQRQMQRLGTS  636

Query  475  CQF  467
            CQF
Sbjct  637  CQF  639



>ref|XP_010943329.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Elaeis 
guineensis]
Length=649

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 73/115 (63%), Gaps = 8/115 (7%)
 Frame = -2

Query  787  NNEHIPIPILSKSLKNTSLGEKKL----GLP--NPSGTKPEN--GYLACSSSGYRSADEQ  632
            +N+   +  LS SLK  SL +K      G+P  N +  +  N  G     S   RSA+EQ
Sbjct  535  SNQFPKVSKLSTSLKGVSLTDKTQRYLDGVPKGNDTTVRTNNSGGASGLQSGSRRSANEQ  594

Query  631  LPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            LPAS+SFVKL+DM +EEW  FLEKFQELL+ AF  R+S   G++Q QRLGTSCQF
Sbjct  595  LPASMSFVKLSDMGEEEWGMFLEKFQELLHGAFRDRKSGAAGQRQRQRLGTSCQF  649



>ref|XP_006395665.1| hypothetical protein EUTSA_v10003797mg [Eutrema salsugineum]
 gb|ESQ32951.1| hypothetical protein EUTSA_v10003797mg [Eutrema salsugineum]
Length=649

 Score = 98.2 bits (243),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 68/95 (72%), Gaps = 8/95 (8%)
 Frame = -2

Query  748  LKNTSLGEKKLGLPNP-SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWAT  572
            +KNT L +     P P +  K EN     +SSG++SA+EQLP S SFVK+ADM ++EW  
Sbjct  562  MKNTHLSDTGRKAPKPLTRGKSEN-----TSSGHKSANEQLPVSASFVKVADMKEDEWVL  616

Query  571  FLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  617  FLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  649



>emb|CBI15360.3| unnamed protein product [Vitis vinifera]
Length=437

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 11/102 (11%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKL----GLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADM  593
            LS S+K   LGE+ L    G+P   G +   G    SS   RSA+EQL A+ SFV LADM
Sbjct  343  LSISMKKVGLGERNLWNYGGIPK--GARAGGG---TSSGNRRSANEQLAATTSFVTLADM  397

Query  592  TDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            ++EEW  FLE+F+ELLYPAFA R+S T+  +Q QRLG+SCQF
Sbjct  398  SEEEWNLFLERFKELLYPAFANRQSATL--RQRQRLGSSCQF  437



>gb|EYU28896.1| hypothetical protein MIMGU_mgv1a003628mg [Erythranthe guttata]
Length=573

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLK+TSLG+K   + N      +   +  SSSG+RSA EQL  SV FVKLADM + E
Sbjct  479  LSMSLKSTSLGKK---ISNQKFDGAKRDLIGSSSSGHRSASEQLSTSVGFVKLADMNEVE  535

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            WA FLEKF+ELL+PA AKR+S+T+G+ Q QRLGTSCQF
Sbjct  536  WAMFLEKFEELLFPAIAKRKSITLGQWQRQRLGTSCQF  573



>ref|XP_004299269.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Fragaria 
vesca subsp. vesca]
Length=623

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 84/150 (56%), Gaps = 16/150 (11%)
 Frame = -2

Query  907  FQFAFG---GNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIPIPILSKSLKNT  737
            F + FG    N  + L KLDES  E         ++    +   + + P+  LS SLK  
Sbjct  487  FSYPFGTEGANSHYLLPKLDESLVEGNVDLGTRAVTAERIINQPDWYKPVSKLSVSLKKL  546

Query  736  SLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKF  557
            ++ E   G     GT PE           RSA++QLP S SFVKLADM +EEW  FLEKF
Sbjct  547  NVDET--GQLQRMGTLPEI---------RRSANDQLPTSTSFVKLADMCEEEWVLFLEKF  595

Query  556  QELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +ELLYPAF+KRRS T+G  Q +RLGTSC F
Sbjct  596  RELLYPAFSKRRSTTIG--QRRRLGTSCTF  623



>ref|XP_008797596.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Phoenix 
dactylifera]
Length=643

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = -2

Query  784  NEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFV  608
            +E IP +  LS SLK   + EK    P      P+       ++   SA+EQLP S SFV
Sbjct  540  HERIPNVSKLSVSLKGVGIAEKT---PGYQVEVPKGDITTSKNNSNGSANEQLPTSTSFV  596

Query  607  KLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            KLADM +EEW  FL+KFQELL+ AF  R+S+  G++Q QRLGTSCQF
Sbjct  597  KLADMDEEEWGAFLDKFQELLHAAFRGRKSMAAGQRQKQRLGTSCQF  643



>gb|KDP24324.1| hypothetical protein JCGZ_25620 [Jatropha curcas]
Length=630

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            +S  L++ S+GE         G   ++GYLA +SSG RS +EQLPAS +FV LAD+T+ E
Sbjct  536  MSTLLRSISIGETSW---RHEGMMQKSGYLAGTSSGNRSVNEQLPASTTFVNLADLTERE  592

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  +L+ FQ+LL  AFA  +S  VG +  QRLGTSCQF
Sbjct  593  WMQYLDHFQKLLSSAFADHKSGNVGPRHRQRLGTSCQF  630



>ref|XP_012088103.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Jatropha 
curcas]
 ref|XP_012088104.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Jatropha 
curcas]
 ref|XP_012088105.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Jatropha 
curcas]
Length=642

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            +S  L++ S+GE         G   ++GYLA +SSG RS +EQLPAS +FV LAD+T+ E
Sbjct  548  MSTLLRSISIGETSW---RHEGMMQKSGYLAGTSSGNRSVNEQLPASTTFVNLADLTERE  604

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  +L+ FQ+LL  AFA  +S  VG +  QRLGTSCQF
Sbjct  605  WMQYLDHFQKLLSSAFADHKSGNVGPRHRQRLGTSCQF  642



>ref|XP_009391284.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391285.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Musa acuminata 
subsp. malaccensis]
Length=649

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 89/155 (57%), Gaps = 9/155 (6%)
 Frame = -2

Query  904  QFAF-GGNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIP-IPILSKSLKNTSL  731
             F F GG+ + PLSKL+   ++  +  E   +      ++  +H+P +  LS SLK   +
Sbjct  495  NFGFKGGSSRNPLSKLESLEEDVGDDNEVGNVEKSSCSLSVWDHLPKVSKLSTSLKGVRI  554

Query  730  GEKK----LGLPN--PSGTKPENGYLACS-SSGYRSADEQLPASVSFVKLADMTDEEWAT  572
             +K      G+P   PS +K   G  +     GY SA+EQLPAS SF+KL+DM + EWA 
Sbjct  555  ADKSQWYPAGVPKLKPSSSKTNIGGGSSRFKGGYGSANEQLPASASFMKLSDMGESEWAA  614

Query  571  FLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FLEKFQELL  AF  R+    G +Q QRLGTSCQF
Sbjct  615  FLEKFQELLQNAFHGRKCGASGLRQRQRLGTSCQF  649



>gb|EPS72797.1| hypothetical protein M569_01959, partial [Genlisea aurea]
Length=643

 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 96/170 (56%), Gaps = 3/170 (2%)
 Frame = -2

Query  973  CED-YRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED + +   P     E          FG  G+ PL KLDE+ +E++  EEE E      
Sbjct  476  CEDGFEFNTNPTPQQDEVPPPPPPPSHFGSGGRNPLFKLDETIEEDDVGEEEEEEKAWLS  535

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
            +  +   I IP LS SL NT LGEKK   P  S     +   + SSS   + D  LP SV
Sbjct  536  IARSPTEI-IPKLSMSLSNTILGEKKQKKPKFSAVSLVSSSSSSSSSHRSANDP-LPPSV  593

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFVK+ DM +EEW  FL++F EL+ PAF KR++ TVG+KQ QRLGTSC+F
Sbjct  594  SFVKVVDMKEEEWGLFLDRFVELVTPAFEKRKAATVGQKQRQRLGTSCKF  643



>ref|XP_006373417.1| hypothetical protein POPTR_0017s13590g [Populus trichocarpa]
 gb|ERP51214.1| hypothetical protein POPTR_0017s13590g [Populus trichocarpa]
Length=587

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 3/108 (3%)
 Frame = -2

Query  790  TNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSF  611
            T ++   I  +S  LK  S GE         G    +GYLA SSSG RS +EQLP+S+SF
Sbjct  483  TEDKITNISRMSMLLKKISGGENSW---RHEGEIRRSGYLAGSSSGNRSVNEQLPSSMSF  539

Query  610  VKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            V LAD+ + EW  FLE F++LL+PAF    S + G++Q QRLGTSCQF
Sbjct  540  VTLADLDEGEWVLFLENFKKLLHPAFTNCESGSAGQRQRQRLGTSCQF  587



>ref|XP_006485717.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X1 [Citrus sinensis]
 ref|XP_006485718.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X2 [Citrus sinensis]
Length=609

 Score = 94.0 bits (232),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 93/171 (54%), Gaps = 21/171 (12%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            C+D  ++   KM+  +F+ + +F +A    NG    S+++   ++E E          G 
Sbjct  458  CDDAEFDRASKMS-GDFLNQGSFSYASDILNGHHLPSEVESFEEDEAE----------GS  506

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACS-SSGYRSADEQLPAS  620
            + +  + +P+     SLK     E+     N    KPE   L  S S   RSA+E LP +
Sbjct  507  LESYGDKLPL-----SLKRMDSHERSQDYQN---GKPEGKCLVGSVSESRRSAEELLPTT  558

