BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1100

Length=951
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604136.1|  PREDICTED: uncharacterized protein At3g49140...    390   2e-129   Nicotiana tomentosiformis
ref|XP_009604135.1|  PREDICTED: uncharacterized protein At3g49140...    390   2e-129   Nicotiana tomentosiformis
ref|XP_009775790.1|  PREDICTED: uncharacterized protein At3g49140...    386   7e-128   Nicotiana sylvestris
ref|XP_009775789.1|  PREDICTED: uncharacterized protein At3g49140...    386   1e-127   Nicotiana sylvestris
ref|XP_006362660.1|  PREDICTED: uncharacterized protein At3g49140...    385   3e-127   Solanum tuberosum [potatoes]
ref|XP_004234194.1|  PREDICTED: uncharacterized protein At3g49140...    379   5e-125   
emb|CDP05133.1|  unnamed protein product                                375   3e-123   Coffea canephora [robusta coffee]
ref|XP_009802899.1|  PREDICTED: uncharacterized protein At3g49140...    358   1e-117   Nicotiana sylvestris
ref|XP_009589586.1|  PREDICTED: uncharacterized protein At3g49140...    358   2e-117   Nicotiana tomentosiformis
ref|XP_009802898.1|  PREDICTED: uncharacterized protein At3g49140...    358   6e-117   Nicotiana sylvestris
ref|XP_009589585.1|  PREDICTED: uncharacterized protein At3g49140...    358   7e-117   Nicotiana tomentosiformis
ref|XP_006360192.1|  PREDICTED: uncharacterized protein At3g49140...    358   8e-117   Solanum tuberosum [potatoes]
ref|XP_011076096.1|  PREDICTED: uncharacterized protein At3g49140...    356   4e-116   Sesamum indicum [beniseed]
ref|XP_004240713.1|  PREDICTED: uncharacterized protein At3g49140       356   5e-116   Solanum lycopersicum
gb|EYU25155.1|  hypothetical protein MIMGU_mgv1a005058mg                348   1e-112   Erythranthe guttata [common monkey flower]
ref|XP_010671596.1|  PREDICTED: uncharacterized protein At3g49140...    337   2e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011084464.1|  PREDICTED: uncharacterized protein At3g49140...    334   1e-107   Sesamum indicum [beniseed]
ref|XP_011084463.1|  PREDICTED: uncharacterized protein At3g49140...    334   1e-107   Sesamum indicum [beniseed]
ref|XP_011046049.1|  PREDICTED: uncharacterized protein At3g49140...    329   7e-107   Populus euphratica
ref|XP_006384112.1|  hypothetical protein POPTR_0004s07090g             331   8e-107   Populus trichocarpa [western balsam poplar]
ref|XP_006384111.1|  hypothetical protein POPTR_0004s07090g             329   2e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006384113.1|  hypothetical protein POPTR_0004s07090g             331   3e-106   
ref|XP_011046048.1|  PREDICTED: uncharacterized protein At3g49140...    328   4e-106   Populus euphratica
ref|XP_011046047.1|  PREDICTED: uncharacterized protein At3g49140...    329   1e-105   Populus euphratica
ref|XP_012090170.1|  PREDICTED: uncharacterized protein At3g49140...    330   2e-105   Jatropha curcas
ref|XP_011046046.1|  PREDICTED: uncharacterized protein At3g49140...    329   2e-105   Populus euphratica
ref|XP_011035364.1|  PREDICTED: uncharacterized protein At3g49140...    324   4e-104   Populus euphratica
ref|XP_011035365.1|  PREDICTED: uncharacterized protein At3g49140...    322   8e-104   Populus euphratica
ref|XP_011035363.1|  PREDICTED: uncharacterized protein At3g49140...    325   1e-103   Populus euphratica
ref|XP_011035362.1|  PREDICTED: uncharacterized protein At3g49140...    324   1e-103   Populus euphratica
ref|XP_010105734.1|  hypothetical protein L484_014223                   324   1e-103   Morus notabilis
emb|CBI22631.3|  unnamed protein product                                319   1e-101   Vitis vinifera
ref|XP_002274287.2|  PREDICTED: uncharacterized protein At3g49140...    320   1e-101   Vitis vinifera
ref|XP_009368726.1|  PREDICTED: uncharacterized protein At3g49140...    318   3e-101   Pyrus x bretschneideri [bai li]
ref|XP_007218146.1|  hypothetical protein PRUPE_ppa007305mg             310   1e-99    
ref|XP_008234829.1|  PREDICTED: uncharacterized protein At3g49140       314   2e-99    Prunus mume [ume]
ref|XP_008376653.1|  PREDICTED: uncharacterized protein At3g49140       313   3e-99    Malus domestica [apple tree]
ref|XP_009377567.1|  PREDICTED: uncharacterized protein At3g49140...    311   2e-98    Pyrus x bretschneideri [bai li]
ref|XP_007038839.1|  Pentatricopeptide repeat superfamily protein...    311   2e-98    
ref|XP_009375539.1|  PREDICTED: uncharacterized protein At3g49140...    311   3e-98    Pyrus x bretschneideri [bai li]
ref|XP_010279050.1|  PREDICTED: uncharacterized protein At3g49140...    303   2e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010261375.1|  PREDICTED: uncharacterized protein At3g49140...    303   4e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010261376.1|  PREDICTED: uncharacterized protein At3g49140...    303   4e-95    Nelumbo nucifera [Indian lotus]
ref|XP_004308044.1|  PREDICTED: uncharacterized protein At3g49140       301   1e-94    Fragaria vesca subsp. vesca
gb|KHG16901.1|  hypothetical protein F383_22772                         301   3e-94    Gossypium arboreum [tree cotton]
gb|KDO56814.1|  hypothetical protein CISIN_1g010741mg                   295   9e-94    Citrus sinensis [apfelsine]
gb|KJB18778.1|  hypothetical protein B456_003G069200                    291   7e-93    Gossypium raimondii
gb|KHG24021.1|  hypothetical protein F383_31053                         296   2e-92    Gossypium arboreum [tree cotton]
gb|KDO56813.1|  hypothetical protein CISIN_1g010741mg                   295   3e-92    Citrus sinensis [apfelsine]
gb|KJB18775.1|  hypothetical protein B456_003G069200                    290   5e-92    Gossypium raimondii
ref|XP_006422049.1|  hypothetical protein CICLE_v10004809mg             290   6e-92    
ref|XP_008382477.1|  PREDICTED: uncharacterized protein At3g49140...    293   2e-91    
ref|XP_006490620.1|  PREDICTED: uncharacterized protein At3g49140...    290   4e-91    
gb|KJB18774.1|  hypothetical protein B456_003G069200                    290   5e-91    Gossypium raimondii
gb|KHN42465.1|  Hypothetical protein glysoja_033933                     291   9e-91    Glycine soja [wild soybean]
ref|XP_006422050.1|  hypothetical protein CICLE_v10004809mg             290   2e-90    Citrus clementina [clementine]
gb|KJB18776.1|  hypothetical protein B456_003G069200                    290   2e-90    Gossypium raimondii
gb|KJB18777.1|  hypothetical protein B456_003G069200                    290   3e-90    Gossypium raimondii
ref|XP_003619417.1|  hypothetical protein MTR_6g052360                  284   3e-90    
ref|XP_006588200.1|  PREDICTED: uncharacterized protein At3g49140...    290   5e-90    
gb|KJB18785.1|  hypothetical protein B456_003G069200                    290   6e-90    Gossypium raimondii
gb|KJB18784.1|  hypothetical protein B456_003G069200                    289   9e-90    Gossypium raimondii
ref|XP_004516701.1|  PREDICTED: uncharacterized protein At3g49140...    288   3e-89    
ref|XP_002513639.1|  conserved hypothetical protein                     282   7e-88    
gb|KHN09284.1|  Hypothetical protein glysoja_029055                     282   8e-88    Glycine soja [wild soybean]
ref|XP_003619416.1|  hypothetical protein MTR_6g052360                  283   1e-87    Medicago truncatula
gb|KJB18783.1|  hypothetical protein B456_003G069200                    283   2e-87    Gossypium raimondii
ref|XP_010279048.1|  PREDICTED: uncharacterized protein At3g49140...    284   2e-87    Nelumbo nucifera [Indian lotus]
ref|XP_006599546.1|  PREDICTED: uncharacterized protein At3g49140...    282   3e-87    Glycine max [soybeans]
ref|XP_008439307.1|  PREDICTED: uncharacterized protein At3g49140...    282   6e-87    Cucumis melo [Oriental melon]
ref|XP_002323951.2|  hypothetical protein POPTR_0017s01000g             278   4e-86    
ref|XP_007152144.1|  hypothetical protein PHAVU_004G106100g             278   2e-85    Phaseolus vulgaris [French bean]
ref|XP_010060327.1|  PREDICTED: uncharacterized protein At3g49140       275   2e-84    Eucalyptus grandis [rose gum]
gb|KJB21281.1|  hypothetical protein B456_004G1170002                   269   2e-82    Gossypium raimondii
ref|XP_004140749.1|  PREDICTED: uncharacterized protein At3g49140       268   2e-81    Cucumis sativus [cucumbers]
gb|KJB21286.1|  hypothetical protein B456_004G1170002                   265   4e-81    Gossypium raimondii
gb|EPS73614.1|  hypothetical protein M569_01143                         265   6e-81    Genlisea aurea
gb|KDO56815.1|  hypothetical protein CISIN_1g010741mg                   254   1e-76    Citrus sinensis [apfelsine]
gb|KGN57421.1|  hypothetical protein Csa_3G184030                       242   8e-74    Cucumis sativus [cucumbers]
gb|AIZ68165.1|  pentatricopeptide repeat superfamily protein, put...    244   4e-73    Ornithogalum longebracteatum [sea-onion]
ref|XP_010541478.1|  PREDICTED: uncharacterized protein At3g49140...    244   2e-72    Tarenaya hassleriana [spider flower]
gb|KCW90616.1|  hypothetical protein EUGRSUZ_A02721                     230   5e-68    Eucalyptus grandis [rose gum]
ref|XP_006404172.1|  hypothetical protein EUTSA_v10010311mg             229   5e-67    Eutrema salsugineum [saltwater cress]
ref|NP_190483.3|  uncharacterized protein                               229   6e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010261377.1|  PREDICTED: uncharacterized protein At3g49140...    229   6e-67    Nelumbo nucifera [Indian lotus]
dbj|BAF01615.1|  hypothetical protein                                   229   8e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404801.1|  PREDICTED: uncharacterized protein At3g49140...    227   2e-66    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB21282.1|  hypothetical protein B456_004G1170002                   226   2e-66    Gossypium raimondii
ref|XP_010515260.1|  PREDICTED: uncharacterized protein At3g49140       225   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_002877651.1|  hypothetical protein ARALYDRAFT_485272             233   2e-65    
gb|KFK34201.1|  hypothetical protein AALP_AA5G114300                    230   2e-64    Arabis alpina [alpine rockcress]
ref|XP_007038842.1|  Pentatricopeptide repeat superfamily protein...    220   6e-64    
ref|XP_006292754.1|  hypothetical protein CARUB_v10019002mg             220   1e-63    Capsella rubella
emb|CAB61996.1|  putative protein                                       228   2e-63    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ91506.1|  predicted protein                                      218   3e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB08729.1|  unnamed protein product                                218   4e-63    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ90572.1|  predicted protein                                      218   6e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93835.1|  predicted protein                                      218   7e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_197794.2|  pentatricopeptide repeat-containing protein-lik...    218   8e-63    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190376.1|  pentatricopeptide repeat-containing protein-...    218   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401022.1|  PREDICTED: uncharacterized protein At3g49140...    216   1e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401021.1|  PREDICTED: uncharacterized protein At3g49140...    216   1e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009149761.1|  PREDICTED: uncharacterized protein At3g49140       217   2e-62    Brassica rapa
ref|XP_009401020.1|  PREDICTED: uncharacterized protein At3g49140...    215   5e-62    
ref|XP_010421214.1|  PREDICTED: uncharacterized protein At3g49140...    216   6e-62    Camelina sativa [gold-of-pleasure]
emb|CDY08112.1|  BnaA06g16140D                                          216   6e-62    Brassica napus [oilseed rape]
ref|XP_007038841.1|  Pentatricopeptide repeat superfamily protein...    215   1e-61    
ref|XP_006394663.1|  hypothetical protein EUTSA_v10004068mg             215   2e-61    
ref|XP_003575992.1|  PREDICTED: uncharacterized protein At3g49140...    213   4e-61    Brachypodium distachyon [annual false brome]
ref|XP_006287582.1|  hypothetical protein CARUB_v10000792mg             214   4e-61    
ref|XP_006663507.1|  PREDICTED: uncharacterized protein At3g49140...    213   4e-61    
ref|XP_010454696.1|  PREDICTED: uncharacterized protein At3g49140...    210   6e-61    Camelina sativa [gold-of-pleasure]
gb|EEC68315.1|  hypothetical protein OsI_36404                          212   8e-61    Oryza sativa Indica Group [Indian rice]
gb|ABA94153.2|  expressed protein                                       212   1e-60    Oryza sativa Japonica Group [Japonica rice]
gb|EEE52237.1|  hypothetical protein OsJ_34175                          211   1e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010454694.1|  PREDICTED: uncharacterized protein At3g49140...    210   5e-60    Camelina sativa [gold-of-pleasure]
ref|XP_004979425.1|  PREDICTED: uncharacterized protein At3g49140...    210   6e-60    Setaria italica
ref|XP_010421215.1|  PREDICTED: uncharacterized protein At3g49140...    209   2e-59    Camelina sativa [gold-of-pleasure]
ref|XP_010493537.1|  PREDICTED: uncharacterized protein At3g49140...    209   2e-59    Camelina sativa [gold-of-pleasure]
gb|KJB18780.1|  hypothetical protein B456_003G069200                    207   4e-59    Gossypium raimondii
ref|XP_002877649.1|  hypothetical protein ARALYDRAFT_348010             204   4e-59    
ref|XP_010426418.1|  PREDICTED: uncharacterized protein At3g49140       208   5e-59    Camelina sativa [gold-of-pleasure]
ref|NP_001159266.1|  hypothetical protein                               206   2e-58    Zea mays [maize]
gb|KJB18779.1|  hypothetical protein B456_003G069200                    206   2e-58    Gossypium raimondii
ref|XP_010454695.1|  PREDICTED: uncharacterized protein At3g49140...    203   1e-57    
ref|XP_002874164.1|  predicted protein                                  203   2e-57    
emb|CDX80406.1|  BnaC07g30380D                                          202   6e-57    
ref|XP_010507340.1|  PREDICTED: uncharacterized protein At3g49140...    204   1e-56    
emb|CDY05906.1|  BnaC08g20830D                                          200   6e-56    
emb|CDX88068.1|  BnaA06g26590D                                          194   7e-54    
gb|AES75635.2|  PPR superfamily protein, putative                       193   9e-54    Medicago truncatula
gb|KFK27685.1|  hypothetical protein AALP_AA8G415300                    193   3e-53    Arabis alpina [alpine rockcress]
ref|XP_003590427.1|  Transcription factor bHLH130                       189   5e-53    
gb|EMT02897.1|  hypothetical protein F775_08396                         183   9e-50    
ref|XP_002877648.1|  predicted protein                                  181   5e-48    
ref|XP_004970926.1|  PREDICTED: uncharacterized protein At3g49140...    164   8e-43    
ref|XP_004970924.1|  PREDICTED: uncharacterized protein At3g49140...    162   5e-42    Setaria italica
ref|XP_010662670.1|  PREDICTED: uncharacterized protein At3g49140...    156   3e-40    Vitis vinifera
gb|ACL54435.1|  unknown                                                 157   4e-40    Zea mays [maize]
ref|NP_001045101.1|  Os01g0899500                                       156   4e-40    
emb|CDM85332.1|  unnamed protein product                                155   2e-39    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001145108.1|  uncharacterized protein LOC100278323               155   2e-39    Zea mays [maize]
ref|XP_008672644.1|  PREDICTED: uncharacterized protein LOC100278...    155   2e-39    Zea mays [maize]
gb|ERN20099.1|  hypothetical protein AMTR_s00066p00038410               155   2e-39    Amborella trichopoda
ref|XP_006858632.2|  PREDICTED: uncharacterized protein At3g49140       155   2e-39    Amborella trichopoda
ref|XP_011084164.1|  PREDICTED: uncharacterized protein At3g49140...    154   5e-39    Sesamum indicum [beniseed]
ref|XP_011084163.1|  PREDICTED: uncharacterized protein At3g49140...    154   6e-39    Sesamum indicum [beniseed]
ref|XP_002458925.1|  hypothetical protein SORBIDRAFT_03g042790          152   2e-38    Sorghum bicolor [broomcorn]
ref|XP_010232696.1|  PREDICTED: uncharacterized protein At3g49140...    151   3e-38    Brachypodium distachyon [annual false brome]
ref|XP_010232694.1|  PREDICTED: uncharacterized protein At3g49140...    151   3e-38    Brachypodium distachyon [annual false brome]
ref|XP_009591981.1|  PREDICTED: uncharacterized protein At3g49140       150   8e-38    
ref|XP_009765201.1|  PREDICTED: uncharacterized protein At3g49140...    150   1e-37    Nicotiana sylvestris
ref|XP_008802368.1|  PREDICTED: uncharacterized protein At3g49140...    149   1e-37    
ref|XP_008802363.1|  PREDICTED: uncharacterized protein At3g49140...    150   1e-37    Phoenix dactylifera
ref|XP_009387060.1|  PREDICTED: uncharacterized protein At3g49140...    150   2e-37    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010322468.1|  PREDICTED: uncharacterized protein At3g49140...    147   2e-37    Solanum lycopersicum
ref|XP_006347461.1|  PREDICTED: uncharacterized protein At3g49140...    149   2e-37    
ref|XP_008802366.1|  PREDICTED: uncharacterized protein At3g49140...    149   2e-37    
ref|XP_008802362.1|  PREDICTED: uncharacterized protein At3g49140...    149   2e-37    Phoenix dactylifera
ref|XP_006291096.1|  hypothetical protein CARUB_v10017210mg             148   4e-37    Capsella rubella
ref|XP_006645178.1|  PREDICTED: uncharacterized protein At3g49140...    148   5e-37    Oryza brachyantha
ref|XP_003564847.1|  PREDICTED: uncharacterized protein At3g49140...    148   6e-37    Brachypodium distachyon [annual false brome]
ref|XP_010322467.1|  PREDICTED: uncharacterized protein At3g49140...    148   7e-37    Solanum lycopersicum
ref|XP_004241392.1|  PREDICTED: uncharacterized protein At3g49140...    148   7e-37    Solanum lycopersicum
ref|XP_010512181.1|  PREDICTED: uncharacterized protein At3g49140...    147   8e-37    Camelina sativa [gold-of-pleasure]
ref|XP_010469340.1|  PREDICTED: uncharacterized protein At3g49140...    147   9e-37    Camelina sativa [gold-of-pleasure]
gb|KCW57667.1|  hypothetical protein EUGRSUZ_H00428                     145   2e-36    Eucalyptus grandis [rose gum]
ref|XP_010413718.1|  PREDICTED: uncharacterized protein At3g49140...    146   3e-36    Camelina sativa [gold-of-pleasure]
ref|XP_010069338.1|  PREDICTED: uncharacterized protein At3g49140...    146   3e-36    Eucalyptus grandis [rose gum]
ref|XP_006478864.1|  PREDICTED: uncharacterized protein At3g49140...    145   4e-36    Citrus sinensis [apfelsine]
ref|XP_006478863.1|  PREDICTED: uncharacterized protein At3g49140...    145   5e-36    Citrus sinensis [apfelsine]
ref|XP_009387059.1|  PREDICTED: uncharacterized protein At3g49140...    145   7e-36    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387058.1|  PREDICTED: uncharacterized protein At3g49140...    145   7e-36    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002876496.1|  hypothetical protein ARALYDRAFT_486397             145   8e-36    
ref|XP_007038840.1|  Pentatricopeptide repeat superfamily protein...    143   1e-35    
ref|XP_007038843.1|  Pentatricopeptide repeat superfamily protein...    143   1e-35    
gb|EMS59101.1|  hypothetical protein TRIUR3_12121                       145   3e-35    Triticum urartu
gb|KJB21287.1|  hypothetical protein B456_004G1170002                   142   3e-35    Gossypium raimondii
gb|KJB21285.1|  hypothetical protein B456_004G1170002                   142   3e-35    Gossypium raimondii
ref|XP_006402701.1|  hypothetical protein EUTSA_v10005960mg             143   4e-35    Eutrema salsugineum [saltwater cress]
ref|XP_004152092.1|  PREDICTED: uncharacterized protein At3g49140       142   4e-35    Cucumis sativus [cucumbers]
ref|XP_008453945.1|  PREDICTED: uncharacterized protein At3g49140...    142   6e-35    Cucumis melo [Oriental melon]
ref|XP_008453943.1|  PREDICTED: uncharacterized protein At3g49140...    142   6e-35    Cucumis melo [Oriental melon]
ref|XP_010912142.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    142   6e-35    
gb|EEE55821.1|  hypothetical protein OsJ_04424                          142   6e-35    Oryza sativa Japonica Group [Japonica rice]
gb|EEC71966.1|  hypothetical protein OsI_04801                          142   7e-35    Oryza sativa Indica Group [Indian rice]
emb|CAB91600.1|  putative protein                                       141   1e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223038.1|  hypothetical protein PRUPE_ppa005374mg             141   1e-34    Prunus persica
ref|NP_567080.1|  pentatricopeptide repeat-containing protein-lik...    141   2e-34    Arabidopsis thaliana [mouse-ear cress]
emb|CDX98363.1|  BnaC06g17240D                                          140   2e-34    
ref|XP_010069337.1|  PREDICTED: uncharacterized protein At3g49140...    139   6e-34    Eucalyptus grandis [rose gum]
ref|XP_008222586.1|  PREDICTED: uncharacterized protein At3g49140...    138   9e-34    Prunus mume [ume]
emb|CDY57496.1|  BnaC08g48890D                                          139   1e-33    Brassica napus [oilseed rape]
gb|KJB61306.1|  hypothetical protein B456_009G350800                    135   2e-33    Gossypium raimondii
ref|XP_008222584.1|  PREDICTED: uncharacterized protein At3g49140...    138   2e-33    Prunus mume [ume]
ref|XP_008222585.1|  PREDICTED: uncharacterized protein At3g49140...    138   2e-33    Prunus mume [ume]
emb|CDY06013.1|  BnaA09g37670D                                          138   2e-33    
ref|XP_009363688.1|  PREDICTED: uncharacterized protein At3g49140...    138   2e-33    Pyrus x bretschneideri [bai li]
ref|XP_010525800.1|  PREDICTED: uncharacterized protein At3g49140       138   2e-33    Tarenaya hassleriana [spider flower]
ref|XP_009363689.1|  PREDICTED: uncharacterized protein At3g49140...    137   2e-33    Pyrus x bretschneideri [bai li]
ref|XP_009104199.1|  PREDICTED: uncharacterized protein At3g49140       137   3e-33    Brassica rapa
ref|XP_008372047.1|  PREDICTED: uncharacterized protein At3g49140...    137   3e-33    
emb|CDX67791.1|  BnaA07g18310D                                          137   3e-33    
ref|XP_008372049.1|  PREDICTED: uncharacterized protein At3g49140...    137   4e-33    
gb|KJB61300.1|  hypothetical protein B456_009G350800                    136   7e-33    Gossypium raimondii
gb|KJB61305.1|  hypothetical protein B456_009G350800                    135   1e-32    Gossypium raimondii
ref|XP_009116591.1|  PREDICTED: uncharacterized protein At3g49140...    136   1e-32    Brassica rapa
gb|KJB61301.1|  hypothetical protein B456_009G350800                    135   1e-32    Gossypium raimondii
ref|XP_008802365.1|  PREDICTED: uncharacterized protein At3g49140...    135   3e-32    Phoenix dactylifera
emb|CBI39163.3|  unnamed protein product                                135   3e-32    Vitis vinifera
ref|XP_010650474.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    134   4e-32    
ref|XP_007034031.1|  Pentatricopeptide repeat (PPR) superfamily p...    134   4e-32    
ref|XP_008802364.1|  PREDICTED: uncharacterized protein At3g49140...    134   5e-32    Phoenix dactylifera
ref|XP_011462599.1|  PREDICTED: uncharacterized protein At3g49140...    134   8e-32    Fragaria vesca subsp. vesca
ref|XP_004296717.1|  PREDICTED: uncharacterized protein At3g49140...    133   9e-32    Fragaria vesca subsp. vesca
ref|XP_002302882.1|  hypothetical protein POPTR_0002s23140g             133   1e-31    Populus trichocarpa [western balsam poplar]
ref|XP_009765199.1|  PREDICTED: uncharacterized protein At3g49140...    132   2e-31    Nicotiana sylvestris
ref|XP_009765198.1|  PREDICTED: uncharacterized protein At3g49140...    132   2e-31    Nicotiana sylvestris
ref|XP_009765200.1|  PREDICTED: uncharacterized protein At3g49140...    132   3e-31    Nicotiana sylvestris
ref|XP_012066226.1|  PREDICTED: uncharacterized protein At3g49140       131   4e-31    Jatropha curcas
ref|XP_002530542.1|  conserved hypothetical protein                     130   8e-31    
gb|KJB61304.1|  hypothetical protein B456_009G350800                    129   9e-31    Gossypium raimondii
ref|XP_010097509.1|  hypothetical protein L484_024718                   129   4e-30    
ref|XP_001763992.1|  predicted protein                                  130   6e-30    
gb|KHG13029.1|  hypothetical protein F383_17155                         128   7e-30    Gossypium arboreum [tree cotton]
ref|XP_010279051.1|  PREDICTED: uncharacterized protein At3g49140...    126   3e-29    
gb|KJB18781.1|  hypothetical protein B456_003G069200                    125   3e-29    Gossypium raimondii
ref|XP_007034030.1|  Pentatricopeptide repeat superfamily protein...    124   1e-28    
gb|EMT08991.1|  hypothetical protein F775_07025                         125   5e-28    
emb|CDP14676.1|  unnamed protein product                                121   1e-27    Coffea canephora [robusta coffee]
ref|XP_011042801.1|  PREDICTED: uncharacterized protein At3g49140       118   2e-26    Populus euphratica
ref|XP_003617306.1|  hypothetical protein MTR_5g090150                  118   2e-26    Medicago truncatula
ref|XP_010069339.1|  PREDICTED: uncharacterized protein At3g49140...    117   4e-26    Eucalyptus grandis [rose gum]
ref|XP_004491268.1|  PREDICTED: uncharacterized protein LOC101512...    114   3e-25    
ref|XP_007141480.1|  hypothetical protein PHAVU_008G199500g             114   3e-25    Phaseolus vulgaris [French bean]
ref|XP_002320457.2|  hypothetical protein POPTR_0014s14980g             114   1e-24    
gb|KHN12012.1|  Hypothetical protein glysoja_019985                     112   2e-24    Glycine soja [wild soybean]
ref|XP_004491270.1|  PREDICTED: uncharacterized protein LOC101512...    107   7e-23    
dbj|BAH56735.1|  AT3G59300                                            95.9    5e-20    Arabidopsis thaliana [mouse-ear cress]
gb|EYU45227.1|  hypothetical protein MIMGU_mgv1a0208701mg             92.4    1e-19    Erythranthe guttata [common monkey flower]
ref|XP_004491272.1|  PREDICTED: uncharacterized protein LOC101512...  95.1    8e-19    
ref|XP_004491271.1|  PREDICTED: uncharacterized protein LOC101512...  94.7    2e-18    
ref|XP_004491267.1|  PREDICTED: uncharacterized protein LOC101512...  95.1    2e-18    
ref|XP_008354286.1|  PREDICTED: uncharacterized protein LOC103417906  89.0    1e-16    
ref|XP_004491269.1|  PREDICTED: uncharacterized protein LOC101512...  87.8    6e-16    
ref|XP_011084165.1|  PREDICTED: uncharacterized protein At3g49140...  85.1    4e-15    
ref|XP_008364257.1|  PREDICTED: uncharacterized protein LOC103427...  74.3    2e-11    
ref|XP_008364258.1|  PREDICTED: uncharacterized protein LOC103427...  73.9    2e-11    
emb|CAN71237.1|  hypothetical protein VITISV_014867                   64.7    2e-08    Vitis vinifera
ref|XP_003590430.1|  hypothetical protein MTR_1g062060                60.8    4e-07    
gb|EYU45226.1|  hypothetical protein MIMGU_mgv1a0208702mg             57.8    3e-06    Erythranthe guttata [common monkey flower]
dbj|BAJ94348.1|  predicted protein                                    58.5    3e-06    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ETX07297.1|  hypothetical protein ETSY2_12040                      57.0    4e-06    Candidatus Entotheonella gemina
gb|EWM28087.1|  pyridoxamine 5 -phosphate oxidase-related fmn-bin...  57.0    9e-06    Nannochloropsis gaditana
ref|XP_011005126.1|  PREDICTED: uncharacterized protein LOC105111465  51.6    1e-04    Populus euphratica
ref|XP_009765202.1|  PREDICTED: uncharacterized protein At3g49140...  53.1    2e-04    Nicotiana sylvestris
ref|XP_001781449.1|  predicted protein                                51.2    6e-04    



>ref|XP_009604136.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Nicotiana tomentosiformis]
Length=498

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 216/247 (87%), Gaps = 2/247 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+++ EV  DDPIDFM+ PPAGLAIQG+LRP+FLEEH  IQKQ+S+H+ S
Sbjct  253  TMRSSHPMYFAKKIAEVVTDDPIDFMDQPPAGLAIQGVLRPSFLEEHTTIQKQISEHRLS  312

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD NQ+ K  D KE   + INGH+H+SG  QD+PNWAE LEKDE LG+GTSFYKLEMIK
Sbjct  313  DADLNQMEKDEDHKEKGGIQINGHKHESGSSQDSPNWAE-LEKDENLGNGTSFYKLEMIK  371

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS++GNQ FVE++DFRRAR DAIAHSA KI+SRLK +GEKT QAL+SLCWRCKGIQV
Sbjct  372  IQLISSNGNQIFVELDDFRRARPDAIAHSAAKIISRLKAAGEKTTQALRSLCWRCKGIQV  431

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEVSLIGVDSLG DLRVCSGTQVQTLRF+F+KRASSEYSAERQLN+LLFPR   K +Q+K
Sbjct  432  EEVSLIGVDSLGFDLRVCSGTQVQTLRFSFRKRASSEYSAERQLNDLLFPRIHHKSRQKK  491

Query  232  EAQQAES  212
            E+ QAES
Sbjct  492  ESHQAES  498



>ref|XP_009604135.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Nicotiana tomentosiformis]
Length=502

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 216/247 (87%), Gaps = 2/247 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+++ EV  DDPIDFM+ PPAGLAIQG+LRP+FLEEH  IQKQ+S+H+ S
Sbjct  257  TMRSSHPMYFAKKIAEVVTDDPIDFMDQPPAGLAIQGVLRPSFLEEHTTIQKQISEHRLS  316

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD NQ+ K  D KE   + INGH+H+SG  QD+PNWAE LEKDE LG+GTSFYKLEMIK
Sbjct  317  DADLNQMEKDEDHKEKGGIQINGHKHESGSSQDSPNWAE-LEKDENLGNGTSFYKLEMIK  375

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS++GNQ FVE++DFRRAR DAIAHSA KI+SRLK +GEKT QAL+SLCWRCKGIQV
Sbjct  376  IQLISSNGNQIFVELDDFRRARPDAIAHSAAKIISRLKAAGEKTTQALRSLCWRCKGIQV  435

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEVSLIGVDSLG DLRVCSGTQVQTLRF+F+KRASSEYSAERQLN+LLFPR   K +Q+K
Sbjct  436  EEVSLIGVDSLGFDLRVCSGTQVQTLRFSFRKRASSEYSAERQLNDLLFPRIHHKSRQKK  495

Query  232  EAQQAES  212
            E+ QAES
Sbjct  496  ESHQAES  502



>ref|XP_009775790.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Nicotiana sylvestris]
Length=498

 Score =   386 bits (992),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 215/247 (87%), Gaps = 2/247 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+++ EV  DDPIDFM+ PPAGLAIQG+LRP+FLEEH  IQKQ+S+H+ S
Sbjct  253  TMRSSHPMYFAKKIAEVVTDDPIDFMDQPPAGLAIQGVLRPSFLEEHTTIQKQISEHRLS  312

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD NQ+ K  D KE   + INGH+H+SG  QD+P+WAE LEKDE LG+GTSFYKLEMIK
Sbjct  313  DADLNQMEKDEDHKEKGGIHINGHKHESGSSQDSPSWAE-LEKDENLGNGTSFYKLEMIK  371

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS++GNQ FVE++DFRRAR DAIAHS  KI+SRLK +GEKT QAL+SLCWRCKGIQV
Sbjct  372  IQLISSNGNQIFVELDDFRRARPDAIAHSTAKIISRLKAAGEKTTQALRSLCWRCKGIQV  431

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEVSLIGVDSLG DLRVCSGTQVQTLRF+F+KRASSEYSAERQLN+LLFPR   K +Q+K
Sbjct  432  EEVSLIGVDSLGFDLRVCSGTQVQTLRFSFRKRASSEYSAERQLNDLLFPRIHHKSRQKK  491

Query  232  EAQQAES  212
            E+ QAES
Sbjct  492  ESHQAES  498



>ref|XP_009775789.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Nicotiana sylvestris]
Length=502

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 215/247 (87%), Gaps = 2/247 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+++ EV  DDPIDFM+ PPAGLAIQG+LRP+FLEEH  IQKQ+S+H+ S
Sbjct  257  TMRSSHPMYFAKKIAEVVTDDPIDFMDQPPAGLAIQGVLRPSFLEEHTTIQKQISEHRLS  316

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD NQ+ K  D KE   + INGH+H+SG  QD+P+WAE LEKDE LG+GTSFYKLEMIK
Sbjct  317  DADLNQMEKDEDHKEKGGIHINGHKHESGSSQDSPSWAE-LEKDENLGNGTSFYKLEMIK  375

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS++GNQ FVE++DFRRAR DAIAHS  KI+SRLK +GEKT QAL+SLCWRCKGIQV
Sbjct  376  IQLISSNGNQIFVELDDFRRARPDAIAHSTAKIISRLKAAGEKTTQALRSLCWRCKGIQV  435

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEVSLIGVDSLG DLRVCSGTQVQTLRF+F+KRASSEYSAERQLN+LLFPR   K +Q+K
Sbjct  436  EEVSLIGVDSLGFDLRVCSGTQVQTLRFSFRKRASSEYSAERQLNDLLFPRIHHKSRQKK  495

Query  232  EAQQAES  212
            E+ QAES
Sbjct  496  ESHQAES  502



>ref|XP_006362660.1| PREDICTED: uncharacterized protein At3g49140-like [Solanum tuberosum]
Length=497

 Score =   385 bits (989),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 216/247 (87%), Gaps = 2/247 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+++ EV  DDPIDFM+ PPAGLAIQG+LRP+FLEEH  IQKQ+S+   S
Sbjct  252  TMRSSHPMYFAKKIAEVVTDDPIDFMDQPPAGLAIQGLLRPSFLEEHTTIQKQISEDTLS  311

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N+I K  D KE   V INGH+H+SG  Q+NP+W EELEKDE LGSGTSFYKLEMI+
Sbjct  312  DADLNRIEKDDDHKEKGGVQINGHKHESGSSQENPSW-EELEKDENLGSGTSFYKLEMIR  370

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS++GNQ FVE++DFRRAR+DAI HSA KI+SRLK +GEKT+QAL+SLCWRCKGIQV
Sbjct  371  IQLISSNGNQIFVELDDFRRARSDAIVHSAAKIISRLKAAGEKTMQALRSLCWRCKGIQV  430

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEVSLIGVDSLG DLRVCSGTQVQTLRF+F+KRASSEYSAERQLN+LLFPR   K +Q+K
Sbjct  431  EEVSLIGVDSLGFDLRVCSGTQVQTLRFSFRKRASSEYSAERQLNDLLFPRIHHKSRQKK  490

Query  232  EAQQAES  212
            E+QQAES
Sbjct  491  ESQQAES  497



>ref|XP_004234194.1| PREDICTED: uncharacterized protein At3g49140-like [Solanum lycopersicum]
Length=497