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             SFVKL DM +EEW  FLEKF+ELL+PA AKRR  T+G  Q QRLGTSC+F
Sbjct  559  TSFVKLTDMNEEEWLLFLEKFKELLHPALAKRRHTTIGHGQRQRLGTSCKF  609



>ref|XP_010928120.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Elaeis 
guineensis]
 ref|XP_010928121.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Elaeis 
guineensis]
 ref|XP_010928122.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Elaeis 
guineensis]
Length=647

 Score = 94.0 bits (232),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 66/103 (64%), Gaps = 5/103 (5%)
 Frame = -2

Query  760  LSKSLKNTSLGEKK---LG-LPNPSGTKPE-NGYLACSSSGYRSADEQLPASVSFVKLAD  596
            LS SLK  SL EK    LG +P  + T  + N   +   SG RSA EQLPAS SFV LAD
Sbjct  545  LSTSLKGVSLTEKTPQYLGRVPKGNDTTVKTNNSGSGLRSGSRSAKEQLPASASFVNLAD  604

Query  595  MTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            M +EEW  FLEKFQELLY AF  R+    G++Q QRLG SCQF
Sbjct  605  MGEEEWGLFLEKFQELLYGAFHGRKCGAAGQRQWQRLGASCQF  647



>ref|XP_008788927.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Phoenix dactylifera]
Length=650

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 73/119 (61%), Gaps = 10/119 (8%)
 Frame = -2

Query  799  PVVTNNEHIPIPILSKSLKNTSLGEKKL----GLP--NPSGTKPENGYLACS--SSGYRS  644
            PV+  N+   I  LS SLK  SL +K      G+P  N +  +  N   A    S   RS
Sbjct  534  PVI--NQFPNISKLSTSLKGVSLTDKTQRYLGGVPKGNDTTVRTNNSGSASGLQSGSRRS  591

Query  643  ADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            A+EQLPASVSFV LADM +EEW  FLEKFQELL+ AF   +S   G++Q QRLGTSCQF
Sbjct  592  ANEQLPASVSFVTLADMGEEEWGLFLEKFQELLHGAFRGWKSGAAGQRQRQRLGTSCQF  650



>emb|CDX83526.1| BnaC07g22660D [Brassica napus]
Length=615

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 3/79 (4%)
 Frame = -2

Query  700  SGTKP-ENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKR  524
            + TKP   G    +SSG++SA+EQL AS SFVK+ADM ++EW  FLE+FQELL PAFAKR
Sbjct  539  NNTKPLTRGKSENTSSGHKSANEQLQASASFVKVADMKEDEWVLFLERFQELLGPAFAKR  598

Query  523  RSVTVGRKQLQRLGTSCQF  467
            ++ T+ ++  QRLGTSCQF
Sbjct  599  KTATLSKR--QRLGTSCQF  615



>ref|XP_009152139.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7 [Brassica rapa]
Length=647

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 7/95 (7%)
 Frame = -2

Query  748  LKNTSLGEKKLGLPNPSGTKP-ENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWAT  572
            +KNT L +   G  N   TKP   G    +SSG++SA+EQL  S SFVK+ADM ++EW  
Sbjct  559  MKNTHLSDT--GRKN--NTKPLTRGKSENTSSGHKSANEQLQVSASFVKVADMKEDEWVL  614

Query  571  FLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FLE+FQELL PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  615  FLERFQELLGPAFAKRKTATLSKR--QRLGTSCQF  647



>emb|CBI16921.3| unnamed protein product [Vitis vinifera]
Length=532

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 67/98 (68%), Gaps = 4/98 (4%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SL+NT +G+K        G   ++G LA  SSG  S +EQLPAS SF +L D+  E+
Sbjct  439  LSLSLENTKVGKKTW---QHQGAMLKDGCLAGPSSGNWSVNEQLPASTSF-ELTDINGED  494

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLE FQ+LL PAFA R+S ++G++Q QRLGTSCQF
Sbjct  495  WTQFLEIFQKLLRPAFATRKSTSLGQRQRQRLGTSCQF  532



>ref|XP_006440828.1| hypothetical protein CICLE_v10019356mg [Citrus clementina]
 ref|XP_006440829.1| hypothetical protein CICLE_v10019356mg [Citrus clementina]
 gb|ESR54068.1| hypothetical protein CICLE_v10019356mg [Citrus clementina]
 gb|ESR54069.1| hypothetical protein CICLE_v10019356mg [Citrus clementina]
 gb|KDO65632.1| hypothetical protein CISIN_1g037804mg [Citrus sinensis]
Length=609

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 95/171 (56%), Gaps = 21/171 (12%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAFGG-NGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            C+D  ++   KM+  +F+ + +F +A    NG    S+++   ++E E          G 
Sbjct  458  CDDAEFDWASKMS-GDFLNQGSFSYASNILNGHHLPSEVESFEEDEAE----------GS  506

Query  796  VVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACS-SSGYRSADEQLPAS  620
            + +  + +P+     SL  T   E+     N +G KPE   L  S S   RSA+E LP +
Sbjct  507  LESYGDKLPL-----SLNRTDSHERSQ--DNQNG-KPEGKCLVGSVSESRRSAEELLPTT  558

Query  619  VSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             SFVKL DM +EEW  FLEKF+ELL+PA AK+R  T+G  Q QRLGTSC+F
Sbjct  559  TSFVKLTDMNEEEWLLFLEKFKELLHPALAKQRHTTIGHGQRQRLGTSCKF  609



>ref|XP_003621581.1| Phosphatidylinositol 4-kinase type 2-beta [Medicago truncatula]
 gb|ABN09050.1| Phosphatidylinositol 3- and 4-kinase, catalytic [Medicago truncatula]
 gb|AES77799.1| phosphatidylinositol 3- and 4-kinase [Medicago truncatula]
Length=632

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 87/141 (62%), Gaps = 9/141 (6%)
 Frame = -2

Query  889  GNGQWPLSKLDestqeeeeseeeaeiSTGGPVVTNNEHIPIPILSKSLKNTSLGEKKLGL  710
            GN +  LSKL+ES  EEEE E +A  ++ G +V N     I  LS+S+KNT++ E+ L  
Sbjct  501  GNSRLKLSKLEESVIEEEEEECDAYSNSMGKLVLN-----ISKLSESVKNTTINERSL--  553

Query  709  PNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFA  530
               S  K  +G L  +SSG  S +E L  S SFVKL DM +E+W  FLE FQ LL PAF 
Sbjct  554  -QNSSVKQRSGSLVGTSSGNTSVNE-LITSSSFVKLTDMDEEKWNQFLENFQRLLVPAFV  611

Query  529  KRRSVTVGRKQLQRLGTSCQF  467
              +   +G++Q QRLGTSCQF
Sbjct  612  NCKERNLGKRQRQRLGTSCQF  632



>ref|XP_007139389.1| hypothetical protein PHAVU_008G025300g [Phaseolus vulgaris]
 gb|ESW11383.1| hypothetical protein PHAVU_008G025300g [Phaseolus vulgaris]
Length=641

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 12/114 (11%)
 Frame = -2

Query  808  TGGPVVTNNEHIPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQL  629
             G P V+N        LS S+KNT  GEK       SG K ++G+LA +SSG  + ++ L
Sbjct  540  NGVPNVSN--------LSLSVKNTRTGEKAW---QQSGVKQKSGFLAGTSSGNTTVND-L  587

Query  628  PASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            PAS SFVKL DM +++W  FLE FQ+ L PAF+  +   V +KQ QRLGTSCQF
Sbjct  588  PASSSFVKLTDMDEDKWNQFLENFQKRLIPAFSNCKRRNVSKKQRQRLGTSCQF  641



>ref|XP_008809667.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Phoenix 
dactylifera]
Length=645

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 98/186 (53%), Gaps = 35/186 (19%)
 Frame = -2

Query  973  CEDYRYECMPKMAFAEFMTRNAFQFAF-GGNGQWPLSKLDestqeeeeseeeaeiSTGGP  797
            CED     MP+       T  ++ F F GG+ + PLSKL+E  +EE  +    +      
Sbjct  478  CEDE--PVMPR-------TPPSYNFGFKGGSSRNPLSKLEERLEEEGNNYSNEK------  522

Query  796  VVTNNEHIP-----------IPILSKSLKNTSLGEKKL----GLPNPSGTKPE-NGYLAC  665
              +N E +P           +  LS SLK  SL EK L    G+P  + T    N   + 
Sbjct  523  --SNVEEVPCFPPACNQFPNVSKLSTSLKGVSLAEKTLQYLGGVPKGNDTTVRTNNSGSG  580

Query  664  SSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRL  485
              SG RSA E LPA+ SFVKLADM +EEW  FLEKF+ELL+ AF  R+    G++Q QRL
Sbjct  581  LQSGSRSAKE-LPATASFVKLADMGEEEWGLFLEKFKELLHGAFRGRKCGAAGQRQWQRL  639

Query  484  GTSCQF  467
            G SCQF
Sbjct  640  GASCQF  645



>emb|CDY48067.1| BnaA06g33610D [Brassica napus]
Length=616

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 3/79 (4%)
 Frame = -2

Query  700  SGTKP-ENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKR  524
            + TKP   G    +SSG++SA+EQL  S SFVK+ADM ++EW  FLE+FQELL PAFAKR
Sbjct  540  NNTKPLTRGKSENTSSGHKSANEQLQVSASFVKVADMKEDEWVLFLERFQELLGPAFAKR  599

Query  523  RSVTVGRKQLQRLGTSCQF  467
            ++ T+ ++  QRLGTSCQF
Sbjct  600  KTATLSKR--QRLGTSCQF  616



>ref|XP_008240066.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Prunus 
mume]
 ref|XP_008240067.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Prunus 
mume]
Length=602

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 13/98 (13%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS SLKN  +GE+            +   +   S+  RSA++QLP S+SFVK+ADM++E+
Sbjct  518  LSVSLKNIDVGERS-----------QQQGIGTVSAIRRSANDQLPTSISFVKVADMSEEQ  566

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLEK +ELLYPAF  RR  T G  Q QRLG+SC+F
Sbjct  567  WILFLEKVRELLYPAFGNRRRATTG--QRQRLGSSCKF  602



>ref|XP_009381646.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381647.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381648.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381649.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381650.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381651.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381652.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 65/106 (61%), Gaps = 8/106 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKK----LGLPNP----SGTKPENGYLACSSSGYRSADEQLPASVSFVK  605
            LS SLK  +L  K     +G P+     S  K   G         RSA+EQLPA+V+FVK
Sbjct  545  LSTSLKGIALAGKSQRCLVGAPSANFTCSKIKNSGGASRSQVGNSRSANEQLPANVNFVK  604

Query  604  LADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            LADM +EEW+ FLEKFQELL  AF  R+    G++Q QRLGTSCQF
Sbjct  605  LADMGEEEWSAFLEKFQELLPGAFRSRKCGAAGQRQKQRLGTSCQF  650



>ref|XP_003531889.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoformX1 
[Glycine max]
 ref|XP_006585818.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X2 [Glycine max]
Length=638

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 62/98 (63%), Gaps = 4/98 (4%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS S+KNT  GEK        G K ++G+LA +SSG  + +E LPAS  FVKL DM +E 
Sbjct  545  LSVSVKNTRTGEKSR---QQMGVKQKSGFLAGTSSGNTTVNE-LPASSCFVKLTDMDEER  600

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLE FQ L+ PAF   +   V +KQ QRLGTSCQF
Sbjct  601  WNQFLENFQRLVIPAFVNCKRGNVSKKQRQRLGTSCQF  638



>ref|XP_009410293.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410294.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = -2

Query  760  LSKSLKNTSLGEKK----LGLPNPSGTKPENGYLACSSSGY--RSADEQLPASVSFVKLA  599
            LS SLK  +L         G+P  + T   N   A    G   RSA+EQLPASVSFVKLA
Sbjct  547  LSASLKTMTLAGNSQNYVAGVPRANCTTGRNSGGASGLQGRNSRSANEQLPASVSFVKLA  606

Query  598  DMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            DM +EEW+ FLEKFQELL  AF  R+    G++  QRLG+SCQF
Sbjct  607  DMGEEEWSAFLEKFQELLQGAFRSRKCGATGQRLKQRLGSSCQF  650



>gb|KJB08119.1| hypothetical protein B456_001G066500 [Gossypium raimondii]
Length=635

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -2

Query  760  LSKSLKN-TSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS SLK   +LG K     +  G KPE  +    SS  RSA+EQL  S SFVK ADM +E
Sbjct  542  LSLSLKRINNLGPKGF---HYHGQKPERTHTMDYSSRMRSANEQLLTSTSFVKFADMNEE  598

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EW  F+ KF++LL PAFA RRS T+G +  QRLGTSCQF
Sbjct  599  EWNLFIVKFKKLLCPAFANRRSRTIGER--QRLGTSCQF  635



>ref|XP_010528004.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X3 [Tarenaya hassleriana]
Length=641

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 97/173 (56%), Gaps = 20/173 (12%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPVV  791
            +D      PKMA  ++ TRN F      NG+  L+KL ES +EEE+  EE          
Sbjct  484  DDLELVSGPKMATDDYFTRNPF-----SNGRSSLAKLHESIEEEEDETEEDPPMQERSYF  538

Query  790  TNNEHIP-IPILSK---SLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA  623
             ++++    P LSK   S+KNT + E     P  +G +              SA+EQ P 
Sbjct  539  DSDDYFERDPSLSKISMSMKNTHISETGQKYPKFNGNR--------VVENTSSANEQGPG  590

Query  622  -SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             S SFVK+ADM +EEWA FLE+F ELL+PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  591  MSASFVKVADMREEEWAMFLERFHELLHPAFAKRKTATMRKR--QRLGTSCQF  641



>ref|XP_006665104.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Oryza 
brachyantha]
Length=700

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 90/160 (56%), Gaps = 12/160 (8%)
 Frame = -2

Query  910  AFQFAF-GGNGQWPLSKLDestqeeeeseeeaeiST---GGPVVTNNEHIPIPILSKSLK  743
            A+ F   GG+ + PLSKLDE+T+EEE   EE E +    G P   N     I  LS SL 
Sbjct  541  AYHFELKGGSSRNPLSKLDEATEEEEYDIEEEESNAEKLGYPQAVNKWLPNISKLSTSLN  600

Query  742  NTSLGEK-KLGLPNP----SGTKPENGYLACSSS---GYRSADEQLPASVSFVKLADMTD  587
               L +K +  LP         K  +G  + S S    +RSA+EQLP S SFVKLADM  
Sbjct  601  GVRLSDKIQRQLPAAPMVADSMKTSDGNNSHSGSQVGNWRSANEQLPTSASFVKLADMGA  660

Query  586  EEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            E W  FLEKFQELL  AF  R+  T G++  QRLGTSCQF
Sbjct  661  ETWVLFLEKFQELLPGAFRSRKCGTTGQRARQRLGTSCQF  700



>ref|XP_010528002.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010528003.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like isoform 
X2 [Tarenaya hassleriana]
Length=641

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 97/173 (56%), Gaps = 20/173 (12%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPVV  791
            +D      PKMA  ++ TRN F      NG+  L+KL ES +EEE+  EE          
Sbjct  484  DDLELVSGPKMATDDYFTRNPF-----SNGRSSLAKLHESIEEEEDETEEDPPMQERSYF  538

Query  790  TNNEHIP-IPILSK---SLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA  623
             ++++    P LSK   S+KNT + E     P  +G +              SA+EQ P 
Sbjct  539  DSDDYFERDPSLSKISMSMKNTHISETGQKYPKFNGNR--------VVENTSSANEQGPG  590

Query  622  -SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             S SFVK+ADM +EEWA FLE+F ELL+PAFAKR++ T+ ++  QRLGTSCQF
Sbjct  591  MSASFVKVADMREEEWAMFLERFHELLHPAFAKRKTATMRKR--QRLGTSCQF  641



>ref|XP_010101631.1| putative phosphatidylinositol 4-kinase type 2-beta [Morus notabilis]
 gb|EXB89100.1| putative phosphatidylinositol 4-kinase type 2-beta [Morus notabilis]
Length=620

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  682  NGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGR  503
            N  +   S   RSA+EQLP + S+VKLADM +EEW  FL+KF+ELLYPAF KR S T  +
Sbjct  549  NRRMGSLSGIARSANEQLPTTRSYVKLADMNNEEWTMFLDKFKELLYPAFVKRSSATAEQ  608

Query  502  KQLQRLGTSCQF  467
            +Q  RLGTSC+F
Sbjct  609  RQKLRLGTSCRF  620



>gb|KHN45095.1| Putative phosphatidylinositol 4-kinase type 2-beta [Glycine soja]
Length=794

 Score = 88.6 bits (218),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS S+KNT  GEK        G K ++G+LA +SSG  + +E LPAS  FV L DM +E 
Sbjct  701  LSVSVKNTRTGEKSR---QQMGVKQKSGFLAGTSSGNTTVNE-LPASSCFVNLTDMDEER  756

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLE FQ L+ PAF   +   V +KQ QRLGTSCQF
Sbjct  757  WNQFLENFQRLVIPAFVNCKRGNVSKKQRQRLGTSCQF  794



>gb|EEC80404.1| hypothetical protein OsI_22556 [Oryza sativa Indica Group]
Length=700

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 91/160 (57%), Gaps = 12/160 (8%)
 Frame = -2

Query  910  AFQFAF-GGNGQWPLSKLDestqeeeeseeeaeiST---GGPVVTNNEHIPIPILSKSLK  743
            A+ F   GG+ + PLSKLDE+ +EEE+  EE E +    G P   N     I  LS SL 
Sbjct  541  AYHFELKGGSSRNPLSKLDEAIEEEEDDIEEEESNAEKLGYPKAINKWLPNISKLSTSLN  600

Query  742  NTSLGEK-KLGLP------NPSGTKPENGYLACSSSG-YRSADEQLPASVSFVKLADMTD  587
               LG+K +  LP      +P      N   + S  G +RSA+EQLP S SFVKLADM  
Sbjct  601  GVRLGDKIQCQLPAAPKIMDPVKIFEGNSNHSGSQVGNWRSANEQLPTSASFVKLADMGS  660

Query  586  EEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            E WA FLEKFQELL  AF  R+    G++  QRLGTSCQF
Sbjct  661  ETWALFLEKFQELLPEAFRSRKCGAAGQRARQRLGTSCQF  700



>ref|NP_001057397.1| Os06g0283400 [Oryza sativa Japonica Group]
 dbj|BAD69260.1| phosphatidylinositol 3- and 4-kinase family-like [Oryza sativa 
Japonica Group]
 dbj|BAF19311.1| Os06g0283400 [Oryza sativa Japonica Group]
 gb|EEE65532.1| hypothetical protein OsJ_20987 [Oryza sativa Japonica Group]
Length=700

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 91/160 (57%), Gaps = 12/160 (8%)
 Frame = -2