 Score =   379 bits (974),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 182/247 (74%), Positives = 215/247 (87%), Gaps = 2/247 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+++ EV  DDPIDFM+ PPAGLAIQG+LRP+FLEEH  IQKQ+S+   S
Sbjct  252  TMRSSHPMYFAKKIAEVVTDDPIDFMDQPPAGLAIQGLLRPSFLEEHTTIQKQISEDTLS  311

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N+I K  + KE   V INGH+H+SG   +NP+W EELEKDE LG+GTSFYKLEMI+
Sbjct  312  DADLNRIEKDDEHKENGGVQINGHKHESGSSLENPSW-EELEKDEILGNGTSFYKLEMIR  370

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS++GNQ FVE++DFRRAR+DAI HSA KI+SRLK +GEKT+QAL+SLCWRCKGIQV
Sbjct  371  IQLISSNGNQIFVELDDFRRARSDAIVHSAAKIISRLKAAGEKTMQALRSLCWRCKGIQV  430

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEVSLIGVDSLG DLRVCSGTQVQTLRF+F+KRASSEYSAERQLN+LLFPR   K +Q+K
Sbjct  431  EEVSLIGVDSLGFDLRVCSGTQVQTLRFSFRKRASSEYSAERQLNDLLFPRIHHKSRQKK  490

Query  232  EAQQAES  212
            E+QQAES
Sbjct  491  ESQQAES  497



>emb|CDP05133.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   375 bits (962),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/246 (74%), Positives = 206/246 (84%), Gaps = 1/246 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L+E   DDPIDFM+ PPAGLAIQG+LRPAF+EEH VIQK ++D++  
Sbjct  259  TMRSSHPMYFAKKLSEAASDDPIDFMDQPPAGLAIQGLLRPAFVEEHAVIQKHIADNQII  318

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              + +QI+K    KE  I+ INGH+H+ G  Q+  N  EELE DET G+GTSFYKLEM+K
Sbjct  319  EDNTDQITKMEGHKENEIIQINGHKHEHGSAQEGINRVEELESDETPGNGTSFYKLEMVK  378

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHGNQ FVEIEDFRRAR DAIAHSA KI+SRLK  GEKT QA+KSLCWRCKGIQV
Sbjct  379  IQLISAHGNQNFVEIEDFRRARPDAIAHSAAKIISRLKAGGEKTTQAVKSLCWRCKGIQV  438

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPR-TQKLQQRK  233
            EEV+LIGVDSLG DLRVCSGTQVQTLRFAF KRASSEYSAERQLN+LLFPR   KLQQ+K
Sbjct  439  EEVALIGVDSLGFDLRVCSGTQVQTLRFAFNKRASSEYSAERQLNHLLFPRANHKLQQKK  498

Query  232  EAQQAE  215
            EA Q E
Sbjct  499  EAHQTE  504



>ref|XP_009802899.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Nicotiana sylvestris]
Length=439

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 203/246 (83%), Gaps = 0/246 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHP+ FA+ +TEV  DDPIDFM+ PPAGL IQG+LRPAF EEH  I KQ+S+HK++
Sbjct  194  TMRSSHPIDFAKAITEVVTDDPIDFMDQPPAGLVIQGLLRPAFPEEHASIPKQISEHKSN  253

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A  +QI K A+ K+   V +NGH+H+SG  QD P+  EELEKDETLG+GTSFYKLEMIK
Sbjct  254  DAGIDQIEKVAEYKQNCSVQVNGHKHESGSSQDGPSCPEELEKDETLGNGTSFYKLEMIK  313

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS+HG+Q  VE++DF +A+ DAIAHSA  I+SRLK  GE T QAL+SLCWRCKGIQV
Sbjct  314  IQLISSHGHQILVELDDFSQAKPDAIAHSAANIISRLKAVGENTTQALRSLCWRCKGIQV  373

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EEV+LIGVDSLG DLRVCSG QVQTLRF+FKK+ASSEYSAERQLN+LL+PR     Q++E
Sbjct  374  EEVALIGVDSLGFDLRVCSGAQVQTLRFSFKKQASSEYSAERQLNDLLYPRFHPKLQKQE  433

Query  229  AQQAES  212
              QAES
Sbjct  434  THQAES  439



>ref|XP_009589586.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Nicotiana tomentosiformis]
Length=439

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 203/246 (83%), Gaps = 0/246 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHP+ FA+ +TEV  DDPIDFM+ PPAGL IQG+LR AFLEEH  I KQ+S+HK++
Sbjct  194  TMRSSHPIDFAKAITEVVTDDPIDFMDQPPAGLVIQGLLRTAFLEEHAAIPKQISEHKSN  253

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A  +QI K A+ K+   V +NGH+H+SG  QD P+  EELEKDETLG+GTSFYKLEMIK
Sbjct  254  DAGIDQIEKVAEYKQNCSVQVNGHKHESGSSQDGPSCPEELEKDETLGNGTSFYKLEMIK  313

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS+HG+Q  VE++DF +A+ DAIAHSA  I+SRLK  GE T QAL+SLCWRCKGIQV
Sbjct  314  IQLISSHGHQILVELDDFSQAKPDAIAHSAANIISRLKAVGENTTQALRSLCWRCKGIQV  373

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EEV+LIGVDSLG DLRVCSG QVQTLRF+FKK+ASSEYSAERQLN+LL+PR     ++KE
Sbjct  374  EEVALIGVDSLGFDLRVCSGAQVQTLRFSFKKQASSEYSAERQLNDLLYPRFHPKLKKKE  433

Query  229  AQQAES  212
              QAES
Sbjct  434  THQAES  439



>ref|XP_009802898.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Nicotiana sylvestris]
Length=503

 Score =   358 bits (920),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 203/246 (83%), Gaps = 0/246 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHP+ FA+ +TEV  DDPIDFM+ PPAGL IQG+LRPAF EEH  I KQ+S+HK++
Sbjct  258  TMRSSHPIDFAKAITEVVTDDPIDFMDQPPAGLVIQGLLRPAFPEEHASIPKQISEHKSN  317

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A  +QI K A+ K+   V +NGH+H+SG  QD P+  EELEKDETLG+GTSFYKLEMIK
Sbjct  318  DAGIDQIEKVAEYKQNCSVQVNGHKHESGSSQDGPSCPEELEKDETLGNGTSFYKLEMIK  377

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS+HG+Q  VE++DF +A+ DAIAHSA  I+SRLK  GE T QAL+SLCWRCKGIQV
Sbjct  378  IQLISSHGHQILVELDDFSQAKPDAIAHSAANIISRLKAVGENTTQALRSLCWRCKGIQV  437

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EEV+LIGVDSLG DLRVCSG QVQTLRF+FKK+ASSEYSAERQLN+LL+PR     Q++E
Sbjct  438  EEVALIGVDSLGFDLRVCSGAQVQTLRFSFKKQASSEYSAERQLNDLLYPRFHPKLQKQE  497

Query  229  AQQAES  212
              QAES
Sbjct  498  THQAES  503



>ref|XP_009589585.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Nicotiana tomentosiformis]
Length=499

 Score =   358 bits (919),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 203/246 (83%), Gaps = 0/246 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHP+ FA+ +TEV  DDPIDFM+ PPAGL IQG+LR AFLEEH  I KQ+S+HK++
Sbjct  254  TMRSSHPIDFAKAITEVVTDDPIDFMDQPPAGLVIQGLLRTAFLEEHAAIPKQISEHKSN  313

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A  +QI K A+ K+   V +NGH+H+SG  QD P+  EELEKDETLG+GTSFYKLEMIK
Sbjct  314  DAGIDQIEKVAEYKQNCSVQVNGHKHESGSSQDGPSCPEELEKDETLGNGTSFYKLEMIK  373

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS+HG+Q  VE++DF +A+ DAIAHSA  I+SRLK  GE T QAL+SLCWRCKGIQV
Sbjct  374  IQLISSHGHQILVELDDFSQAKPDAIAHSAANIISRLKAVGENTTQALRSLCWRCKGIQV  433

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EEV+LIGVDSLG DLRVCSG QVQTLRF+FKK+ASSEYSAERQLN+LL+PR     ++KE
Sbjct  434  EEVALIGVDSLGFDLRVCSGAQVQTLRFSFKKQASSEYSAERQLNDLLYPRFHPKLKKKE  493

Query  229  AQQAES  212
              QAES
Sbjct  494  THQAES  499



>ref|XP_006360192.1| PREDICTED: uncharacterized protein At3g49140-like [Solanum tuberosum]
Length=502

 Score =   358 bits (919),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 205/247 (83%), Gaps = 1/247 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHP+HFA++++EV  DDPIDFM+ PPAGL I G+LRPAFLE+H  I KQ+S+H+++
Sbjct  256  TMRSSHPIHFAQQISEVVTDDPIDFMDQPPAGLIIHGLLRPAFLEDHTTIPKQISEHESN  315

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A   Q+ + A+ K+   V +NGH+H+S   QDNP+  EELEKDETLG+GTSFYKLEMIK
Sbjct  316  DAGIEQMEQVAEHKQNGSVQVNGHKHESESSQDNPSCPEELEKDETLGNGTSFYKLEMIK  375

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS+HG Q  VE+EDF +AR DAIAHSA  I+SRLK  GEKT QAL+SLCWRCKGIQV
Sbjct  376  IQLISSHGQQILVELEDFCQARPDAIAHSAANIISRLKAVGEKTTQALRSLCWRCKGIQV  435

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EEV LIGVDSLG D+RVCSG Q+QTLRF+FKKRA+SEYSAERQLN+LL+PR   KL Q+K
Sbjct  436  EEVVLIGVDSLGFDVRVCSGAQIQTLRFSFKKRATSEYSAERQLNDLLYPRVHPKLHQKK  495

Query  232  EAQQAES  212
            E  QAES
Sbjct  496  ETHQAES  502



>ref|XP_011076096.1| PREDICTED: uncharacterized protein At3g49140-like [Sesamum indicum]
Length=488

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 203/246 (83%), Gaps = 2/246 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L EV  DDP+D ME P AGLAIQG+LRPAF+EEH  +QK  S  ++S
Sbjct  245  TMRSSHPMYFAKKLAEVVSDDPVDCMEQPSAGLAIQGLLRPAFIEEHSGLQKHTSSAESS  304

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +     I  A +  +  +V INGHRH+    QD P+ AEE EK+ETLG+G +FYKLEMIK
Sbjct  305  DGGTTHI--ADEQLQEGVVQINGHRHEKESAQDRPSLAEEFEKNETLGNGFAFYKLEMIK  362

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQL+S+HG+Q++VE+EDFR+A+ DAIAHS+ KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  363  IQLVSSHGHQSYVELEDFRKAQPDAIAHSSAKIISRLKAGGEKTAQALKSLCWRCKGIQV  422

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE +LIGVDSLG DLRVCSGTQVQTLRFAFKK+ASSEYSAERQLN+LLFPRTQK Q +KE
Sbjct  423  EECALIGVDSLGFDLRVCSGTQVQTLRFAFKKQASSEYSAERQLNDLLFPRTQKYQHKKE  482

Query  229  AQQAES  212
            AQQ ES
Sbjct  483  AQQTES  488



>ref|XP_004240713.1| PREDICTED: uncharacterized protein At3g49140 [Solanum lycopersicum]
Length=501

 Score =   356 bits (914),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 205/247 (83%), Gaps = 1/247 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHP+HFA++++EV  DDPIDFM+ PPAGL I G+LRPAFLE+H+ I KQ+++H+++
Sbjct  255  TMRSSHPIHFAQQISEVVTDDPIDFMDQPPAGLIIHGLLRPAFLEDHITIPKQIAEHESN  314

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A   Q+ + A+ K+   V +NGH+H++   QDNP+  EELEKDETLG+GTSFYKLEMIK
Sbjct  315  DAGIKQMEQVAEHKQNGSVQVNGHKHETESSQDNPSCPEELEKDETLGNGTSFYKLEMIK  374

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS+HG Q  VE+EDF +AR DAIAHSA  I+SRLK  GEKT QAL+SLCWRCKGIQV
Sbjct  375  IQLISSHGQQILVELEDFSQARPDAIAHSAANIISRLKAVGEKTTQALRSLCWRCKGIQV  434

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EEV LIGVDSLG D+RVCSG Q+QT+RF+FKKRA+SEYSAERQLN+LL+PR   KL Q+K
Sbjct  435  EEVVLIGVDSLGFDVRVCSGAQIQTVRFSFKKRATSEYSAERQLNDLLYPRVHPKLHQKK  494

Query  232  EAQQAES  212
            E  Q ES
Sbjct  495  ETHQTES  501



>gb|EYU25155.1| hypothetical protein MIMGU_mgv1a005058mg [Erythranthe guttata]
Length=498

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 202/246 (82%), Gaps = 2/246 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L EV  DDP+D M+ P  GLAI G+LRPAF+EEH VIQKQ+S  ++S
Sbjct  255  TMRSSHPMYFAKKLAEVVSDDPVDCMDQPSVGLAIHGLLRPAFIEEHSVIQKQISGPESS  314

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D ++I  A +  +  +V INGH+H+   ++D+P+  E+ +KDETLG+G++FYK+EMIK
Sbjct  315  DVDTDRI--AEEQSQEGVVRINGHKHEKESEEDDPSLTEDSDKDETLGNGSAFYKIEMIK  372

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQL+SA GN   VEIEDFRRAR DAIAHSA KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  373  IQLVSAQGNPNDVEIEDFRRARPDAIAHSATKIMSRLKAGGEKTTQALKSLCWRCKGIQV  432

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE +LIG+D+LG DLRVCSGTQVQTLRF FKKRASSEYSAERQLN+LLFPR  K QQ++E
Sbjct  433  EECALIGLDTLGFDLRVCSGTQVQTLRFTFKKRASSEYSAERQLNDLLFPRAHKYQQKRE  492

Query  229  AQQAES  212
            A + ES
Sbjct  493  ANKTES  498



>ref|XP_010671596.1| PREDICTED: uncharacterized protein At3g49140-like [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 196/247 (79%), Gaps = 1/247 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++++EV  D+PIDFM  PPAGLAIQG+LRPAF+EE  VIQK        
Sbjct  252  TMRSSHPMYFAKKISEVASDNPIDFMVQPPAGLAIQGLLRPAFIEERSVIQKNRLILPDK  311

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N+  K  + K   +  +NGH H S   +DN  W E+LEKD+ + SGT+FYKLEM K
Sbjct  312  DADVNKGEKNTENKVGNVSIVNGHAHVSASPEDNSVWTEDLEKDDGVSSGTAFYKLEMTK  371

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISA+GNQT VE+ED+R+AR+DAIAHSA KI+SR+  +GEKT  ALK+LCWRCKG+QV
Sbjct  372  IQLISAYGNQTSVEVEDYRKARSDAIAHSAAKIISRVSAAGEKTTNALKTLCWRCKGLQV  431

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EE SLIGVDSLG DLRVCSGTQVQTLRFAF  RA+SEYSAERQLN+LLFPR+ QK Q+ K
Sbjct  432  EEASLIGVDSLGFDLRVCSGTQVQTLRFAFNSRATSEYSAERQLNDLLFPRSNQKAQKVK  491

Query  232  EAQQAES  212
            + ++ ES
Sbjct  492  QTRRKES  498



>ref|XP_011084464.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Sesamum indicum]
Length=485

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 194/245 (79%), Gaps = 3/245 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L EV  D P+D+M+    GLA+QG+LRPAF+EEH VIQK  SD ++S
Sbjct  243  TMRSSHPMYFAQKLVEVVSDAPLDYMDQRSTGLAVQGLLRPAFVEEHSVIQKHASDTESS  302

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + + N +   A  +   I+ INGH  +  L Q N + AEELEKDETLG+G  FY+LEMIK
Sbjct  303  DINTNHV---AGKQIQGILRINGHEKEKELAQGNVSRAEELEKDETLGNGYVFYELEMIK  359

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS+HG+Q F+EIEDFRRA+ DAIAHSA KI+SRLK  GEK  +ALKSLCWRCKGIQV
Sbjct  360  IQLISSHGDQGFLEIEDFRRAQPDAIAHSAAKIISRLKAGGEKITRALKSLCWRCKGIQV  419

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE  LIGVDSLG DLRVCSG QVQTLRFAFKKRASSEYSAERQLN+LLFP+  K QQ KE
Sbjct  420  EECVLIGVDSLGFDLRVCSGRQVQTLRFAFKKRASSEYSAERQLNDLLFPKVHKFQQVKE  479

Query  229  AQQAE  215
             QQ E
Sbjct  480  PQQTE  484



>ref|XP_011084463.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Sesamum indicum]
Length=486

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 194/245 (79%), Gaps = 3/245 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L EV  D P+D+M+    GLA+QG+LRPAF+EEH VIQK  SD ++S
Sbjct  244  TMRSSHPMYFAQKLVEVVSDAPLDYMDQRSTGLAVQGLLRPAFVEEHSVIQKHASDTESS  303

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + + N +   A  +   I+ INGH  +  L Q N + AEELEKDETLG+G  FY+LEMIK
Sbjct  304  DINTNHV---AGKQIQGILRINGHEKEKELAQGNVSRAEELEKDETLGNGYVFYELEMIK  360

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS+HG+Q F+EIEDFRRA+ DAIAHSA KI+SRLK  GEK  +ALKSLCWRCKGIQV
Sbjct  361  IQLISSHGDQGFLEIEDFRRAQPDAIAHSAAKIISRLKAGGEKITRALKSLCWRCKGIQV  420

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE  LIGVDSLG DLRVCSG QVQTLRFAFKKRASSEYSAERQLN+LLFP+  K QQ KE
Sbjct  421  EECVLIGVDSLGFDLRVCSGRQVQTLRFAFKKRASSEYSAERQLNDLLFPKVHKFQQVKE  480

Query  229  AQQAE  215
             QQ E
Sbjct  481  PQQTE  485



>ref|XP_011046049.1| PREDICTED: uncharacterized protein At3g49140-like isoform X4 
[Populus euphratica]
Length=382

 Score =   329 bits (843),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 188/243 (77%), Gaps = 0/243 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA++L +V  DDPID+ME PPAG+AIQG++RPAF+EE   IQ+ MS +++ 
Sbjct  138  TMSSSHPMYFAKKLAQVASDDPIDWMEQPPAGVAIQGLIRPAFMEEQSDIQRHMSGNQSH  197

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A  NQ+ ++ + K      INGH H SG  +D   W EELEKDE   SG SFYKLEMIK
Sbjct  198  HAGTNQVGQSIEGKLEEPGVINGHEHNSGSSEDISLWREELEKDEVPSSGASFYKLEMIK  257

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDFR+A+ DAIA SA KI+SRLK  GEK +QA KSLCWRCKGIQV
Sbjct  258  IQLISAHGHQTTVEVEDFRKAQPDAIALSAAKIISRLKAGGEKIMQAFKSLCWRCKGIQV  317

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE  +I VDSLG DLRVCSGTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR Q   Q+K 
Sbjct  318  EEAMIIDVDSLGFDLRVCSGTQIQTLRFAFNSRATSEYSAERQLNDLLFPRIQSRLQKKN  377

Query  229  AQQ  221
              Q
Sbjct  378  IAQ  380



>ref|XP_006384112.1| hypothetical protein POPTR_0004s07090g [Populus trichocarpa]
 gb|ERP61909.1| hypothetical protein POPTR_0004s07090g [Populus trichocarpa]
Length=457

 Score =   331 bits (849),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 194/244 (80%), Gaps = 1/244 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L +V  DDPID+ME PPAGLAIQG++RPAF+EEH  IQ+ MS +++ 
Sbjct  211  TMRSSHPMYFAKKLAQVASDDPIDWMEQPPAGLAIQGLIRPAFMEEHSDIQRHMSGNQSC  270

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N++ K+ + K      +NGH HKSG  +D+  WAEE EKDE   SGTSFYKLEMIK
Sbjct  271  DADINKVGKSVEGKLEESGVVNGHEHKSGSSEDSSMWAEESEKDEAPRSGTSFYKLEMIK  330

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDF +A+ DAIA SA +I+S +K  GE+  QA KSLCWRCKGIQV
Sbjct  331  IQLISAHGHQTMVEVEDFMKAKPDAIALSAARIISLMKAGGERITQAFKSLCWRCKGIQV  390

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EE ++I VDSLG DLRVCSGTQ+QTLRFAF  +A++EYSAERQLN+LLFPR Q +L ++K
Sbjct  391  EEAAIIDVDSLGFDLRVCSGTQIQTLRFAFNSQATTEYSAERQLNDLLFPRIQSRLPKKK  450

Query  232  EAQQ  221
               Q
Sbjct  451  PTHQ  454



>ref|XP_006384111.1| hypothetical protein POPTR_0004s07090g [Populus trichocarpa]
 gb|ERP61908.1| hypothetical protein POPTR_0004s07090g [Populus trichocarpa]
Length=422

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 194/244 (80%), Gaps = 1/244 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L +V  DDPID+ME PPAGLAIQG++RPAF+EEH  IQ+ MS +++ 
Sbjct  176  TMRSSHPMYFAKKLAQVASDDPIDWMEQPPAGLAIQGLIRPAFMEEHSDIQRHMSGNQSC  235

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N++ K+ + K      +NGH HKSG  +D+  WAEE EKDE   SGTSFYKLEMIK
Sbjct  236  DADINKVGKSVEGKLEESGVVNGHEHKSGSSEDSSMWAEESEKDEAPRSGTSFYKLEMIK  295

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDF +A+ DAIA SA +I+S +K  GE+  QA KSLCWRCKGIQV
Sbjct  296  IQLISAHGHQTMVEVEDFMKAKPDAIALSAARIISLMKAGGERITQAFKSLCWRCKGIQV  355

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EE ++I VDSLG DLRVCSGTQ+QTLRFAF  +A++EYSAERQLN+LLFPR Q +L ++K
Sbjct  356  EEAAIIDVDSLGFDLRVCSGTQIQTLRFAFNSQATTEYSAERQLNDLLFPRIQSRLPKKK  415

Query  232  EAQQ  221
               Q
Sbjct  416  PTHQ  419



>ref|XP_006384113.1| hypothetical protein POPTR_0004s07090g [Populus trichocarpa]
 gb|ERP61910.1| hypothetical protein POPTR_0004s07090g [Populus trichocarpa]
Length=496

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 194/244 (80%), Gaps = 1/244 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L +V  DDPID+ME PPAGLAIQG++RPAF+EEH  IQ+ MS +++ 
Sbjct  250  TMRSSHPMYFAKKLAQVASDDPIDWMEQPPAGLAIQGLIRPAFMEEHSDIQRHMSGNQSC  309

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N++ K+ + K      +NGH HKSG  +D+  WAEE EKDE   SGTSFYKLEMIK
Sbjct  310  DADINKVGKSVEGKLEESGVVNGHEHKSGSSEDSSMWAEESEKDEAPRSGTSFYKLEMIK  369

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDF +A+ DAIA SA +I+S +K  GE+  QA KSLCWRCKGIQV
Sbjct  370  IQLISAHGHQTMVEVEDFMKAKPDAIALSAARIISLMKAGGERITQAFKSLCWRCKGIQV  429

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EE ++I VDSLG DLRVCSGTQ+QTLRFAF  +A++EYSAERQLN+LLFPR Q +L ++K
Sbjct  430  EEAAIIDVDSLGFDLRVCSGTQIQTLRFAFNSQATTEYSAERQLNDLLFPRIQSRLPKKK  489

Query  232  EAQQ  221
               Q
Sbjct  490  PTHQ  493



>ref|XP_011046048.1| PREDICTED: uncharacterized protein At3g49140-like isoform X3 
[Populus euphratica]
Length=418

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 188/243 (77%), Gaps = 0/243 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA++L +V  DDPID+ME PPAG+AIQG++RPAF+EE   IQ+ MS +++ 
Sbjct  174  TMSSSHPMYFAKKLAQVASDDPIDWMEQPPAGVAIQGLIRPAFMEEQSDIQRHMSGNQSH  233

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A  NQ+ ++ + K      INGH H SG  +D   W EELEKDE   SG SFYKLEMIK
Sbjct  234  HAGTNQVGQSIEGKLEEPGVINGHEHNSGSSEDISLWREELEKDEVPSSGASFYKLEMIK  293

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDFR+A+ DAIA SA KI+SRLK  GEK +QA KSLCWRCKGIQV
Sbjct  294  IQLISAHGHQTTVEVEDFRKAQPDAIALSAAKIISRLKAGGEKIMQAFKSLCWRCKGIQV  353

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE  +I VDSLG DLRVCSGTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR Q   Q+K 
Sbjct  354  EEAMIIDVDSLGFDLRVCSGTQIQTLRFAFNSRATSEYSAERQLNDLLFPRIQSRLQKKN  413

Query  229  AQQ  221
              Q
Sbjct  414  IAQ  416



>ref|XP_011046047.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Populus euphratica]
Length=492

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 188/243 (77%), Gaps = 0/243 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA++L +V  DDPID+ME PPAG+AIQG++RPAF+EE   IQ+ MS +++ 
Sbjct  248  TMSSSHPMYFAKKLAQVASDDPIDWMEQPPAGVAIQGLIRPAFMEEQSDIQRHMSGNQSH  307

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A  NQ+ ++ + K      INGH H SG  +D   W EELEKDE   SG SFYKLEMIK
Sbjct  308  HAGTNQVGQSIEGKLEEPGVINGHEHNSGSSEDISLWREELEKDEVPSSGASFYKLEMIK  367

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDFR+A+ DAIA SA KI+SRLK  GEK +QA KSLCWRCKGIQV
Sbjct  368  IQLISAHGHQTTVEVEDFRKAQPDAIALSAAKIISRLKAGGEKIMQAFKSLCWRCKGIQV  427

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE  +I VDSLG DLRVCSGTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR Q   Q+K 
Sbjct  428  EEAMIIDVDSLGFDLRVCSGTQIQTLRFAFNSRATSEYSAERQLNDLLFPRIQSRLQKKN  487

Query  229  AQQ  221
              Q
Sbjct  488  IAQ  490



>ref|XP_012090170.1| PREDICTED: uncharacterized protein At3g49140-like [Jatropha curcas]
 gb|KDP22214.1| hypothetical protein JCGZ_26045 [Jatropha curcas]
Length=525

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 194/246 (79%), Gaps = 1/246 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+++ +V  D PID+ME PPAGLAIQG++RPAF+EEH  IQK MS +++ 
Sbjct  279  TMRSSHPMYFAKKIAQVTSDAPIDWMEQPPAGLAIQGLIRPAFIEEHSDIQKHMSGNQSH  338

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D N++ K  + +   +  ING +H SG  +D   WAE+ EK++   +GTSFYK+EMIK
Sbjct  339  QPDINEVGKKVEGQVEDVGGINGQKHVSGSSEDISTWAEDSEKNQVPRNGTSFYKIEMIK  398

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LISAHG+QT VE+EDFR+A+ DAIAHSA KILSRLK  GEK  QALKSLCWRCKGIQV
Sbjct  399  IRLISAHGHQTMVEVEDFRKAQPDAIAHSAGKILSRLKAGGEKISQALKSLCWRCKGIQV  458

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EE +LIGVDSLG DLRVCSGTQ+QTLRFAF  RASSEYSAERQLN+LLFPR   +  ++K
Sbjct  459  EEAALIGVDSLGFDLRVCSGTQIQTLRFAFNSRASSEYSAERQLNDLLFPRIPHRAPKKK  518

Query  232  EAQQAE  215
            +  Q E
Sbjct  519  QTHQNE  524



>ref|XP_011046046.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Populus euphratica]
Length=499

 Score =   329 bits (843),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 188/243 (77%), Gaps = 0/243 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA++L +V  DDPID+ME PPAG+AIQG++RPAF+EE   IQ+ MS +++ 
Sbjct  255  TMSSSHPMYFAKKLAQVASDDPIDWMEQPPAGVAIQGLIRPAFMEEQSDIQRHMSGNQSH  314

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A  NQ+ ++ + K      INGH H SG  +D   W EELEKDE   SG SFYKLEMIK
Sbjct  315  HAGTNQVGQSIEGKLEEPGVINGHEHNSGSSEDISLWREELEKDEVPSSGASFYKLEMIK  374

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDFR+A+ DAIA SA KI+SRLK  GEK +QA KSLCWRCKGIQV
Sbjct  375  IQLISAHGHQTTVEVEDFRKAQPDAIALSAAKIISRLKAGGEKIMQAFKSLCWRCKGIQV  434

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE  +I VDSLG DLRVCSGTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR Q   Q+K 
Sbjct  435  EEAMIIDVDSLGFDLRVCSGTQIQTLRFAFNSRATSEYSAERQLNDLLFPRIQSRLQKKN  494

Query  229  AQQ  221
              Q
Sbjct  495  IAQ  497



>ref|XP_011035364.1| PREDICTED: uncharacterized protein At3g49140-like isoform X3 
[Populus euphratica]
Length=457

 Score =   324 bits (831),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 190/240 (79%), Gaps = 1/240 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L +V  DDPID+ME PPAGLAIQG++RPAF+EEH  IQ+ MS  ++ 
Sbjct  211  TMRSSHPMYFAKKLAQVASDDPIDWMEQPPAGLAIQGLIRPAFMEEHSDIQRHMSGSQSC  270

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N++ K+ + K      +NGH HKSG  +D+  W EE EKD+   S TSFYKLEMIK
Sbjct  271  DADINKVGKSVEGKLEESGVVNGHEHKSGSSEDSSMWVEESEKDKVPRSRTSFYKLEMIK  330

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDF +A+ DAIA SA +I+S +K  GEK  QA KSLCWRCKGIQV
Sbjct  331  IQLISAHGHQTMVEVEDFMKAKPDAIALSAARIISLMKAGGEKITQAFKSLCWRCKGIQV  390

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EE ++I VDSLG DLRVCSGTQ+QTLRFAF  +A+SEYSAERQLN+LLFPR Q +L ++K
Sbjct  391  EEAAIIDVDSLGFDLRVCSGTQIQTLRFAFNSQATSEYSAERQLNDLLFPRIQSRLPKKK  450



>ref|XP_011035365.1| PREDICTED: uncharacterized protein At3g49140-like isoform X4 
[Populus euphratica]
 ref|XP_011035367.1| PREDICTED: uncharacterized protein At3g49140-like isoform X4 
[Populus euphratica]
Length=422

 Score =   322 bits (826),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 190/240 (79%), Gaps = 1/240 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L +V  DDPID+ME PPAGLAIQG++RPAF+EEH  IQ+ MS  ++ 
Sbjct  176  TMRSSHPMYFAKKLAQVASDDPIDWMEQPPAGLAIQGLIRPAFMEEHSDIQRHMSGSQSC  235

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N++ K+ + K      +NGH HKSG  +D+  W EE EKD+   S TSFYKLEMIK
Sbjct  236  DADINKVGKSVEGKLEESGVVNGHEHKSGSSEDSSMWVEESEKDKVPRSRTSFYKLEMIK  295

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDF +A+ DAIA SA +I+S +K  GEK  QA KSLCWRCKGIQV
Sbjct  296  IQLISAHGHQTMVEVEDFMKAKPDAIALSAARIISLMKAGGEKITQAFKSLCWRCKGIQV  355

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EE ++I VDSLG DLRVCSGTQ+QTLRFAF  +A+SEYSAERQLN+LLFPR Q +L ++K
Sbjct  356  EEAAIIDVDSLGFDLRVCSGTQIQTLRFAFNSQATSEYSAERQLNDLLFPRIQSRLPKKK  415



>ref|XP_011035363.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Populus euphratica]
Length=496

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 190/240 (79%), Gaps = 1/240 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L +V  DDPID+ME PPAGLAIQG++RPAF+EEH  IQ+ MS  ++ 
Sbjct  250  TMRSSHPMYFAKKLAQVASDDPIDWMEQPPAGLAIQGLIRPAFMEEHSDIQRHMSGSQSC  309

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N++ K+ + K      +NGH HKSG  +D+  W EE EKD+   S TSFYKLEMIK
Sbjct  310  DADINKVGKSVEGKLEESGVVNGHEHKSGSSEDSSMWVEESEKDKVPRSRTSFYKLEMIK  369

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDF +A+ DAIA SA +I+S +K  GEK  QA KSLCWRCKGIQV
Sbjct  370  IQLISAHGHQTMVEVEDFMKAKPDAIALSAARIISLMKAGGEKITQAFKSLCWRCKGIQV  429

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EE ++I VDSLG DLRVCSGTQ+QTLRFAF  +A+SEYSAERQLN+LLFPR Q +L ++K
Sbjct  430  EEAAIIDVDSLGFDLRVCSGTQIQTLRFAFNSQATSEYSAERQLNDLLFPRIQSRLPKKK  489



>ref|XP_011035362.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Populus euphratica]
Length=502

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 190/240 (79%), Gaps = 1/240 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L +V  DDPID+ME PPAGLAIQG++RPAF+EEH  IQ+ MS  ++ 
Sbjct  256  TMRSSHPMYFAKKLAQVASDDPIDWMEQPPAGLAIQGLIRPAFMEEHSDIQRHMSGSQSC  315

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +AD N++ K+ + K      +NGH HKSG  +D+  W EE EKD+   S TSFYKLEMIK
Sbjct  316  DADINKVGKSVEGKLEESGVVNGHEHKSGSSEDSSMWVEESEKDKVPRSRTSFYKLEMIK  375

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLISAHG+QT VE+EDF +A+ DAIA SA +I+S +K  GEK  QA KSLCWRCKGIQV
Sbjct  376  IQLISAHGHQTMVEVEDFMKAKPDAIALSAARIISLMKAGGEKITQAFKSLCWRCKGIQV  435

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EE ++I VDSLG DLRVCSGTQ+QTLRFAF  +A+SEYSAERQLN+LLFPR Q +L ++K
Sbjct  436  EEAAIIDVDSLGFDLRVCSGTQIQTLRFAFNSQATSEYSAERQLNDLLFPRIQSRLPKKK  495



>ref|XP_010105734.1| hypothetical protein L484_014223 [Morus notabilis]
 gb|EXC05954.1| hypothetical protein L484_014223 [Morus notabilis]
Length=506

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/246 (65%), Positives = 193/246 (78%), Gaps = 1/246 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L EV  D+PID+ME PPA LAIQG++RPAF+EEH VI+K +S+ ++S
Sbjct  260  TMRSSHPMYFAQKLAEVVSDNPIDWMEQPPASLAIQGVVRPAFIEEHSVIRKHLSNQQSS  319

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            NA+ NQ+ K  +      + INGH  +S   +D+  W EELEKDE   +G +FYKLE+IK
Sbjct  320  NAELNQVGKPVEGGSEDPIRINGHESESESSKDSSTWEEELEKDEITPNGATFYKLEIIK  379

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L SAHG QT VEIEDF +A+ D IAHSA KI+SRLK  GEKT QALKSLCWR KGIQV
Sbjct  380  IELFSAHGRQTLVEIEDFMKAQPDPIAHSATKIISRLKAGGEKTTQALKSLCWRLKGIQV  439

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EE  +IGVDSLGIDLR+CSGTQVQTLRF F  RA+SEYSAERQLN++LFPR  QK Q+ K
Sbjct  440  EEAVIIGVDSLGIDLRICSGTQVQTLRFGFDSRATSEYSAERQLNDILFPRIHQKPQKIK  499

Query  232  EAQQAE  215
            + QQ E
Sbjct  500  QTQQNE  505



>emb|CBI22631.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM FA+ + EV   DP+D+M  PPAG+AIQG+LRPAF+EE  VIQK +S H++S
Sbjct  260  TMRSSHPMFFAKTMAEVASGDPVDWMNQPPAGIAIQGLLRPAFIEEQSVIQKHISSHQSS  319

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            NA+ NQ+ K ++ K   +  INGH  +SG  +DN   AE++EKD  + +G SFYKLEMIK
Sbjct  320  NANVNQVEKNSEDKAEDLEKINGHGQESGSSRDNSIQAEDIEKDHNMMNGFSFYKLEMIK  379

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I LISAHG Q  V++EDFR A+ DAIAHSA KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  380  ILLISAHGLQAVVDLEDFRNAQPDAIAHSASKIISRLKAGGEKTTQALKSLCWRCKGIQV  439