Query  910  AFQFAF-GGNGQWPLSKLDestqeeeeseeeaeiST---GGPVVTNNEHIPIPILSKSLK  743
            A+ F   GG+ + PLSKLDE+ +EEE+  EE E +    G P   N     I  LS SL 
Sbjct  541  AYHFELKGGSSRNPLSKLDEAIEEEEDDIEEEESNAEKLGYPKAINKWLPNISKLSTSLN  600

Query  742  NTSLGEK-KLGLP------NPSGTKPENGYLACSSSG-YRSADEQLPASVSFVKLADMTD  587
               LG+K +  LP      +P      N   + S  G +RSA+EQLP S SFVKLADM  
Sbjct  601  GVRLGDKIQCQLPAAPKIMDPVKIFEGNSNHSGSQVGNWRSANEQLPTSASFVKLADMGS  660

Query  586  EEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            E WA FLEKFQELL  AF  R+    G++  QRLGTSCQF
Sbjct  661  ETWALFLEKFQELLPEAFRSRKCGAAGQRARQRLGTSCQF  700



>gb|KHG01930.1| hypothetical protein F383_21230 [Gossypium arboreum]
Length=636

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 3/78 (4%)
 Frame = -2

Query  697  GTKPENGY-LACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRR  521
            G KPE  + +  SS   RSA+EQL  S SFVKLADM +EEW  F+ KF++LL PAFA RR
Sbjct  561  GQKPERTHTMDYSSRMRRSANEQLLTSTSFVKLADMNEEEWNLFIVKFKKLLCPAFANRR  620

Query  520  SVTVGRKQLQRLGTSCQF  467
            S T+G +  QRLGTSCQF
Sbjct  621  SRTIGER--QRLGTSCQF  636



>ref|XP_003552619.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Glycine 
max]
Length=638

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 67/113 (59%), Gaps = 8/113 (7%)
 Frame = -2

Query  802  GPVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
            GPV+     +P +  LS SL+NT   EK        G K ++ +LA +SSG  + +E LP
Sbjct  533  GPVLNG---VPNVSKLSVSLQNTRTSEKSW---QQMGVKQKSDFLAGTSSGNTTVNE-LP  585

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            AS SFVKL DM +E W  FLE FQ LL P F   +   V +KQ QRLGTSCQF
Sbjct  586  ASSSFVKLTDMDEERWNQFLENFQRLLIPDFVNYKRGNVSKKQRQRLGTSCQF  638



>gb|KHN13767.1| Putative phosphatidylinositol 4-kinase type 2-beta [Glycine soja]
Length=638

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 67/113 (59%), Gaps = 8/113 (7%)
 Frame = -2

Query  802  GPVVTNNEHIP-IPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLP  626
            GPV+     +P +  LS SL+NT   EK        G K ++ +LA +SSG  + +E LP
Sbjct  533  GPVLNG---VPNVSKLSVSLQNTRTSEKSW---QQMGAKQKSDFLAGTSSGNTTVNE-LP  585

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            AS SFVKL DM +E W  FLE FQ LL P F   +   V +KQ QRLGTSCQF
Sbjct  586  ASSSFVKLTDMDEERWNQFLENFQRLLIPDFVNYKRGNVSKKQRQRLGTSCQF  638



>ref|XP_004491949.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like isoform X1 [Cicer arietinum]
 ref|XP_004491950.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like isoform X2 [Cicer arietinum]
 ref|XP_004491951.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like isoform X3 [Cicer arietinum]
 ref|XP_004491952.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like isoform X4 [Cicer arietinum]
Length=625

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = -2

Query  775  IPIPILSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLAD  596
            I I  LS S+KN ++ EK   L + +G K  +G LA  SSG  + +E L +S SFVKL+D
Sbjct  528  INISKLSASVKNATIDEK--SLQHSAGVKQRSGSLAGISSGNTNMNELLTSS-SFVKLSD  584

Query  595  MTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSC  473
            M +E+W TFLE FQ LL PAF   +  ++G++Q QRLGTSC
Sbjct  585  MDEEKWNTFLEIFQRLLVPAFLNCKQWSLGKRQRQRLGTSC  625



>ref|XP_007210230.1| hypothetical protein PRUPE_ppa015565mg [Prunus persica]
 gb|EMJ11429.1| hypothetical protein PRUPE_ppa015565mg [Prunus persica]
Length=589

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 50/61 (82%), Gaps = 2/61 (3%)
 Frame = -2

Query  649  RSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQ  470
            RSA++QLP S+SFVK+ADM++E+W  FLEK +ELLYPAF  RR  T+G  Q QRLG+SC+
Sbjct  531  RSANDQLPTSISFVKVADMSEEQWILFLEKVRELLYPAFGNRRRATIG--QRQRLGSSCK  588

Query  469  F  467
            F
Sbjct  589  F  589



>gb|ABR25357.1| phosphatidylinositol 3- and 4-kinase family protein [Oryza sativa 
Indica Group]
Length=91

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -2

Query  715  GLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPA  536
            GL  PS  K  +G      +  RSADEQLP+SV FV+L+DM  EEW  FLEKFQELL  A
Sbjct  11   GLKFPSADKS-SGSNGSVHALNRSADEQLPSSVYFVRLSDMNAEEWNIFLEKFQELLKEA  69

Query  535  FAKRRSVTVGRKQLQRLGTSCQF  467
              + R+   G++  QRLGTSC+F
Sbjct  70   L-QERAAAAGQRMKQRLGTSCKF  91



>ref|XP_010694275.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010694284.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010694293.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Beta vulgaris 
subsp. vulgaris]
Length=600

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = -2

Query  700  SGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRR  521
            S  +P  GYL  +S G  SA+E LP S SFV LADM +EEW  FLE FQ+LL+PAF   +
Sbjct  524  SAVQP-GGYLFGTSPGNGSANELLPRSSSFVTLADMNEEEWLVFLENFQKLLHPAFVNHK  582

Query  520  SVTVGRKQLQRLGTSCQF  467
            +   G++ +QRLGTSC+F
Sbjct  583  AGRTGQRLMQRLGTSCKF  600



>ref|XP_010495469.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Camelina 
sativa]
Length=616

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 67/104 (64%), Gaps = 8/104 (8%)
 Frame = -2

Query  775  IPIPILSKSLKNTSLGEKK-LGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLA  599
            +P+  LS SLKN SL      G   P   K E   ++     ++SA+ QLPAS +FVKLA
Sbjct  520  LPLTKLSTSLKNHSLSNNMGSGFLKPPRVKTEKTLVS-----HKSANVQLPASANFVKLA  574

Query  598  DMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +M + EW  FLEKFQELL  AFA+R+++T+  +  QRLGTSC+F
Sbjct  575  EMKEVEWVMFLEKFQELLDSAFAERKTMTL--RNRQRLGTSCKF  616



>dbj|BAJ95204.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = -2

Query  772  PIPILSKSLKNTSLGEK----KLGLPNPSGTKPENGYLACSS---SGYRSADEQLPASVS  614
            P+  LS SLK      K    + G+P       +  Y    S   SG RSA+E LP S S
Sbjct  540  PVSTLSASLKGIGFRGKAKPYRGGIPKSKVAAAKTNYSGEGSMYQSGSRSANEMLPPSAS  599

Query  613  FVKLADMTDEEWATFLEKFQELLYPAF-AKRRSVTVGRKQLQRLGTSCQF  467
            FVKL+DM  EEW+ FL+KFQELL  AF A++ +   G + LQRLGTSCQF
Sbjct  600  FVKLSDMGSEEWSAFLDKFQELLPSAFRARKHAAGAGPRPLQRLGTSCQF  649



>ref|XP_009337827.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Pyrus 
x bretschneideri]
 ref|XP_009337835.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Pyrus 
x bretschneideri]
Length=634

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = -2

Query  670  ACSSSGYR-SADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQL  494
            A + SG R SA++QLP S  FVK+ADM++EEW  FLEKF ELLYPAF  RRS T+  +Q 
Sbjct  568  AATISGIRRSANDQLPTSPCFVKVADMSEEEWILFLEKFGELLYPAFGNRRSATL--RQR  625

Query  493  QRLGTSCQF  467
            +RLGTSC+F
Sbjct  626  KRLGTSCRF  634



>ref|XP_002448727.1| hypothetical protein SORBIDRAFT_06g032160 [Sorghum bicolor]
 gb|EES13055.1| hypothetical protein SORBIDRAFT_06g032160 [Sorghum bicolor]
Length=625

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = -2

Query  706  NPSGTKP--ENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAF  533
            NPS +KP  +NG +A  S+  RSADEQLP+S+ FV+L+DM+ +EW  FLEKF+ELL  A 
Sbjct  545  NPSSSKPIGQNG-IASKSAMNRSADEQLPSSMCFVRLSDMSADEWDVFLEKFKELLKEAL  603

Query  532  AKRRSVTVGRKQLQRLGTSCQF  467
             +      G++  QRLGTSC+F
Sbjct  604  HESARTAAGQRMKQRLGTSCKF  625



>ref|XP_010554259.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Tarenaya 
hassleriana]
 ref|XP_010554260.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Tarenaya 
hassleriana]
 ref|XP_010554261.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Tarenaya 
hassleriana]
 ref|XP_010554262.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Tarenaya 
hassleriana]
 ref|XP_010554263.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Tarenaya 
hassleriana]
Length=614

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 97/172 (56%), Gaps = 31/172 (18%)
 Frame = -2

Query  970  EDYRYECMPKMAFAEFMTRNAFQFAFGGNGQWPLSKLDestqeeeeseeeaeiSTGGPVV  791
            +D       K A  ++ TRN F      NG+  L+KL+E  +EEEE++            
Sbjct  470  DDLELASGSKTAADDYFTRNPF-----SNGRSSLAKLEEEEEEEEEND-----------T  513

Query  790  TNNEHIP-IPILSKSLKNTSL---GEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA  623
             NN   P +  LS ++KNT L   G++K   P   GT+ EN       +  RS DE +  
Sbjct  514  ENNFDAPSLSKLSVTMKNTHLSNMGQQKY--PKFVGTRGEN-------TSNRSTDELIRT  564

Query  622  SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            S SFVK+ADMT++EW  FLE+F ELL+PAFAKR++ T+ ++  Q LGTSC+F
Sbjct  565  SESFVKVADMTEDEWTLFLERFHELLHPAFAKRKTETLRKR--QGLGTSCRF  614



>ref|NP_563930.1| phosphatidylinositol 4-kinase gamma 6 [Arabidopsis thaliana]
 sp|Q8W4R8.1|P4KG6_ARATH RecName: Full=Phosphatidylinositol 4-kinase gamma 6; Short=AtPI4Kgamma6; 
Short=PI-4Kgamma6; Short=PI4K gamma 6 [Arabidopsis 
thaliana]
 gb|AAL31202.1| At1g13640/F21F23_7 [Arabidopsis thaliana]
 gb|AAN31098.1| At1g13640/F21F23_7 [Arabidopsis thaliana]
 gb|AEE29053.1| phosphatidylinositol 3- and 4-kinase-like protein [Arabidopsis 
thaliana]
Length=622

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS S+KN        G   P    P++     +   ++SA+ QLP SV+FVKLADM + E
Sbjct  531  LSTSMKNNLSNTMGSGYLKP----PKDNQTDKALVSHKSANVQLPLSVNFVKLADMKEVE  586

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLE+FQELLY AFA+R+++T+  +  QRLGTSC+F
Sbjct  587  WVVFLERFQELLYSAFAERKTMTL--RNTQRLGTSCKF  622



>gb|AAF81291.1|AC027656_8 Strong similarity to an unknown protein At2g03890 gi|4582436 
from Arabidopsis thaliana BAC T18C20 gb|AC007196. ESTs gb|AI993825, 
gb|T13863, gb|N65091, gb|AI998990, gb|W43493 and gb|AA585974 
come from this gene [Arabidopsis thaliana]
Length=620

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS S+KN        G   P    P++     +   ++SA+ QLP SV+FVKLADM + E
Sbjct  529  LSTSMKNNLSNTMGSGYLKP----PKDNQTDKALVSHKSANVQLPLSVNFVKLADMKEVE  584

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLE+FQELLY AFA+R+++T+  +  QRLGTSC+F
Sbjct  585  WVVFLERFQELLYSAFAERKTMTL--RNTQRLGTSCKF  620



>ref|XP_002892764.1| phosphatidylinositol 3-and 4-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH69023.1| phosphatidylinositol 3-and 4-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=623

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 6/103 (6%)
 Frame = -2

Query  763  ILSKSLKNTSLGEKKLGLPNPSGTK----PENGYLACSSSGYRSADEQLPASVSFVKLAD  596
            IL+ SL   S   K   L N  G+     P +     +   ++SA+ QLP S +FVKLAD
Sbjct  523  ILTISLSKLSTSMKNNNLSNTMGSGHLKPPRDNKTDKALVSHKSANVQLPVSANFVKLAD  582

Query  595  MTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            M + EW  FLE+FQELL+ AFA+R+++T+  +  QRLGTSC+F
Sbjct  583  MKEVEWVVFLERFQELLHSAFAERKTLTL--RNTQRLGTSCKF  623



>ref|XP_008393261.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Malus 
domestica]
 ref|XP_008351872.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Malus 
domestica]
Length=657

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = -2

Query  670  ACSSSGYR-SADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQL  494
            A + SG R SA++QLP S  FVK+ADM++EEW  FLE F+ELLYPAF  +RS T+  +Q 
Sbjct  591  AATISGIRRSANDQLPTSPCFVKVADMSEEEWILFLEXFRELLYPAFGNQRSATL--RQR  648

Query  493  QRLGTSCQF  467
            QRLGTSC+F
Sbjct  649  QRLGTSCRF  657



>gb|ACF22722.1| phosphatidylinositol kinase family-like protein, partial [Brachypodium 
distachyon]
Length=473

 Score = 81.6 bits (200),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 49/79 (62%), Gaps = 9/79 (11%)
 Frame = -2

Query  703  PSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKR  524
            P GT P N         +RSA+EQLP S SFVKLADM  E W  FLEKF ELL  AF  R
Sbjct  404  PKGTDPGN---------WRSANEQLPTSASFVKLADMGMETWGLFLEKFHELLPGAFNSR  454

Query  523  RSVTVGRKQLQRLGTSCQF  467
            +    G++  QRLGTSCQF
Sbjct  455  KCGATGQRAKQRLGTSCQF  473



>ref|XP_010227761.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-kinase 
gamma 5-like [Brachypodium distachyon]
Length=686

 Score = 82.0 bits (201),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 49/79 (62%), Gaps = 9/79 (11%)
 Frame = -2

Query  703  PSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKR  524
            P GT P N         +RSA+EQLP S SFVKLADM  E W  FLEKF ELL  AF  R
Sbjct  617  PKGTDPGN---------WRSANEQLPTSASFVKLADMGMETWGLFLEKFHELLPGAFNSR  667

Query  523  RSVTVGRKQLQRLGTSCQF  467
            +    G++  QRLGTSCQF
Sbjct  668  KCGATGQRAKQRLGTSCQF  686



>ref|XP_002462528.1| hypothetical protein SORBIDRAFT_02g027450 [Sorghum bicolor]
 gb|EER99049.1| hypothetical protein SORBIDRAFT_02g027450 [Sorghum bicolor]
Length=648

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 70/113 (62%), Gaps = 8/113 (7%)
 Frame = -2

Query  781  EHIP-IPILSKSLKNTS-LGEKKL---GLPNPSGTKPEN--GYLACSSSGYRSADEQLPA  623
            + IP I  LS S+K    +G+ KL   G+P    T   N  G  +   SG RSA+E LP 
Sbjct  536  QKIPSISKLSSSMKGLGFIGKSKLYRRGVPKGKVTGRTNYSGKASEHQSGSRSANELLPP  595

Query  622  SVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVT-VGRKQLQRLGTSCQF  467
            S SFVKL+DM+ +EW+ FLEKFQELL  AF  R+    VG++ + RLGTSCQF
Sbjct  596  SASFVKLSDMSPKEWSAFLEKFQELLPGAFHTRKHTAGVGQRPMPRLGTSCQF  648



>ref|XP_010476371.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6 [Camelina sativa]
Length=620

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKK-LGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS SLKN SL      G   P   K E   ++     ++SA+ QLPAS +FVKLA+M + 
Sbjct  529  LSTSLKNHSLSNNMGSGFLKPPRVKTEKTLVS-----HKSANVQLPASANFVKLAEMKEV  583

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            +W  FLEKFQELL  AFA+R+++T+  +  QRLGTSC+F
Sbjct  584  DWVVFLEKFQELLDSAFAERKTMTL--RNRQRLGTSCKF  620



>gb|EMT25946.1| Phosphatidylinositol 4-kinase type 2-alpha [Aegilops tauschii]
Length=639

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = -2

Query  658  SGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAF-AKRRSVTVGRKQLQRLG  482
            SG RSA+E LP S SFVKL+DM  EEW  FL+KFQELL  AF A++ +   G + LQRLG
Sbjct  575  SGSRSANEMLPPSASFVKLSDMGSEEWTAFLDKFQELLPSAFQARKHAAGAGPRPLQRLG  634

Query  481  TSCQF  467
            TSCQF
Sbjct  635  TSCQF  639



>ref|XP_010238261.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Brachypodium 
distachyon]
Length=648

 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = -2

Query  769  IPILSKSLKNTSL-GEKK---LGLPNPSGTKPEN--GYLACSSSGYRSADEQLPASVSFV  608
            I  LS SLK     G+ K    G+P    T   N  G  +   SG RSA+E LP S SFV
Sbjct  541  ISKLSASLKGAGFFGKAKPYHRGIPKSKVTAKTNSSGEGSMHQSGSRSANEMLPPSASFV  600

Query  607  KLADMTDEEWATFLEKFQELLYPAF-AKRRSVTVGRKQLQRLGTSCQF  467
            KL+DM  EEW+ FL+KFQ LL  AF A++ +  VG + +QRLGTSCQF
Sbjct  601  KLSDMGPEEWSAFLDKFQALLPGAFRARKHTAGVGPRPMQRLGTSCQF  648



>emb|CDY56175.1| BnaC05g49350D [Brassica napus]
Length=611

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 59/98 (60%), Gaps = 10/98 (10%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEE  581
            LS   K+  +G   L  P     K        + S ++SA+  LP S +FVKLADM + E
Sbjct  524  LSTLTKDNKMGSMYLNTPRDETEK--------TLSSHKSANVLLPVSTNFVKLADMIEAE  575

Query  580  WATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            W  FLEKFQELL  AFA+RR++T+  +  QRLGTSCQF
Sbjct  576  WVVFLEKFQELLDSAFAERRTMTL--RSRQRLGTSCQF  611



>ref|XP_010458817.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Camelina 
sativa]
 ref|XP_010458818.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Camelina 
sativa]
Length=616