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPR  257
            EE +LI VD+LG DLRVCSG QVQTLRF F  RA+SEYSAERQLN+LLFPR
Sbjct  440  EEATLIDVDTLGFDLRVCSGRQVQTLRFTFNTRATSEYSAERQLNDLLFPR  490



>ref|XP_002274287.2| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Vitis 
vinifera]
Length=511

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM FA+ + EV   DP+D+M  PPAG+AIQG+LRPAF+EE  VIQK +S H++S
Sbjct  265  TMRSSHPMFFAKTMAEVASGDPVDWMNQPPAGIAIQGLLRPAFIEEQSVIQKHISSHQSS  324

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            NA+ NQ+ K ++ K   +  INGH  +SG  +DN   AE++EKD  + +G SFYKLEMIK
Sbjct  325  NANVNQVEKNSEDKAEDLEKINGHGQESGSSRDNSIQAEDIEKDHNMMNGFSFYKLEMIK  384

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I LISAHG Q  V++EDFR A+ DAIAHSA KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  385  ILLISAHGLQAVVDLEDFRNAQPDAIAHSASKIISRLKAGGEKTTQALKSLCWRCKGIQV  444

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPR  257
            EE +LI VD+LG DLRVCSG QVQTLRF F  RA+SEYSAERQLN+LLFPR
Sbjct  445  EEATLIDVDTLGFDLRVCSGRQVQTLRFTFNTRATSEYSAERQLNDLLFPR  495



>ref|XP_009368726.1| PREDICTED: uncharacterized protein At3g49140-like [Pyrus x bretschneideri]
Length=509

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 186/235 (79%), Gaps = 4/235 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM+FA++L+EV  DDP+D+ E  PA LAIQG++RPA +EEH VIQK +SDH++ 
Sbjct  268  TMRYSHPMYFAKKLSEVASDDPVDWAEQAPASLAIQGLIRPALVEEHSVIQKHLSDHQSD  327

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELE--KDETLGSGTSFYKLEM  596
            N   +++ +  +      V ING+  KSG  +D+P+ AEELE  KDE LG+GT+FYKLEM
Sbjct  328  NDGIDEVGRTVEDDLEDPVTINGY--KSGNSKDSPDSAEELENKKDEALGNGTTFYKLEM  385

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            +KIQL S+HGNQT VE+EDF +A+ D IAHSA KI+SRLK  GEKT QALKSLCWR KG+
Sbjct  386  VKIQLFSSHGNQTLVEVEDFVKAQPDCIAHSAAKIISRLKAGGEKTTQALKSLCWRLKGL  445

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ  251
            QVEE  LIGVDSLG DLRVCSGTQVQTLRFA   RA+SEYSAERQLN+LLFPR Q
Sbjct  446  QVEEAVLIGVDSLGFDLRVCSGTQVQTLRFALNTRATSEYSAERQLNDLLFPRMQ  500



>ref|XP_007218146.1| hypothetical protein PRUPE_ppa007305mg [Prunus persica]
 gb|EMJ19345.1| hypothetical protein PRUPE_ppa007305mg [Prunus persica]
Length=373

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 182/235 (77%), Gaps = 4/235 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM+FA++LTEV  DDPID+ E  PA LAIQG++RPA +EEH VIQK MSDH++S
Sbjct  132  TMRFSHPMYFAKKLTEVASDDPIDWAEQAPASLAIQGLIRPALIEEHSVIQKHMSDHQSS  191

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELE--KDETLGSGTSFYKLEM  596
            N   + +    +      V INGH  +SG  +D+P  AEELE  KDE   +GT+FYKLEM
Sbjct  192  NDGVDSLGSIVEDDLEDPVRINGH--ESGSSKDSPVQAEELENKKDEISRNGTTFYKLEM  249

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            +KIQL S+HGNQT VE+E+F +A+ DAIAHSA KI+SRL   GEKT QALKSLCW+ KG+
Sbjct  250  VKIQLFSSHGNQTVVEVEEFVKAQPDAIAHSAAKIISRLNAGGEKTTQALKSLCWKLKGL  309

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ  251
            QVEE  LIGVDSLG DLRVCSGTQVQTLRFA   RA+SEYSAERQLN+LLFPR Q
Sbjct  310  QVEEAVLIGVDSLGFDLRVCSGTQVQTLRFALNTRATSEYSAERQLNDLLFPRMQ  364



>ref|XP_008234829.1| PREDICTED: uncharacterized protein At3g49140 [Prunus mume]
Length=514

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 182/235 (77%), Gaps = 4/235 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM+FA++LTEV  DDPID+ E  PA LAIQG++RPA +EEH VIQK MSDH++S
Sbjct  273  TMRYSHPMYFAKKLTEVASDDPIDWAEQAPASLAIQGLIRPALIEEHSVIQKHMSDHQSS  332

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELE--KDETLGSGTSFYKLEM  596
            N   + +    +      V INGH  +SG  +D+P  AEELE  KDE   +GT+FYKLEM
Sbjct  333  NDGVDSVGSIVEDDLEDPVRINGH--ESGSSKDSPVQAEELENKKDEISRNGTTFYKLEM  390

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            +KIQL S+HGNQT VE+EDF +A+ DAIAHSA KI+SRL   GEKT QALKSLCWR KG+
Sbjct  391  VKIQLFSSHGNQTVVEVEDFVKAQPDAIAHSAAKIISRLNAGGEKTTQALKSLCWRLKGL  450

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ  251
            QVEE  LIGVDSLG DLRVCSGTQVQTLRFA   RA+SEYSAERQLN+LLFPR Q
Sbjct  451  QVEEAVLIGVDSLGFDLRVCSGTQVQTLRFALNTRATSEYSAERQLNDLLFPRIQ  505



>ref|XP_008376653.1| PREDICTED: uncharacterized protein At3g49140 [Malus domestica]
Length=509

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 184/239 (77%), Gaps = 4/239 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM+FA++L+EV  DDPID+ E  PA LAIQG++RPA +EEH VIQK +SDH++ 
Sbjct  268  TMRYSHPMYFAKKLSEVASDDPIDWAEQAPASLAIQGLIRPALVEEHSVIQKHLSDHQSF  327

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELE--KDETLGSGTSFYKLEM  596
            N   +++ +  +      V INGH  KSG  +D+P  AEELE  KDE  G+GT+FYKLEM
Sbjct  328  NDGIDEVGRTVEDDLEDPVKINGH--KSGTSKDSPVSAEELENKKDEAPGNGTTFYKLEM  385

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            +KIQL S+HG QT VE+EDF +A+ D IAHSA KI+SRLK  GEKT QALKSLCWR KG+
Sbjct  386  VKIQLFSSHGTQTLVEVEDFVKAQPDCIAHSAAKIISRLKAGGEKTTQALKSLCWRLKGL  445

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            QVEE  LIGVDSLG DLRVCSGTQVQTLRFA   RA+SEYSAERQLN+LLFPR Q   Q
Sbjct  446  QVEEAVLIGVDSLGFDLRVCSGTQVQTLRFAHNTRATSEYSAERQLNDLLFPRMQHKPQ  504



>ref|XP_009377567.1| PREDICTED: uncharacterized protein At3g49140-like [Pyrus x bretschneideri]
Length=510

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 186/239 (78%), Gaps = 4/239 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM+FA++L+EV  DDPID+ E  PA LAIQG++RPA +EEH VIQK +SDH++ 
Sbjct  269  TMRYSHPMNFAKKLSEVASDDPIDWAEQAPASLAIQGLIRPALIEEHSVIQKHLSDHQSC  328

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELE--KDETLGSGTSFYKLEM  596
            N   +++ +  +      V INGH  KSG+ +D+P   EELE  KDET G+ T+FYKL M
Sbjct  329  NDGVDEVGRTVEDDLEDPVRINGH--KSGISKDSPALEEELENKKDETPGNRTTFYKLGM  386

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            +KIQL S+HG+QT VE+EDF +A+ DAIAHSA KI+SRLK  GEKT QALKSLCWR KG+
Sbjct  387  VKIQLFSSHGSQTVVEVEDFVKAQPDAIAHSAAKIISRLKADGEKTTQALKSLCWRLKGL  446

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            QVEE  LIGVDSLG DLRVCSGTQVQTLRFA   RA+SEYSAERQLN+LLFPR Q+  Q
Sbjct  447  QVEEAVLIGVDSLGFDLRVCSGTQVQTLRFALNTRATSEYSAERQLNDLLFPRMQQKPQ  505



>ref|XP_007038839.1| Pentatricopeptide repeat superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY23340.1| Pentatricopeptide repeat superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=516

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 193/246 (78%), Gaps = 1/246 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTEV  DDPID+ME P  GLAIQG++RPAF+EEH  IQK MS +++ 
Sbjct  270  TMRSSHPMYFAKKLTEVASDDPIDWMEQPSDGLAIQGLIRPAFVEEHSEIQKHMSSNQSR  329

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D +Q+ K  + K   +  ING  ++ G   D+   +EE EK E   +G+SFYKLE++K
Sbjct  330  SSDTSQVEKVVEDKLEDLGIINGQSNELGWSGDSSTISEEPEKKEISINGSSFYKLEIVK  389

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIA SA KI+S LK  GEKT QALKSLCWRCK IQV
Sbjct  390  IQLITAHGHQTVVELEDFKQAQPDAIAQSAAKIISCLKAGGEKTTQALKSLCWRCKSIQV  449

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEV++IG+DSLG DLRVC G Q+QTLRFAF  RA+SEYSAERQLN+LLFPR+ QK Q+R 
Sbjct  450  EEVAIIGIDSLGFDLRVCCGPQIQTLRFAFNTRATSEYSAERQLNDLLFPRSHQKPQKRT  509

Query  232  EAQQAE  215
            +A Q E
Sbjct  510  QAHQNE  515



>ref|XP_009375539.1| PREDICTED: uncharacterized protein At3g49140-like [Pyrus x bretschneideri]
Length=506

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 186/239 (78%), Gaps = 4/239 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM+FA++L+EV  DDPID+ E  PA LAIQG++RPA +EEH VIQK +SDH++ 
Sbjct  265  TMRYSHPMNFAKKLSEVASDDPIDWAEQAPASLAIQGLIRPALIEEHSVIQKHLSDHQSC  324

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELE--KDETLGSGTSFYKLEM  596
            N   +++ +  +      V INGH  KSG+ +D+P   EELE  KDET G+ T+FYKL M
Sbjct  325  NDGVDEVGRTVEDDLEDPVRINGH--KSGISRDSPASEEELENKKDETPGNRTTFYKLGM  382

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            +KIQL S+HG+QT VE+EDF +A+ DAIAHSA KI+SRLK  GEKT QALKSLCWR KG+
Sbjct  383  VKIQLFSSHGSQTVVEVEDFVKAQPDAIAHSAAKIISRLKADGEKTTQALKSLCWRLKGL  442

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            QVEE  LIGVDSLG DLRVCSGTQVQTLRFA   RA+SEYSAERQLN+LLFPR Q+  Q
Sbjct  443  QVEEAVLIGVDSLGFDLRVCSGTQVQTLRFALNTRATSEYSAERQLNDLLFPRMQQKPQ  501



>ref|XP_010279050.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Nelumbo nucifera]
Length=514

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 188/248 (76%), Gaps = 3/248 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L E   D PID+ME P  GLAIQG+L P F+EE  VIQ+ + DH+ S
Sbjct  268  TMRSSHPMYFAKKLAEAASDLPIDWMEQPSVGLAIQGLLTPVFVEE-AVIQEHIPDHEYS  326

Query  769  NAD-RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMI  593
            N + +NQ+ +  + K   I  + GH+H+    + N  WAE+LE DE+L +G SFYKLEM+
Sbjct  327  NGNSKNQVGEYVEDKLEDIGMVYGHQHELASSEGNSIWAEQLEIDESLRTGVSFYKLEMV  386

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            KIQ+ISAHGNQT V+++DF++A+ DAIAH A KI+S LK  GEK  +ALKSLCWR K IQ
Sbjct  387  KIQMISAHGNQTAVDVKDFQKAKPDAIAHYATKIISSLKAGGEKVTKALKSLCWRRKNIQ  446

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQR  236
            VEE  L+GVDSLG DLRVCSGTQVQTLRFAFK RA+SEYSAERQL++LLFPR   KL +R
Sbjct  447  VEEAMLVGVDSLGFDLRVCSGTQVQTLRFAFKSRATSEYSAERQLHDLLFPRIHHKLPKR  506

Query  235  KEAQQAES  212
            +   + ES
Sbjct  507  QHVHKKES  514



>ref|XP_010261375.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 186/247 (75%), Gaps = 7/247 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+RL EV  D P+D+ME PPAGLAIQG+LRPAF EE   IQK +  H+  
Sbjct  277  TMRSSHPMYFAKRLAEVASDLPVDWMEQPPAGLAIQGLLRPAFNEESSFIQKYIPGHERR  336

Query  769  NAD-RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMI  593
            N +  NQ+ + A+ K   I   NG        +DNP  AEEL+K+E L + TSFYKLE++
Sbjct  337  NDNSNNQVEENAENKLEDIGMANGE----STSEDNPV-AEELDKNERLRTRTSFYKLEIV  391

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            KIQLI AHGNQT V IEDF+ A+ DAIAHS+ KILSRLK SGEK  +ALKSLCWRCK +Q
Sbjct  392  KIQLILAHGNQTVVAIEDFQEAKPDAIAHSSAKILSRLKASGEKITEALKSLCWRCKNVQ  451

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQR  236
            VEE +L+GVDSLG DLRVCSGTQVQTLRFAFK RA+SEYSAERQL  LLFPR   KL + 
Sbjct  452  VEEAALVGVDSLGFDLRVCSGTQVQTLRFAFKTRATSEYSAERQLRELLFPRIHHKLPKP  511

Query  235  KEAQQAE  215
            ++A Q E
Sbjct  512  QQAHQKE  518



>ref|XP_010261376.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Nelumbo 
nucifera]
Length=515

 Score =   303 bits (775),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 186/247 (75%), Gaps = 7/247 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+RL EV  D P+D+ME PPAGLAIQG+LRPAF EE   IQK +  H+  
Sbjct  273  TMRSSHPMYFAKRLAEVASDLPVDWMEQPPAGLAIQGLLRPAFNEESSFIQKYIPGHERR  332

Query  769  NAD-RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMI  593
            N +  NQ+ + A+ K   I   NG        +DNP  AEEL+K+E L + TSFYKLE++
Sbjct  333  NDNSNNQVEENAENKLEDIGMANGE----STSEDNPV-AEELDKNERLRTRTSFYKLEIV  387

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            KIQLI AHGNQT V IEDF+ A+ DAIAHS+ KILSRLK SGEK  +ALKSLCWRCK +Q
Sbjct  388  KIQLILAHGNQTVVAIEDFQEAKPDAIAHSSAKILSRLKASGEKITEALKSLCWRCKNVQ  447

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQR  236
            VEE +L+GVDSLG DLRVCSGTQVQTLRFAFK RA+SEYSAERQL  LLFPR   KL + 
Sbjct  448  VEEAALVGVDSLGFDLRVCSGTQVQTLRFAFKTRATSEYSAERQLRELLFPRIHHKLPKP  507

Query  235  KEAQQAE  215
            ++A Q E
Sbjct  508  QQAHQKE  514



>ref|XP_004308044.1| PREDICTED: uncharacterized protein At3g49140 [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/240 (63%), Positives = 183/240 (76%), Gaps = 5/240 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM+FA++LTEV  DDPID+ E  PA L IQG+LRPA+++EH VI+K  SDH+ +
Sbjct  269  TMRYSHPMYFAKKLTEVASDDPIDWAEQAPASLVIQGLLRPAYIDEHTVIKKHFSDHELN  328

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEEL--EKDETLGSGTSFYKLEM  596
            N D  Q+ +  +        INGH  +SG  + +P  AEE   EK ET  +GT+FYKLE+
Sbjct  329  N-DEKQVERTVEAHSEEPDKINGH--ESGSLEGSPLQAEESDNEKGETPKNGTTFYKLEI  385

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            +KIQL S+HG+ + VE+EDF +A+ DAIAHSA KI+SRLK  GEKT QALKSLCWR KGI
Sbjct  386  VKIQLFSSHGHLSVVEVEDFVKAKPDAIAHSAAKIISRLKAGGEKTTQALKSLCWRLKGI  445

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            QVEEV LIG+DSLG DLRVCSGTQVQTLRFA   RA+SEYSAERQLN+LLFPRTQ   Q+
Sbjct  446  QVEEVVLIGIDSLGFDLRVCSGTQVQTLRFALNARATSEYSAERQLNDLLFPRTQHKPQK  505



>gb|KHG16901.1| hypothetical protein F383_22772 [Gossypium arboreum]
Length=515

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  272  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  331

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ +++ L + + + +E   K+E   +G+SFYKLEMIK
Sbjct  332  GSDTNQAEKVVGDKVEDLGIINGYGNETELSRKSTS-SERSGKNEISTNGSSFYKLEMIK  390

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAHSA KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  391  IQLITAHGHQTDVELEDFKQAQPDAIAHSAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  450

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            EEV++I VDSLG  LR+CSGTQ++TLRFAF  RA+SEYSAERQLN++LFPR+ +  Q++
Sbjct  451  EEVAIISVDSLGFVLRICSGTQIETLRFAFNARATSEYSAERQLNDMLFPRSHQRPQKQ  509



>gb|KDO56814.1| hypothetical protein CISIN_1g010741mg [Citrus sinensis]
Length=371

 Score =   295 bits (754),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 188/246 (76%), Gaps = 5/246 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L+EV  DDPID+ME PPAG+ IQG+LRPA +EEH  IQ+  S ++  
Sbjct  129  TMRSSHPMYFAKKLSEVISDDPIDWMEQPPAGITIQGLLRPALIEEHSDIQRHRSSNQYH  188

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D ++     + +E   V INGHR++S   + + N +EE +KD+   +GTSFYKLEM K
Sbjct  189  DVDNSKNVVVGNNQEDLHV-INGHRNES---EPSRNGSEESKKDDKPMNGTSFYKLEMTK  244

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ I AH +Q  V+IED+R+A+ D IAHSA  I+SRLK  GEKT QALKSLCWR KGIQV
Sbjct  245  IQPILAHAHQAAVDIEDYRKAQPDVIAHSAANIISRLKAGGEKTTQALKSLCWRTKGIQV  304

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EE ++IGVDS+G DLRVC+GTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR  QK Q+RK
Sbjct  305  EEEAVIGVDSIGFDLRVCAGTQIQTLRFAFNTRATSEYSAERQLNDLLFPRIHQKPQKRK  364

Query  232  EAQQAE  215
            +  Q E
Sbjct  365  QTYQNE  370



>gb|KJB18778.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=319

 Score =   291 bits (744),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  76   TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  135

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  136  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  194

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  195  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  254

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            EEV++I VDSLG  LR+CSGTQ++TLRFAF  RA+SEYSAERQLN++LFPR+ +  Q++
Sbjct  255  EEVAIISVDSLGFVLRICSGTQIETLRFAFNARATSEYSAERQLNDMLFPRSHQRPQKQ  313



>gb|KHG24021.1| hypothetical protein F383_31053 [Gossypium arboreum]
Length=509

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 185/239 (77%), Gaps = 2/239 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA +LTEV  DDPID ME P  GLAIQG LRPAF+EEH  IQK +S +++ 
Sbjct  266  TMHSSHPMYFANKLTEVASDDPIDLMEQPSDGLAIQGRLRPAFIEEHSEIQKHISTNQSR  325

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D++Q+ K    K   +  INGHR+  G  +DN   +EE EK+E   +G+ FYKL+M K
Sbjct  326  SSDKHQVEKVVGDKVEDVSIINGHRNGLGSSEDNST-SEESEKNEISMNGSLFYKLQMSK  384

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAHSA KI+SRLK  GEKT+QALKSLCWRCKGI V
Sbjct  385  IQLITAHGHQTDVELEDFKQAQPDAIAHSAAKIISRLKAGGEKTVQALKSLCWRCKGIPV  444

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQR  236
            EE ++I VDSLG +LR+  GTQ+QTLRF +  RA+SEYSAERQ+ +LLFPR+ QK Q+R
Sbjct  445  EEAAIISVDSLGFNLRISCGTQIQTLRFTYNARATSEYSAERQIKDLLFPRSHQKPQKR  503



>gb|KDO56813.1| hypothetical protein CISIN_1g010741mg [Citrus sinensis]
Length=502

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 188/246 (76%), Gaps = 5/246 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L+EV  DDPID+ME PPAG+ IQG+LRPA +EEH  IQ+  S ++  
Sbjct  260  TMRSSHPMYFAKKLSEVISDDPIDWMEQPPAGITIQGLLRPALIEEHSDIQRHRSSNQYH  319

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D ++     + +E   V INGHR++S   + + N +EE +KD+   +GTSFYKLEM K
Sbjct  320  DVDNSKNVVVGNNQEDLHV-INGHRNES---EPSRNGSEESKKDDKPMNGTSFYKLEMTK  375

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ I AH +Q  V+IED+R+A+ D IAHSA  I+SRLK  GEKT QALKSLCWR KGIQV
Sbjct  376  IQPILAHAHQAAVDIEDYRKAQPDVIAHSAANIISRLKAGGEKTTQALKSLCWRTKGIQV  435

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EE ++IGVDS+G DLRVC+GTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR  QK Q+RK
Sbjct  436  EEEAVIGVDSIGFDLRVCAGTQIQTLRFAFNTRATSEYSAERQLNDLLFPRIHQKPQKRK  495

Query  232  EAQQAE  215
            +  Q E
Sbjct  496  QTYQNE  501



>gb|KJB18775.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=376

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  133  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  192

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  193  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  251

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  252  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  311

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            EEV++I VDSLG  LR+CSGTQ++TLRFAF  RA+SEYSAERQLN++LFPR+ +  Q++
Sbjct  312  EEVAIISVDSLGFVLRICSGTQIETLRFAFNARATSEYSAERQLNDMLFPRSHQRPQKQ  370



>ref|XP_006422049.1| hypothetical protein CICLE_v10004809mg [Citrus clementina]
 gb|ESR35289.1| hypothetical protein CICLE_v10004809mg [Citrus clementina]
Length=370

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 187/246 (76%), Gaps = 6/246 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L+EV  DDPID+ME PPAG+ IQG+LRPA +EEH  IQ+  S ++  
Sbjct  129  TMRSSHPMYFAKKLSEVISDDPIDWMEQPPAGITIQGLLRPALIEEHSDIQRHRSSNQYH  188

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D N  +   + +E   V INGHR++S   + + N +E  +KD+   +GTSFYKLEM K
Sbjct  189  DVD-NSKNVVGNNQEDLHV-INGHRNES---EPSRNGSEVSKKDDKPMNGTSFYKLEMTK  243

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ I AH +Q  V+IED+R+A+ D IAHSA  I+SRLK  GEKT QALKSLCWR KGIQV
Sbjct  244  IQPILAHAHQAAVDIEDYRKAQPDVIAHSAANIISRLKAGGEKTTQALKSLCWRTKGIQV  303

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EE ++IGVDS+G DLRVC+GTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR  QK Q+RK
Sbjct  304  EEEAVIGVDSIGFDLRVCAGTQIQTLRFAFNTRATSEYSAERQLNDLLFPRIHQKPQKRK  363

Query  232  EAQQAE  215
            +  Q E
Sbjct  364  QTYQNE  369



>ref|XP_008382477.1| PREDICTED: uncharacterized protein At3g49140-like [Malus domestica]
Length=506

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 184/239 (77%), Gaps = 4/239 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM+FA++L+EV  DDPID+ E  PA LAIQG++RPA +EEH VIQK +SDH++ 
Sbjct  265  TMRYSHPMNFAKKLSEVASDDPIDWAEQAPASLAIQGLIRPALIEEHSVIQKHLSDHQSC  324

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNP--NWAEELEKDETLGSGTSFYKLEM  596
            N   +++ +  +      V INGH  KSG+ +D+P      E ++DET G+ T+FYKL M
Sbjct  325  NDGVDEVGRTVEDDLEDPVRINGH--KSGISKDSPASEEELENKEDETPGNRTTFYKLGM  382

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            +KIQL S+HG+QT VE+EDF +A+ DAIAHSA KI+SRLK  GEKT QALKSLCWR KG+
Sbjct  383  VKIQLFSSHGSQTVVEVEDFVKAQPDAIAHSAAKIISRLKADGEKTTQALKSLCWRLKGL  442

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            QVEE  LIGVDSLG +LRVCSGTQVQTLRFA   RA+SEYSAERQLN+LLFPR Q+  Q
Sbjct  443  QVEEAVLIGVDSLGFELRVCSGTQVQTLRFALNTRATSEYSAERQLNDLLFPRMQQKPQ  501



>ref|XP_006490620.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Citrus sinensis]
Length=444

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 187/246 (76%), Gaps = 6/246 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L+EV  DDPID+ME PPAG+ IQG+LRPA +EEH  IQ+  S ++  
Sbjct  203  TMRSSHPMYFAKKLSEVISDDPIDWMEQPPAGITIQGLLRPALIEEHSDIQRHRSSNQYH  262

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D N  +   + +E   V INGHR++S   + + N +E  +KD+   +GTSFYKLEM K
Sbjct  263  DVD-NSKNVVGNNQEDLHV-INGHRNES---EPSRNGSEVSKKDDKPMNGTSFYKLEMTK  317

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ I AH +Q  V+IED+R+A+ D IAHSA  I+SRLK  GEKT QALKSLCWR KGIQV
Sbjct  318  IQPILAHAHQAAVDIEDYRKAQPDVIAHSAANIISRLKAGGEKTTQALKSLCWRTKGIQV  377

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EE ++IGVDS+G DLRVC+GTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR  QK Q+RK
Sbjct  378  EEEAVIGVDSIGFDLRVCAGTQIQTLRFAFNTRATSEYSAERQLNDLLFPRIHQKPQKRK  437

Query  232  EAQQAE  215
            +  Q E
Sbjct  438  QTYQNE  443



>gb|KJB18774.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=430

 Score =   290 bits (741),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  187  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  246

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  247  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  305

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  306  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  365

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            EEV++I VDSLG  LR+CSGTQ++TLRFAF  RA+SEYSAERQLN++LFPR+ +  Q++
Sbjct  366  EEVAIISVDSLGFVLRICSGTQIETLRFAFNARATSEYSAERQLNDMLFPRSHQRPQKQ  424



>gb|KHN42465.1| Hypothetical protein glysoja_033933 [Glycine soja]
Length=515

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 186/249 (75%), Gaps = 9/249 (4%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            +M+SSHPM+FA++L E+  DDP+D+ME PPA +AIQG++RPAF+EEH  IQK +S +++S
Sbjct  271  SMQSSHPMYFAKKLAEIASDDPVDWMEQPPACVAIQGVIRPAFVEEHSTIQKHLSANQSS  330

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETL---GSGTSFYKLE  599
            + D+   S++ + K   I  INGH   SG   DN   A+++E +E        TSFYKLE
Sbjct  331  DTDK---SRSIESKGENIGVINGHVLNSGSSGDNA--AQQVENNENSVIPSCETSFYKLE  385

Query  598  MIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKG  419
            MIKIQ+ SA G  T +E+ED+  A+ D IAHSA KI+SRLK  GEKT++ALKSLCWRCKG
Sbjct  386  MIKIQVFSAQGQPTALELEDYMNAQPDIIAHSASKIISRLKADGEKTLEALKSLCWRCKG  445

Query  418  IQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            IQVEE  LI +DSLG DLRVCSGTQ+QTLRF FKKRA+SEYSAERQLN++LFPR    QQ
Sbjct  446  IQVEEAQLICLDSLGFDLRVCSGTQIQTLRFTFKKRATSEYSAERQLNDILFPRIHPKQQ  505

Query  238  R-KEAQQAE  215
            + K+  Q E
Sbjct  506  KMKQTHQNE  514



>ref|XP_006422050.1| hypothetical protein CICLE_v10004809mg [Citrus clementina]
 ref|XP_006490619.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Citrus sinensis]
 gb|ESR35290.1| hypothetical protein CICLE_v10004809mg [Citrus clementina]
Length=501

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 187/246 (76%), Gaps = 6/246 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L+EV  DDPID+ME PPAG+ IQG+LRPA +EEH  IQ+  S ++  
Sbjct  260  TMRSSHPMYFAKKLSEVISDDPIDWMEQPPAGITIQGLLRPALIEEHSDIQRHRSSNQYH  319

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D N  +   + +E   V INGHR++S   + + N +E  +KD+   +GTSFYKLEM K
Sbjct  320  DVD-NSKNVVGNNQEDLHV-INGHRNES---EPSRNGSEVSKKDDKPMNGTSFYKLEMTK  374

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ I AH +Q  V+IED+R+A+ D IAHSA  I+SRLK  GEKT QALKSLCWR KGIQV
Sbjct  375  IQPILAHAHQAAVDIEDYRKAQPDVIAHSAANIISRLKAGGEKTTQALKSLCWRTKGIQV  434

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EE ++IGVDS+G DLRVC+GTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR  QK Q+RK
Sbjct  435  EEEAVIGVDSIGFDLRVCAGTQIQTLRFAFNTRATSEYSAERQLNDLLFPRIHQKPQKRK  494

Query  232  EAQQAE  215
            +  Q E
Sbjct  495  QTYQNE  500



>gb|KJB18776.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=487

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  244  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  303

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  304  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  362

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  363  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  422

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            EEV++I VDSLG  LR+CSGTQ++TLRFAF  RA+SEYSAERQLN++LFPR+ +  Q++
Sbjct  423  EEVAIISVDSLGFVLRICSGTQIETLRFAFNARATSEYSAERQLNDMLFPRSHQRPQKQ  481



>gb|KJB18777.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=494

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  251  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  310

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  311  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  369

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  370  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  429

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            EEV++I VDSLG  LR+CSGTQ++TLRFAF  RA+SEYSAERQLN++LFPR+ +  Q++
Sbjct  430  EEVAIISVDSLGFVLRICSGTQIETLRFAFNARATSEYSAERQLNDMLFPRSHQRPQKQ  488



>ref|XP_003619417.1| hypothetical protein MTR_6g052360 [Medicago truncatula]
 gb|KEH26303.1| PPR superfamily protein, putative [Medicago truncatula]
Length=325

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 183/249 (73%), Gaps = 7/249 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM FA++LTE+  DDPID+ME PPA +  QG++RPAF+EE+  IQK +S +++S
Sbjct  79   TMRFSHPMDFAKKLTEIASDDPIDWMEQPPACVVFQGVIRPAFIEENSPIQKHLSANQSS  138

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNW-AEELEKDETLGSGTSFYKLEMI  593
             A   +ISK  + KE ++  INGH H     +DN +   E  E  +T    TSFY+LE++
Sbjct  139  TA---EISKVTENKEESVGAINGHEHNKESSEDNASQKVENNENGDTPSDETSFYRLEIV  195

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGE--KTIQALKSLCWRCKG  419
            KIQ+ SAHG+   +E+ED+ +A+ DAIA S+ KI+S LK +GE  KT+QALKSLCW CKG
Sbjct  196  KIQVFSAHGHPVVLEVEDYTKAQPDAIARSSSKIISHLKAAGESEKTLQALKSLCWICKG  255

Query  418  IQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            IQVEE  LI VDSLG D+RVCSGTQVQTLRF FKKRA+SEYSAERQLN++LFPR    QQ
Sbjct  256  IQVEEAQLICVDSLGFDVRVCSGTQVQTLRFGFKKRATSEYSAERQLNDILFPRNHPKQQ  315

Query  238  R-KEAQQAE  215
            + K+  Q E
Sbjct  316  KTKQTHQNE  324



>ref|XP_006588200.1| PREDICTED: uncharacterized protein At3g49140-like [Glycine max]
Length=523

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 186/249 (75%), Gaps = 9/249 (4%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            +M+SSHPM+FA++L E+  DDP+D+ME PPA +AIQG++RPAF+EEH  IQK +S +++S
Sbjct  279  SMQSSHPMYFAKKLAEIASDDPVDWMEQPPACVAIQGVIRPAFVEEHSTIQKHLSANQSS  338

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDET---LGSGTSFYKLE  599
            + D+   S++ + K   I  INGH   SG   DN   A+++E +E        TSFYKLE
Sbjct  339  DTDK---SRSIESKGENIGVINGHVLNSGSSGDNA--AQQVENNENSVIPSCETSFYKLE  393

Query  598  MIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKG  419
            MIKIQ+ SA G  T +E+ED+  A+ D IAHSA KI+SRLK  GEKT++ALKSLCWRCKG
Sbjct  394  MIKIQVFSAQGQPTALELEDYMNAQPDIIAHSASKIISRLKADGEKTLEALKSLCWRCKG  453

Query  418  IQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            IQVEE  LI +DSLG D+RVCSGTQ+QTLRF FKKRA+SEYSAERQLN++LFPR    QQ
Sbjct  454  IQVEEAQLICLDSLGFDVRVCSGTQIQTLRFTFKKRATSEYSAERQLNDILFPRIHPKQQ  513

Query  238  R-KEAQQAE  215
            + K+  Q E
Sbjct  514  KMKQTHQNE  522



>gb|KJB18785.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=517

 Score =   290 bits (741),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  274  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  333

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  334  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  392

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  393  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  452

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            EEV++I VDSLG  LR+CSGTQ++TLRFAF  RA+SEYSAERQLN++LFPR+ +  Q++
Sbjct  453  EEVAIISVDSLGFVLRICSGTQIETLRFAFNARATSEYSAERQLNDMLFPRSHQRPQKQ  511



>gb|KJB18784.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=524

 Score =   289 bits (740),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 187/239 (78%), Gaps = 1/239 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  281  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  340

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  341  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  399

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  400  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  459

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            EEV++I VDSLG  LR+CSGTQ++TLRFAF  RA+SEYSAERQLN++LFPR+ +  Q++
Sbjct  460  EEVAIISVDSLGFVLRICSGTQIETLRFAFNARATSEYSAERQLNDMLFPRSHQRPQKQ  518



>ref|XP_004516701.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Cicer arietinum]
 ref|XP_004516702.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Cicer arietinum]
Length=520

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/247 (59%), Positives = 179/247 (72%), Gaps = 5/247 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPMHFA++L E+  DDPID+ME PPA + IQG+LRPAF+EEH  IQK +S +++S
Sbjct  276  TMRFSHPMHFAKKLAEIASDDPIDWMEQPPACVVIQGVLRPAFVEEHSPIQKHLSANQSS  335

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLG-SGTSFYKLEMI  593
                 +ISK    KE +   INGH H     +DN +   E   +  +    TSFY+LEM+
Sbjct  336  TT---EISKVTQNKEESTGAINGHEHNIESSEDNASQQVENSGNSDIPIDETSFYRLEMV  392

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            KIQ+ SAHG+   +E+ED+ +A+ DAIA S+ KI+S LK  GEKT+QALKSLCWRCK IQ
Sbjct  393  KIQVFSAHGHPIVLELEDYMKAQPDAIARSSSKIISHLKAGGEKTLQALKSLCWRCKSIQ  452

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR-  236
            VEE  LI VDSLG DLRVCSGTQVQTLRF FKKRA+SEYSAERQLN++LFPR    QQ+ 
Sbjct  453  VEEAQLICVDSLGFDLRVCSGTQVQTLRFGFKKRATSEYSAERQLNDILFPRNHPKQQKT  512

Query  235  KEAQQAE  215
            K+  Q E
Sbjct  513  KQTHQNE  519



>ref|XP_002513639.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49042.1| conserved hypothetical protein [Ricinus communis]
Length=461

 Score =   282 bits (722),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 172/235 (73%), Gaps = 6/235 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L +V  DDPID+ME PPAGLAIQG++RPAF+EEH  IQK MS + + 
Sbjct  208  TMRSSHPMYFAKKLAQVASDDPIDWMEQPPAGLAIQGLIRPAFIEEHSDIQKHMSGNLSH  267

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            N+D N+  K  D K      INGH H+ G+ +DN   AEE +KD+   +GTSFYKLEMIK
Sbjct  268  NSDINETGKNVDSKLENDSGINGHEHEPGISEDNSVGAEESQKDKAPRNGTSFYKLEMIK  327

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLIS+ G QT VE EDFR+A+ DAIAHS+ KILSRLK  GEK  QALKSLCWRCKG+QV
Sbjct  328  IQLISSLGQQTVVEEEDFRKAQPDAIAHSSGKILSRLKAGGEKITQALKSLCWRCKGLQV  387

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKL  245
            EE ++I VDSLG D RVCS T+++TLRF+F  R S      R + +L  P   +L
Sbjct  388  EEAAVISVDSLGFDARVCSETKIETLRFSFNSRIS------RLVQSLHMPSVAQL  436



>gb|KHN09284.1| Hypothetical protein glysoja_029055 [Glycine soja]
Length=461

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 183/249 (73%), Gaps = 9/249 (4%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHP++FA++L E+  DDP+D+ME PPA +AIQG++RPAF++EH  IQK +S +++S
Sbjct  217  TMRSSHPVYFAKKLAEIASDDPVDWMEQPPACVAIQGVIRPAFVDEHSTIQKHLSANQSS  276

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDET---LGSGTSFYKLE  599
            + D+   SK+ + K   I  INGH   S    DN   A+++E +       S TSFYKL 
Sbjct  277  DTDK---SKSIESKGENIGVINGHVLNSESSGDNA--AQQVENNGNSVIPFSETSFYKLV  331

Query  598  MIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKG  419
            MIKIQ+ SA G  T +E+ED+  A+ D IAHSA KI+SRLK  GE+T++ALKSLCWRCKG
Sbjct  332  MIKIQVFSAQGQPTAIELEDYMNAQPDVIAHSASKIISRLKADGEETLEALKSLCWRCKG  391

Query  418  IQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            IQVEE  LI +DSLG DLRVCSGTQ+QTLRF FK RA+SEYSAERQLN++LFPR    QQ
Sbjct  392  IQVEEAQLICLDSLGFDLRVCSGTQIQTLRFTFKNRATSEYSAERQLNDILFPRIHPKQQ  451

Query  238  R-KEAQQAE  215
            + K+  Q E
Sbjct  452  KMKQTHQNE  460



>ref|XP_003619416.1| hypothetical protein MTR_6g052360 [Medicago truncatula]
 gb|AES75634.1| PPR superfamily protein, putative [Medicago truncatula]
Length=524

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 183/249 (73%), Gaps = 7/249 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM FA++LTE+  DDPID+ME PPA +  QG++RPAF+EE+  IQK +S +++S
Sbjct  278  TMRFSHPMDFAKKLTEIASDDPIDWMEQPPACVVFQGVIRPAFIEENSPIQKHLSANQSS  337

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNW-AEELEKDETLGSGTSFYKLEMI  593
             A   +ISK  + KE ++  INGH H     +DN +   E  E  +T    TSFY+LE++
Sbjct  338  TA---EISKVTENKEESVGAINGHEHNKESSEDNASQKVENNENGDTPSDETSFYRLEIV  394

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGE--KTIQALKSLCWRCKG  419
            KIQ+ SAHG+   +E+ED+ +A+ DAIA S+ KI+S LK +GE  KT+QALKSLCW CKG
Sbjct  395  KIQVFSAHGHPVVLEVEDYTKAQPDAIARSSSKIISHLKAAGESEKTLQALKSLCWICKG  454

Query  418  IQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            IQVEE  LI VDSLG D+RVCSGTQVQTLRF FKKRA+SEYSAERQLN++LFPR    QQ
Sbjct  455  IQVEEAQLICVDSLGFDVRVCSGTQVQTLRFGFKKRATSEYSAERQLNDILFPRNHPKQQ  514

Query  238  R-KEAQQAE  215
            + K+  Q E
Sbjct  515  KTKQTHQNE  523



>gb|KJB18783.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=522

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 187/244 (77%), Gaps = 6/244 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  274  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  333

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  334  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  392

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  393  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  452

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKR-----ASSEYSAERQLNNLLFPRTQKL  245
            EEV++I VDSLG  LR+CSGTQ++TLRFAF  R     A+SEYSAERQLN++LFPR+ + 
Sbjct  453  EEVAIISVDSLGFVLRICSGTQIETLRFAFNARVCHTLATSEYSAERQLNDMLFPRSHQR  512

Query  244  QQRK  233
             Q++
Sbjct  513  PQKQ  516



>ref|XP_010279048.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Nelumbo nucifera]
Length=551

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 188/285 (66%), Gaps = 40/285 (14%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTE-------------------------------------VXDDDPI  881
            TMRSSHPM+FA++L E                                        D PI
Sbjct  268  TMRSSHPMYFAKKLAECLCRFYYRPVLSYIRMEWLKLWSPFLFLDHQHEIRELAASDLPI  327

Query  880  DFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNAD-RNQISKAADCKETTIVPIN  704
            D+ME P  GLAIQG+L P F+EE  VIQ+ + DH+ SN + +NQ+ +  + K   I  + 
Sbjct  328  DWMEQPSVGLAIQGLLTPVFVEE-AVIQEHIPDHEYSNGNSKNQVGEYVEDKLEDIGMVY  386

Query  703  GHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLISAHGNQTFVEIEDFRRAR  524
            GH+H+    + N  WAE+LE DE+L +G SFYKLEM+KIQ+ISAHGNQT V+++DF++A+
Sbjct  387  GHQHELASSEGNSIWAEQLEIDESLRTGVSFYKLEMVKIQMISAHGNQTAVDVKDFQKAK  446

Query  523  ADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQ  344
             DAIAH A KI+S LK  GEK  +ALKSLCWR K IQVEE  L+GVDSLG DLRVCSGTQ
Sbjct  447  PDAIAHYATKIISSLKAGGEKVTKALKSLCWRRKNIQVEEAMLVGVDSLGFDLRVCSGTQ  506

Query  343  VQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRKEAQQAES  212
            VQTLRFAFK RA+SEYSAERQL++LLFPR   KL +R+   + ES
Sbjct  507  VQTLRFAFKSRATSEYSAERQLHDLLFPRIHHKLPKRQHVHKKES  551



>ref|XP_006599546.1| PREDICTED: uncharacterized protein At3g49140-like [Glycine max]
Length=518

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 183/249 (73%), Gaps = 9/249 (4%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHP++FA++L E+  DDP+D+ME PPA +AIQG++RPAF++EH  IQK +S +++S
Sbjct  274  TMRSSHPVYFAKKLAEIASDDPVDWMEQPPACVAIQGVIRPAFVDEHSTIQKHLSANQSS  333

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDET---LGSGTSFYKLE  599
            + D+   SK+ + K   I  INGH   S    DN   A+++E +       S TSFYKL 
Sbjct  334  DTDK---SKSIESKGENIGVINGHVLNSESSGDNA--AQQVENNGNSVIPFSETSFYKLV  388

Query  598  MIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKG  419
            MIKIQ+ SA G  T +E+ED+  A+ D IAHSA KI+SRLK  GE+T++ALKSLCWRCKG
Sbjct  389  MIKIQVFSAQGQPTAIELEDYMNAQPDVIAHSASKIISRLKADGEETLEALKSLCWRCKG  448

Query  418  IQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            IQVEE  LI +DSLG DLRVCSGTQ+QTLRF FK RA+SEYSAERQLN++LFPR    QQ
Sbjct  449  IQVEEAQLICLDSLGFDLRVCSGTQIQTLRFTFKNRATSEYSAERQLNDILFPRIHPKQQ  508

Query  238  R-KEAQQAE  215
            + K+  Q E
Sbjct  509  KMKQTHQNE  517



>ref|XP_008439307.1| PREDICTED: uncharacterized protein At3g49140-like [Cucumis melo]
Length=528

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 147/247 (60%), Positives = 179/247 (72%), Gaps = 5/247 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPMHFA +L+EV  DDPID+ME PPA L IQG+LRPAF EE  VIQK +S    S
Sbjct  284  TMRSSHPMHFANKLSEVASDDPIDWMEQPPATLVIQGVLRPAFSEEQTVIQKHLSSRHLS  343

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETL-GSGTSFYKLEMI  593
            N D N+  K  +  E+    IN H H+S   +D  N  + L  DE++  S  SFY+LEMI
Sbjct  344  NGDINEAQKLEENLESH-GRINHHGHESSSSKDGLNLMDAL--DESIPASEASFYRLEMI  400

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            K+QL + + + + VEIED  +A+ DAIAHSA KI+SRL+  GEKT QALKSLCWRCKGIQ
Sbjct  401  KVQLFTGNSHPSDVEIEDLMKAQPDAIAHSAEKIISRLRAGGEKTTQALKSLCWRCKGIQ  460

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQR  236
            VEE  + G+DSLG D+RVCSGTQVQTLRFAF  RA+SE+SAE+QLN+LLFPR   K Q+ 
Sbjct  461  VEEAVINGIDSLGFDVRVCSGTQVQTLRFAFDTRATSEFSAEKQLNDLLFPRIHSKHQKM  520

Query  235  KEAQQAE  215
            K+  Q E
Sbjct  521  KQTYQNE  527



>ref|XP_002323951.2| hypothetical protein POPTR_0017s01000g [Populus trichocarpa]
 gb|EEF04084.2| hypothetical protein POPTR_0017s01000g [Populus trichocarpa]
Length=482

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 171/243 (70%), Gaps = 26/243 (11%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA++L +V  DDPID+ME PPAG+AIQG++RPAF+EE   IQ+ MS +++ 
Sbjct  263  TMSSSHPMYFAKKLAQVASDDPIDWMEQPPAGVAIQGLIRPAFMEEQSDIQRHMSGNQSH  322

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +A  NQ+ ++ + K      INGH HKSG  +D   W EELEKDET              
Sbjct  323  HAGTNQVGQSMEGKLEEPGVINGHEHKSGSSEDISLWREELEKDETT-------------  369

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
                        VE+EDFR+A+ DAIA SA KI+SRLK  GEK  QA KSLCWRCKGIQV
Sbjct  370  ------------VEVEDFRKAQPDAIALSAAKIISRLKAGGEKITQAFKSLCWRCKGIQV  417

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EE ++I VDSLG DLRVCSGTQ+QTLRFAF  RA+SEYSAERQLN+LLFPR Q +LQ++ 
Sbjct  418  EEATIIDVDSLGFDLRVCSGTQIQTLRFAFNSRATSEYSAERQLNDLLFPRIQSRLQKKN  477

Query  232  EAQ  224
             AQ
Sbjct  478  TAQ  480



>ref|XP_007152144.1| hypothetical protein PHAVU_004G106100g [Phaseolus vulgaris]
 gb|ESW24138.1| hypothetical protein PHAVU_004G106100g [Phaseolus vulgaris]
Length=509

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 180/247 (73%), Gaps = 6/247 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM++SHPM+FA++L E+  DDP+D+ME PPA +AIQG++R AF+EEH  IQK +S  ++S
Sbjct  266  TMQASHPMYFAKKLAEIASDDPVDWMEQPPACVAIQGVIRAAFVEEHSTIQKHLSAGQSS  325

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLG-SGTSFYKLEMI  593
            + D   ISK+ +     I  INGH   SG   D+ +   E   +  +  S   FYKLEMI
Sbjct  326  DTD---ISKSIE-SNGEIGAINGHVLDSGSSGDDESQQVENNGNSIVPISEAPFYKLEMI  381

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            KIQ+ SA G  T +E+ED+ +A+ D IAHSA KI+SRLK  GEKT+QALKSLCWRCK IQ
Sbjct  382  KIQVFSAQGQPTVLEVEDYMKAQPDVIAHSASKIISRLKADGEKTLQALKSLCWRCKSIQ  441

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR-  236
            VEE  LI +DSLG DLRVCSGTQ+QTLRF+FKKRA+SEYSAERQLN++LFPR    QQ+ 
Sbjct  442  VEEAQLICLDSLGFDLRVCSGTQIQTLRFSFKKRATSEYSAERQLNDILFPRIHPKQQKM  501

Query  235  KEAQQAE  215
            K+  Q E
Sbjct  502  KQTHQNE  508



>ref|XP_010060327.1| PREDICTED: uncharacterized protein At3g49140 [Eucalyptus grandis]
Length=507

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/243 (57%), Positives = 174/243 (72%), Gaps = 4/243 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKT-  773
            TMRSSHPM+FA ++ EV  D PID+ME PP G+AIQG+L PA LEE+ + Q+ +S   T 
Sbjct  268  TMRSSHPMYFAEKVAEVASDGPIDWMERPPVGIAIQGLLSPALLEENSINQRHLSSPDTG  327

Query  772  SNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMI  593
            +  DR +        +++    +G  H     +D P+ AEEL K+ +  SG S YKLEMI
Sbjct  328  AEVDRTRTILEDKQVDSSSTDADGQDHSL---EDGPSRAEELGKNGSPRSGKSLYKLEMI  384

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
             IQL+S HG    VE+EDFR+A+ DAIAHSA KI+SRLK   EKTIQALKSLCWRCKGIQ
Sbjct  385  NIQLLSVHGPPHTVEVEDFRKAQPDAIAHSAAKIISRLKAGEEKTIQALKSLCWRCKGIQ  444

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            VEE  + GVD+LG D+R+CSGTQ+QTLRFAF+ RA+SE SAERQ+NNLLFPR  +   +K
Sbjct  445  VEEAMITGVDALGFDVRICSGTQIQTLRFAFETRATSEQSAERQVNNLLFPRVLRKPHKK  504

Query  232  EAQ  224
            +A 
Sbjct  505  KAH  507



>gb|KJB21281.1| hypothetical protein B456_004G1170002, partial [Gossypium raimondii]
 gb|KJB21283.1| hypothetical protein B456_004G1170002, partial [Gossypium raimondii]
Length=475

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 164/213 (77%), Gaps = 1/213 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA +LTEV  DDPID+ME P  GLAIQG+LRPAF+EEH  IQK +S +++ 
Sbjct  264  TMHSSHPMYFANKLTEVASDDPIDWMEQPSDGLAIQGLLRPAFIEEHSEIQKHISTNQSR  323

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D++Q+ K    K   +  INGHR+  G  +DN   +EE EK+E   +G+ FYKL+M K
Sbjct  324  SSDKHQVEKVVGDKVEDVSIINGHRNGLGSSKDNST-SEESEKNEISMNGSLFYKLQMSK  382

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAHSA KI+SRLK  GEKT+QALKSLCWRCKGI V
Sbjct  383  IQLITAHGHQTDVELEDFKQAQPDAIAHSAAKIISRLKAGGEKTVQALKSLCWRCKGIPV  442

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKR  311
            EE ++I VDS G +LRVC GTQ+QTLRF +  R
Sbjct  443  EEAAIISVDSFGFNLRVCCGTQIQTLRFTYNAR  475



>ref|XP_004140749.1| PREDICTED: uncharacterized protein At3g49140 [Cucumis sativus]
Length=513

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 168/230 (73%), Gaps = 4/230 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPMHFA +L+E+  DDPID+ME PPA L IQG+LRPAF EE  VI+K +S    S
Sbjct  284  TMRSSHPMHFANKLSEIASDDPIDWMEQPPATLVIQGVLRPAFNEEQTVIEKHLSSRHLS  343

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETL-GSGTSFYKLEMI  593
            N D N+  +  +  E     IN H H+S   +D  N  E L  DE++  S  SFY+LEMI
Sbjct  344  NGDINEAQELEENLEGH-GRINHHGHESSSSKDGLNLMEAL--DESIPASEASFYRLEMI  400

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            K+QL + + + + VEIED  +A+ DAIAHSA KI+SRL+  GEKT QALKSLCWRCKGIQ
Sbjct  401  KVQLFTGNSHPSNVEIEDLMKAQPDAIAHSAEKIISRLRAGGEKTTQALKSLCWRCKGIQ  460

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLF  263
            VEE  + G+DSLG D+RVCS TQVQTLRFAF  RA+SE+SAE+QLN+LLF
Sbjct  461  VEEAVINGIDSLGFDVRVCSETQVQTLRFAFDTRATSEFSAEKQLNDLLF  510



>gb|KJB21286.1| hypothetical protein B456_004G1170002, partial [Gossypium raimondii]
Length=471

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 162/208 (78%), Gaps = 1/208 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA +LTEV  DDPID+ME P  GLAIQG+LRPAF+EEH  IQK +S +++ 
Sbjct  264  TMHSSHPMYFANKLTEVASDDPIDWMEQPSDGLAIQGLLRPAFIEEHSEIQKHISTNQSR  323

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D++Q+ K    K   +  INGHR+  G  +DN   +EE EK+E   +G+ FYKL+M K
Sbjct  324  SSDKHQVEKVVGDKVEDVSIINGHRNGLGSSKDNST-SEESEKNEISMNGSLFYKLQMSK  382

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAHSA KI+SRLK  GEKT+QALKSLCWRCKGI V
Sbjct  383  IQLITAHGHQTDVELEDFKQAQPDAIAHSAAKIISRLKAGGEKTVQALKSLCWRCKGIPV  442

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRF  326
            EE ++I VDS G +LRVC GTQ+QTLRF
Sbjct  443  EEAAIISVDSFGFNLRVCCGTQIQTLRF  470



>gb|EPS73614.1| hypothetical protein M569_01143 [Genlisea aurea]
Length=472

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 174/249 (70%), Gaps = 29/249 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEE-HVVIQKQMSDHKT  773
            T+ SSHPM FA+++ EV  D+P+DFM+ P AGLAIQGILRPAF+E+  VVI K   + K 
Sbjct  250  TLSSSHPMDFAKKIAEVASDEPLDFMDQPSAGLAIQGILRPAFIEDPSVVIYKHGDEEK-  308

Query  772  SNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMI  593
                                P  G+   S  ++   +  E  EKD     G SFYKLEM+
Sbjct  309  --------------------PEYGNLGHSNEEESGEDGEEVEEKD-----GFSFYKLEMV  343

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            KIQL+ A+G QT+V+ EDFRRA+ DAIAHSA  I+SR+K  GEK+ QALKSLCWRCKG+Q
Sbjct  344  KIQLVCANGQQTYVDPEDFRRAQPDAIAHSAANIISRVKDGGEKSAQALKSLCWRCKGVQ  403

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKR--ASSEYSAERQLNNLLFPRTQKLQQ  239
            V+E SLIGVDSLG D+RVCS TQ+QTLRFAFKKR  ASSEYSAERQLN+LLFPR  K  Q
Sbjct  404  VDEGSLIGVDSLGFDVRVCSATQIQTLRFAFKKRVGASSEYSAERQLNDLLFPRAHKHHQ  463

Query  238  RKEAQQAES  212
            +KEA+  ES
Sbjct  464  KKEARPTES  472



>gb|KDO56815.1| hypothetical protein CISIN_1g010741mg [Citrus sinensis]
Length=470

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 161/214 (75%), Gaps = 4/214 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++L+EV  DDPID+ME PPAG+ IQG+LRPA +EEH  IQ+  S ++  
Sbjct  260  TMRSSHPMYFAKKLSEVISDDPIDWMEQPPAGITIQGLLRPALIEEHSDIQRHRSSNQYH  319

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D ++     + +E   V INGHR++S   + + N +EE +KD+   +GTSFYKLEM K
Sbjct  320  DVDNSKNVVVGNNQEDLHV-INGHRNES---EPSRNGSEESKKDDKPMNGTSFYKLEMTK  375

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ I AH +Q  V+IED+R+A+ D IAHSA  I+SRLK  GEKT QALKSLCWR KGIQV
Sbjct  376  IQPILAHAHQAAVDIEDYRKAQPDVIAHSAANIISRLKAGGEKTTQALKSLCWRTKGIQV  435

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRA  308
            EE ++IGVDS+G DLRVC+GTQ+QTLRFAF  R 
Sbjct  436  EEEAVIGVDSIGFDLRVCAGTQIQTLRFAFNTRV  469



>gb|KGN57421.1| hypothetical protein Csa_3G184030 [Cucumis sativus]
Length=333

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 153/215 (71%), Gaps = 4/215 (2%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPMHFA +L+E+  DDPID+ME PPA L IQG+LRPAF EE  VI+K +S    S
Sbjct  106  TMRSSHPMHFANKLSEIASDDPIDWMEQPPATLVIQGVLRPAFNEEQTVIEKHLSSRHLS  165

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETL-GSGTSFYKLEMI  593
            N D N+  +  +  E     IN H H+S   +D  N  E L  DE++  S  SFY+LEMI
Sbjct  166  NGDINEAQELEENLEGH-GRINHHGHESSSSKDGLNLMEAL--DESIPASEASFYRLEMI  222

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            K+QL + + + + VEIED  +A+ DAIAHSA KI+SRL+  GEKT QALKSLCWRCKGIQ
Sbjct  223  KVQLFTGNSHPSNVEIEDLMKAQPDAIAHSAEKIISRLRAGGEKTTQALKSLCWRCKGIQ  282

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRA  308
            VEE  + G+DSLG D+RVCS TQVQTLRFAF  R+
Sbjct  283  VEEAVINGIDSLGFDVRVCSETQVQTLRFAFDTRS  317



>gb|AIZ68165.1| pentatricopeptide repeat superfamily protein, putative isoform 
1 [Ornithogalum saundersiae]
Length=452

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 168/237 (71%), Gaps = 22/237 (9%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM+SSHPM+FAR+++EV     +D+M+ P A + +QG+LRPAF EEH  I+K +S   +S
Sbjct  237  TMQSSHPMYFARKISEVVTSTNLDWMDQPSASIVMQGVLRPAFAEEHSFIKKHLSVGGSS  296

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            N +               VP +G   +  +        + L+KD +L S  SFYKL+MI 
Sbjct  297  NDE---------------VPHHGKIVEEKI-------KDALDKDRSLHSEASFYKLDMIS  334

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQL+SA+G Q+ VE++DFR+A+ D + + A +ILS+LK  G+KTI+ALKSLCWR KGI+V
Sbjct  335  IQLVSAYGTQSSVEVQDFRKAQPDDVVNHAAEILSQLKAGGDKTIEALKSLCWRLKGIKV  394

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            EE ++IGVDSLG DLRVCSGTQVQTLRFAF+ RA++E +AERQL++LLFPR+Q   Q
Sbjct  395  EEATVIGVDSLGFDLRVCSGTQVQTLRFAFRTRATTELNAERQLHDLLFPRSQHKNQ  451



>ref|XP_010541478.1| PREDICTED: uncharacterized protein At3g49140-like [Tarenaya hassleriana]
Length=510

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 168/246 (68%), Gaps = 13/246 (5%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HPM+FARR+TEV  DDP+D+ME P AGLAIQG+LR   +E++  IQK ++  ++S
Sbjct  276  TMRACHPMYFARRMTEVASDDPVDWMEQPSAGLAIQGLLRCVVVEDYPDIQKHITLSESS  335

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D N++++  + K   +  +NG         D P      +K     +G S+YKLEM +
Sbjct  336  SIDENKLAENMEEKLEEVGTMNG---------DEPEIDASGDKS---SNGVSYYKLEMTR  383

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT V++ED R+A+ DAIAH++ +I+ RL+  GE  IQALKSLCWR  GIQ 
Sbjct  384  IQLITAQGDQTDVDVEDVRKAKPDAIAHASAEIIRRLEEGGETLIQALKSLCWRHNGIQA  443

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEV LIG+DSLG DLRVCSGTQ+ TLR++F  RA +E SAERQL  LLFP    KLQ+  
Sbjct  444  EEVKLIGIDSLGFDLRVCSGTQIDTLRYSFSVRAITEQSAERQLKELLFPTVLPKLQKPN  503

Query  232  EAQQAE  215
               Q E
Sbjct  504  RTHQKE  509



>gb|KCW90616.1| hypothetical protein EUGRSUZ_A02721 [Eucalyptus grandis]
Length=430

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 156/243 (64%), Gaps = 23/243 (9%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKT-  773
            TMRSSHPM+FA ++ EV  D PID+ME PP G+AIQG+L PA LEE+ + Q+ +S   T 
Sbjct  210  TMRSSHPMYFAEKVAEVASDGPIDWMERPPVGIAIQGLLSPALLEENSINQRHLSSPDTG  269

Query  772  SNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMI  593
            +  DR +        +++    +G  H     +D P+ AEEL K+ +  SG S YKLEMI
Sbjct  270  AEVDRTRTILEDKQVDSSSTDADGQDHSL---EDGPSRAEELGKNGSPRSGKSLYKLEMI  326

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
             IQL+S HG    VE+EDFR+A+ DAIAHSA KI+SRLK   EKTIQALKSLCWRCKGIQ
Sbjct  327  NIQLLSVHGPPHTVEVEDFRKAQPDAIAHSAAKIISRLKAGEEKTIQALKSLCWRCKGIQ  386

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            VEE  + GVD+LG D                   A+SE SAERQ+NNLLFPR  +   +K
Sbjct  387  VEEAMITGVDALGFD-------------------ATSEQSAERQVNNLLFPRVLRKPHKK  427

Query  232  EAQ  224
            +A 
Sbjct  428  KAH  430



>ref|XP_006404172.1| hypothetical protein EUTSA_v10010311mg [Eutrema salsugineum]
 gb|ESQ45625.1| hypothetical protein EUTSA_v10010311mg [Eutrema salsugineum]
Length=501

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 165/246 (67%), Gaps = 18/246 (7%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HPM FA+R+TEV  +DPID+M+ P AGLAIQG+L    +E++  IQK+++D K++
Sbjct  274  TMRSCHPMFFAKRMTEVASNDPIDWMDQPSAGLAIQGLLSHILVEDYSDIQKKLADRKST  333

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              + N   K A+  +  I  IN  +   G          E EK   +    +FYKLEMI+
Sbjct  334  FTNGN---KDAENLQEKIEDIN--KEDGG----------ESEKKRNV---VAFYKLEMIR  375

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ED R+A+ DAIAH++  I+SRL+ SG+K  +ALKSLCWR  GIQ 
Sbjct  376  IQLITAQGDQTDVEVEDVRKAQPDAIAHASAGIISRLEESGDKLAEALKSLCWRHYGIQA  435

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EEV LIG+DSLG D R+C+G ++++LRFAF  RA+SE  AE Q+  LLFP T   +  K+
Sbjct  436  EEVKLIGIDSLGFDFRLCAGAKIESLRFAFLTRATSEDDAEGQMRTLLFPTTNPQKPTKQ  495

Query  229  AQQAES  212
              Q ES
Sbjct  496  TSQKES  501



>ref|NP_190483.3| uncharacterized protein [Arabidopsis thaliana]
 sp|Q0WMN5.2|Y3913_ARATH RecName: Full=Uncharacterized protein At3g49140 [Arabidopsis 
thaliana]
 gb|AEE78503.1| uncharacterized protein AT3G49140 [Arabidopsis thaliana]
Length=499

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 168/243 (69%), Gaps = 20/243 (8%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSD-HKT  773
            TMRS HPM FA+R+TEV  +DP+D+M+ P AGLAIQG+L    +E++  IQK+++D + T
Sbjct  271  TMRSCHPMFFAKRMTEVASNDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQKKLADSNST  330

Query  772  SNADR---NQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKL  602
            +N ++   N + K  D              K+G D+   + ++    DE   +  +FYKL
Sbjct  331  TNGNKDAENLVDKLED------------NSKAGGDESEIDSSQ----DEKARNVVAFYKL  374

Query  601  EMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCK  422
            EMI+IQLI+A G+QT VE+ED R+A+ DAIAH++ +I+SRL+ SG+K  +ALKSLCWR  
Sbjct  375  EMIRIQLITAQGDQTEVEVEDVRKAQPDAIAHASAEIISRLEESGDKITEALKSLCWRHN  434

Query  421  GIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQ  242
             IQ EEV LIG+DSLG DLR+C+G ++++LRFAF  RA+SE +AE Q+  LLFP+T +  
Sbjct  435  SIQAEEVKLIGIDSLGFDLRLCAGAKIESLRFAFSTRATSEENAEGQIRKLLFPKTNQST  494

Query  241  QRK  233
            Q K
Sbjct  495  QPK  497



>ref|XP_010261377.1| PREDICTED: uncharacterized protein At3g49140 isoform X3 [Nelumbo 
nucifera]
Length=487

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 157/247 (64%), Gaps = 39/247 (16%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA+RL EV  D P+D+ME PPAGLAIQG+LRPAF EE   IQK +  H+  
Sbjct  277  TMRSSHPMYFAKRLAEVASDLPVDWMEQPPAGLAIQGLLRPAFNEESSFIQKYIPGHERR  336

Query  769  NAD-RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMI  593
            N +  NQ+ + A+ K   I   NG        +DNP  AEEL+K+E L + TSFYKLE++
Sbjct  337  NDNSNNQVEENAENKLEDIGMANGE----STSEDNPV-AEELDKNERLRTRTSFYKLEIV  391

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            KIQLI AHGNQT V IEDF+ A+ DAIAHS+ KILSRLK SGEK  +ALKSLCWRCK +Q
Sbjct  392  KIQLILAHGNQTVVAIEDFQEAKPDAIAHSSAKILSRLKASGEKITEALKSLCWRCKNVQ  451

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQR  236
            VE                                A+SEYSAERQL  LLFPR   KL + 
Sbjct  452  VE--------------------------------ATSEYSAERQLRELLFPRIHHKLPKP  479

Query  235  KEAQQAE  215
            ++A Q E
Sbjct  480  QQAHQKE  486



>dbj|BAF01615.1| hypothetical protein [Arabidopsis thaliana]
Length=519

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 168/243 (69%), Gaps = 20/243 (8%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSD-HKT  773
            TMRS HPM FA+R+TEV  +DP+D+M+ P AGLAIQG+L    +E++  IQK+++D + T
Sbjct  291  TMRSCHPMFFAKRMTEVASNDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQKKLADSNST  350

Query  772  SNADR---NQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKL  602
            +N ++   N + K  D              K+G D+   + ++    DE   +  +FYKL
Sbjct  351  TNGNKDAENLVDKLED------------NSKAGGDESEIDSSQ----DEKARNVVAFYKL  394

Query  601  EMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCK  422
            EMI+IQLI+A G+QT VE+ED R+A+ DAIAH++ +I+SRL+ SG+K  +ALKSLCWR  
Sbjct  395  EMIRIQLITAQGDQTEVEVEDVRKAQPDAIAHASAEIISRLEESGDKITEALKSLCWRHN  454

Query  421  GIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQ  242
             IQ EEV LIG+DSLG DLR+C+G ++++LRFAF  RA+SE +AE Q+  LLFP+T +  
Sbjct  455  SIQAEEVKLIGIDSLGFDLRLCAGAKIESLRFAFSTRATSEENAEGQIRKLLFPKTNQST  514

Query  241  QRK  233
            Q K
Sbjct  515  QPK  517



>ref|XP_009404801.1| PREDICTED: uncharacterized protein At3g49140-like [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 155/238 (65%), Gaps = 42/238 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM+S HPM+FA+++ E   +  +D+M+ PPA + IQG LRPAF EE + I+K        
Sbjct  255  TMQSCHPMYFAKKMEESVSNVDLDWMDQPPASIVIQGQLRPAFAEESINIKK--------  306

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                              +P +G                EL+KD++L +G SFYKLEMI 
Sbjct  307  ------------------LPYSG----------------ELDKDQSLHNGASFYKLEMIN  332

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ++S++GNQ  V+I+DFR AR D +AHSA  I+SRLK+ GEK  QALK LC R KGI V
Sbjct  333  IQIVSSYGNQFEVKIQDFREARPDVLAHSATNIISRLKSGGEKVSQALKMLCMRQKGIHV  392

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EE  +IGVDSLG DLRVCSG QVQTLRF+F  +A+SE+SAERQLN++LFP  ++ QQR
Sbjct  393  EEAVVIGVDSLGFDLRVCSGRQVQTLRFSFATQATSEFSAERQLNDILFPLLKQKQQR  450



>gb|KJB21282.1| hypothetical protein B456_004G1170002 [Gossypium raimondii]
 gb|KJB21284.1| hypothetical protein B456_004G1170002 [Gossypium raimondii]
Length=445

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 141/182 (77%), Gaps = 1/182 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA +LTEV  DDPID+ME P  GLAIQG+LRPAF+EEH  IQK +S +++ 
Sbjct  264  TMHSSHPMYFANKLTEVASDDPIDWMEQPSDGLAIQGLLRPAFIEEHSEIQKHISTNQSR  323

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D++Q+ K    K   +  INGHR+  G  +DN   +EE EK+E   +G+ FYKL+M K
Sbjct  324  SSDKHQVEKVVGDKVEDVSIINGHRNGLGSSKDNST-SEESEKNEISMNGSLFYKLQMSK  382

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAHSA KI+SRLK  GEKT+QALKSLCWRCKGI V
Sbjct  383  IQLITAHGHQTDVELEDFKQAQPDAIAHSAAKIISRLKAGGEKTVQALKSLCWRCKGIPV  442

Query  409  EE  404
            EE
Sbjct  443  EE  444



>ref|XP_010515260.1| PREDICTED: uncharacterized protein At3g49140 [Camelina sativa]
Length=491

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 160/234 (68%), Gaps = 11/234 (5%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HPM FA+R+TEV  +DP+D+M+ P AGLAIQG+L    +E++  IQK++++  ++
Sbjct  266  TMRSCHPMFFAKRMTEVASNDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQKRLAESNST  325

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                N+ ++  + K   I    G   + G        + E EK   +    +FYKLEMI+
Sbjct  326  ITSGNKDAENLEEKLADISKAGGEESEIG--------SSEGEKPRNV---VAFYKLEMIR  374

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ED R+A+ DAIAH++ +I+SRL+ SG+K  +ALKSLCWR  G+Q 
Sbjct  375  IQLITAQGDQTEVEVEDVRKAQPDAIAHASAEIISRLEESGDKLTEALKSLCWRHNGVQA  434

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            EEV LIG+DSLG DLR+CSG ++++LRFAF  RA SE  AE Q+  LLFP  Q+
Sbjct  435  EEVKLIGIDSLGFDLRLCSGAKIESLRFAFSTRAISEDKAEEQIRELLFPTKQQ  488



>ref|XP_002877651.1| hypothetical protein ARALYDRAFT_485272 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53910.1| hypothetical protein ARALYDRAFT_485272 [Arabidopsis lyrata subsp. 
lyrata]
Length=1217

 Score =   233 bits (595),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 172/239 (72%), Gaps = 11/239 (5%)
 Frame = -3

Query  949   TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
             TMRS HPM FA+R+TEV  +DP+D+M+ P AGLAIQG+L    +E++  IQK+++D  ++
Sbjct  988   TMRSCHPMFFAKRMTEVASNDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQKKLADSNST  1047

Query  769   NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             + +RN   K A+  E  +  I+    K+G D+++   + + EK+ T+    +FYKLEMI+
Sbjct  1048  STNRN---KDAENLEEKLADIS----KAG-DEESDIDSSQGEKERTV---VAFYKLEMIR  1096

Query  589   IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
             IQLI+A G QT VE+ED R+A+ DAIAH++ KI+SRL+ SG+K  +ALKSLCWR  GI  
Sbjct  1097  IQLITAQGEQTEVEVEDVRKAQPDAIAHASAKIISRLEESGDKLTEALKSLCWRHNGILA  1156

Query  409   EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
             EEV LIG+DSLG DLR+C+G ++++LRFAF  RA+SE +AE Q+  LLFP T +  Q K
Sbjct  1157  EEVKLIGIDSLGFDLRLCAGAKIESLRFAFSTRATSEENAEGQIRELLFPTTNQATQPK  1215



>gb|KFK34201.1| hypothetical protein AALP_AA5G114300 [Arabis alpina]
Length=1097

 Score =   230 bits (587),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 167/239 (70%), Gaps = 11/239 (5%)
 Frame = -3

Query  949   TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
             TMRS HPM FA+R+TEV  +DPID+M+ P AGLAIQG+L    +E++  IQK+++D K++
Sbjct  861   TMRSCHPMFFAKRMTEVASNDPIDWMDQPSAGLAIQGLLSHILVEDYSDIQKKLADSKST  920

Query  769   NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
               +RN+   A D +E         + K+  D+   + + E+EK   +    +FYKLEMI+
Sbjct  921   ITNRNK--DAKDLEEKL-----EDKDKADGDESEKD-SSEVEKKRNV---VAFYKLEMIR  969

Query  589   IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
             IQLISA G+QT VE+ED R+A+ DAIAHS+  I+SRL+ SG+K  +ALKSLCWR  GIQ 
Sbjct  970   IQLISAQGDQTEVEVEDVRKAQPDAIAHSSAGIISRLEESGDKLTEALKSLCWRHNGIQA  1029