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 63/99 (64%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKK-LGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDE  584
            LS SLKN  L      G   P   K E   ++     ++SA+ QLPAS +FVKLA+M + 
Sbjct  525  LSTSLKNHCLSNNMGSGFLKPPRVKTEKTLVS-----HKSANVQLPASANFVKLAEMKEA  579

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EW  FLEKFQELL  AFA+R+++T+  +  QRLGTSC+F
Sbjct  580  EWVMFLEKFQELLDSAFAERKTMTL--RNRQRLGTSCKF  616



>gb|AEV41104.1| phosphatidylinositol 3- and 4-kinase family protein [Oryza officinalis]
Length=627

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 56/87 (64%), Gaps = 10/87 (11%)
 Frame = -2

Query  715  GLPNPSGTKPENGYLACSSSGY----RSADEQLPASVSFVKLADMTDEEWATFLEKFQEL  548
            GL  PSG K      +CS+       RSADEQLP+SV FV+L+DM  EEW  FLEKFQEL
Sbjct  547  GLKFPSGDKS-----SCSNGSVHALNRSADEQLPSSVCFVRLSDMNAEEWNIFLEKFQEL  601

Query  547  LYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            L  A  + R+   G++  QRLGTSC+F
Sbjct  602  LKEAL-QERAAAAGQRMKQRLGTSCKF  627



>ref|XP_006652988.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like, partial 
[Oryza brachyantha]
Length=591

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 4/84 (5%)
 Frame = -2

Query  718  LGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYP  539
            L LP+   +   NG +   +   RSADEQLP+SV FV+L+DM  EEW+ FLEKFQELL  
Sbjct  512  LKLPSADKSSGSNGSVHALN---RSADEQLPSSVCFVRLSDMNAEEWSIFLEKFQELLKE  568

Query  538  AFAKRRSVTVGRKQLQRLGTSCQF  467
            A  + R+   G++  QRLGTSC+F
Sbjct  569  AL-QERAAAAGQRMKQRLGTSCKF  591



>gb|EEC84748.1| hypothetical protein OsI_31747 [Oryza sativa Indica Group]
Length=630

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 8/114 (7%)
 Frame = -2

Query  784  NEHIP-IPILSKSLKNTS-LGEKKL---GLPNPSGTKPEN--GYLACSSSGYRSADEQLP  626
            ++HIP +  LS S K    +G+ +    G+P    T   N  G  +   SG RSA+E LP
Sbjct  517  SKHIPSVSKLSASFKGLGFIGKARAYHKGVPKNKVTAKTNYSGKGSEHQSGSRSANELLP  576

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAF-AKRRSVTVGRKQLQRLGTSCQF  467
             S SFVKL+DM  +EW+ FL+KFQELL  AF A++ +   G + LQRLGTSCQF
Sbjct  577  PSASFVKLSDMGSDEWSAFLDKFQELLPSAFRARKHAAADGPRPLQRLGTSCQF  630



>gb|EAZ45098.1| hypothetical protein OsJ_29736 [Oryza sativa Japonica Group]
Length=648

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 8/114 (7%)
 Frame = -2

Query  784  NEHIP-IPILSKSLKNTS-LGEKKL---GLPNPSGTKPEN--GYLACSSSGYRSADEQLP  626
            ++HIP +  LS S K    +G+ +    G+P    T   N  G  +   SG RSA+E LP
Sbjct  535  SKHIPSVSKLSASFKGLGFIGKARAYHKGVPKNKVTAKTNYSGKGSEHQSGSRSANELLP  594

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAF-AKRRSVTVGRKQLQRLGTSCQF  467
             S SFVKL+DM  +EW+ FL+KFQELL  AF A++ +   G + LQRLGTSCQF
Sbjct  595  PSASFVKLSDMGSDEWSAFLDKFQELLPSAFRARKHAAADGPRPLQRLGTSCQF  648



>ref|NP_001063457.1| Os09g0474800 [Oryza sativa Japonica Group]
 dbj|BAD34349.1| phosphatidylinositol 3- and 4-kinase family-like [Oryza sativa 
Japonica Group]
 dbj|BAF25371.1| Os09g0474800 [Oryza sativa Japonica Group]
 dbj|BAG90096.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94711.1| unnamed protein product [Oryza sativa Japonica Group]
Length=660

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 8/114 (7%)
 Frame = -2

Query  784  NEHIP-IPILSKSLKNTS-LGEKKL---GLPNPSGTKPEN--GYLACSSSGYRSADEQLP  626
            ++HIP +  LS S K    +G+ +    G+P    T   N  G  +   SG RSA+E LP
Sbjct  547  SKHIPSVSKLSASFKGLGFIGKARAYHKGVPKNKVTAKTNYSGKGSEHQSGSRSANELLP  606

Query  625  ASVSFVKLADMTDEEWATFLEKFQELLYPAF-AKRRSVTVGRKQLQRLGTSCQF  467
             S SFVKL+DM  +EW+ FL+KFQELL  AF A++ +   G + LQRLGTSCQF
Sbjct  607  PSASFVKLSDMGSDEWSAFLDKFQELLPSAFRARKHAAADGPRPLQRLGTSCQF  660



>ref|XP_006417104.1| hypothetical protein EUTSA_v10007082mg [Eutrema salsugineum]
 gb|ESQ35457.1| hypothetical protein EUTSA_v10007082mg [Eutrema salsugineum]
Length=621

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = -2

Query  694  TKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSV  515
            +KP       + S ++SA+ QLP S  FVKLADM + EW  FLE+FQELL  AFA+R+++
Sbjct  548  SKPSRDKTEKTLSRHKSANVQLPVSARFVKLADMNEVEWVVFLERFQELLDSAFAERKTM  607

Query  514  TVGRKQLQRLGTSCQF  467
            T+  +  QRLGTSCQF
Sbjct  608  TLSIR--QRLGTSCQF  621



>ref|NP_001288372.1| uncharacterized protein LOC103632899 [Zea mays]
 ref|XP_008652835.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Zea mays]
 gb|ACN31314.1| unknown [Zea mays]
 gb|ACR34808.1| unknown [Zea mays]
Length=647

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = -2

Query  772  PIPILSKSLKNTS-LGEKKL----GLPNPSGTKPEN--GYLACSSSGYRSADEQLPASVS  614
            PI  LS S+K    +G+ K     G+P    T   N  G  +   SG RSA+E LP S S
Sbjct  538  PISKLSSSMKGLGFIGKSKPYRTGGVPKGKVTGRTNYSGKASEHQSGSRSANELLPPSAS  597

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRR-SVTVGRKQLQRLGTSCQF  467
            FVKL+DM+ +EW+ FLEKFQELL  A   R+ S  VG++ + RLGTSCQF
Sbjct  598  FVKLSDMSRKEWSAFLEKFQELLPSALRTRKHSAGVGQRPMPRLGTSCQF  647



>ref|NP_001151804.1| phosphatidylinositol 3- and 4-kinase family protein [Zea mays]
 gb|ACG44357.1| phosphatidylinositol 3- and 4-kinase family protein [Zea mays]
Length=621

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  670  ACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQ  491
            A  S+  RSADEQLP+S+ FV+L+DM+ +EW  FLEKFQELL  A  +     VG++  Q
Sbjct  554  ASKSAMNRSADEQLPSSMCFVRLSDMSADEWDVFLEKFQELLKEALHESARAAVGQRMKQ  613

Query  490  RLGTSCQF  467
            RLGTSC+F
Sbjct  614  RLGTSCKF  621



>gb|ACL53462.1| unknown [Zea mays]
 gb|ACN28620.1| unknown [Zea mays]
 gb|AFW59807.1| phosphatidylinositol 3-and 4-kinase family protein [Zea mays]
Length=621

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  670  ACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQ  491
            A  S+  RSADEQLP+S+ FV+L+DM+ +EW  FLEKFQELL  A  +     VG++  Q
Sbjct  554  ASKSAMNRSADEQLPSSMCFVRLSDMSADEWDVFLEKFQELLKEALHESARAAVGQRMKQ  613

Query  490  RLGTSCQF  467
            RLGTSC+F
Sbjct  614  RLGTSCKF  621



>emb|CDX98118.1| BnaA06g08690D [Brassica napus]
Length=347

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = -2

Query  658  SGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGT  479
            S ++SA+  LP S +FVKLADM + EW  FLEKFQELL  AFA+R+++T+  +  QRLGT
Sbjct  286  SSHKSANVLLPVSTNFVKLADMVEVEWVVFLEKFQELLDSAFAERQTMTL--RSSQRLGT  343

Query  478  SCQF  467
            SCQF
Sbjct  344  SCQF  347



>gb|AEV41011.1| phosphatidylinositol 3- and 4-kinase family protein [Oryza minuta]
Length=629

 Score = 79.3 bits (194),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = -2

Query  715  GLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPA  536
            GL  PS  K  +G      +  RSADEQLP+SV FV+L+DM  EEW  FLEKFQELL  A
Sbjct  549  GLKFPSADK-SSGSNGSVHALNRSADEQLPSSVCFVRLSDMNAEEWNIFLEKFQELLKEA  607

Query  535  FAKRRSVTVGRKQLQRLGTSCQF  467
              + R+   G++ ++RLGTSC+F
Sbjct  608  L-QERAAAAGQRMMRRLGTSCKF  629



>ref|NP_001054197.1| Os04g0668700 [Oryza sativa Japonica Group]
 emb|CAE02809.1| OSJNBa0043A12.14 [Oryza sativa Japonica Group]
 emb|CAH68315.1| B0811B10.16 [Oryza sativa Indica Group]
 dbj|BAF16111.1| Os04g0668700 [Oryza sativa Japonica Group]
Length=605