Query  409   EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
             EEV LI +DSLG DLR+C+G ++++LRF+F  RA+SE  AE Q+  LLFP T  L+  K
Sbjct  1030  EEVKLIEIDSLGFDLRLCAGAKIESLRFSFSTRATSEDDAEGQIRELLFPTTNPLKPEK  1088



>ref|XP_007038842.1| Pentatricopeptide repeat superfamily protein, putative isoform 
4, partial [Theobroma cacao]
 gb|EOY23343.1| Pentatricopeptide repeat superfamily protein, putative isoform 
4, partial [Theobroma cacao]
Length=459

 Score =   220 bits (561),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTEV  DDPID+ME P  GLAIQG++RPAF+EEH  IQK MS +++ 
Sbjct  270  TMRSSHPMYFAKKLTEVASDDPIDWMEQPSDGLAIQGLIRPAFVEEHSEIQKHMSSNQSR  329

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D +Q+ K  + K   +  ING  ++ G   D+   +EE EK E   +G+SFYKLE++K
Sbjct  330  SSDTSQVEKVVEDKLEDLGIINGQSNELGWSGDSSTISEEPEKKEISINGSSFYKLEIVK  389

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIA SA KI+S LK  GEKT QALKSLCWRCK IQV
Sbjct  390  IQLITAHGHQTVVELEDFKQAQPDAIAQSAAKIISCLKAGGEKTTQALKSLCWRCKSIQV  449

Query  409  EEVS  398
            E  S
Sbjct  450  EATS  453



>ref|XP_006292754.1| hypothetical protein CARUB_v10019002mg [Capsella rubella]
 gb|EOA25652.1| hypothetical protein CARUB_v10019002mg [Capsella rubella]
Length=491

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 157/232 (68%), Gaps = 11/232 (5%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HPM FA+R+TEV  +DP+D+M+ P AGLAIQG+L    +E++  IQK+++D  ++
Sbjct  269  TMRSCHPMFFAKRMTEVASNDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQKKLADISST  328

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +   N+ ++    K   I    G   +S +D      A  +          +FYKLEMI+
Sbjct  329  STSGNKDAENLKEKLADISEAGGE--ESDVDSSQGEKARNV---------VAFYKLEMIR  377

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ED R+A+ DAIAH++  I+SRL+ +G+K  +ALKSLCWR  GIQ 
Sbjct  378  IQLITAQGDQTEVEVEDVRKAQPDAIAHASAGIISRLEETGDKLTEALKSLCWRHNGIQA  437

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT  254
            EEV LI +DSLG DLR+C+G ++ +LRFAF  RA+SE +AE Q+  LLFP T
Sbjct  438  EEVKLIAIDSLGFDLRLCAGAKIDSLRFAFSTRATSEDNAEGQIRELLFPTT  489



>emb|CAB61996.1| putative protein [Arabidopsis thaliana]
Length=1229

 Score =   228 bits (581),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 168/243 (69%), Gaps = 20/243 (8%)
 Frame = -3

Query  949   TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSD-HKT  773
             TMRS HPM FA+R+TEV  +DP+D+M+ P AGLAIQG+L    +E++  IQK+++D + T
Sbjct  1001  TMRSCHPMFFAKRMTEVASNDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQKKLADSNST  1060

Query  772   SNADR---NQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKL  602
             +N ++   N + K  D              K+G D+   + ++    DE   +  +FYKL
Sbjct  1061  TNGNKDAENLVDKLED------------NSKAGGDESEIDSSQ----DEKARNVVAFYKL  1104

Query  601   EMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCK  422
             EMI+IQLI+A G+QT VE+ED R+A+ DAIAH++ +I+SRL+ SG+K  +ALKSLCWR  
Sbjct  1105  EMIRIQLITAQGDQTEVEVEDVRKAQPDAIAHASAEIISRLEESGDKITEALKSLCWRHN  1164

Query  421   GIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQ  242
              IQ EEV LIG+DSLG DLR+C+G ++++LRFAF  RA+SE +AE Q+  LLFP+T +  
Sbjct  1165  SIQAEEVKLIGIDSLGFDLRLCAGAKIESLRFAFSTRATSEENAEGQIRKLLFPKTNQST  1224

Query  241   QRK  233
             Q K
Sbjct  1225  QPK  1227



>dbj|BAJ91506.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 155/245 (63%), Gaps = 43/245 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+ S HP++FAR + E      ID+++ PPA L ++G LRPAF EE  ++ + +      
Sbjct  226  TVNSCHPLYFARMIVENASKSSIDWLDRPPASLVVEGQLRPAFAEESTMVSRHL------  279

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                                +NG               +E  KD+  GSG +F+K+E++ 
Sbjct  280  --------------------LNG---------------DEPLKDDKKGSGATFFKVEVLS  304

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+IE++R++R D IAHSA  I+SRL+  G+K  QALKSLCWRCK IQV
Sbjct  305  IELITAYGTEPKVKIEEYRKSRPDIIAHSAPNIISRLRAGGDKITQALKSLCWRCKAIQV  364

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE ++IGVD LG DLR+CSGTQVQTLRFAF  +ASSE+SAE+Q++ LLFPR  ++ Q  E
Sbjct  365  EEAAIIGVDCLGFDLRLCSGTQVQTLRFAFPTKASSEFSAEKQIHELLFPR--RIHQEGE  422

Query  229  AQQAE  215
            + QA+
Sbjct  423  SPQAQ  427



>dbj|BAB08729.1| unnamed protein product [Arabidopsis thaliana]
Length=464

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 160/247 (65%), Gaps = 17/247 (7%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HPM+FARR+ EV   DP+++M+ P AGLAIQG+L P  +E+H  IQK +S   ++
Sbjct  234  TMRYCHPMYFARRMAEVASTDPVNWMDQPSAGLAIQGLLSPVIVEDHSDIQKHISGCIST  293

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+  +            N      G+ ++      E+   E   +   +YKLE+I+
Sbjct  294  GTDKNKERE------------NSEEIFEGIGENE----SEILHVENSRNAIQYYKLEIIR  337

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ED R+A+ D IA ++  IL+RL+  G+K  +AL+SLCWR  GIQ 
Sbjct  338  IQLITAQGHQTEVEVEDVRKAQPDVIACASDGILTRLEEDGDKLTEALRSLCWRNNGIQA  397

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEV LIG+DSLG DLR+CSG Q++TLRFAF  RA+SE++AE QL  LLF  T  K Q+ K
Sbjct  398  EEVKLIGIDSLGFDLRICSGMQIETLRFAFSIRATSEHNAEGQLRELLFASTPSKPQKPK  457

Query  232  EAQQAES  212
            +  Q ES
Sbjct  458  QTNQKES  464



>dbj|BAJ90572.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93403.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=459

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 155/245 (63%), Gaps = 43/245 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+ S HP++FAR + E      ID+++ PPA L ++G LRPAF EE  ++ + +      
Sbjct  254  TVNSCHPLYFARMIVENASKSSIDWLDRPPASLVVEGQLRPAFAEESTMVSRHL------  307

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                                +NG               +E  KD+  GSG +F+K+E++ 
Sbjct  308  --------------------LNG---------------DEPLKDDKKGSGATFFKVEVLS  332

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+IE++R++R D IAHSA  I+SRL+  G+K  QALKSLCWRCK IQV
Sbjct  333  IELITAYGTEPKVKIEEYRKSRPDIIAHSAPNIISRLRAGGDKITQALKSLCWRCKAIQV  392

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE ++IGVD LG DLR+CSGTQVQTLRFAF  +ASSE+SAE+Q++ LLFPR  ++ Q  E
Sbjct  393  EEAAIIGVDCLGFDLRLCSGTQVQTLRFAFPTKASSEFSAEKQIHELLFPR--RIHQEGE  450

Query  229  AQQAE  215
            + QA+
Sbjct  451  SPQAQ  455



>dbj|BAJ93835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=459

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 155/245 (63%), Gaps = 43/245 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+ S HP++FAR + E      ID+++ PPA L ++G LRPAF EE  ++ + +      
Sbjct  254  TVNSCHPLYFARMIVENASKSSIDWLDRPPASLVVEGQLRPAFAEESTMVSRHL------  307

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                                +NG               +E  KD+  GSG +F+K+E++ 
Sbjct  308  --------------------LNG---------------DEPLKDDKKGSGATFFKVEVLS  332

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+IE++R++R D IAHSA  I+SRL+  G+K  QALKSLCWRCK IQV
Sbjct  333  IELITAYGTEPKVKIEEYRKSRPDIIAHSAPNIISRLRAGGDKITQALKSLCWRCKAIQV  392

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE ++IGVD LG DLR+CSGTQVQTLRFAF  +ASSE+SAE+Q++ LLFPR  ++ Q  E
Sbjct  393  EEAAIIGVDCLGFDLRLCSGTQVQTLRFAFPTKASSEFSAEKQIHELLFPR--RIHQEGE  450

Query  229  AQQAE  215
            + QA+
Sbjct  451  SPQAQ  455



>ref|NP_197794.2| pentatricopeptide repeat-containing protein-like protein [Arabidopsis 
thaliana]
 gb|AED93251.1| pentatricopeptide repeat-containing protein-like protein [Arabidopsis 
thaliana]
Length=481

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 160/247 (65%), Gaps = 17/247 (7%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HPM+FARR+ EV   DP+++M+ P AGLAIQG+L P  +E+H  IQK +S   ++
Sbjct  251  TMRYCHPMYFARRMAEVASTDPVNWMDQPSAGLAIQGLLSPVIVEDHSDIQKHISGCIST  310

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+  +            N      G+ ++      E+   E   +   +YKLE+I+
Sbjct  311  GTDKNKERE------------NSEEIFEGIGENE----SEILHVENSRNAIQYYKLEIIR  354

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ED R+A+ D IA ++  IL+RL+  G+K  +AL+SLCWR  GIQ 
Sbjct  355  IQLITAQGHQTEVEVEDVRKAQPDVIACASDGILTRLEEDGDKLTEALRSLCWRNNGIQA  414

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEV LIG+DSLG DLR+CSG Q++TLRFAF  RA+SE++AE QL  LLF  T  K Q+ K
Sbjct  415  EEVKLIGIDSLGFDLRICSGMQIETLRFAFSIRATSEHNAEGQLRELLFASTPSKPQKPK  474

Query  232  EAQQAES  212
            +  Q ES
Sbjct  475  QTNQKES  481



>ref|NP_001190376.1| pentatricopeptide repeat-containing protein-like protein [Arabidopsis 
thaliana]
 gb|AED93252.1| pentatricopeptide repeat-containing protein-like protein [Arabidopsis 
thaliana]
Length=494

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 160/247 (65%), Gaps = 17/247 (7%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HPM+FARR+ EV   DP+++M+ P AGLAIQG+L P  +E+H  IQK +S   ++
Sbjct  264  TMRYCHPMYFARRMAEVASTDPVNWMDQPSAGLAIQGLLSPVIVEDHSDIQKHISGCIST  323

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+  +            N      G+ ++      E+   E   +   +YKLE+I+
Sbjct  324  GTDKNKERE------------NSEEIFEGIGENE----SEILHVENSRNAIQYYKLEIIR  367

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ED R+A+ D IA ++  IL+RL+  G+K  +AL+SLCWR  GIQ 
Sbjct  368  IQLITAQGHQTEVEVEDVRKAQPDVIACASDGILTRLEEDGDKLTEALRSLCWRNNGIQA  427

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEV LIG+DSLG DLR+CSG Q++TLRFAF  RA+SE++AE QL  LLF  T  K Q+ K
Sbjct  428  EEVKLIGIDSLGFDLRICSGMQIETLRFAFSIRATSEHNAEGQLRELLFASTPSKPQKPK  487

Query  232  EAQQAES  212
            +  Q ES
Sbjct  488  QTNQKES  494



>ref|XP_009401022.1| PREDICTED: uncharacterized protein At3g49140-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=441

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 151/238 (63%), Gaps = 42/238 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM+S HP++FA+++ E   +  +D+M+ PPA + IQG LRPAF EE + I+K        
Sbjct  236  TMQSCHPIYFAKKMEESISNVNLDWMDQPPASIVIQGHLRPAFAEESINIKK--------  287

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                              +P                +A E + D++L SG +FYKLEM+ 
Sbjct  288  ------------------LP----------------YAGEFDMDQSLQSGATFYKLEMLN  313

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ++SA+GNQ+ V+I +FR AR D +AHSAV I+SRLK  GEK  QALK LC R K I V
Sbjct  314  IQIVSAYGNQSTVKIHNFREARPDVLAHSAVNIISRLKAGGEKISQALKLLCIRQKSIHV  373

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EE  +IGVDSLG DLR+CSG QVQTLRFAF  +A+SE+ AERQL++LLFPR Q+  Q+
Sbjct  374  EEAVVIGVDSLGFDLRICSGRQVQTLRFAFGTQATSEFGAERQLHDLLFPRLQQTWQQ  431



>ref|XP_009401021.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=442

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 151/238 (63%), Gaps = 42/238 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM+S HP++FA+++ E   +  +D+M+ PPA + IQG LRPAF EE + I+K        
Sbjct  237  TMQSCHPIYFAKKMEESISNVNLDWMDQPPASIVIQGHLRPAFAEESINIKK--------  288

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                              +P                +A E + D++L SG +FYKLEM+ 
Sbjct  289  ------------------LP----------------YAGEFDMDQSLQSGATFYKLEMLN  314

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ++SA+GNQ+ V+I +FR AR D +AHSAV I+SRLK  GEK  QALK LC R K I V
Sbjct  315  IQIVSAYGNQSTVKIHNFREARPDVLAHSAVNIISRLKAGGEKISQALKLLCIRQKSIHV  374

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EE  +IGVDSLG DLR+CSG QVQTLRFAF  +A+SE+ AERQL++LLFPR Q+  Q+
Sbjct  375  EEAVVIGVDSLGFDLRICSGRQVQTLRFAFGTQATSEFGAERQLHDLLFPRLQQTWQQ  432



>ref|XP_009149761.1| PREDICTED: uncharacterized protein At3g49140 [Brassica rapa]
Length=505

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 159/236 (67%), Gaps = 21/236 (9%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HPM FA+R++EV  +DP+D+M+ P AGLAIQG+L    +E++  IQ++++D K++
Sbjct  274  TMRSCHPMFFAKRMSEVAANDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQQKLADIKST  333

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQ--DNPNWAEELEKDETLGSGTSFYKLEM  596
            +                     G ++   L++  ++ N A+  ++ E      +FYKLEM
Sbjct  334  ST-------------------KGDKNAENLEEKLEDTNKADSDDESEKTRKVVAFYKLEM  374

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            I+IQLI+A G+QT VE+ED R+A+ DAIAH++  I+ RL+ SG+K  +AL+SLCWR  GI
Sbjct  375  IRIQLITAQGDQTEVEVEDVRKAQPDAIAHASAGIIRRLEESGDKLAEALRSLCWRYYGI  434

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            Q EEV LIG+DSLG DLR+C+G ++++LRFAF  RA+S   AE Q+  LLFP T +
Sbjct  435  QAEEVKLIGLDSLGFDLRLCAGAKIESLRFAFSTRATSAEDAEGQMKELLFPTTNQ  490



>ref|XP_009401020.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=446

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 150/238 (63%), Gaps = 37/238 (16%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM+S HP++FA+++ E   +  +D+M+ PPA + IQG LRPAF EE + I+K        
Sbjct  236  TMQSCHPIYFAKKMEESISNVNLDWMDQPPASIVIQGHLRPAFAEESINIKK--------  287

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                                         L     ++  E + D++L SG +FYKLEM+ 
Sbjct  288  -----------------------------LPYAVFSYVGEFDMDQSLQSGATFYKLEMLN  318

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQ++SA+GNQ+ V+I +FR AR D +AHSAV I+SRLK  GEK  QALK LC R K I V
Sbjct  319  IQIVSAYGNQSTVKIHNFREARPDVLAHSAVNIISRLKAGGEKISQALKLLCIRQKSIHV  378

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EE  +IGVDSLG DLR+CSG QVQTLRFAF  +A+SE+ AERQL++LLFPR Q+  Q+
Sbjct  379  EEAVVIGVDSLGFDLRICSGRQVQTLRFAFGTQATSEFGAERQLHDLLFPRLQQTWQQ  436



>ref|XP_010421214.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Camelina sativa]
Length=494

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 163/238 (68%), Gaps = 13/238 (5%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HPM+FARR+ EV  +DP+++ME P AGLAIQG+L    +E+H  IQK +SD K +
Sbjct  264  TMRYCHPMYFARRMAEVASNDPVNWMEQPSAGLAIQGLLSRVVVEDHSDIQKHISDCKAT  323

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+  +            N      GL + + + +E L+ + +  +  S+YKLE+I+
Sbjct  324  CTDKNKDVE------------NLEEKFEGLGRPSGDESEILQVENSR-NAISYYKLEIIR  370

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT V++ED R+A+ DAIA ++  I+++L+ +G+K  +AL+SLCWR KG+Q 
Sbjct  371  IQLITAQGHQTEVKVEDVRKAQPDAIARASDGIVTQLEENGDKLTEALRSLCWRHKGLQA  430

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EEV LIG+DSLG DLR+CSG Q++TLRFAF  RA+S ++AE QL +LLF  T    Q+
Sbjct  431  EEVKLIGIDSLGFDLRICSGMQIETLRFAFAVRATSVHNAEGQLRDLLFASTPSKPQK  488



>emb|CDY08112.1| BnaA06g16140D [Brassica napus]
Length=505

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/236 (45%), Positives = 159/236 (67%), Gaps = 21/236 (9%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HPM FA+R++EV  +DP+D+M+ P AGLAIQG+L    +E++  IQ++++D K++
Sbjct  274  TMRSCHPMFFAKRMSEVAANDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQQKLADIKST  333

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQ--DNPNWAEELEKDETLGSGTSFYKLEM  596
            +                     G ++   L++  ++ N A+  ++ E      +FYKLEM
Sbjct  334  ST-------------------KGDKNAENLEEKLEDTNKADSDDESEKTRKVVAFYKLEM  374

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            I+IQLI+A G+QT VE+ED R+A+ DAIAH++  I+ RL+ SG+K  +AL+SLCWR  GI
Sbjct  375  IRIQLITAQGDQTEVEVEDVRKAQPDAIAHASAGIIRRLEESGDKIAEALRSLCWRYYGI  434

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            Q EEV LIG+DSLG DLR+C+G ++++LRFAF  RA+S   AE ++  LLFP T +
Sbjct  435  QAEEVKLIGLDSLGFDLRLCAGAKIESLRFAFSTRATSAEDAEGEMKELLFPTTNQ  490



>ref|XP_007038841.1| Pentatricopeptide repeat superfamily protein, putative isoform 
3 [Theobroma cacao]
 gb|EOY23342.1| Pentatricopeptide repeat superfamily protein, putative isoform 
3 [Theobroma cacao]
Length=483

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 0/179 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTEV  DDPID+ME P  GLAIQG++RPAF+EEH  IQK MS +++ 
Sbjct  270  TMRSSHPMYFAKKLTEVASDDPIDWMEQPSDGLAIQGLIRPAFVEEHSEIQKHMSSNQSR  329

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D +Q+ K  + K   +  ING  ++ G   D+   +EE EK E   +G+SFYKLE++K
Sbjct  330  SSDTSQVEKVVEDKLEDLGIINGQSNELGWSGDSSTISEEPEKKEISINGSSFYKLEIVK  389

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            IQLI+AHG+QT VE+EDF++A+ DAIA SA KI+S LK  GEKT QALKSLCWRCK IQ
Sbjct  390  IQLITAHGHQTVVELEDFKQAQPDAIAQSAAKIISCLKAGGEKTTQALKSLCWRCKSIQ  448



>ref|XP_006394663.1| hypothetical protein EUTSA_v10004068mg [Eutrema salsugineum]
 gb|ESQ31949.1| hypothetical protein EUTSA_v10004068mg [Eutrema salsugineum]
Length=497

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 161/232 (69%), Gaps = 17/232 (7%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HPM+FARR  EV  +DP+++ME P AGLAIQG+L   F+++H+ I    + HK++
Sbjct  266  TMRSCHPMYFARRTAEVASNDPLNWMEQPSAGLAIQGLLSRVFVKDHLDI----TGHKST  321

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D+N   + ++ K   I           +D+     +E L+ D +  + T++YKLEMI+
Sbjct  322  SSDKNLEGENSEEKLENI-------GTPSVDE-----SEILQHDNSR-NATTYYKLEMIR  368

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ED R+A+ DAIA ++  I++RL+  G K  +ALKS+CWR KGIQ 
Sbjct  369  IQLITAQGHQTEVEVEDVRKAQPDAIALASDGIVNRLEADGNKLTEALKSMCWRHKGIQA  428

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT  254
            EEV LIG+DSLG DLR+CSG Q++TLRFAF  +A+S +SAE QL  LLF  T
Sbjct  429  EEVKLIGIDSLGFDLRLCSGMQIETLRFAFSIKATSVHSAEGQLRELLFAST  480



>ref|XP_003575992.1| PREDICTED: uncharacterized protein At3g49140-like [Brachypodium 
distachyon]
Length=471

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 150/246 (61%), Gaps = 42/246 (17%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+ S HP++FAR + E  +   ID+++ PPA L ++G LRPAF EE  ++ + + +    
Sbjct  268  TLNSCHPLYFARMIVESANKSSIDWLDRPPASLVVEGQLRPAFAEESTMVSRHLLNGDEP  327

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              DR +                                          SG +F+K+E++ 
Sbjct  328  LKDRKE------------------------------------------SGATFFKVEVLS  345

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+IE++RR+R D IAHSA  I+SRL+  G+K  QALKSLCWRCK I+V
Sbjct  346  IELITAYGTEPKVKIEEYRRSRPDIIAHSAPNIISRLRAGGDKITQALKSLCWRCKAIKV  405

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE ++IGVD LG DLR+CSGTQVQTLRFAF  +A+SE+SAE+Q++ LLFPR  +  Q  +
Sbjct  406  EEAAIIGVDCLGFDLRLCSGTQVQTLRFAFPTKATSEFSAEKQIHELLFPRIHQEGQSPQ  465

Query  229  AQQAES  212
             QQ ES
Sbjct  466  TQQKES  471



>ref|XP_006287582.1| hypothetical protein CARUB_v10000792mg, partial [Capsella rubella]
 gb|EOA20480.1| hypothetical protein CARUB_v10000792mg, partial [Capsella rubella]
Length=499

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 161/247 (65%), Gaps = 14/247 (6%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HPM+FARR+ EV  + PI++ME P AGLAIQG+L    +E+H  IQK +S  K +
Sbjct  266  TMRYCHPMYFARRMAEVVSNGPINWMEQPSAGLAIQGLLSRVVVEDHSDIQKHISGSKPT  325

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D+N+  +            N      G+   + + +E L+  E L +  S+YKLE+I+
Sbjct  326  DIDKNKEGE------------NSEEKFEGIGTPSVDESEILQV-ENLKNAISYYKLEIIR  372

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT V++ED R+A+ DAIA  +  I++ L+  G+K  +ALKSLCWR  GIQ 
Sbjct  373  IQLITAQGHQTEVKVEDVRKAQPDAIARVSDGIVTCLEDDGDKLTEALKSLCWRHNGIQA  432

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEV LIG+DSLG DLR+CSG Q++TLRFAF  RA+S ++AE QL  LLF     K Q+ K
Sbjct  433  EEVKLIGIDSLGFDLRICSGMQIETLRFAFSIRATSVHNAEGQLRELLFTSAPPKPQKPK  492

Query  232  EAQQAES  212
            +  Q ES
Sbjct  493  QTSQKES  499



>ref|XP_006663507.1| PREDICTED: uncharacterized protein At3g49140-like [Oryza brachyantha]
Length=468

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 150/246 (61%), Gaps = 43/246 (17%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+ S HP++FAR + E      ID+++ PPA L ++G LRPAF EE  ++ + +S     
Sbjct  266  TLNSCHPLYFARMIVETATKSNIDWLDRPPASLVVEGQLRPAFAEESTMVSRHLS-----  320

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                                 NG   K     DN              SG +F+K+E++ 
Sbjct  321  ---------------------NGEPQK-----DNKE------------SGATFFKVEVLS  342

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+I ++R+AR D IAHSA  I+SRL+  G+K  QALKSLCWRCK IQ+
Sbjct  343  IELITAYGTEPKVKIGEYRKARPDIIAHSAPNIISRLRAGGDKITQALKSLCWRCKAIQI  402

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE ++IGVD LG DLRVCSGTQVQTLRFAF  +A+SE+ AE+Q++ LLFPR Q+  Q  +
Sbjct  403  EEAAVIGVDCLGFDLRVCSGTQVQTLRFAFPAKATSEFGAEKQMHELLFPRIQQEGQSPQ  462

Query  229  AQQAES  212
             +Q ES
Sbjct  463  TRQKES  468



>ref|XP_010454696.1| PREDICTED: uncharacterized protein At3g49140-like isoform X3 
[Camelina sativa]
Length=366

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 158/238 (66%), Gaps = 13/238 (5%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HP +FARR+ EV  +DP+++ME P AGLAIQG+L    +E+H  IQK +SD K +
Sbjct  136  TMRYCHPTYFARRMAEVASNDPVNWMEQPSAGLAIQGLLSRVVVEDHSNIQKHISDCKAT  195

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+  + +  K        G    SG +        E+ + E   +  S+YKLE+I+
Sbjct  196  CTDKNKGVENSGEK------FEGIGRPSGDES-------EILQVENSKNAISYYKLEIIR  242

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT V++ED R+A+ DAIA ++  I+++L+ +G+K  +AL+SLCWR KG+Q 
Sbjct  243  IQLITAQGHQTEVKVEDVRKAQPDAIARASDGIVTQLEENGDKLTEALRSLCWRHKGLQA  302

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EEV L G+DSLG DLR+C G Q++TLRFAF  RA+S ++AE QL +LLF  T    Q+
Sbjct  303  EEVKLTGIDSLGFDLRICLGMQIETLRFAFSVRATSVHNAEGQLRDLLFASTPSKPQK  360



>gb|EEC68315.1| hypothetical protein OsI_36404 [Oryza sativa Indica Group]
Length=467

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 150/246 (61%), Gaps = 43/246 (17%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM S HP++FAR + E      ID+++ PPA L ++G LRPAF EE  ++ + +S+ +  
Sbjct  265  TMNSCHPLYFARMIAETSTKSSIDWLDRPPASLVVEGQLRPAFAEESTMVSRHLSNDEPR  324

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                       D KE                                 SG +F+K+E++ 
Sbjct  325  K----------DNKE---------------------------------SGATFFKVEVLS  341

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+I ++R+AR D IAHSA  I+SRL+  G+K  QALKSLCWRCK IQ+
Sbjct  342  IELITAYGTEPKVKIGEYRKARPDIIAHSAPNIISRLRAGGDKITQALKSLCWRCKAIQI  401

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE ++IGVD LG DLRVCSGTQVQTLRFAF  +A+SE+ AE+Q++ LLFPR Q+  Q  +
Sbjct  402  EEAAVIGVDCLGFDLRVCSGTQVQTLRFAFPAKATSEFGAEKQIHELLFPRIQQEGQSPQ  461

Query  229  AQQAES  212
             +Q ES
Sbjct  462  TRQKES  467



>gb|ABA94153.2| expressed protein [Oryza sativa Japonica Group]
Length=462

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 150/246 (61%), Gaps = 43/246 (17%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM S HP++FAR + E      ID+++ PPA L ++G LRPAF EE  ++ + +S+    
Sbjct  260  TMNSCHPLYFARMIAETSTKSSIDWLDRPPASLVVEGQLRPAFAEESTMVSRHLSN----  315

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                                            D P       + +   SG +F+K+E++ 
Sbjct  316  --------------------------------DEP-------RKDNKESGATFFKVEVLS  336

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+I ++R+AR D IAHSA  I+SRL+  G+K  QALKSLCWRCK IQ+
Sbjct  337  IELITAYGTEPKVKIGEYRKARPDIIAHSAPNIISRLRAGGDKISQALKSLCWRCKAIQI  396

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE ++IGVD LG DLRVCSGTQVQTLRFAF  +A+SE+ AE+Q++ LLFPR Q+  Q  +
Sbjct  397  EEAAVIGVDCLGFDLRVCSGTQVQTLRFAFPAKATSEFGAEKQIHELLFPRIQQEGQSPQ  456

Query  229  AQQAES  212
             +Q ES
Sbjct  457  TRQKES  462



>gb|EEE52237.1| hypothetical protein OsJ_34175 [Oryza sativa Japonica Group]
Length=457

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 150/246 (61%), Gaps = 43/246 (17%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM S HP++FAR + E      ID+++ PPA L ++G LRPAF EE  ++ + +S+ +  
Sbjct  255  TMNSCHPLYFARMIAETSTKSSIDWLDRPPASLVVEGQLRPAFAEESTMVSRHLSNDEPR  314

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                       D KE                                 SG +F+K+E++ 
Sbjct  315  K----------DNKE---------------------------------SGATFFKVEVLS  331

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+I ++R+AR D IAHSA  I+SRL+  G+K  QALKSLCWRCK IQ+
Sbjct  332  IELITAYGTEPKVKIGEYRKARPDIIAHSAPNIISRLRAGGDKISQALKSLCWRCKAIQI  391

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            EE ++IGVD LG DLRVCSGTQVQTLRFAF  +A+SE+ AE+Q++ LLFPR Q+  Q  +
Sbjct  392  EEAAVIGVDCLGFDLRVCSGTQVQTLRFAFPAKATSEFGAEKQIHELLFPRIQQEGQSPQ  451

Query  229  AQQAES  212
             +Q ES
Sbjct  452  TRQKES  457



>ref|XP_010454694.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Camelina sativa]
Length=451

 Score =   210 bits (534),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 158/238 (66%), Gaps = 13/238 (5%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HP +FARR+ EV  +DP+++ME P AGLAIQG+L    +E+H  IQK +SD K +
Sbjct  221  TMRYCHPTYFARRMAEVASNDPVNWMEQPSAGLAIQGLLSRVVVEDHSNIQKHISDCKAT  280

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+  + +  K        G    SG +        E+ + E   +  S+YKLE+I+
Sbjct  281  CTDKNKGVENSGEK------FEGIGRPSGDES-------EILQVENSKNAISYYKLEIIR  327

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT V++ED R+A+ DAIA ++  I+++L+ +G+K  +AL+SLCWR KG+Q 
Sbjct  328  IQLITAQGHQTEVKVEDVRKAQPDAIARASDGIVTQLEENGDKLTEALRSLCWRHKGLQA  387

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EEV L G+DSLG DLR+C G Q++TLRFAF  RA+S ++AE QL +LLF  T    Q+
Sbjct  388  EEVKLTGIDSLGFDLRICLGMQIETLRFAFSVRATSVHNAEGQLRDLLFASTPSKPQK  445



>ref|XP_004979425.1| PREDICTED: uncharacterized protein At3g49140-like [Setaria italica]
Length=472

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 146/231 (63%), Gaps = 43/231 (19%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+ S HP++FAR + E      ID+++ PPA L ++G LRPAF EE  ++ K +S     
Sbjct  270  TVNSCHPLYFARMIVETATKSNIDWLDRPPASLVVEGQLRPAFAEESTMVAKHLS-----  324

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                                                 ++E +KD+   SG +F+K+E++ 
Sbjct  325  -------------------------------------SDEPQKDKK-ESGATFFKVEVLS  346

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+IE++R+AR D IAHSA  ++SRL+  G+K  QALKSLCWRCK IQV
Sbjct  347  IELITAYGTEPKVKIEEYRKARPDIIAHSAPNVISRLRAGGDKITQALKSLCWRCKAIQV  406

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPR  257
            EE ++IGVD LG DLRVCSGTQVQTLRFAF  +A+SE+SAE+Q++ LLFPR
Sbjct  407  EEAAVIGVDCLGFDLRVCSGTQVQTLRFAFPTKATSEFSAEKQIHELLFPR  457



>ref|XP_010421215.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Camelina sativa]
Length=492

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 162/238 (68%), Gaps = 15/238 (6%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HPM+FARR+ EV  +DP+++ME P AGLAIQG+L    +E+H  IQK +SD K +
Sbjct  264  TMRYCHPMYFARRMAEVASNDPVNWMEQPSAGLAIQGLLSRVVVEDHSDIQKHISDCKAT  323

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+  +            N      GL + + + +E L+ + +  +  S+YKLE+I+
Sbjct  324  CTDKNKDVE------------NLEEKFEGLGRPSGDESEILQVENSR-NAISYYKLEIIR  370

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT V++ED R+A+ DAIA ++  I+++L+ +G+K  +AL+SLCWR KG+Q 
Sbjct  371  IQLITAQGHQTEVKVEDVRKAQPDAIARASDGIVTQLEENGDKLTEALRSLCWRHKGLQA  430

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EEV LIG+DSLG DLR+CSG Q++TLRFAF   A+S ++AE QL +LLF  T    Q+
Sbjct  431  EEVKLIGIDSLGFDLRICSGMQIETLRFAFA--ATSVHNAEGQLRDLLFASTPSKPQK  486



>ref|XP_010493537.1| PREDICTED: uncharacterized protein At3g49140-like [Camelina sativa]
Length=497

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 163/247 (66%), Gaps = 14/247 (6%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HP +FARR+ EV  +DP ++ME P AGLAIQG+L    +E++  IQK +SD K +
Sbjct  264  TMRYCHPTYFARRMAEVASNDPENWMEQPSAGLAIQGLLSRVVVEDYSDIQKHISDCKAT  323

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+  + +  K        G    SG +        E+ + E   +  S+YKLE+I+
Sbjct  324  CTDKNKDVENSGEK------FEGISRPSGDES-------EILQVENSKNAISYYKLEIIR  370

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT V++ D R+A+ DAIA ++  I+S+L+ +G+K   AL+SLCWR KG+Q 
Sbjct  371  IQLITAQGHQTEVKVGDVRKAQPDAIARASDGIVSQLEENGDKLTDALRSLCWRHKGLQA  430

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEV LIG+DSLG DLR+CSG Q++TLRFAF  RA+S ++AE QL +LLF  T  K Q+ K
Sbjct  431  EEVKLIGIDSLGFDLRICSGMQIETLRFAFSIRATSVHNAEGQLRDLLFASTPSKPQKPK  490

Query  232  EAQQAES  212
            +  + ES
Sbjct  491  QTSEKES  497



>gb|KJB18780.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=464

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 140/185 (76%), Gaps = 1/185 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  274  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  333

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  334  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  392

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  393  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  452

Query  409  EEVSL  395
            E +S+
Sbjct  453  EPLSV  457



>ref|XP_002877649.1| hypothetical protein ARALYDRAFT_348010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53908.1| hypothetical protein ARALYDRAFT_348010 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 159/231 (69%), Gaps = 15/231 (6%)
 Frame = -3

Query  949  TMRSSHPMHF-ARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKT  773
            TMRS HPM F  +R+TEV  DD +D+M+ P AGLAIQGIL    +E++  IQ++++D+ +
Sbjct  131  TMRSCHPMFFFLKRMTEVASDDLVDWMDQPSAGLAIQGILSHILVEDYSDIQRKLADNNS  190

Query  772  SNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMI  593
            ++ +RN+ ++  + K   I    G   +S +D      + + EK+ T+    +FYKLEMI
Sbjct  191  TSTNRNKDAENLEEKLADISKACGE--ESDID------SSQGEKERTV---VAFYKLEMI  239

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQ  413
            +IQLI+    Q  VE+ED R+A+ D IAH++  I+SRL+ SG+K  +ALKSLCWR  GIQ
Sbjct  240  RIQLITP---QAGVEVEDVRKAQPDVIAHASAGIISRLEESGDKVTEALKSLCWRHNGIQ  296

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP  260
             EEV LIGVDSLG DLR+C+G ++++ RFAF  RA+SE +AE ++  LLFP
Sbjct  297  AEEVKLIGVDSLGFDLRLCAGAKIESFRFAFLTRATSEDNAEGRIRELLFP  347



>ref|XP_010426418.1| PREDICTED: uncharacterized protein At3g49140 [Camelina sativa]
Length=498

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 166/243 (68%), Gaps = 19/243 (8%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HPM FA+R+TEV  +DP+D+M+ P AGLAIQG+L    +E++  IQK+++D   S
Sbjct  271  TMRSCHPMFFAKRMTEVASNDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQKRLAD---S  327

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLG----SGTSFYKL  602
            N+     +K A+  E  +  I+    K+G         EE E D + G    +  +FYKL
Sbjct  328  NSTITSGNKDAENLEEKLADIS----KAG--------GEESEIDSSEGEKPRNVVAFYKL  375

Query  601  EMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCK  422
            EMI+IQLI+A G+QT VE+ED R+A+ DAIAH++  I+SRL+ SG+K  +ALKSLCWR  
Sbjct  376  EMIRIQLITAQGDQTEVEVEDVRKAQPDAIAHASAAIISRLEESGDKLTEALKSLCWRHN  435

Query  421  GIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQ  242
            G+Q EEV LI +DSLG DLR+C+G ++++LRFAF  RA+SE +AE Q+  LLFP T   +
Sbjct  436  GVQAEEVKLIEIDSLGFDLRLCAGAKIESLRFAFSTRATSEDNAEGQIRELLFPTTHPSK  495

Query  241  QRK  233
            Q K
Sbjct  496  QPK  498



>ref|NP_001159266.1| hypothetical protein [Zea mays]
 gb|ACN25623.1| unknown [Zea mays]
 gb|AFW64910.1| hypothetical protein ZEAMMB73_914991 [Zea mays]
Length=485

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 150/244 (61%), Gaps = 44/244 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+ S HP++FAR + E      ID+++ PPA L ++G LRPAF EE  ++ K +S     
Sbjct  283  TVNSCHPLYFARMIVETATKSSIDWLDRPPASLVVEGQLRPAFAEESTMVAKHIS-----  337

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                                            D P       K +T  SG +F+K+E++ 
Sbjct  338  -------------------------------SDAP-------KKDTKESGATFFKVEVLS  359

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+IE++++A+ D IAHSA  ++SRL+  G+K  QALKSLCWR K IQV
Sbjct  360  IELITAYGTEPKVKIEEYQKAKPDIIAHSAPNVISRLRAGGDKVTQALKSLCWRSKAIQV  419

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPR-TQKLQQRK  233
            EE ++IGVD LG DLRVCSGTQVQTLRFAF  +A+SE+SAE+Q++ LLFPR T +  Q  
Sbjct  420  EEAAVIGVDCLGFDLRVCSGTQVQTLRFAFPTKATSEFSAEKQIHELLFPRNTHQEGQSP  479

Query  232  EAQQ  221
            +A+Q
Sbjct  480  QARQ  483



>gb|KJB18779.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
 gb|KJB18782.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=480

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 137/181 (76%), Gaps = 1/181 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  274  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  333

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  334  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  392

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+AHG+QT VE+EDF++A+ DAIAH A KI+SRLK  GEKT QALKSLCWRCKGIQV
Sbjct  393  IQLITAHGHQTDVELEDFKQAQPDAIAHLAAKIISRLKAGGEKTTQALKSLCWRCKGIQV  452

Query  409  E  407
            E
Sbjct  453  E  453



>ref|XP_010454695.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Camelina sativa]
Length=449

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 157/238 (66%), Gaps = 15/238 (6%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HP +FARR+ EV  +DP+++ME P AGLAIQG+L    +E+H  IQK +SD K +
Sbjct  221  TMRYCHPTYFARRMAEVASNDPVNWMEQPSAGLAIQGLLSRVVVEDHSNIQKHISDCKAT  280

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+  + +  K        G    SG +        E+ + E   +  S+YKLE+I+
Sbjct  281  CTDKNKGVENSGEK------FEGIGRPSGDES-------EILQVENSKNAISYYKLEIIR  327

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT V++ED R+A+ DAIA ++  I+++L+ +G+K  +AL+SLCWR KG+Q 
Sbjct  328  IQLITAQGHQTEVKVEDVRKAQPDAIARASDGIVTQLEENGDKLTEALRSLCWRHKGLQA  387

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EEV L G+DSLG DLR+C G Q++TLRFAF   A+S ++AE QL +LLF  T    Q+
Sbjct  388  EEVKLTGIDSLGFDLRICLGMQIETLRFAFS--ATSVHNAEGQLRDLLFASTPSKPQK  443



>ref|XP_002874164.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50423.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=465

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 151/238 (63%), Gaps = 22/238 (9%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR  HPM+FA R+ EV   DP+++ME P AGLAIQG+L    +E+H  IQK +S  K++
Sbjct  234  TMRYCHPMYFATRMAEVTSTDPVNWMEQPSAGLAIQGLLSRVVVEDHSDIQKHISGCKST  293

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+              +N      G+ ++      E+ + E   +  ++YKLE+I+
Sbjct  294  GTDKNKEG------------VNSEEKFEGIGENE----SEILQVENSRNAIAYYKLEIIR  337

Query  589  IQLISAHGNQ------TFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWR  428
            IQLI+A G+Q      T V++ED R+ + DAIA ++  IL+RL+  G+K  +ALKSLCWR
Sbjct  338  IQLITAQGHQARFSRLTEVKVEDVRKVQPDAIARASDGILTRLEEDGDKLTEALKSLCWR  397

Query  427  CKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT  254
              GIQ EE+ LIG+DSLG DLR+CSG Q++TLRFAF  RA+S + AE QL  LLF  T
Sbjct  398  HNGIQAEEMKLIGIDSLGFDLRICSGMQIETLRFAFSIRATSVHKAEGQLRELLFAST  455



>emb|CDX80406.1| BnaC07g30380D [Brassica napus]
Length=480

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/247 (46%), Positives = 158/247 (64%), Gaps = 22/247 (9%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HPM+FARR+ EV   DP+++ME P AGLAIQG+L   F+++H      +S  K++
Sbjct  254  TMRTCHPMYFARRIAEVASKDPLNWMEQPSAGLAIQGLLSRVFVKDH----SHISAPKST  309

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D+N+  + ++ K   I                 + +E++ + E   +  S+YKLEM K
Sbjct  310  SSDKNKEGEKSEEKVEDI-----------------DESEKILQLENSRNAISYYKLEMNK  352

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ D R+A+ DAIA ++  I+ RL+  G    +ALKSLCWR  GIQ 
Sbjct  353  IQLITAQGHQTEVEVGDVRKAQPDAIALASDGIVRRLEEDGNMLTEALKSLCWRHNGIQA  412

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQRK  233
            EEV LIG+DSLG D+R+CSG Q++TLRFAF  RA+S +SAE QL  LLF  T  K Q  K
Sbjct  413  EEVKLIGIDSLGFDIRLCSGMQIETLRFAFLTRATSVHSAEGQLRELLFASTPHKPQTPK  472

Query  232  EAQQAES  212
            +    ES
Sbjct  473  QTSPKES  479



>ref|XP_010507340.1| PREDICTED: uncharacterized protein At3g49140-like [Camelina sativa]
Length=617

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 161/239 (67%), Gaps = 23/239 (10%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HPM FA+R+TEV  +DP+D+M+ P AGLAIQG+L    +E++  IQK+++D  ++
Sbjct  402  TMRSCHPMFFAKRMTEVASNDPVDWMDQPSAGLAIQGLLSHILVEDYSDIQKRLADINST  461

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            +                    NG++    L++   + + E EK   +    +FYKLEMI+
Sbjct  462  ST-------------------NGNKDAENLEEKLAD-SSEGEKPRNV---VAFYKLEMIR  498

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ED R+A+ DAIAH++  I+SRL+ SG+K  +ALKSLCWR  G+Q 
Sbjct  499  IQLITAQGDQTEVEVEDVRKAQPDAIAHASAAIISRLEESGDKLTEALKSLCWRHNGVQA  558

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRK  233
            EEV LI +DSLG DLR+C+G ++++LRFAF  RA+SE +AE Q+  LLFP T   +Q K
Sbjct  559  EEVKLIEIDSLGFDLRLCAGAKIESLRFAFSTRATSEDNAEGQIRELLFPTTHPSKQPK  617



>emb|CDY05906.1| BnaC08g20830D [Brassica napus]
Length=481

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 107/249 (43%), Positives = 152/249 (61%), Gaps = 45/249 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HPM FA+R++EV  +DP+D+M+ P AGLAIQG+L     +    +++++ D   +
Sbjct  274  TMRSCHPMFFAKRMSEVAANDPVDWMDQPSAGLAIQGLLN----KNAENLEEKLEDTNKA  329

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + D                                   +E EK   +    +FYKLEMI+
Sbjct  330  DGD-----------------------------------DESEKTRKV---VAFYKLEMIR  351

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT VE+ED R+A+ D IA+ +  I+SRL+ SG+K  +AL+SLCWR  GIQ 
Sbjct  352  IQLITAQGDQTEVEVEDVRKAQPDVIANGSAGIISRLEESGDKLAEALRSLCWRYYGIQA  411

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK---LQQ  239
            EEV +IG+DSLG DLR+C+G ++++LRFAF  RA+SE  AE Q+  LLFP T +   L++
Sbjct  412  EEVKMIGLDSLGFDLRLCAGAKIESLRFAFSTRATSEEDAEEQIKELLFPTTNQSKPLEE  471

Query  238  RKEAQQAES  212
             K   Q ES
Sbjct  472  PKGTSQTES  480



>emb|CDX88068.1| BnaA06g26590D [Brassica napus]
Length=450

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 149/248 (60%), Gaps = 39/248 (16%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HPM+FARR+ EV   DP+++ME P AGLAIQG+L   F+++H      +S  K++
Sbjct  239  TMRTCHPMYFARRIAEVASKDPLNWMEQPSAGLAIQGLLSRVFVKDH----SDISAPKST  294

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            N D              I+ +   R+                         S+YKLEM K
Sbjct  295  NIDETD----------KILQLENSRN-----------------------AVSYYKLEMNK  321

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGE-KTIQALKSLCWRCKGIQ  413
            IQLI+A G QT VE+ D R+A+ DAIA ++  I+ RL+  G+ K  +ALKSLCWR KGI+
Sbjct  322  IQLITAQGRQTEVEVGDVRKAQPDAIALASDGIVRRLEEDGDNKLTEALKSLCWRHKGIE  381

Query  412  VEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT-QKLQQR  236
             EEV LIG+DSLG DLR+CSG +++TLRFAF  RA+S +SAE QL  LLF  T  K Q+ 
Sbjct  382  AEEVKLIGIDSLGFDLRLCSGMEIETLRFAFLTRATSVHSAEGQLRELLFASTPHKPQKP  441

Query  235  KEAQQAES  212
            K+    ES
Sbjct  442  KQTSPKES  449



>gb|AES75635.2| PPR superfamily protein, putative [Medicago truncatula]
Length=461

 Score =   193 bits (491),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 131/184 (71%), Gaps = 6/184 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR SHPM FA++LTE+  DDPID+ME PPA +  QG++RPAF+EE+  IQK +S +++S
Sbjct  278  TMRFSHPMDFAKKLTEIASDDPIDWMEQPPACVVFQGVIRPAFIEENSPIQKHLSANQSS  337

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNW-AEELEKDETLGSGTSFYKLEMI  593
             A   +ISK  + KE ++  INGH H     +DN +   E  E  +T    TSFY+LE++
Sbjct  338  TA---EISKVTENKEESVGAINGHEHNKESSEDNASQKVENNENGDTPSDETSFYRLEIV  394

Query  592  KIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSG--EKTIQALKSLCWRCKG  419
            KIQ+ SAHG+   +E+ED+ +A+ DAIA S+ KI+S LK +G  EKT+QALKSLCW CKG
Sbjct  395  KIQVFSAHGHPVVLEVEDYTKAQPDAIARSSSKIISHLKAAGESEKTLQALKSLCWICKG  454

Query  418  IQVE  407
            IQVE
Sbjct  455  IQVE  458



>gb|KFK27685.1| hypothetical protein AALP_AA8G415300 [Arabis alpina]
Length=500

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 157/247 (64%), Gaps = 15/247 (6%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HPM+FARR+ EV  +D +++M+   AGLAIQG+L   F+++   IQK  SD   S
Sbjct  267  TMRACHPMYFARRMAEVASNDSVNWMKQASAGLAIQGLLSRVFVKDPSDIQKHTSD-TLS  325

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
              D+N+     + K   I   +G              +E LE +++     S+YKLEMI+
Sbjct  326  KTDKNKEGVKLEDKLKDICTTSGDE------------SEILETEDSR-KAISYYKLEMIR  372

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            IQLI+A G+QT V++E  R+A+ DAIA ++  I+S L+  G K  +ALKSLCW+   IQ 
Sbjct  373  IQLITAQGHQTEVQVEAVRKAQPDAIALASDSIVSGLEEDGGKLTEALKSLCWKHNEIQA  432

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQ-KLQQRK  233
            EEV  IG+DSLG DLR+CSG Q++TLRFAF ++A+S ++AE QL  +LF  T  K Q+ K
Sbjct  433  EEVKFIGIDSLGFDLRLCSGMQIETLRFAFLRKATSVHNAEGQLREILFASTPLKPQKPK  492

Query  232  EAQQAES  212
            +  Q ES
Sbjct  493  QPNQKES  499



>ref|XP_003590427.1| Transcription factor bHLH130 [Medicago truncatula]
Length=373

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 112/138 (81%), Gaps = 3/138 (2%)
 Frame = -3

Query  619  TSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGE--KTIQAL  446
            TSFY+LE++KIQ+ SAHG+   +E+ED+ +A+ DAIA S+ KI+S LK +GE  KT+QAL
Sbjct  232  TSFYRLEIVKIQVFSAHGHPVVLEVEDYTKAQPDAIARSSSKIISHLKAAGESEKTLQAL  291

Query  445  KSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLL  266
            KSLCW CKGIQVEE  LI VDSLG D+RVCSGTQVQTLRF FKKRA+SEYSAERQLN++L
Sbjct  292  KSLCWICKGIQVEEAQLICVDSLGFDVRVCSGTQVQTLRFGFKKRATSEYSAERQLNDIL  351

Query  265  FPRTQKLQQR-KEAQQAE  215
            FPR    QQ+ K+  Q E
Sbjct  352  FPRNHPKQQKTKQTHQNE  369



>gb|EMT02897.1| hypothetical protein F775_08396 [Aegilops tauschii]
Length=467

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 147/276 (53%), Gaps = 76/276 (28%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+ S HP++FAR + E      ID+++ PPA L ++ I   AFL                
Sbjct  233  TVNSCHPLYFARMIVENASKSSIDWLDRPPASLVVEDI---AFL----------------  273

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
                                    +H +          +E  KD+  GSG +F+K+E++ 
Sbjct  274  ------------------------KHSTNPTAPGILVGDEPLKDDKKGSGATFFKVEVLS  309

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+LI+A+G +  V+IE++R++R D IAHSA  I+SRL+  G+K  QALKSLCWRCK IQV
Sbjct  310  IELITAYGTEPKVKIEEYRKSRPDIIAHSAPNIISRLRAGGDKITQALKSLCWRCKAIQV  369

Query  409  EEVSLIGVDSLGIDLRVCSGTQV-------------------------------QTLRFA  323
            EE ++IGVD LG DLR+CSGTQV                               QTLRFA
Sbjct  370  EEAAIIGVDCLGFDLRLCSGTQVQTLRFAFPEEAAIIGVDCLGFDLRLCSGTQVQTLRFA  429

Query  322  FKKRASSEYSAERQLNNLLFPRTQKLQQRKEAQQAE  215
            F  +ASSE+SAE+Q++ LLFPR  ++ Q  E+ QA+
Sbjct  430  FPTKASSEFSAEKQIHELLFPR--RIHQEGESPQAQ  463



>ref|XP_002877648.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53907.1| predicted protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=786

 Score =   181 bits (460),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 145/215 (67%), Gaps = 15/215 (7%)
 Frame = -3

Query  904  EVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRNQISKAADCKE  725
            EV  DD +D+M+ P AGLAIQGIL    +E++  IQ++++D+ +++ +RN+ ++  + K 
Sbjct  587  EVASDDLVDWMDQPSAGLAIQGILSHILVEDYSDIQRKLADNNSTSTNRNKDAENLEEKL  646

Query  724  TTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLISAHGNQTFVEI  545
              I    G   +S +D      + + EK+ T+    +FYKLEMI+IQLI+        E+
Sbjct  647  ADISKACGE--ESDID------SSQGEKERTV---VAFYKLEMIRIQLITPQAG----EV  691

Query  544  EDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDL  365
            ED R+A+ D IAH++  I+SRL+ SG+K  +ALKSLCWR  GIQ EEV LIGVDSLG DL
Sbjct  692  EDVRKAQPDVIAHASAGIISRLEESGDKVTEALKSLCWRHNGIQAEEVKLIGVDSLGFDL  751

Query  364  RVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP  260
            R+C+G ++++ RFAF  RA+SE +AE ++  LLFP
Sbjct  752  RLCAGAKIESFRFAFLTRATSEDNAEGRIRELLFP  786



>ref|XP_004970926.1| PREDICTED: uncharacterized protein At3g49140-like isoform X3 
[Setaria italica]
Length=454

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 141/234 (60%), Gaps = 8/234 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HP++FA+ LT+   D+  + M+ P   ++I G LRPAF+EE   ++     H  S
Sbjct  214  TMRAIHPIYFAKCLTKAVHDNRGEKMDSPSNSVSIVGYLRPAFIEEESYLRSLF--HAES  271

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            N+D    S   D   T   PI+G  H    D+   ++      D    +G+  YKLE++ 
Sbjct  272  NSD-GYSSDWKDGYNTETRPISGTNHLVDDDKSRFDF-----NDTGTSTGSMIYKLEIMT  325

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L S +G Q  ++ +DF+ +  D +A+SA  I+ R+K + ++   AL+SLC R K + V
Sbjct  326  IELFSMYGKQLMIDPQDFQDSEPDILANSASAIIERIKENSDQCAVALRSLCRRKKSLTV  385

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            EE SLIGVDSLGID+R  SG + +T+RF+F  +A SE SAE+++  +LFPR Q+
Sbjct  386  EEASLIGVDSLGIDVRAFSGLEARTVRFSFNAQALSERSAEKKIRRMLFPRYQR  439



>ref|XP_004970924.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Setaria italica]
 ref|XP_004970925.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Setaria italica]
Length=458

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 141/237 (59%), Gaps = 10/237 (4%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HP++FA+ LT+   D+  + M+ P   ++I G LRPAF+EE   ++     H  S
Sbjct  214  TMRAIHPIYFAKCLTKAVHDNRGEKMDSPSNSVSIVGYLRPAFIEEESYLRSLF--HAES  271

Query  769  NAD---RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLE  599
            N+D    +      D   T   PI+G  H    D+   ++      D    +G+  YKLE
Sbjct  272  NSDGYSSDWKVNETDGYNTETRPISGTNHLVDDDKSRFDF-----NDTGTSTGSMIYKLE  326

Query  598  MIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKG  419
            ++ I+L S +G Q  ++ +DF+ +  D +A+SA  I+ R+K + ++   AL+SLC R K 
Sbjct  327  IMTIELFSMYGKQLMIDPQDFQDSEPDILANSASAIIERIKENSDQCAVALRSLCRRKKS  386

Query  418  IQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            + VEE SLIGVDSLGID+R  SG + +T+RF+F  +A SE SAE+++  +LFPR Q+
Sbjct  387  LTVEEASLIGVDSLGIDVRAFSGLEARTVRFSFNAQALSERSAEKKIRRMLFPRYQR  443



>ref|XP_010662670.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Vitis 
vinifera]
Length=409

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM FA+ + EV   DP+D+M  PPAG+AIQG+LRPAF+EE  VIQK +S H++S
Sbjct  265  TMRSSHPMFFAKTMAEVASGDPVDWMNQPPAGIAIQGLLRPAFIEEQSVIQKHISSHQSS  324

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            NA+ NQ+ K ++ K   +  INGH  +SG  +DN   AE++EKD  + +G SFYKLEMIK
Sbjct  325  NANVNQVEKNSEDKAEDLEKINGHGQESGSSRDNSIQAEDIEKDHNMMNGFSFYKLEMIK  384

Query  589  IQLISAHGNQTF  554
            I LISAHG Q  
Sbjct  385  ILLISAHGLQVL  396



>gb|ACL54435.1| unknown [Zea mays]
Length=452

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 143/234 (61%), Gaps = 6/234 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HP++FA+ LT+   ++  + M+ P  GL+I G LRPAF+EE   ++         
Sbjct  214  TMRAIHPIYFAKCLTKAIHNNNGEKMDSPSNGLSIVGYLRPAFIEEESYLRSMFHGDNGG  273

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +   ++++  +    T  P++G      +D D   +  +    ET  + +  YKLE++ 
Sbjct  274  YSSDWKVNETDEYNRET-RPVSGTNRL--IDDDKSRF--DFNHAETR-TDSMIYKLEIMT  327

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L S HG Q  ++ +DF+ +  D +A+SA  I+ R+K + ++   AL+SLC R KG+ V
Sbjct  328  IELFSMHGKQFKIDPQDFQDSEPDILANSASSIIERIKENSDQCAAALRSLCRRKKGLTV  387

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            EE SLIGVDSLGID+R  SG +V+T+RF+F  +A SE SAE+++  +LFPR Q+
Sbjct  388  EEASLIGVDSLGIDVRAFSGLEVKTVRFSFNAQALSERSAEKKIRRMLFPRYQR  441



>ref|NP_001045101.1| Os01g0899500 [Oryza sativa Japonica Group]
 dbj|BAD82359.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07015.1| Os01g0899500 [Oryza sativa Japonica Group]
 dbj|BAG94354.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 146/244 (60%), Gaps = 12/244 (5%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HP++FA+ LT+   D   + M+ P  G++I G LRPAF+EE   ++     H   
Sbjct  214  TMRAIHPIYFAKCLTKAVHDKHREKMDSPSNGVSIVGYLRPAFIEEESYLRSLF--HGEC  271

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGT--SFYKLEM  596
            N D        +CK     P +G    +GL  D+ +  +       +GS T  + YKLE+
Sbjct  272  NGDGYSSDWRDECKREP-APASG---TNGLIDDDKSRFDFT----NVGSSTDSTIYKLEI  323

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            + ++L S +G Q  ++ +DF+ A  D +A+SA +I++R+K + ++   AL+SLC R KG+
Sbjct  324  MTVELFSIYGKQLMIDPQDFQDAEPDILANSASEIINRIKENDDQCAMALRSLCHRKKGL  383

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
             VEE SLI +DSLGID+R  SG + +T+RF+F  +A SE SAE+++  +LFPR + ++  
Sbjct  384  TVEEASLISIDSLGIDVRAFSGLEARTVRFSFNAQALSERSAEKKIRRMLFPRRKNVKPS  443

Query  235  KEAQ  224
             E +
Sbjct  444  TEDE  447



>emb|CDM85332.1| unnamed protein product [Triticum aestivum]
Length=448

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 145/239 (61%), Gaps = 18/239 (8%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQ-----KQMS  785
            TMRS HP++FA+ LT+   D+  + ++ P  G++I G LRPAF+EE   ++     +  +
Sbjct  213  TMRSIHPIYFAKCLTKAVHDNHGEKIDNPSNGVSIVGYLRPAFIEEESYLRSLFGAEYSA  272

Query  784  DHKTSNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYK  605
            D  +SN  R + ++       T   I+G   KS LD +N     E   D T+      YK
Sbjct  273  DGYSSNW-REEYNREPQPASGTNGLIDGD--KSRLDINN----TESSIDSTI------YK  319

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LEM+ I+L S +G Q  ++ +DF+ A  D +++ A  I+ R+K + ++   AL+SLC R 
Sbjct  320  LEMMSIELFSVYGKQFMIDPQDFQDAEPDLLSNHASDIIKRVKENSDQCTMALRSLCSRK  379

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            KG+ VE+ SLIGVDSLGID+R  SG + +T+RF+F  +A SE SAE+++  +LFPR +K
Sbjct  380  KGLTVEDASLIGVDSLGIDVRAFSGLEARTVRFSFNAQALSERSAEKKIKRMLFPRYRK  438



>ref|NP_001145108.1| uncharacterized protein LOC100278323 [Zea mays]
 gb|ACG45126.1| hypothetical protein [Zea mays]
Length=452

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/234 (38%), Positives = 143/234 (61%), Gaps = 6/234 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HP++FA+ LT+   ++  + M+ P  GL+I G LRPAF+EE   ++         
Sbjct  214  TMRAIHPIYFAKCLTKAIHNNNGEKMDSPSNGLSIVGYLRPAFIEEESYLRSMFHGDNGG  273

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +   ++++  +    T  P++G      +D D   +  +    ET  + +  YKLE++ 
Sbjct  274  YSSDWKVNETDEYNRET-RPVSGTNRL--IDDDKSRF--DFNHAETR-TDSMIYKLEIMT  327

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L S +G Q  ++ +DF+ +  D +A+SA  I+ R+K + ++   AL+SLC R KG+ V
Sbjct  328  IELFSMYGKQFKIDPQDFQDSEPDILANSASSIIERIKENSDQCAAALRSLCRRKKGLTV  387

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            EE SLIGVDSLGID+R  SG +V+T+RF+F  +A SE SAE+++  +LFPR Q+
Sbjct  388  EEASLIGVDSLGIDVRAFSGLEVKTVRFSFNAQALSERSAEKKIRRMLFPRYQR  441



>ref|XP_008672644.1| PREDICTED: uncharacterized protein LOC100278323 isoform X1 [Zea 
mays]
 tpg|DAA56324.1| TPA: hypothetical protein ZEAMMB73_559531 [Zea mays]
 tpg|DAA56325.1| TPA: hypothetical protein ZEAMMB73_559531 [Zea mays]
Length=452

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/234 (38%), Positives = 143/234 (61%), Gaps = 6/234 (3%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HP++FA+ LT+   ++  + M+ P  GL+I G LRPAF+EE   ++         
Sbjct  214  TMRAIHPIYFAKCLTKAIHNNNGEKMDSPSNGLSIVGYLRPAFIEEESYLRSMFHGDNGG  273

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +   ++++  +    T  P++G      +D D   +  +    ET  + +  YKLE++ 
Sbjct  274  YSSDWKVNETDEYNRET-RPVSGTNRL--IDDDKSRF--DFNHAETR-TDSMIYKLEIMT  327

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L S +G Q  ++ +DF+ +  D +A+SA  I+ R+K + ++   AL+SLC R KG+ V
Sbjct  328  IELFSMYGKQFKIDPQDFQDSEPDILANSASSIIERIKENSDQCAAALRSLCRRKKGLTV  387

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            EE SLIGVDSLGID+R  SG +V+T+RF+F  +A SE SAE+++  +LFPR Q+
Sbjct  388  EEASLIGVDSLGIDVRAFSGLEVKTVRFSFNAQALSERSAEKKIRRMLFPRYQR  441



>gb|ERN20099.1| hypothetical protein AMTR_s00066p00038410 [Amborella trichopoda]
Length=477

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 135/236 (57%), Gaps = 19/236 (8%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM----SD  782
            TM   HPM+FA+ LT+       + M+ P  GL+I G+LRPAF++E   +++      SD
Sbjct  237  TMLQVHPMYFAKCLTKAVYAKHAEKMDHPTNGLSIMGLLRPAFVDEESYLRRLFHSDDSD  296

Query  781  HKTSNADRNQISKAADCKETTIVPINGH-RHKSGLDQDNPNWAEELEKDETLGSGTSFYK  605
              TS+       +      T  +  +G  R  SG D                  G++ YK
Sbjct  297  GYTSDGKDESEREDEKVASTYDLIDDGFLRFPSGED--------------GASMGSTLYK  342

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE+I IQL S +G+Q+ + +EDF++A  D + HSA  I+ R    G K   ALK+LC + 
Sbjct  343  LEIISIQLHSIYGDQSGINLEDFQQAEPDILVHSASAIIERFNEYGMKCDVALKTLCRKK  402

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPR  257
            KG++VE  +LI VDSLG+D+RV SG + QTLRF+F  +A+SE SAE+++  +LFPR
Sbjct  403  KGLKVEGANLINVDSLGMDVRVFSGVEAQTLRFSFNSQATSESSAEKKIRRMLFPR  458



>ref|XP_006858632.2| PREDICTED: uncharacterized protein At3g49140 [Amborella trichopoda]
Length=484

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 135/236 (57%), Gaps = 19/236 (8%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM----SD  782
            TM   HPM+FA+ LT+       + M+ P  GL+I G+LRPAF++E   +++      SD
Sbjct  244  TMLQVHPMYFAKCLTKAVYAKHAEKMDHPTNGLSIMGLLRPAFVDEESYLRRLFHSDDSD  303

Query  781  HKTSNADRNQISKAADCKETTIVPINGH-RHKSGLDQDNPNWAEELEKDETLGSGTSFYK  605
              TS+       +      T  +  +G  R  SG D                  G++ YK
Sbjct  304  GYTSDGKDESEREDEKVASTYDLIDDGFLRFPSGED--------------GASMGSTLYK  349

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE+I IQL S +G+Q+ + +EDF++A  D + HSA  I+ R    G K   ALK+LC + 
Sbjct  350  LEIISIQLHSIYGDQSGINLEDFQQAEPDILVHSASAIIERFNEYGMKCDVALKTLCRKK  409

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPR  257
            KG++VE  +LI VDSLG+D+RV SG + QTLRF+F  +A+SE SAE+++  +LFPR
Sbjct  410  KGLKVEGANLINVDSLGMDVRVFSGVEAQTLRFSFNSQATSESSAEKKIRRMLFPR  465



>ref|XP_011084164.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Sesamum 
indicum]
Length=466

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 134/234 (57%), Gaps = 27/234 (12%)
 Frame = -3

Query  937  SHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADR  758
            +HP++FA+ LT+  D +    M+ P  G+ + G L+P F++E   +++   D        
Sbjct  251  THPVYFAKCLTKAIDVEHAKLMDYPSNGVVLWGFLKPTFIDEEFYLRRLFHDEDNDG---  307

Query  757  NQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLI  578
                 ++DC++  +  ++                     D + G  T  Y+LE+ KI+L 
Sbjct  308  ----YSSDCEDGDVASVSS------------------SHDGSCGRST-IYRLEITKIELF  344

Query  577  SAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVS  398
            S +G Q+ V ++DF+ A  D + HS   IL R   S  +   ALK+LC + KG+ VE  +
Sbjct  345  SVYGVQSVVSVQDFQYAEPDVLVHSIPSILERFGESRTRCNIALKALC-KKKGLHVEGAN  403

Query  397  LIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            LIGVDSLG+D+RVCSGT+V+T RF+FK RA+SE +A++Q+  LLFPR+++ + R
Sbjct  404  LIGVDSLGMDVRVCSGTEVRTHRFSFKVRATSECAADKQIQQLLFPRSRRKKLR  457



>ref|XP_011084163.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Sesamum 
indicum]
Length=471

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 134/234 (57%), Gaps = 27/234 (12%)
 Frame = -3

Query  937  SHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADR  758
            +HP++FA+ LT+  D +    M+ P  G+ + G L+P F++E   +++   D        
Sbjct  256  THPVYFAKCLTKAIDVEHAKLMDYPSNGVVLWGFLKPTFIDEEFYLRRLFHDEDNDG---  312

Query  757  NQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLI  578
                 ++DC++  +  ++                     D + G  T  Y+LE+ KI+L 
Sbjct  313  ----YSSDCEDGDVASVSS------------------SHDGSCGRST-IYRLEITKIELF  349

Query  577  SAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVS  398
            S +G Q+ V ++DF+ A  D + HS   IL R   S  +   ALK+LC + KG+ VE  +
Sbjct  350  SVYGVQSVVSVQDFQYAEPDVLVHSIPSILERFGESRTRCNIALKALC-KKKGLHVEGAN  408

Query  397  LIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            LIGVDSLG+D+RVCSGT+V+T RF+FK RA+SE +A++Q+  LLFPR+++ + R
Sbjct  409  LIGVDSLGMDVRVCSGTEVRTHRFSFKVRATSECAADKQIQQLLFPRSRRKKLR  462



>ref|XP_002458925.1| hypothetical protein SORBIDRAFT_03g042790 [Sorghum bicolor]
 gb|EES04045.1| hypothetical protein SORBIDRAFT_03g042790 [Sorghum bicolor]
Length=454

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 145/239 (61%), Gaps = 14/239 (6%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM-----S  785
            TMR+ HP++FA+ L +   ++    M+ P  GL+I G LRPAF+EE   ++        S
Sbjct  214  TMRAIHPIYFAKCLKKAIHNNNGKKMDSPSNGLSIVGYLRPAFIEEESYLRSLFHGECSS  273

Query  784  DHKTSNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYK  605
            D  +S+   N+  + +  +ET   P++G       D+   ++ +   K +++      YK
Sbjct  274  DRYSSDWKVNETDEYS--RETR--PVSGTNRLIDGDKSKFDFNDAETKTDSM-----IYK  324

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE++ I+L S +G Q  ++ +DF+ +  D +A+SA  I+ R+K + ++   AL+SLC R 
Sbjct  325  LEIMTIELFSMYGKQFMIDPQDFQDSEPDILANSASAIIERIKENSDQCAMALRSLCRRK  384

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            KG+ VEE SLIGVDSLGID+R  SG + +T+R +F  +A SE SAE+++  +LFPR+Q+
Sbjct  385  KGLTVEEASLIGVDSLGIDVRAFSGLEARTVRISFNAQALSERSAEKKIRRMLFPRSQR  443



>ref|XP_010232696.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Brachypodium 
distachyon]
Length=450

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 144/239 (60%), Gaps = 14/239 (6%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM-----S  785
            TMR+ HP++FA+ LT+   D+  + M+ P  G++I G LRPAF+EE   ++        +
Sbjct  211  TMRAIHPIYFAKCLTKAIHDNHGEKMDNPSNGVSIVGYLRPAFIEEESYLRSLFRAECNA  270

Query  784  DHKTSNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYK  605
            D ++SN   NQ       +E    P++ +   +GL  D+ +  +  +   ++ S    YK
Sbjct  271  DGQSSNWRVNQT------EEHHREPVSAY-GTNGLIDDDKSRIDSSDAGSSMES--MIYK  321

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE++ I+L S +G Q  ++ +DF+ A  D + + A  I+ R+K + ++   AL+SLC R 
Sbjct  322  LEIMTIELFSIYGKQLMIDPQDFQDAEPDLLTNYAPDIIKRIKENNDQCTMALRSLCSRK  381

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            KG+ VE  SLIGVDSLGID+R  SG + +T+RF+F  +A SE SAE+++  +LFPR +K
Sbjct  382  KGLAVEGASLIGVDSLGIDVRAFSGLEARTVRFSFNAQALSERSAEKKIRRMLFPRYRK  440



>ref|XP_010232694.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010232695.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Brachypodium 
distachyon]
Length=452

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 144/239 (60%), Gaps = 14/239 (6%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM-----S  785
            TMR+ HP++FA+ LT+   D+  + M+ P  G++I G LRPAF+EE   ++        +
Sbjct  213  TMRAIHPIYFAKCLTKAIHDNHGEKMDNPSNGVSIVGYLRPAFIEEESYLRSLFRAECNA  272

Query  784  DHKTSNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYK  605
            D ++SN   NQ       +E    P++ +   +GL  D+ +  +  +   ++ S    YK
Sbjct  273  DGQSSNWRVNQT------EEHHREPVSAY-GTNGLIDDDKSRIDSSDAGSSMES--MIYK  323

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE++ I+L S +G Q  ++ +DF+ A  D + + A  I+ R+K + ++   AL+SLC R 
Sbjct  324  LEIMTIELFSIYGKQLMIDPQDFQDAEPDLLTNYAPDIIKRIKENNDQCTMALRSLCSRK  383

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            KG+ VE  SLIGVDSLGID+R  SG + +T+RF+F  +A SE SAE+++  +LFPR +K
Sbjct  384  KGLAVEGASLIGVDSLGIDVRAFSGLEARTVRFSFNAQALSERSAEKKIRRMLFPRYRK  442



>ref|XP_009591981.1| PREDICTED: uncharacterized protein At3g49140 [Nicotiana tomentosiformis]
Length=467