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -2

Query  715  GLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPA  536
            GL  PS  K  +G      +  RSADEQLP+SV FV+L+DM  EEW  FLEKFQELL  A
Sbjct  525  GLKFPSADK-SSGSNGSVHALNRSADEQLPSSVYFVRLSDMNAEEWNIFLEKFQELLKEA  583

Query  535  FAKRRSVTVGRKQLQRLGTSCQF  467
              + R+   G++  QRLGTSC+F
Sbjct  584  L-QERAAAAGQRMKQRLGTSCKF  605



>gb|AEV41058.1| phosphatidylinositol 3- and 4-kinase family protein [Oryza minuta]
Length=627

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 10/87 (11%)
 Frame = -2

Query  715  GLPNPSGTKPENGYLACSSSGY----RSADEQLPASVSFVKLADMTDEEWATFLEKFQEL  548
            GL  PS  K      +CS+       RSADEQLP+SV FV+L+DM  EEW  FLEKFQEL
Sbjct  547  GLKFPSADKS-----SCSNGSVHALNRSADEQLPSSVCFVRLSDMNAEEWNIFLEKFQEL  601

Query  547  LYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            L  A  + R+   G++  QRLGTSC+F
Sbjct  602  LKEAL-QERAAAAGQRMKQRLGTSCKF  627



>gb|EEC78215.1| hypothetical protein OsI_17848 [Oryza sativa Indica Group]
Length=638

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -2

Query  715  GLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPA  536
            GL  PS  K  +G      +  RSADEQLP+SV FV+L+DM  EEW  FLEKFQELL  A
Sbjct  558  GLKFPSADK-SSGSNGSVHALNRSADEQLPSSVYFVRLSDMNAEEWNIFLEKFQELLKEA  616

Query  535  FAKRRSVTVGRKQLQRLGTSCQF  467
              + R+   G++  QRLGTSC+F
Sbjct  617  L-QERAAAAGQRMKQRLGTSCKF  638



>gb|AEV40961.1| phosphatidylinositol 3- and 4-kinase family protein [Oryza punctata]
Length=628

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -2

Query  649  RSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQ  470
            RSADEQLP+SV FV+L+DM  EEW  FLEKFQELL  A  + R+   G++ ++RLGTSC+
Sbjct  569  RSADEQLPSSVCFVRLSDMNAEEWNIFLEKFQELLKEAL-QERAAAAGQRMMRRLGTSCK  627

Query  469  F  467
            F
Sbjct  628  F  628



>gb|EEE61869.1| hypothetical protein OsJ_16555 [Oryza sativa Japonica Group]
Length=638

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -2

Query  715  GLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPA  536
            GL  PS  K  +G      +  RSADEQLP+SV FV+L+DM  EEW  FLEKFQELL  A
Sbjct  558  GLKFPSADK-SSGSNGSVHALNRSADEQLPSSVYFVRLSDMNAEEWNIFLEKFQELLKEA  616

Query  535  FAKRRSVTVGRKQLQRLGTSCQF  467
              + R+   G++  QRLGTSC+F
Sbjct  617  L-QERAAAAGQRMKQRLGTSCKF  638



>ref|XP_004960221.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like [Setaria italica]
Length=616

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -2

Query  670  ACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQ  491
            A  S+  RSADEQL +S+ FV+L+DM+ +EW  FLEKFQELL  A  +R     G++  Q
Sbjct  549  ATKSAMNRSADEQLQSSMCFVRLSDMSADEWNVFLEKFQELLKEALQERARAAAGQRMKQ  608

Query  490  RLGTSCQF  467
            RLGTSC+F
Sbjct  609  RLGTSCKF  616



>emb|CDO98537.1| unnamed protein product [Coffea canephora]
Length=637

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYR-SADEQLPASVSFVKLADMTDE  584
            LSKSLK       ++ L   SG KP+   LA ++   R S +E LP +  FV LAD ++E
Sbjct  546  LSKSLK-------RIDLVKSSGQKPKLACLAGTTCAQRRSGNELLPITTGFVNLADPSEE  598

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EW  FL KFQELL  AFA R+S ++  KQ QR GTS +F
Sbjct  599  EWILFLSKFQELLGAAFANRKSSSIALKQRQRQGTSREF  637



>ref|XP_006307009.1| hypothetical protein CARUB_v10008594mg [Capsella rubella]
 gb|EOA39907.1| hypothetical protein CARUB_v10008594mg [Capsella rubella]
Length=620

 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 62/102 (61%), Gaps = 5/102 (5%)
 Frame = -2

Query  763  ILSKSLKNTSLGEKKLGLPNPSGTK---PENGYLACSSSGYRSADEQLPASVSFVKLADM  593
            IL++SL   S+  K   L N  G+    P       +   ++SA+ QLP S +FVKLA+M
Sbjct  521  ILTRSLTKLSVSLKNHNLSNNMGSGFLIPPRDKTDKTLVSHKSANVQLPVSANFVKLAEM  580

Query  592  TDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
             +  W  FLEKFQELL  AF +R+++T+  +  QRLGTSC+F
Sbjct  581  KEVVWVVFLEKFQELLGSAFTERKTMTL--RNRQRLGTSCKF  620



>ref|XP_006660740.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Oryza 
brachyantha]
Length=657

 Score = 75.9 bits (185),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = -2

Query  658  SGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAF-AKRRSVTVGRKQLQRLG  482
            SG RSA+E LP S SFVKL+DM  EEW+ FL+K +ELL  AF A++ +   G + LQRLG
Sbjct  593  SGSRSANELLPPSASFVKLSDMGPEEWSAFLDKLKELLPSAFRARKHTAAGGPRPLQRLG  652

Query  481  TSCQF  467
            TSCQF
Sbjct  653  TSCQF  657



>ref|XP_002438242.1| hypothetical protein SORBIDRAFT_10g010450 [Sorghum bicolor]
 gb|EER89609.1| hypothetical protein SORBIDRAFT_10g010450 [Sorghum bicolor]
Length=653

 Score = 75.9 bits (185),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 58/109 (53%), Gaps = 8/109 (7%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKL-------GLPNPSGTKPENGYLACSS-SGYRSADEQLPASVS  614
            I  LS SLK  +L +K            +P+ T   N     S    + SA++ LP SVS
Sbjct  545  ISKLSTSLKGVNLTDKTQRQLSAGPKFVDPANTSKSNSNDTGSQLCNWGSANDMLPTSVS  604

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            FVKLADM  E W  FLEKFQELL   F  R+     ++  QRLGTSCQF
Sbjct  605  FVKLADMKPETWGLFLEKFQELLPETFRSRKCSVTAQRAKQRLGTSCQF  653



>ref|XP_008670267.1| PREDICTED: phosphatidylinositol 4-kinase gamma 7-like [Zea mays]
 tpg|DAA40322.1| TPA: hypothetical protein ZEAMMB73_350252 [Zea mays]
Length=650

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = -2

Query  658  SGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSV--TVGRKQLQRL  485
            SG RSA+E LP S SFVKL+DM+ ++W+ FL+KFQELL  A + R+     VG++ + RL
Sbjct  585  SGSRSANELLPPSASFVKLSDMSPKQWSAFLDKFQELLPGALSARKHAAGVVGQRSMPRL  644

Query  484  GTSCQF  467
            GTSCQF
Sbjct  645  GTSCQF  650



>ref|XP_004965234.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like [Setaria italica]
Length=661

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  646  SADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SA++ LPASVSFVKLADM  E W  FLEKF+ELL  AF  R+     ++  QRLGTSCQF
Sbjct  602  SANDMLPASVSFVKLADMGPEMWGLFLEKFRELLPEAFRSRKCSVTAQRAKQRLGTSCQF  661



>gb|EMT13521.1| Phosphatidylinositol 4-kinase type 2-beta [Aegilops tauschii]
Length=463

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -2

Query  649  RSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQ  470
            RSADEQLP+S+ FV+L+DM+ EEW  F+EKFQELL  A  + ++   G++  QRLGTSC+
Sbjct  404  RSADEQLPSSLCFVRLSDMSAEEWHVFVEKFQELLKEALEECKA-AAGQRMKQRLGTSCK  462

Query  469  F  467
            F
Sbjct  463  F  463



>ref|XP_004957104.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like [Setaria italica]
Length=652

 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 7/93 (8%)
 Frame = -2

Query  742  NTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLE  563
            +T + + K+   N SG   E+       SG RSA+E LP S SFVK++DM   EW+ FL+
Sbjct  566  HTGVPKGKVSKTNYSGKASEH------QSGSRSANELLPPSASFVKVSDMGPREWSAFLD  619

Query  562  KFQELLYPAFAKRRSVTVGR-KQLQRLGTSCQF  467
             FQELL  AF  R+  T G  +Q+ RLGTSCQF
Sbjct  620  MFQELLPNAFRARKHTTGGGPRQMPRLGTSCQF  652



>ref|XP_008659457.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Zea mays]
 gb|AFW86357.1| hypothetical protein ZEAMMB73_818102 [Zea mays]
Length=642

 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 61/110 (55%), Gaps = 13/110 (12%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEK---------KLGLPNPSGTKPENGYLACSSSGYRSADEQLPASV  617
            I  LS SLK  +L  K         K   P  S +  ++G   C+   + SA++ LP+SV
Sbjct  537  ISKLSTSLKGVNLTNKTQRQLYAGPKFVDPVKSNSN-DSGSQHCN---WGSANDMLPSSV  592