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 132/233 (57%), Gaps = 26/233 (11%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  D +    M+ P  G++I G L+PAFLEE   +++  SD +  +    
Sbjct  250  HPVYFAKCLTKAVDMEHAKMMDYPSNGISIWGHLKPAFLEEEFYVRRLFSDDEVGDG---  306

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                ++D K+   +       KS                    S ++ Y+LE+IKI+L S
Sbjct  307  ---YSSDWKDGETLSFGSSYDKS-------------------CSLSTIYRLEIIKIELFS  344

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q  V + DF+ A  D + HS   I+   +  G K   ALK+LC R KG++VE  +L
Sbjct  345  VYGAQLAVNLHDFQDAEPDILVHSTPAIVEWFRQQGIKCKFALKALC-RKKGLRVERANL  403

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IG DSLG+D+RV SGT+V+T RF FK RA+S  +AE+Q+  LLFPR+++ + R
Sbjct  404  IGFDSLGMDVRVLSGTEVRTHRFPFKVRATSVVAAEKQIRQLLFPRSRRKKFR  456



>ref|XP_009765201.1| PREDICTED: uncharacterized protein At3g49140 isoform X4 [Nicotiana 
sylvestris]
Length=467

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 130/233 (56%), Gaps = 26/233 (11%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  G++I G L+PAFLEE   +++  SD +  +    
Sbjct  250  HPVYFAKCLTKAVEMEHAKMMDHPSNGISIWGHLKPAFLEEEFYVRRLFSDDEVGDG---  306

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                 +D K+   +       KS                    S ++ Y+LE++KI+L S
Sbjct  307  ---YISDWKDGETLSFGSSYDKS-------------------CSLSTIYRLEILKIELFS  344

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q  V + DF+ A  D + HS   I+   K  G K   ALK+LC R KG+  E   L
Sbjct  345  VYGAQLAVNLHDFQDAEPDILVHSTPAIVEWFKQQGIKCKFALKALC-RKKGLHAERAKL  403

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+RV SGT+VQT RF FK RA+SE +AE+Q+  LLFPR+++ + R
Sbjct  404  IGVDSLGMDVRVLSGTEVQTHRFPFKVRATSEVAAEKQIRQLLFPRSRRKKFR  456



>ref|XP_008802368.1| PREDICTED: uncharacterized protein At3g49140 isoform X6 [Phoenix 
dactylifera]
 ref|XP_008802370.1| PREDICTED: uncharacterized protein At3g49140 isoform X6 [Phoenix 
dactylifera]
Length=426

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 139/260 (53%), Gaps = 46/260 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+R  HPM+FA+ L++  +      M+ P  GL+I G LRPAF++E   +++    +   
Sbjct  182  TLRWVHPMYFAKCLSKAVNTKQERKMDRPSNGLSIVGCLRPAFIDEESYLRRLFHSN---  238

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGT---------  617
                                 +G  + S     +PN A+E EK+E   +GT         
Sbjct  239  ---------------------DGDDYMSDWRALSPNPADESEKEEEQVAGTYDLVDGEML  277

Query  616  -------------SFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLK  476
                         + YKLE++ ++L S +G Q+ + ++DF+ A  D +AHSA  I+ R  
Sbjct  278  RFNSKYDGGNISSTLYKLEIMSMELHSVYGGQSMISLQDFQDAEPDVLAHSASAIIERSN  337

Query  475  TSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEY  296
              G +   AL+SLC R KG+ VE  +LIGVDSLG+D+RV SG + QT+RF+F  RA+SE 
Sbjct  338  EYGVQCNAALRSLCRRRKGLVVERANLIGVDSLGMDVRVFSGMEAQTIRFSFNARATSES  397

Query  295  SAERQLNNLLFPRTQKLQQR  236
            +AE+++  +LFPR  + + R
Sbjct  398  AAEKKIKRMLFPRYYRKKLR  417



>ref|XP_008802363.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Phoenix 
dactylifera]
Length=479

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 140/248 (56%), Gaps = 29/248 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQK--------  794
            T+R  HPM+FA+ L++  +      M+ P  GL+I G LRPAF++E   +++        
Sbjct  242  TLRWVHPMYFAKCLSKAVNTKQERKMDRPSNGLSIVGCLRPAFIDEESYLRRLFHSNDGD  301

Query  793  -QMSDHKT-SNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSG  620
              MSD +  S  +  Q++   D  +  ++     R  S  D  N +              
Sbjct  302  DYMSDWRDESEKEEEQVAGTYDLVDGEML-----RFNSKYDGGNIS--------------  342

Query  619  TSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKS  440
            ++ YKLE++ ++L S +G Q+ + ++DF+ A  D +AHSA  I+ R    G +   AL+S
Sbjct  343  STLYKLEIMSMELHSVYGGQSMISLQDFQDAEPDVLAHSASAIIERSNEYGVQCNAALRS  402

Query  439  LCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP  260
            LC R KG+ VE  +LIGVDSLG+D+RV SG + QT+RF+F  RA+SE +AE+++  +LFP
Sbjct  403  LCRRRKGLVVERANLIGVDSLGMDVRVFSGMEAQTIRFSFNARATSESAAEKKIKRMLFP  462

Query  259  RTQKLQQR  236
            R  + + R
Sbjct  463  RYYRKKLR  470



>ref|XP_009387060.1| PREDICTED: uncharacterized protein At3g49140 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=473

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 138/248 (56%), Gaps = 29/248 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQK--------  794
            T+R  HP++FA+ LT+V        ++ P  GL I G LRPAF++E   +++        
Sbjct  236  TLRYIHPLYFAKCLTKVVQTKFGKVVDWPSNGLQIIGCLRPAFIDEESYLRRLFHRDDGD  295

Query  793  -QMSDHKT-SNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSG  620
              +SD +  S  +  Q+++A D  +  ++  +  R  S +                    
Sbjct  296  NYISDWRDESEKEEEQVARAYDLIDGGMLSFDSKRDVSTI-------------------S  336

Query  619  TSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKS  440
            ++ YKLE+I ++L S +G+Q+ + +++F+ A  D +AHSA  I+ R+   G +   ALK+
Sbjct  337  STLYKLEIITVELHSVYGDQSLISLQEFQDAEPDLLAHSASAIIERINEYGLQCNVALKA  396

Query  439  LCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP  260
            LC R KG+ VE  +LIG+DSLGID+RV  G + +TLRF F  RA SE +AE+++  +LFP
Sbjct  397  LCRRKKGLNVEGANLIGIDSLGIDVRVYCGMEARTLRFPFSARAMSESAAEKKIKRMLFP  456

Query  259  RTQKLQQR  236
            R  +   R
Sbjct  457  RYHRKNLR  464



>ref|XP_010322468.1| PREDICTED: uncharacterized protein At3g49140 isoform X3 [Solanum 
lycopersicum]
Length=359

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 132/233 (57%), Gaps = 26/233 (11%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+         M+ P  G++I G L+PAFLEE   +++  S  + S+    
Sbjct  142  HPVYFAKCLTKAVHMKHAKMMDHPSNGISIWGRLKPAFLEEEYYVRRLFSGDEVSDG---  198

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                  D K+  I+                +++   +K  TL   +S Y+LE++++ L S
Sbjct  199  ---STLDWKDGEIL----------------SFSSRYDKSRTL---SSIYRLEIMRVDLFS  236

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q  V + DF  A  D++ +SA  IL   +  G +   ALK+LC R KG+ VE  +L
Sbjct  237  VYGAQLAVNLYDFHDAEPDSLVYSAPAILEWFRQQGIRCKYALKALC-RKKGLHVERANL  295

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+RV SGT+V T RF FK RA SE +AE+Q+  LLFPR+++ + R
Sbjct  296  IGVDSLGMDVRVLSGTEVWTHRFPFKVRAHSEIAAEKQIRQLLFPRSRRKKFR  348



>ref|XP_006347461.1| PREDICTED: uncharacterized protein At3g49140-like [Solanum tuberosum]
Length=485

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 135/241 (56%), Gaps = 26/241 (11%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+         M+ P  G++I G L+PAFLEE   +++  S  + S+    
Sbjct  270  HPVYFAKCLTKAVHMKHAKMMDHPSNGISIWGRLKPAFLEEEYYVRRLFSGDEVSDG---  326

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                  D K+  I+                +++   +K  TL   +S Y+LE+I++ L S
Sbjct  327  ---STLDWKDGEIL----------------SFSSRYDKSCTL---SSIYRLEIIRVDLFS  364

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q  V + DF  A  D++ HSA  IL   +  G +   ALK+LC R KG+ VE  +L
Sbjct  365  VYGAQLAVNLYDFHDAEPDSLVHSAPAILEWFRQQGIRCKYALKALC-RKKGLHVERANL  423

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKEAQQAE  215
            IGVDSLG+D+RV SGT+V T RF FK RA SE +AE+Q+  LLFPR+++ +  + A   +
Sbjct  424  IGVDSLGMDVRVLSGTEVWTHRFPFKVRAHSEIAAEKQIRQLLFPRSRRKKFTERAGDLD  483

Query  214  S  212
            S
Sbjct  484  S  484



>ref|XP_008802366.1| PREDICTED: uncharacterized protein At3g49140 isoform X5 [Phoenix 
dactylifera]
 ref|XP_008802367.1| PREDICTED: uncharacterized protein At3g49140 isoform X5 [Phoenix 
dactylifera]
Length=454

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 139/260 (53%), Gaps = 46/260 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+R  HPM+FA+ L++  +      M+ P  GL+I G LRPAF++E   +++    +   
Sbjct  210  TLRWVHPMYFAKCLSKAVNTKQERKMDRPSNGLSIVGCLRPAFIDEESYLRRLFHSN---  266

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGT---------  617
                                 +G  + S     +PN A+E EK+E   +GT         
Sbjct  267  ---------------------DGDDYMSDWRALSPNPADESEKEEEQVAGTYDLVDGEML  305

Query  616  -------------SFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLK  476
                         + YKLE++ ++L S +G Q+ + ++DF+ A  D +AHSA  I+ R  
Sbjct  306  RFNSKYDGGNISSTLYKLEIMSMELHSVYGGQSMISLQDFQDAEPDVLAHSASAIIERSN  365

Query  475  TSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEY  296
              G +   AL+SLC R KG+ VE  +LIGVDSLG+D+RV SG + QT+RF+F  RA+SE 
Sbjct  366  EYGVQCNAALRSLCRRRKGLVVERANLIGVDSLGMDVRVFSGMEAQTIRFSFNARATSES  425

Query  295  SAERQLNNLLFPRTQKLQQR  236
            +AE+++  +LFPR  + + R
Sbjct  426  AAEKKIKRMLFPRYYRKKLR  445



>ref|XP_008802362.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Phoenix 
dactylifera]
Length=486

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 139/260 (53%), Gaps = 46/260 (18%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+R  HPM+FA+ L++  +      M+ P  GL+I G LRPAF++E   +++    +   
Sbjct  242  TLRWVHPMYFAKCLSKAVNTKQERKMDRPSNGLSIVGCLRPAFIDEESYLRRLFHSN---  298

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGT---------  617
                                 +G  + S     +PN A+E EK+E   +GT         
Sbjct  299  ---------------------DGDDYMSDWRALSPNPADESEKEEEQVAGTYDLVDGEML  337

Query  616  -------------SFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLK  476
                         + YKLE++ ++L S +G Q+ + ++DF+ A  D +AHSA  I+ R  
Sbjct  338  RFNSKYDGGNISSTLYKLEIMSMELHSVYGGQSMISLQDFQDAEPDVLAHSASAIIERSN  397

Query  475  TSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEY  296
              G +   AL+SLC R KG+ VE  +LIGVDSLG+D+RV SG + QT+RF+F  RA+SE 
Sbjct  398  EYGVQCNAALRSLCRRRKGLVVERANLIGVDSLGMDVRVFSGMEAQTIRFSFNARATSES  457

Query  295  SAERQLNNLLFPRTQKLQQR  236
            +AE+++  +LFPR  + + R
Sbjct  458  AAEKKIKRMLFPRYYRKKLR  477



>ref|XP_006291096.1| hypothetical protein CARUB_v10017210mg [Capsella rubella]
 gb|EOA23994.1| hypothetical protein CARUB_v10017210mg [Capsella rubella]
Length=457

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/243 (37%), Positives = 141/243 (58%), Gaps = 31/243 (13%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  + HP++FA+ +++    D    M+ P  G++I G LRPAFL+E   I++  +     
Sbjct  238  TSNAVHPIYFAKHMSKAISMDYDRKMDYPSNGVSILGCLRPAFLDEESYIRRLFT-----  292

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S  A                    QDNP  +  L +DE   S +S Y+LE++ 
Sbjct  293  SEDRDDYSWEA--------------------QDNP--STSLRRDEKDIS-SSLYRLEIVG  329

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  330  IELLSLYGAESSISLQDFQDAEPDILVHSTSAIIERFNNRGINSSIALKALC-KKKGLHA  388

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT--QKLQQR  236
            EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFPR+  +KL+  
Sbjct  389  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKIHQLLFPRSRRRKLKSH  448

Query  235  KEA  227
             E+
Sbjct  449  DES  451



>ref|XP_006645178.1| PREDICTED: uncharacterized protein At3g49140-like [Oryza brachyantha]
Length=448

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/246 (35%), Positives = 138/246 (56%), Gaps = 16/246 (7%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HP++FA+ LT+   D+    M+ P  G++I G LRPAF+EE   ++         
Sbjct  214  TMRAIHPIYFAKCLTKAVHDNHRVKMDSPSNGVSIVGYLRPAFIEEESYLRSLFHGDCNG  273

Query  769  NADRNQISKAADCKETTIVPING--HRHKSGLDQDNPNWAEELEKDETLGSGT--SFYKL  602
            N   +        +       NG     KS  D  N            +GS T  + YKL
Sbjct  274  NGYSSDWRDEYKREPAPAAGTNGLIDDDKSSFDFKN------------VGSSTDSTIYKL  321

Query  601  EMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCK  422
            E++ ++L S +G Q  ++ +DF+ A  D +A+S  +I++R+K + ++   AL+SLC R K
Sbjct  322  EIMMVELFSIYGKQLMIDPQDFQDAEPDILANSGSEIINRIKENDDQCAMALRSLCHRKK  381

Query  421  GIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQ  242
            G+ VE+ SLI +DSLGID+R  SG + +T+RF+F  +A SE SAE+++  +LFPR + ++
Sbjct  382  GLTVEDASLISIDSLGIDVRAFSGLEARTVRFSFNSQALSERSAEKKIRRMLFPRRKNVK  441

Query  241  QRKEAQ  224
               E +
Sbjct  442  ASTEDE  447



>ref|XP_003564847.1| PREDICTED: uncharacterized protein At3g49140 isoform X3 [Brachypodium 
distachyon]
Length=448

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/239 (36%), Positives = 142/239 (59%), Gaps = 18/239 (8%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMR+ HP++FA+ LT+   D+  + M+ P  G++I G LRPAF+EE   ++         
Sbjct  213  TMRAIHPIYFAKCLTKAIHDNHGEKMDNPSNGVSIVGYLRPAFIEEESYLRSLF------  266

Query  769  NADRNQISKAADCKETT-IVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSF----YK  605
             A+ N   ++++ +E     P++ +     +D D         + ++  +G+S     YK
Sbjct  267  RAECNADGQSSNWREEHHREPVSAYGTNGLIDDDK-------SRIDSSDAGSSMESMIYK  319

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE++ I+L S +G Q  ++ +DF+ A  D + + A  I+ R+K + ++   AL+SLC R 
Sbjct  320  LEIMTIELFSIYGKQLMIDPQDFQDAEPDLLTNYAPDIIKRIKENNDQCTMALRSLCSRK  379

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            KG+ VE  SLIGVDSLGID+R  SG + +T+RF+F  +A SE SAE+++  +LFPR +K
Sbjct  380  KGLAVEGASLIGVDSLGIDVRAFSGLEARTVRFSFNAQALSERSAEKKIRRMLFPRYRK  438



>ref|XP_010322467.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Solanum 
lycopersicum]
Length=465

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 132/233 (57%), Gaps = 26/233 (11%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+         M+ P  G++I G L+PAFLEE   +++  S  + S+    
Sbjct  248  HPVYFAKCLTKAVHMKHAKMMDHPSNGISIWGRLKPAFLEEEYYVRRLFSGDEVSDG---  304

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                  D K+  I+                +++   +K  TL   +S Y+LE++++ L S
Sbjct  305  ---STLDWKDGEIL----------------SFSSRYDKSRTL---SSIYRLEIMRVDLFS  342

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q  V + DF  A  D++ +SA  IL   +  G +   ALK+LC R KG+ VE  +L
Sbjct  343  VYGAQLAVNLYDFHDAEPDSLVYSAPAILEWFRQQGIRCKYALKALC-RKKGLHVERANL  401

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+RV SGT+V T RF FK RA SE +AE+Q+  LLFPR+++ + R
Sbjct  402  IGVDSLGMDVRVLSGTEVWTHRFPFKVRAHSEIAAEKQIRQLLFPRSRRKKFR  454



>ref|XP_004241392.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Solanum 
lycopersicum]
Length=467

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 132/233 (57%), Gaps = 26/233 (11%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+         M+ P  G++I G L+PAFLEE   +++  S  + S+    
Sbjct  250  HPVYFAKCLTKAVHMKHAKMMDHPSNGISIWGRLKPAFLEEEYYVRRLFSGDEVSDG---  306

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                  D K+  I+                +++   +K  TL   +S Y+LE++++ L S
Sbjct  307  ---STLDWKDGEIL----------------SFSSRYDKSRTL---SSIYRLEIMRVDLFS  344

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q  V + DF  A  D++ +SA  IL   +  G +   ALK+LC R KG+ VE  +L
Sbjct  345  VYGAQLAVNLYDFHDAEPDSLVYSAPAILEWFRQQGIRCKYALKALC-RKKGLHVERANL  403

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+RV SGT+V T RF FK RA SE +AE+Q+  LLFPR+++ + R
Sbjct  404  IGVDSLGMDVRVLSGTEVWTHRFPFKVRAHSEIAAEKQIRQLLFPRSRRKKFR  456



>ref|XP_010512181.1| PREDICTED: uncharacterized protein At3g49140-like [Camelina sativa]
Length=461

 Score =   147 bits (372),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 143/243 (59%), Gaps = 29/243 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  + HP++FA+ L++    D    M+ P  G++I G LRPAFL+E   I++       +
Sbjct  240  TSNAVHPIYFAKHLSKAISMDYDRKMDYPSNGVSILGCLRPAFLDEESDIRRLF-----T  294

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S            + G         DNP  +  L +D++  S +S Y+LE++ 
Sbjct  295  SEDRDNYSWE----------VQG--------DDNP--SSSLRRDDSDMS-SSLYRLEIVG  333

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G ++++ ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  334  IELLSLYGAESYISLQDFQDAEPDILVHSTSAIIERFNNRGINSSIALKALCKK-KGLHA  392

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT--QKLQQR  236
            EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFPR+  +KL+  
Sbjct  393  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKIHQLLFPRSRRRKLKSH  452

Query  235  KEA  227
             E+
Sbjct  453  DES  455



>ref|XP_010469340.1| PREDICTED: uncharacterized protein At3g49140-like [Camelina sativa]
Length=461

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 142/243 (58%), Gaps = 29/243 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  + HP++FA+ L++    D    M+ P  G++I G LRPAFL+E   I++       +
Sbjct  240  TSNAVHPIYFAKHLSKAISMDYDRKMDYPSNGVSILGCLRPAFLDEESDIRRLF-----T  294

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S            + G         DNP  +  L +D++  S +S Y+LE++ 
Sbjct  295  SEDRDNYSWE----------VQG--------DDNP--SSSLRRDDSDMS-SSLYRLEIVG  333

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+ +S +G ++++ ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  334  IEFLSLYGAESYISLQDFQDAEPDILVHSTSAIIERFNNRGSNSSIALKALCKK-KGLHA  392

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT--QKLQQR  236
            EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFPR+  +KL+  
Sbjct  393  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKIHQLLFPRSRRRKLKSH  452

Query  235  KEA  227
             E+
Sbjct  453  DES  455



>gb|KCW57667.1| hypothetical protein EUGRSUZ_H00428 [Eucalyptus grandis]
Length=422

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 134/233 (58%), Gaps = 28/233 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  GL+I G LRPAF +E   ++K     ++ +AD +
Sbjct  206  HPVYFAKCLTKAVNAEYDKKMDTPSNGLSILGCLRPAFSDEESYLRKLF---QSEDADNH  262

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
             +    D K+  +V +     K                    G  +  Y+LE+I+I+L S
Sbjct  263  NL----DWKDADVVTLASSDRK--------------------GCNSIIYRLEIIRIELFS  298

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G+Q  + ++DF  A  D + HS   IL R    G +   ALK+LC R KG+ VE  ++
Sbjct  299  VYGSQCEIHLQDFLDAEPDILVHSTSAILDRFSEKGIRCNVALKALCKR-KGLHVEGANI  357

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+R+ SGT+V+T RF FK +A+SE +AE+Q+  LLFPR+++ + R
Sbjct  358  IGVDSLGMDVRIYSGTEVRTHRFPFKIQATSEAAAEKQIQQLLFPRSRRKKLR  410



>ref|XP_010413718.1| PREDICTED: uncharacterized protein At3g49140-like [Camelina sativa]
Length=461

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 138/234 (59%), Gaps = 28/234 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  + HP++FA+ L++    D    M+ P  G++I G LRPAFL+E   I++       +
Sbjct  241  TSNAVHPIYFAKHLSKAISMDYDRKMDYPSNGVSILGCLRPAFLDEESDIRRLF-----T  295

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S                     +  DNP  +  L +D++  S +S Y+LE++ 
Sbjct  296  SEDRDNYSWE-------------------VQGDNP--SSSLRRDDSDMS-SSLYRLEIVG  333

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+++S +G ++++ ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  334  IEILSLYGAESYISLQDFQDAEPDILVHSTSAIIERFNNRGINSSIALKALCKK-KGLHA  392

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFPR+++
Sbjct  393  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKIHQLLFPRSRR  446



>ref|XP_010069338.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Eucalyptus 
grandis]
 gb|KCW57665.1| hypothetical protein EUGRSUZ_H00428 [Eucalyptus grandis]
Length=453

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 134/233 (58%), Gaps = 28/233 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  GL+I G LRPAF +E   ++K     ++ +AD +
Sbjct  237  HPVYFAKCLTKAVNAEYDKKMDTPSNGLSILGCLRPAFSDEESYLRKLF---QSEDADNH  293

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
             +    D K+  +V +     K                    G  +  Y+LE+I+I+L S
Sbjct  294  NL----DWKDADVVTLASSDRK--------------------GCNSIIYRLEIIRIELFS  329

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G+Q  + ++DF  A  D + HS   IL R    G +   ALK+LC R KG+ VE  ++
Sbjct  330  VYGSQCEIHLQDFLDAEPDILVHSTSAILDRFSEKGIRCNVALKALCKR-KGLHVEGANI  388

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+R+ SGT+V+T RF FK +A+SE +AE+Q+  LLFPR+++ + R
Sbjct  389  IGVDSLGMDVRIYSGTEVRTHRFPFKIQATSEAAAEKQIQQLLFPRSRRKKLR  441



>ref|XP_006478864.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Citrus sinensis]
Length=458

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 136/237 (57%), Gaps = 31/237 (13%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM--SDHKTSNAD  761
            HP++F++ LT+  + +    M+ P  GL+I G LRPAF +E   +++Q    D    N+D
Sbjct  241  HPIYFSKCLTKAVNMEYDRKMDHPSNGLSIVGYLRPAFADEESYLRRQFHSEDSDGDNSD  300

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
                                       D + PN++ +  +  T   G++ Y+LE+++I+L
Sbjct  301  WQ-------------------------DGETPNFSSKNGRSNT---GSTLYRLEIMRIEL  332

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
             S +G ++ V ++DF+ A  D + HS   I+      G +   ALK+LC + KG+ VEE 
Sbjct  333  FSVYGIRSPVSLQDFQDAEPDILVHSTSAIIEHFSLKGIRCNGALKALC-KKKGLNVEEA  391

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            +LIGVDSLG+D+RV SG +V+T RF FK RA+SE +AE+Q+  LLFPR+++ + R +
Sbjct  392  NLIGVDSLGMDVRVFSGVEVRTHRFPFKIRATSEVAAEKQIQQLLFPRSRRKKLRSQ  448



>ref|XP_006478863.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Citrus sinensis]
Length=468

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 136/237 (57%), Gaps = 31/237 (13%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM--SDHKTSNAD  761
            HP++F++ LT+  + +    M+ P  GL+I G LRPAF +E   +++Q    D    N+D
Sbjct  251  HPIYFSKCLTKAVNMEYDRKMDHPSNGLSIVGYLRPAFADEESYLRRQFHSEDSDGDNSD  310

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
                                       D + PN++ +  +  T   G++ Y+LE+++I+L
Sbjct  311  WQ-------------------------DGETPNFSSKNGRSNT---GSTLYRLEIMRIEL  342

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
             S +G ++ V ++DF+ A  D + HS   I+      G +   ALK+LC + KG+ VEE 
Sbjct  343  FSVYGIRSPVSLQDFQDAEPDILVHSTSAIIEHFSLKGIRCNGALKALC-KKKGLNVEEA  401

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            +LIGVDSLG+D+RV SG +V+T RF FK RA+SE +AE+Q+  LLFPR+++ + R +
Sbjct  402  NLIGVDSLGMDVRVFSGVEVRTHRFPFKIRATSEVAAEKQIQQLLFPRSRRKKLRSQ  458



>ref|XP_009387059.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=475

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 138/251 (55%), Gaps = 32/251 (13%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQK--------  794
            T+R  HP++FA+ LT+V        ++ P  GL I G LRPAF++E   +++        
Sbjct  235  TLRYIHPLYFAKCLTKVVQTKFGKVVDWPSNGLQIIGCLRPAFIDEESYLRRLFHRDDGD  294

Query  793  -QMSDHKT-SNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSG  620
              +SD +  S  +  Q+++A D  +  ++  +  R  S +                    
Sbjct  295  NYISDWRDESEKEEEQVARAYDLIDGGMLSFDSKRDVSTI-------------------S  335

Query  619  TSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKS  440
            ++ YKLE+I ++L S +G+Q+ + +++F+ A  D +AHSA  I+ R+   G +   ALK+
Sbjct  336  STLYKLEIITVELHSVYGDQSLISLQEFQDAEPDLLAHSASAIIERINEYGLQCNVALKA  395

Query  439  LCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRAS---SEYSAERQLNNL  269
            LC R KG+ VE  +LIG+DSLGID+RV  G + +TLRF F  R S   SE +AE+++  +
Sbjct  396  LCRRKKGLNVEGANLIGIDSLGIDVRVYCGMEARTLRFPFSARVSIAMSESAAEKKIKRM  455

Query  268  LFPRTQKLQQR  236
            LFPR  +   R
Sbjct  456  LFPRYHRKNLR  466



>ref|XP_009387058.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=476

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 138/251 (55%), Gaps = 32/251 (13%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQK--------  794
            T+R  HP++FA+ LT+V        ++ P  GL I G LRPAF++E   +++        
Sbjct  236  TLRYIHPLYFAKCLTKVVQTKFGKVVDWPSNGLQIIGCLRPAFIDEESYLRRLFHRDDGD  295

Query  793  -QMSDHKT-SNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSG  620
              +SD +  S  +  Q+++A D  +  ++  +  R  S +                    
Sbjct  296  NYISDWRDESEKEEEQVARAYDLIDGGMLSFDSKRDVSTI-------------------S  336

Query  619  TSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKS  440
            ++ YKLE+I ++L S +G+Q+ + +++F+ A  D +AHSA  I+ R+   G +   ALK+
Sbjct  337  STLYKLEIITVELHSVYGDQSLISLQEFQDAEPDLLAHSASAIIERINEYGLQCNVALKA  396

Query  439  LCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRAS---SEYSAERQLNNL  269
            LC R KG+ VE  +LIG+DSLGID+RV  G + +TLRF F  R S   SE +AE+++  +
Sbjct  397  LCRRKKGLNVEGANLIGIDSLGIDVRVYCGMEARTLRFPFSARVSIAMSESAAEKKIKRM  456

Query  268  LFPRTQKLQQR  236
            LFPR  +   R
Sbjct  457  LFPRYHRKNLR  467



>ref|XP_002876496.1| hypothetical protein ARALYDRAFT_486397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52755.1| hypothetical protein ARALYDRAFT_486397 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 139/243 (57%), Gaps = 29/243 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ L++    D    M+ P  G++I G LRPAFL+E   I++        
Sbjct  238  TSNGVHPIYFAKHLSKAISMDYDRKMDYPSNGVSILGCLRPAFLDEESYIRRLFL-----  292

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S            + G         DNPN +   ++++     +S Y+LE++ 
Sbjct  293  SEDRDDYSWE----------VQG--------DDNPNTSSRQDENDM---SSSLYRLEIVG  331

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  332  IELLSLYGAESSISLQDFQDAEPDILVHSMSAIIERFNNRGINSSIALKALC-KKKGLHA  390

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT--QKLQQR  236
            EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFPR+  +KL+  
Sbjct  391  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKIHQLLFPRSRRRKLKSH  450

Query  235  KEA  227
             E+
Sbjct  451  DES  453



>ref|XP_007038840.1| Pentatricopeptide repeat superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY23341.1| Pentatricopeptide repeat superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=402

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 96/130 (74%), Gaps = 0/130 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTEV  DDPID+ME P  GLAIQG++RPAF+EEH  IQK MS +++ 
Sbjct  270  TMRSSHPMYFAKKLTEVASDDPIDWMEQPSDGLAIQGLIRPAFVEEHSEIQKHMSSNQSR  329

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D +Q+ K  + K   +  ING  ++ G   D+   +EE EK E   +G+SFYKLE++K
Sbjct  330  SSDTSQVEKVVEDKLEDLGIINGQSNELGWSGDSSTISEEPEKKEISINGSSFYKLEIVK  389

Query  589  IQLISAHGNQ  560
            IQLI+AHG+Q
Sbjct  390  IQLITAHGHQ  399



>ref|XP_007038843.1| Pentatricopeptide repeat superfamily protein, putative isoform 
5 [Theobroma cacao]
 gb|EOY23344.1| Pentatricopeptide repeat superfamily protein, putative isoform 
5 [Theobroma cacao]
Length=404

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 96/130 (74%), Gaps = 0/130 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTEV  DDPID+ME P  GLAIQG++RPAF+EEH  IQK MS +++ 
Sbjct  270  TMRSSHPMYFAKKLTEVASDDPIDWMEQPSDGLAIQGLIRPAFVEEHSEIQKHMSSNQSR  329

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D +Q+ K  + K   +  ING  ++ G   D+   +EE EK E   +G+SFYKLE++K
Sbjct  330  SSDTSQVEKVVEDKLEDLGIINGQSNELGWSGDSSTISEEPEKKEISINGSSFYKLEIVK  389

Query  589  IQLISAHGNQ  560
            IQLI+AHG+Q
Sbjct  390  IQLITAHGHQ  399



>gb|EMS59101.1| hypothetical protein TRIUR3_12121 [Triticum urartu]
Length=678

 Score =   145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/256 (34%), Positives = 139/256 (54%), Gaps = 24/256 (9%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRS HP++FA+ LT+   D+  + ++ P  G++I G LRPAF+EE   ++       ++
Sbjct  415  TMRSIHPIYFAKCLTKAVHDNHGEKIDNPSNGVSIVGYLRPAFIEEESYLRSLFGAECSA  474

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGT---------  617
            +   +    A+    +     +       L +   N  EE  ++    SGT         
Sbjct  475  DGYSSNWRGASQLAHSCFYQSSASIQLFVLIR--VNLTEEYNREPRPASGTNGLIDGDKS  532

Query  616  -------------SFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLK  476
                         + YKLEM+ I+L S +G Q  ++ +DF+ A  D +++ A  I+ R+K
Sbjct  533  KSDINDTESSIDSTIYKLEMMSIELFSVYGKQFMIDPQDFQDAEPDLLSNHASDIIKRVK  592

Query  475  TSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEY  296
               ++   AL+SLC R KG+ VE+ SLIGVDSLGID+R  SG + +T+RF+F  +A SE 
Sbjct  593  EDSDQCTMALRSLCNRKKGLTVEDASLIGVDSLGIDVRAFSGLEARTVRFSFNAQALSER  652

Query  295  SAERQLNNLLFPRTQK  248
            SAE+++  +LFPR +K
Sbjct  653  SAEKKIKRMLFPRYRK  668



>gb|KJB21287.1| hypothetical protein B456_004G1170002 [Gossypium raimondii]
Length=395

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA +LTEV  DDPID+ME P  GLAIQG+LRPAF+EEH  IQK +S +++ 
Sbjct  264  TMHSSHPMYFANKLTEVASDDPIDWMEQPSDGLAIQGLLRPAFIEEHSEIQKHISTNQSR  323

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D++Q+ K    K   +  INGHR+  G  +DN   +EE EK+E   +G+ FYKL+M K
Sbjct  324  SSDKHQVEKVVGDKVEDVSIINGHRNGLGSSKDNST-SEESEKNEISMNGSLFYKLQMSK  382

Query  589  IQLISAHGNQ  560
            IQLI+AHG+Q
Sbjct  383  IQLITAHGHQ  392



>gb|KJB21285.1| hypothetical protein B456_004G1170002 [Gossypium raimondii]
Length=408

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TM SSHPM+FA +LTEV  DDPID+ME P  GLAIQG+LRPAF+EEH  IQK +S +++ 
Sbjct  264  TMHSSHPMYFANKLTEVASDDPIDWMEQPSDGLAIQGLLRPAFIEEHSEIQKHISTNQSR  323

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            ++D++Q+ K    K   +  INGHR+  G  +DN   +EE EK+E   +G+ FYKL+M K
Sbjct  324  SSDKHQVEKVVGDKVEDVSIINGHRNGLGSSKDNST-SEESEKNEISMNGSLFYKLQMSK  382

Query  589  IQLISAHGNQ  560
            IQLI+AHG+Q
Sbjct  383  IQLITAHGHQ  392



>ref|XP_006402701.1| hypothetical protein EUTSA_v10005960mg [Eutrema salsugineum]
 gb|ESQ44154.1| hypothetical protein EUTSA_v10005960mg [Eutrema salsugineum]
Length=459

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 136/238 (57%), Gaps = 27/238 (11%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ L++    D    M+ P  G++I G LRPAFL+E   I++        
Sbjct  238  TSNGVHPIYFAKHLSKAISVDYDRKMDYPSNGVSILGCLRPAFLDEESYIRRLFL-----  292

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S            + G         DNP+ +   E+++     +S Y+LE++ 
Sbjct  293  SEDRDDYSWD----------VQG--------DDNPSTSSRREENDM---SSSLYRLEIVG  331

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  332  IELLSLYGAESSISLQDFQDAEPDILVHSTSAIIERFNNRGINSSIALKALC-KKKGLHA  390

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            EE +LI VDSLG+D+RV +G QVQT RF FK RA +E +AE++++ LLFPR+++ + +
Sbjct  391  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRAMTEIAAEKKIHQLLFPRSRRRKMK  448



>ref|XP_004152092.1| PREDICTED: uncharacterized protein At3g49140 [Cucumis sativus]
 gb|KGN53114.1| hypothetical protein Csa_4G017020 [Cucumis sativus]
Length=446

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 134/233 (58%), Gaps = 25/233 (11%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ L +V + +    M+ P  G++I G LRPA+ +E   I++     ++   +  
Sbjct  227  HPVYFAKCLKKVINMEYDRNMKHPSNGVSILGCLRPAYADEESYIRRLFYFEESEGYNTE  286

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                                   GL+ +  N   ++++       ++ Y+LE+++I+L S
Sbjct  287  W---------------------KGLEGETSNLESKIDRS---SQRSTLYRLEIMRIELFS  322

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ V ++DF+ A  D + HS  +IL R    G K   ALK+LC + +G+ VE+  L
Sbjct  323  VYGVQSEVSLQDFQDAEPDILLHSTAEILERFNEKGIKCNIALKALC-KKRGLHVEDAIL  381

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+RVC GT+V+T RF FK RA+SE +AE+Q+  LLFPR+++ + R
Sbjct  382  IGVDSLGMDVRVCVGTEVRTFRFPFKIRATSEAAAEKQIQQLLFPRSRRKKLR  434