Query  616  SFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            SFVKLADM  E W  FLEKF ELL   F  R+ +   ++  QRLGTSCQF
Sbjct  593  SFVKLADMKPETWCLFLEKFHELLPETFRSRKCIVKEQRAKQRLGTSCQF  642



>dbj|BAK02490.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -2

Query  649  RSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQ  470
            RSADEQLP+S+ FV+L+DM  EEW  F+EKFQELL  A  + ++   G++  QRLGTSC+
Sbjct  573  RSADEQLPSSLCFVRLSDMNAEEWHVFVEKFQELLKEALEECKAA-AGQRMKQRLGTSCK  631

Query  469  F  467
            F
Sbjct  632  F  632



>gb|EMT31973.1| Phosphatidylinositol 4-kinase type 2-beta [Aegilops tauschii]
Length=738

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  652  YRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSC  473
            +R+A+EQLP S SFVKLADM  + W  FLEKFQELL  AF   +    G++   R+GTSC
Sbjct  677  WRTANEQLPTSASFVKLADMGVDTWGLFLEKFQELLPGAFRAHKLGATGQRGRLRMGTSC  736

Query  472  QF  467
            QF
Sbjct  737  QF  738



>gb|AHF50148.1| PI4KIIgamma [Triticum aestivum]
Length=629

 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -2

Query  649  RSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQ  470
            RSADEQLP+S+ F +L+DM+ EEW  F+EKFQELL  A  + ++   G++  QRLGTSC+
Sbjct  570  RSADEQLPSSLCFFRLSDMSAEEWHVFVEKFQELLKEALEECKAAG-GQRMKQRLGTSCK  628

Query  469  F  467
            F
Sbjct  629  F  629



>ref|XP_003580777.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Brachypodium 
distachyon]
Length=624

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -2

Query  649  RSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQ  470
            RSADEQLP+S+ FV+ ADM+ EEW  F+EKFQELL  A  + ++    R +L R+GTSC+
Sbjct  565  RSADEQLPSSMCFVRFADMSTEEWHVFIEKFQELLKEALDECKAAAGQRMKL-RMGTSCK  623

Query  469  F  467
            F
Sbjct  624  F  624



>tpg|DAA61913.1| TPA: hypothetical protein ZEAMMB73_755135, partial [Zea mays]
Length=369

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 63/106 (59%), Gaps = 8/106 (8%)
 Frame = -2

Query  772  PIPILSKSLKNTS-LGEKKL----GLPNPSGTKPEN--GYLACSSSGYRSADEQLPASVS  614
            PI  LS S+K    +G+ K     G+P    T   N  G  +   SG RSA+E LP S S
Sbjct  213  PISKLSSSMKGLGFIGKSKPYRTGGVPKGKVTGRTNYSGKASEHQSGSRSANELLPPSAS  272

Query  613  FVKLADMTDEEWATFLEKFQELLYPAFAKRR-SVTVGRKQLQRLGT  479
            FVKL+DM+ +EW+ FLEKFQELL  A   R+ S  VG++ + RLGT
Sbjct  273  FVKLSDMSRKEWSAFLEKFQELLPSALRTRKHSAGVGQRPMPRLGT  318



>ref|XP_004973762.1| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta 
At1g26270-like [Setaria italica]
Length=657

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = -2

Query  769  IPILSKSLKNTSLGEKKLGLP-NPSGTKPE--NGYLACSSSGYRSADEQLPASVSFVKLA  599
            +P+  K L  +   +++ G+P N    K +  +GY +   S   SA+E LP S SFVKL+
Sbjct  553  LPVSLKGLCFSGNSKRRNGVPKNRVSAKTDYCSGYHSEYQSAGWSANEMLPPSSSFVKLS  612

Query  598  DMTDEEWATFLEKFQELLYPAFAKRRSVTV-GRKQLQRLGTSCQF  467
            D++  EW+ FLEKFQELL   F  R+  +  G    QRLGTSCQF
Sbjct  613  DLSAIEWSAFLEKFQELLPSMFHDRKQTSACGPWLTQRLGTSCQF  657



>ref|XP_006844080.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5 [Amborella trichopoda]
 gb|ERN05755.1| hypothetical protein AMTR_s00006p00251240 [Amborella trichopoda]
Length=690

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 55/99 (56%), Gaps = 12/99 (12%)
 Frame = -2

Query  760  LSKSLKNTSLGEKKLGLPNPSGTKPENGYLACSSSGYRSADEQLPA-SVSFVKLADMTDE  584
            LS SL++ S  +K      P G    N          RSA+EQ    + SFVKL+DM +E
Sbjct  603  LSASLRSMSFHDKNQRHVGPKGEVGGN---------RRSAEEQGAGPAASFVKLSDMDEE  653

Query  583  EWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            EW  FL  F+ELL+  F  R+  T+G  Q QRLGTSCQF
Sbjct  654  EWGAFLRHFRELLHGVFPDRKGRTLG--QRQRLGTSCQF  690



>ref|XP_010549980.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Tarenaya 
hassleriana]
 ref|XP_010549981.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Tarenaya 
hassleriana]
 ref|XP_010549982.1| PREDICTED: phosphatidylinositol 4-kinase gamma 5-like [Tarenaya 
hassleriana]
 gb|ABD96840.1| hypothetical protein [Cleome spinosa]
Length=611

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -2

Query  688  PENGYLACSSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTV  509
            P  G  A  S   +S +++   S SFVKL+DM++EEW  +LE FQ++L PAF +R S   
Sbjct  538  PRKGQSAGRSLRQQSLNKESLGSSSFVKLSDMSEEEWLQYLEIFQKMLNPAFTRRNSSRS  597

Query  508  GRKQLQRLGTSCQF  467
             +K   RLGTSC+F
Sbjct  598  DQKLRHRLGTSCRF  611



>ref|NP_001062108.1| Os08g0489800 [Oryza sativa Japonica Group]
 dbj|BAD09660.1| phosphatidylinositol 3- and 4-kinase family-like [Oryza sativa 
Japonica Group]
 dbj|BAF24022.1| Os08g0489800 [Oryza sativa Japonica Group]
 gb|EAZ07435.1| hypothetical protein OsI_29690 [Oryza sativa Indica Group]
 gb|EAZ43156.1| hypothetical protein OsJ_27749 [Oryza sativa Japonica Group]
Length=633

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = -2

Query  664  SSSGYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQ--LQ  491
            S SG  SA E+LP + SF KL+D++  +W+ FLEKFQ+LL   F  R+  T GR     Q
Sbjct  567  SYSGNHSAKEKLPHNSSFAKLSDLSANKWSPFLEKFQDLLQSMFQDRKQ-TAGRNPWLTQ  625

Query  490  RLGTSCQF  467
            RLGTSCQF
Sbjct  626  RLGTSCQF  633



>ref|XP_003574681.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6 [Brachypodium 
distachyon]
Length=638

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = -2

Query  715  GLP-NPSGTKPENGYLACSSS---GYRSADEQLPASVSFVKLADMTDEEWATFLEKFQEL  548
            G+P N   TK   GY+  ++    G RS +  LP S +FVKL+D++  EW  FL+KFQEL
Sbjct  551  GVPKNRVTTKTNYGYIGNTTQHQPGGRSTNNMLPPSSNFVKLSDLSTYEWNAFLKKFQEL  610

Query  547  LYPAFAKRRSVTV-GRKQLQRLGTSCQF  467
            L   F+ R+     G    QRLG SCQF
Sbjct  611  LPTMFSDRKQTAARGTWLTQRLGASCQF  638



>ref|XP_002525951.1| hypothetical protein RCOM_0791550 [Ricinus communis]
 gb|EEF36471.1| hypothetical protein RCOM_0791550 [Ricinus communis]
Length=70

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -2

Query  655  GYRSADEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVT  512
            G  S +EQLP S SFV L D+T+ EW  +LE FQ LL PAFA R+S T
Sbjct  19   GAMSVNEQLPESTSFVSLTDLTEREWVQYLENFQTLLCPAFANRKSGT  66



>ref|XP_009398745.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398746.1| PREDICTED: phosphatidylinositol 4-kinase gamma 6-like [Musa acuminata 
subsp. malaccensis]
Length=596

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -2

Query  640  DEQLPASVSFVKLADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTS  476
            DE LP   SFV+LADM++EEW  FLE FQ LL  AF  R+ +   ++Q QRLG +
Sbjct  542  DETLPFGTSFVRLADMSEEEWGAFLENFQVLLQSAFHDRKCLATKQRQKQRLGIA  596



>ref|XP_001757033.1| predicted protein [Physcomitrella patens]
 gb|EDQ78264.1| predicted protein, partial [Physcomitrella patens]
Length=576

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = -2

Query  604  LADMTDEEWATFLEKFQELLYPAFAKRRSVTVGRKQLQRLGTSCQF  467
            LADM+++EW+ FLE FQELL  AFA+ +  +  + Q+QRLGTSC+F
Sbjct  533  LADMSEKEWSLFLEGFQELLPEAFAEVKFKS--KNQVQRLGTSCRF  576



>gb|ACF79538.1| unknown [Zea mays]
Length=45

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 2/45 (4%)
 Frame = -2

Query  595  MTDEEWATFLEKFQELLYPAFAKRRSV--TVGRKQLQRLGTSCQF  467
            M+ ++W+ FL+KFQELL  A + R+     VG++ + RLGTSCQF
Sbjct  1    MSPKQWSAFLDKFQELLPGALSARKHAAGVVGQRSMPRLGTSCQF  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2366563193034