>ref|XP_008453945.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Cucumis 
melo]
Length=439

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 134/233 (58%), Gaps = 25/233 (11%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ L +V + +    M+ P  G+AI G LRP + +E   +++  +  ++   +  
Sbjct  220  HPVYFAKCLNKVVNVEYDRNMKHPSNGVAILGYLRPTYADEESYVRRLFNFEESEGYNTE  279

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                                   GL+ +  N   ++++       ++ Y+LE+++I+L S
Sbjct  280  W---------------------KGLEGETSNLEFKIDRS---SQRSTLYRLEILRIELFS  315

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ V ++DF+ A  D + HS  +IL R    G K   ALK+LC + +G+ VE+  L
Sbjct  316  VYGVQSEVSLQDFQDAEPDILLHSTEQILERFNEKGIKCNIALKALC-KKRGLHVEDAIL  374

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+RVC GT+V+T RF FK RA+SE +AE+Q+  LLFPR+++ + R
Sbjct  375  IGVDSLGVDVRVCFGTEVRTFRFPFKIRATSEVAAEKQIQQLLFPRSRRKKLR  427



>ref|XP_008453943.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Cucumis 
melo]
 ref|XP_008453944.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Cucumis 
melo]
Length=446

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 134/233 (58%), Gaps = 25/233 (11%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ L +V + +    M+ P  G+AI G LRP + +E   +++  +  ++   +  
Sbjct  227  HPVYFAKCLNKVVNVEYDRNMKHPSNGVAILGYLRPTYADEESYVRRLFNFEESEGYNTE  286

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                                   GL+ +  N   ++++       ++ Y+LE+++I+L S
Sbjct  287  W---------------------KGLEGETSNLEFKIDRS---SQRSTLYRLEILRIELFS  322

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ V ++DF+ A  D + HS  +IL R    G K   ALK+LC + +G+ VE+  L
Sbjct  323  VYGVQSEVSLQDFQDAEPDILLHSTEQILERFNEKGIKCNIALKALC-KKRGLHVEDAIL  381

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+RVC GT+V+T RF FK RA+SE +AE+Q+  LLFPR+++ + R
Sbjct  382  IGVDSLGVDVRVCFGTEVRTFRFPFKIRATSEVAAEKQIQQLLFPRSRRKKLR  434



>ref|XP_010912142.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At3g49140 
[Elaeis guineensis]
Length=486

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 138/255 (54%), Gaps = 36/255 (14%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQK--------  794
            T+R  HPM+F + L++  +      M+ P  GL+I G LRPAF++E   +++        
Sbjct  242  TLRWIHPMYFTKCLSKAVNTKQERKMDWPSNGLSIVGCLRPAFIDEESYLRRLFHRNDGD  301

Query  793  -QMSDHKTSN---ADRN-----QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEK  641
              +SD + S    AD +     Q++   D  ++ I+  N                    K
Sbjct  302  GYISDWRVSYQNPADESEKEEEQVAGTYDLVDSEILRFN-------------------SK  342

Query  640  DETLGSGTSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEK  461
             +     ++ YKLE++ ++L S +GNQ  + ++DF+ A  D +A SA  I+ R+   G +
Sbjct  343  GDGGNISSTLYKLEIMSMELHSVYGNQCMISLQDFQDAEPDVLARSASAIMERINEYGLQ  402

Query  460  TIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQ  281
               AL+SLC R KG+ VE  +LIGVDSLG+D+RV SG +VQT+RF+F  RA SE +AE++
Sbjct  403  CNVALRSLCRRRKGLIVERGNLIGVDSLGMDVRVFSGMEVQTIRFSFNARAISESAAEKK  462

Query  280  LNNLLFPRTQKLQQR  236
            +  +LFP   +   R
Sbjct  463  IKRMLFPHYHRKNLR  477



>gb|EEE55821.1| hypothetical protein OsJ_04424 [Oryza sativa Japonica Group]
Length=474

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/270 (34%), Positives = 146/270 (54%), Gaps = 38/270 (14%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTE--------------------------VXDDDPIDFMELPPAGLA  848
            TMR+ HP++FA+ LT+                             D   + M+ P  G++
Sbjct  214  TMRAIHPIYFAKCLTKGAKSLSSGNKSKSLDLNLILQKGKKKAVHDKHREKMDSPSNGVS  273

Query  847  IQGILRPAFLEEHVVIQKQMSDHKTSNADRNQISKAADCKETTIVPINGHRHKSGLDQDN  668
            I G LRPAF+EE   ++     H   N D        +CK     P +G    +GL  D+
Sbjct  274  IVGYLRPAFIEEESYLRSLF--HGECNGDGYSSDWRDECKREP-APASG---TNGLIDDD  327

Query  667  PNWAEELEKDETLGSGT--SFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVK  494
             +  +       +GS T  + YKLE++ ++L S +G Q  ++ +DF+ A  D +A+SA +
Sbjct  328  KSRFDFT----NVGSSTDSTIYKLEIMTVELFSIYGKQLMIDPQDFQDAEPDILANSASE  383

Query  493  ILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKK  314
            I++R+K + ++   AL+SLC R KG+ VEE SLI +DSLGID+R  SG + +T+RF+F  
Sbjct  384  IINRIKENDDQCAMALRSLCHRKKGLTVEEASLISIDSLGIDVRAFSGLEARTVRFSFNA  443

Query  313  RASSEYSAERQLNNLLFPRTQKLQQRKEAQ  224
            +A SE SAE+++  +LFPR + ++   E +
Sbjct  444  QALSERSAEKKIRRMLFPRRKNVKPSTEDE  473



>gb|EEC71966.1| hypothetical protein OsI_04801 [Oryza sativa Indica Group]
Length=474

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/270 (34%), Positives = 146/270 (54%), Gaps = 38/270 (14%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTE--------------------------VXDDDPIDFMELPPAGLA  848
            TMR+ HP++FA+ LT+                             D   + M+ P  G++
Sbjct  214  TMRAIHPIYFAKCLTKGAKSLSSGNKSKSPDLNLILQKGKKKAVHDKHREKMDSPSNGVS  273

Query  847  IQGILRPAFLEEHVVIQKQMSDHKTSNADRNQISKAADCKETTIVPINGHRHKSGLDQDN  668
            I G LRPAF+EE   ++     H   N D        +CK     P +G    +GL  D+
Sbjct  274  IVGYLRPAFIEEESYLRSLF--HGECNGDGYSSDWRDECKREP-APASG---TNGLIDDD  327

Query  667  PNWAEELEKDETLGSGT--SFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVK  494
             +  +       +GS T  + YKLE++ ++L S +G Q  ++ +DF+ A  D +A+SA +
Sbjct  328  KSRFDFT----NVGSSTDSTIYKLEIMTVELFSIYGKQLMIDPQDFQDAEPDILANSASE  383

Query  493  ILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKK  314
            I++R+K + ++   AL+SLC R KG+ VEE SLI +DSLGID+R  SG + +T+RF+F  
Sbjct  384  IINRIKENDDQCAMALRSLCHRKKGLTVEEASLISIDSLGIDVRAFSGLEARTVRFSFNA  443

Query  313  RASSEYSAERQLNNLLFPRTQKLQQRKEAQ  224
            +A SE SAE+++  +LFPR + ++   E +
Sbjct  444  QALSERSAEKKIRRMLFPRRKNVKPSTEDE  473



>emb|CAB91600.1| putative protein [Arabidopsis thaliana]
Length=452

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 134/234 (57%), Gaps = 27/234 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ L++    D    M+ P  G++I G LRPAFL+E   I++        
Sbjct  231  TSNGVHPIYFAKHLSKAISMDYDRKMDYPSNGVSILGCLRPAFLDEESYIRRLFL-----  285

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S            + G         DNP  +   ++++     +S Y+LE++ 
Sbjct  286  SEDRDDYSWE----------VQG--------DDNPITSSRRDENDM---SSSLYRLEIVG  324

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  325  IELLSLYGAESSISLQDFQDAEPDILVHSTSAIIERFNNRGINSSIALKALCKK-KGLHA  383

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFPR+++
Sbjct  384  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKIHQLLFPRSRR  437



>ref|XP_007223038.1| hypothetical protein PRUPE_ppa005374mg [Prunus persica]
 gb|EMJ24237.1| hypothetical protein PRUPE_ppa005374mg [Prunus persica]
Length=464

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 135/248 (54%), Gaps = 37/248 (15%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP++FA+ LT+V + +    M+ P  G++I G LRPAF +E   +++        
Sbjct  242  TSSSIHPIYFAKCLTKVINIEYHKKMDHPSNGVSILGCLRPAFADEEFYVRRLF------  295

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAE-----ELEKDETLGSGTSFYK  605
                                     H    D  N +W +        K + + + ++ Y+
Sbjct  296  -------------------------HYEDSDGYNSDWKDGKSLSLSSKSDRIKTCSTLYR  330

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE+++I+L S +G Q+ + +EDF+ A  D + ++ ++I+ R    G +   ALK+LC R 
Sbjct  331  LEIMRIELFSVYGVQSTISLEDFQDAEPDVLVNATLEIVDRFNERGIRCDVALKALCKR-  389

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKL  245
            KG+ VE   LIGVDSLG+D+RV SG +VQT RF FK RA+SE +AE+Q+  LLFPR+++ 
Sbjct  390  KGLHVEGAHLIGVDSLGMDVRVFSGLEVQTHRFPFKVRATSEVAAEKQIQQLLFPRSRRK  449

Query  244  QQRKEAQQ  221
            + + +   
Sbjct  450  KLKSQGNN  457



>ref|NP_567080.1| pentatricopeptide repeat-containing protein-like protein [Arabidopsis 
thaliana]
 gb|AAK92800.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14144.1| unknown protein [Arabidopsis thaliana]
 gb|AEE79901.1| pentatricopeptide repeat-containing protein-like protein [Arabidopsis 
thaliana]
Length=459

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 134/234 (57%), Gaps = 27/234 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ L++    D    M+ P  G++I G LRPAFL+E   I++        
Sbjct  238  TSNGVHPIYFAKHLSKAISMDYDRKMDYPSNGVSILGCLRPAFLDEESYIRRLFL-----  292

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S            + G         DNP  +   ++++     +S Y+LE++ 
Sbjct  293  SEDRDDYSWE----------VQG--------DDNPITSSRRDENDM---SSSLYRLEIVG  331

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  332  IELLSLYGAESSISLQDFQDAEPDILVHSTSAIIERFNNRGINSSIALKALCKK-KGLHA  390

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFPR+++
Sbjct  391  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKIHQLLFPRSRR  444



>emb|CDX98363.1| BnaC06g17240D [Brassica napus]
Length=444

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/243 (35%), Positives = 139/243 (57%), Gaps = 27/243 (11%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ +++    D    M+ P  G++I G LRPAFL+E   I++        
Sbjct  221  TSNGVHPIYFAKHMSKAISMDYEKKMDCPSNGVSILGCLRPAFLDEESYIRRLFL-----  275

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S          + + G       D +N + +   E+++   SG   Y+LE++ 
Sbjct  276  SEDRDDYS----------LEVQG-------DDNNTSTSSRHEENDMSSSG--LYRLEIVG  316

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G +  + ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  317  IELLSLYGTEFSISLQDFQDAEPDILVHSTSTIIERFNNRGISSGIALKALCKK-KGLHA  375

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP--RTQKLQQR  236
            EE +LI VDSLG+D+RV SG +VQT RF FK RA++E +AE++++ LLFP  R +KL+  
Sbjct  376  EEANLISVDSLGMDVRVFSGAKVQTHRFPFKTRATTEMAAEKKIHQLLFPPSRRRKLKSN  435

Query  235  KEA  227
            +E+
Sbjct  436  EES  438



>ref|XP_010069337.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57666.1| hypothetical protein EUGRSUZ_H00428 [Eucalyptus grandis]
Length=459

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 85/239 (36%), Positives = 134/239 (56%), Gaps = 34/239 (14%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  GL+I G LRPAF +E   ++K     ++ +AD +
Sbjct  237  HPVYFAKCLTKAVNAEYDKKMDTPSNGLSILGCLRPAFSDEESYLRKLF---QSEDADNH  293

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
             +    D K+  +V +     K                    G  +  Y+LE+I+I+L S
Sbjct  294  NL----DWKDADVVTLASSDRK--------------------GCNSIIYRLEIIRIELFS  329

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVE----  407
             +G+Q  + ++DF  A  D + HS   IL R    G +   ALK+LC R KG+ VE    
Sbjct  330  VYGSQCEIHLQDFLDAEPDILVHSTSAILDRFSEKGIRCNVALKALCKR-KGLHVEVKET  388

Query  406  --EVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
                ++IGVDSLG+D+R+ SGT+V+T RF FK +A+SE +AE+Q+  LLFPR+++ + R
Sbjct  389  ASGANIIGVDSLGMDVRIYSGTEVRTHRFPFKIQATSEAAAEKQIQQLLFPRSRRKKLR  447



>ref|XP_008222586.1| PREDICTED: uncharacterized protein At3g49140 isoform X3 [Prunus 
mume]
Length=407

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 133/248 (54%), Gaps = 37/248 (15%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP++FA+ LT+V + +    M+ P  G++I G LRPAF +E   +++        
Sbjct  185  TSSSIHPIYFAKCLTKVINIEYHKKMDHPSNGVSILGCLRPAFADEEFYVRRLF------  238

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAE-----ELEKDETLGSGTSFYK  605
                                     H    D  N +W +        K +   + ++ Y+
Sbjct  239  -------------------------HYEDSDGYNSDWKDGKSLSLSSKSDRSKTCSTLYR  273

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE+++I+L S +G Q+ + +EDF+ A  D + ++  +I+ R    G +   ALK+LC R 
Sbjct  274  LEIMRIELFSVYGVQSTISLEDFQDAEPDVLVNATSEIVDRFNERGIRCDVALKALCKR-  332

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKL  245
            KG+ VE   LIGVDSLG+D+RV SG +VQT RF FK RA+SE +AE+Q+  LLFPR+++ 
Sbjct  333  KGLHVEGAHLIGVDSLGMDVRVFSGLEVQTHRFPFKVRATSEVAAEKQIQQLLFPRSRRK  392

Query  244  QQRKEAQQ  221
            + + +   
Sbjct  393  KLKSKGHN  400



>emb|CDY57496.1| BnaC08g48890D [Brassica napus]
Length=457

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/243 (34%), Positives = 134/243 (55%), Gaps = 29/243 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ +++    +    M+ P  G++I   LRPAFL+E   I++        
Sbjct  236  TSNGVHPIYFAKHMSKAISMNYDRKMDYPSNGVSILACLRPAFLDEESYIRRLF-----L  290

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S      E                  NPN +    +D+     +S Y+LE++ 
Sbjct  291  SEDRDDYSWEVQGDE------------------NPNAS---SRDDENDMSSSLYRLEIVG  329

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  330  IELLSLYGTESSISLQDFQDAEPDILVHSTSAIIERFNNRGVSSDIALKALC-KKKGLHA  388

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT--QKLQQR  236
            EE +LI VDSLG+D+RV +G  VQT RF FK RA++E +AE++++ LLFPR+  +KL+  
Sbjct  389  EEANLISVDSLGMDVRVFAGAHVQTHRFPFKTRATTEMAAEKKMHQLLFPRSRRRKLKSN  448

Query  235  KEA  227
             E+
Sbjct  449  DES  451



>gb|KJB61306.1| hypothetical protein B456_009G350800 [Gossypium raimondii]
Length=275

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 130/229 (57%), Gaps = 27/229 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ L +    +    M+ P  G++I G LRPAF +E   +++        + D +
Sbjct  59   HPIYFAKCLMKAVHVEHDRKMDHPSNGVSIVGCLRPAFADEESYLRRLF------HFDYD  112

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
            +    +D K                D + P  + +    +   SG+  Y+LE+++I+L S
Sbjct  113  E-GYTSDWK----------------DGEAPKPSSKYGGSK---SGSILYRLEIMQIELFS  152

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ + ++DF+ A  D + HS   IL R    G     ALKSLC + KG+Q+EE +L
Sbjct  153  VYGAQSLISLKDFQDAEPDVLVHSTSAILERFSEKGIWCNVALKSLC-KKKGLQIEEANL  211

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            IGVDSLGID+R+ SG +V+T RF FK RA SE +AE+++  LLFPR+++
Sbjct  212  IGVDSLGIDVRIFSGVEVRTCRFPFKIRAMSEAAAEKKIRQLLFPRSRR  260



>ref|XP_008222584.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Prunus 
mume]
Length=463

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 133/248 (54%), Gaps = 37/248 (15%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP++FA+ LT+V + +    M+ P  G++I G LRPAF +E   +++        
Sbjct  241  TSSSIHPIYFAKCLTKVINIEYHKKMDHPSNGVSILGCLRPAFADEEFYVRRLF------  294

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAE-----ELEKDETLGSGTSFYK  605
                                     H    D  N +W +        K +   + ++ Y+
Sbjct  295  -------------------------HYEDSDGYNSDWKDGKSLSLSSKSDRSKTCSTLYR  329

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE+++I+L S +G Q+ + +EDF+ A  D + ++  +I+ R    G +   ALK+LC R 
Sbjct  330  LEIMRIELFSVYGVQSTISLEDFQDAEPDVLVNATSEIVDRFNERGIRCDVALKALCKR-  388

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKL  245
            KG+ VE   LIGVDSLG+D+RV SG +VQT RF FK RA+SE +AE+Q+  LLFPR+++ 
Sbjct  389  KGLHVEGAHLIGVDSLGMDVRVFSGLEVQTHRFPFKVRATSEVAAEKQIQQLLFPRSRRK  448

Query  244  QQRKEAQQ  221
            + + +   
Sbjct  449  KLKSKGHN  456



>ref|XP_008222585.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Prunus 
mume]
Length=459

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 133/248 (54%), Gaps = 37/248 (15%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP++FA+ LT+V + +    M+ P  G++I G LRPAF +E   +++        
Sbjct  237  TSSSIHPIYFAKCLTKVINIEYHKKMDHPSNGVSILGCLRPAFADEEFYVRRLF------  290

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAE-----ELEKDETLGSGTSFYK  605
                                     H    D  N +W +        K +   + ++ Y+
Sbjct  291  -------------------------HYEDSDGYNSDWKDGKSLSLSSKSDRSKTCSTLYR  325

Query  604  LEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRC  425
            LE+++I+L S +G Q+ + +EDF+ A  D + ++  +I+ R    G +   ALK+LC R 
Sbjct  326  LEIMRIELFSVYGVQSTISLEDFQDAEPDVLVNATSEIVDRFNERGIRCDVALKALCKR-  384

Query  424  KGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKL  245
            KG+ VE   LIGVDSLG+D+RV SG +VQT RF FK RA+SE +AE+Q+  LLFPR+++ 
Sbjct  385  KGLHVEGAHLIGVDSLGMDVRVFSGLEVQTHRFPFKVRATSEVAAEKQIQQLLFPRSRRK  444

Query  244  QQRKEAQQ  221
            + + +   
Sbjct  445  KLKSKGHN  452



>emb|CDY06013.1| BnaA09g37670D [Brassica napus]
Length=457

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 133/252 (53%), Gaps = 47/252 (19%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ +++    D    M+ P  G++I   LRPAFL+E   I+         
Sbjct  236  TSNGVHPIYFAKHMSKAISMDYDRKMDYPSNGVSILACLRPAFLDEESYIRSLF------  289

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGS---------GT  617
                                         L +D  +++ E++ DE   +          +
Sbjct  290  -----------------------------LSEDRDDYSWEVQGDENQNTSSRDDENDMSS  320

Query  616  SFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSL  437
            S Y+LE++ I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+L
Sbjct  321  SLYRLEIVGIELLSLYGTESSISLQDFQDAEPDILVHSTSAIIERFNNRGVSSDIALKAL  380

Query  436  CWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPR  257
            C + KG+  EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFPR
Sbjct  381  C-KKKGLHAEEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKMHQLLFPR  439

Query  256  T--QKLQQRKEA  227
            +  +KL+   E+
Sbjct  440  SRRRKLKSNDES  451



>ref|XP_009363688.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009337441.1| PREDICTED: uncharacterized protein At3g49140-like isoform X1 
[Pyrus x bretschneideri]
Length=449

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 127/236 (54%), Gaps = 34/236 (14%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP+ FA+ LT+  D++    M+ P  G++I G LRPAF +E   +++  +   + 
Sbjct  232  TCSSIHPICFAKYLTKAIDNEYNRKMDHPSNGVSILGCLRPAFADEEFYVRRLFNYEDS-  290

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNW--AEELEKDETLGSGTSFYKLEM  596
                                          D  N +W   + +         ++ Y+LE+
Sbjct  291  ------------------------------DGYNSDWKDGKSVSLSSESDRSSTLYRLEI  320

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            ++I+L S +G Q+ + + DF+ A  D + +S  +I+ R    G +   ALK+LC R KG+
Sbjct  321  MRIELFSVYGVQSTISLHDFQDAEPDVLVNSTSEIVERFSERGIRCDVALKALCKR-KGL  379

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
             VE   LIGVDSLG+D+RV SG +VQT RF FK RA+SE +AE+Q+  LLFPR+++
Sbjct  380  HVEGAHLIGVDSLGMDVRVFSGLEVQTHRFPFKVRATSEVAAEKQIQQLLFPRSRR  435



>ref|XP_010525800.1| PREDICTED: uncharacterized protein At3g49140 [Tarenaya hassleriana]
Length=465

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/243 (34%), Positives = 131/243 (54%), Gaps = 29/243 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+RL +    D    M+ P  G++I G LRPAFL+E   I++        + D  
Sbjct  248  HPVYFAKRLAKAISMDYDRKMDYPSNGVSILGCLRPAFLDEESYIRRLFIPEDRDDYDWE  307

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                                       DNP+ +   +  +     ++ Y+LE+++I+L S
Sbjct  308  SQG-----------------------DDNPSSSSRYDGHDM---SSTLYRLEIVRIELSS  341

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ V ++DF+ A  D + HS   I+ R    G     ALK+LC + KG+QVE  +L
Sbjct  342  IYGIQSSVSLQDFQDAEPDILVHSTSAIIDRFNKKGINCNMALKALCKK-KGLQVEGANL  400

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRT--QKLQQRKEAQQ  221
            I +DSLG+D+RV +G +VQT RF FK RA +E +AE+++  LLFPR+  +KL+  ++  +
Sbjct  401  ISIDSLGMDVRVFTGVEVQTHRFPFKARALTEIAAEKKIQQLLFPRSLRRKLKSHRDGLK  460

Query  220  AES  212
              S
Sbjct  461  DTS  463



>ref|XP_009363689.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009337442.1| PREDICTED: uncharacterized protein At3g49140-like isoform X2 
[Pyrus x bretschneideri]
Length=445

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 127/236 (54%), Gaps = 34/236 (14%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP+ FA+ LT+  D++    M+ P  G++I G LRPAF +E   +++  +   + 
Sbjct  228  TCSSIHPICFAKYLTKAIDNEYNRKMDHPSNGVSILGCLRPAFADEEFYVRRLFNYEDS-  286

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNW--AEELEKDETLGSGTSFYKLEM  596
                                          D  N +W   + +         ++ Y+LE+
Sbjct  287  ------------------------------DGYNSDWKDGKSVSLSSESDRSSTLYRLEI  316

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            ++I+L S +G Q+ + + DF+ A  D + +S  +I+ R    G +   ALK+LC R KG+
Sbjct  317  MRIELFSVYGVQSTISLHDFQDAEPDVLVNSTSEIVERFSERGIRCDVALKALCKR-KGL  375

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
             VE   LIGVDSLG+D+RV SG +VQT RF FK RA+SE +AE+Q+  LLFPR+++
Sbjct  376  HVEGAHLIGVDSLGMDVRVFSGLEVQTHRFPFKVRATSEVAAEKQIQQLLFPRSRR  431



>ref|XP_009104199.1| PREDICTED: uncharacterized protein At3g49140 [Brassica rapa]
Length=460

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 137/243 (56%), Gaps = 29/243 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ +++    D    M+ P  G++I G LRPAFL+E   I++        
Sbjct  239  TSNGVHPIYFAKHMSKAISMDYEKKMDCPSNGVSILGCLRPAFLDEEFYIRRLFL-----  293

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S            + G         DN + +   ++D+     +S Y+LE++ 
Sbjct  294  SEDRDDYSWE----------VQG--------DDNTSTSSRRDEDDMT---SSVYRLEIVG  332

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  333  IELLSLYGTESSISLQDFQDAEPDVLVHSTSAIIERFNNRGISSGIALKALC-KKKGLHA  391

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP--RTQKLQQR  236
            EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFP  R +KL+  
Sbjct  392  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKIHQLLFPPSRRRKLKSN  451

Query  235  KEA  227
             ++
Sbjct  452  DKS  454



>ref|XP_008372047.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Malus 
domestica]
 ref|XP_008372048.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Malus 
domestica]
Length=459

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/236 (35%), Positives = 128/236 (54%), Gaps = 34/236 (14%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP+ FA+ LT+  D++    M+ P  G++I G LRPAF +E   +++  +     
Sbjct  232  TCSSIHPICFAKYLTKAIDNEYNRKMDHPSNGVSILGCLRPAFADEEFYVRRLFN-----  286

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNW--AEELEKDETLGSGTSFYKLEM  596
                              V  +G+         N +W   + +         ++ Y+LE+
Sbjct  287  -----------------YVDSDGY---------NSDWKDGKSVSLSSESDRSSTLYRLEI  320

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            ++I+L S +G Q+ + + DF+ A  D + +S  +I+ R    G +   ALK LC R KG+
Sbjct  321  MRIELFSVYGVQSTISLHDFQDAEPDVLVNSTSEIVERFSERGIRCDVALKDLCKR-KGL  379

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
             VE   LIGVDSLG+D+RV SG +VQT RF FK RA+SE +AE+Q+  LLFPR+++
Sbjct  380  HVEGAHLIGVDSLGMDVRVFSGLEVQTHRFPFKVRATSEVAAEKQIQQLLFPRSRR  435



>emb|CDX67791.1| BnaA07g18310D [Brassica napus]
Length=460

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 137/243 (56%), Gaps = 29/243 (12%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ +++    D    M+ P  G++I G LRPAFL+E   I++        
Sbjct  239  TSNGVHPIYFAKHMSKAISMDYEKKMDCPSNGVSILGCLRPAFLDEESYIRRLFL-----  293

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
            + DR+  S            + G         DN + +   ++D+     +S Y+LE++ 
Sbjct  294  SEDRDDYSWE----------VQG--------DDNTSTSSRRDEDDM---SSSVYRLEIVG  332

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+LC + KG+  
Sbjct  333  IELLSLYGTESSISLQDFQDAEPDVLVHSTSAIIERFNNRGISSGIALKALC-KKKGLHA  391

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP--RTQKLQQR  236
            EE +LI VDSLG+D+RV +G QVQT RF FK RA++E +AE++++ LLFP  R +KL+  
Sbjct  392  EEANLISVDSLGMDVRVFAGAQVQTHRFPFKTRATTEMAAEKKIHQLLFPPSRRRKLKSN  451

Query  235  KEA  227
             ++
Sbjct  452  DKS  454



>ref|XP_008372049.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Malus 
domestica]
Length=455

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/236 (35%), Positives = 128/236 (54%), Gaps = 34/236 (14%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP+ FA+ LT+  D++    M+ P  G++I G LRPAF +E   +++  +     
Sbjct  228  TCSSIHPICFAKYLTKAIDNEYNRKMDHPSNGVSILGCLRPAFADEEFYVRRLFN-----  282

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNW--AEELEKDETLGSGTSFYKLEM  596
                              V  +G+         N +W   + +         ++ Y+LE+
Sbjct  283  -----------------YVDSDGY---------NSDWKDGKSVSLSSESDRSSTLYRLEI  316

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            ++I+L S +G Q+ + + DF+ A  D + +S  +I+ R    G +   ALK LC R KG+
Sbjct  317  MRIELFSVYGVQSTISLHDFQDAEPDVLVNSTSEIVERFSERGIRCDVALKDLCKR-KGL  375

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
             VE   LIGVDSLG+D+RV SG +VQT RF FK RA+SE +AE+Q+  LLFPR+++
Sbjct  376  HVEGAHLIGVDSLGMDVRVFSGLEVQTHRFPFKVRATSEVAAEKQIQQLLFPRSRR  431



>gb|KJB61300.1| hypothetical protein B456_009G350800 [Gossypium raimondii]
Length=410

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 130/229 (57%), Gaps = 27/229 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ L +    +    M+ P  G++I G LRPAF +E   +++        + D +
Sbjct  194  HPIYFAKCLMKAVHVEHDRKMDHPSNGVSIVGCLRPAFADEESYLRRLF------HFDYD  247

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
            +    +D K                D + P  + +    +   SG+  Y+LE+++I+L S
Sbjct  248  E-GYTSDWK----------------DGEAPKPSSKYGGSK---SGSILYRLEIMQIELFS  287

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ + ++DF+ A  D + HS   IL R    G     ALKSLC + KG+Q+EE +L
Sbjct  288  VYGAQSLISLKDFQDAEPDVLVHSTSAILERFSEKGIWCNVALKSLC-KKKGLQIEEANL  346

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            IGVDSLGID+R+ SG +V+T RF FK RA SE +AE+++  LLFPR+++
Sbjct  347  IGVDSLGIDVRIFSGVEVRTCRFPFKIRAMSEAAAEKKIRQLLFPRSRR  395



>gb|KJB61305.1| hypothetical protein B456_009G350800 [Gossypium raimondii]
Length=396

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 130/229 (57%), Gaps = 27/229 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ L +    +    M+ P  G++I G LRPAF +E   +++        + D +
Sbjct  180  HPIYFAKCLMKAVHVEHDRKMDHPSNGVSIVGCLRPAFADEESYLRRLF------HFDYD  233

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
            +    +D K                D + P  + +    +   SG+  Y+LE+++I+L S
Sbjct  234  E-GYTSDWK----------------DGEAPKPSSKYGGSK---SGSILYRLEIMQIELFS  273

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ + ++DF+ A  D + HS   IL R    G     ALKSLC + KG+Q+EE +L
Sbjct  274  VYGAQSLISLKDFQDAEPDVLVHSTSAILERFSEKGIWCNVALKSLC-KKKGLQIEEANL  332

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            IGVDSLGID+R+ SG +V+T RF FK RA SE +AE+++  LLFPR+++
Sbjct  333  IGVDSLGIDVRIFSGVEVRTCRFPFKIRAMSEAAAEKKIRQLLFPRSRR  381



>ref|XP_009116591.1| PREDICTED: uncharacterized protein At3g49140-like [Brassica rapa]
Length=457

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 133/252 (53%), Gaps = 47/252 (19%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T    HP++FA+ +++    D    M+ P  G++I   LRPAFL+E   I++        
Sbjct  236  TSNGVHPIYFAKHMSKAISMDYDRKMDYPSNGVSILACLRPAFLDEESYIRRLF------  289

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGS---------GT  617
                                         L +D  +++ E++ DE   +          +
Sbjct  290  -----------------------------LSEDRDDYSWEVQGDENQNTSSRDDENDMSS  320

Query  616  SFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSL  437
            S Y+LE++ I+L+S +G ++ + ++DF+ A  D + HS   I+ R    G  +  ALK+L
Sbjct  321  SLYRLEIVGIELLSLYGTESSISLQDFQDAEPDILVHSTSAIIERFNNRGVSSDIALKAL  380

Query  436  CWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPR  257
            C + KG+  EE +LI VDSLG+D+R  +G QVQT RF FK RA++E +AE++++ LLFPR
Sbjct  381  C-KKKGLHAEEANLISVDSLGMDVRGFAGAQVQTHRFPFKTRATTEMAAEKKMHQLLFPR  439

Query  256  T--QKLQQRKEA  227
            +  +KL+   E+
Sbjct  440  SRRRKLKSNDES  451



>gb|KJB61301.1| hypothetical protein B456_009G350800 [Gossypium raimondii]
Length=466

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 130/229 (57%), Gaps = 27/229 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ L +    +    M+ P  G++I G LRPAF +E   +++        + D +
Sbjct  250  HPIYFAKCLMKAVHVEHDRKMDHPSNGVSIVGCLRPAFADEESYLRRLF------HFDYD  303

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
            +    +D K                D + P  + +    +   SG+  Y+LE+++I+L S
Sbjct  304  E-GYTSDWK----------------DGEAPKPSSKYGGSK---SGSILYRLEIMQIELFS  343

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ + ++DF+ A  D + HS   IL R    G     ALKSLC + KG+Q+EE +L
Sbjct  344  VYGAQSLISLKDFQDAEPDVLVHSTSAILERFSEKGIWCNVALKSLC-KKKGLQIEEANL  402

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            IGVDSLGID+R+ SG +V+T RF FK RA SE +AE+++  LLFPR+++
Sbjct  403  IGVDSLGIDVRIFSGVEVRTCRFPFKIRAMSEAAAEKKIRQLLFPRSRR  451



>ref|XP_008802365.1| PREDICTED: uncharacterized protein At3g49140 isoform X4 [Phoenix 
dactylifera]
Length=470

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/248 (35%), Positives = 133/248 (54%), Gaps = 38/248 (15%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQK--------  794
            T+R  HPM+FA+ L++  +      M+ P  GL+I G LRPAF++E   +++        
Sbjct  242  TLRWVHPMYFAKCLSKAVNTKQERKMDRPSNGLSIVGCLRPAFIDEESYLRRLFHSNDGD  301

Query  793  -QMSDHKT-SNADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSG  620
              MSD +  S  +  Q++   D  +  ++     R  S  D  N +              
Sbjct  302  DYMSDWRDESEKEEEQVAGTYDLVDGEML-----RFNSKYDGGNIS--------------  342

Query  619  TSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKS  440
            ++ YKLE++ ++L S +G Q          A  D +AHSA  I+ R    G +   AL+S
Sbjct  343  STLYKLEIMSMELHSVYGGQD---------AEPDVLAHSASAIIERSNEYGVQCNAALRS  393

Query  439  LCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP  260
            LC R KG+ VE  +LIGVDSLG+D+RV SG + QT+RF+F  RA+SE +AE+++  +LFP
Sbjct  394  LCRRRKGLVVERANLIGVDSLGMDVRVFSGMEAQTIRFSFNARATSESAAEKKIKRMLFP  453

Query  259  RTQKLQQR  236
            R  + + R
Sbjct  454  RYYRKKLR  461



>emb|CBI39163.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 130/234 (56%), Gaps = 29/234 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  G+++ G LRPAF++E   +++  S   +      
Sbjct  259  HPIYFAKCLTKAVNMEYNKEMDHPSNGISMVGCLRPAFIDEEPYLRRLFSCEDSDG----  314

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                 +D K+  I    G   K   D  NP               ++FY+LE+++I+L S
Sbjct  315  ---YTSDWKDEEIT---GFSSKG--DGHNPR--------------STFYRLEIMRIELFS  352

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q  + ++DF+ A  D + HS   I+     +G     ALK+LC + KG  VE  +L
Sbjct  353  VYGIQALISLQDFQDAEPDVLVHSTKAIVEHFTENGTWFNVALKALC-KKKGFHVEGANL  411

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP--RTQKLQQ  239
            IGVDSLG+D+RV +G ++QT RF+FK RA+S  +AE+Q+  LLFP  R +K+Q 
Sbjct  412  IGVDSLGMDVRVFTGVEIQTHRFSFKVRATSAAAAEKQIQQLLFPPSRRKKVQN  465



>ref|XP_010650474.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At3g49140 
[Vitis vinifera]
Length=481

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 131/233 (56%), Gaps = 27/233 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  G+++ G LRPAF++E   +++  S   +      
Sbjct  243  HPIYFAKCLTKAVNMEYNKEMDHPSNGISMVGCLRPAFIDEEPYLRRLFSCEDSDG----  298

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                 +D K+  I    G   K   D  NP               ++FY+LE+++I+L S
Sbjct  299  ---YTSDWKDEEIT---GFSSKG--DGHNPR--------------STFYRLEIMRIELFS  336

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ + ++DF+ A  D + HS   I+     +G     ALK+LC + KG  VE  +L
Sbjct  337  VYGIQSVISLQDFQDAEPDVLVHSTKAIVEHFTENGTWFNVALKALC-KKKGFHVEGANL  395

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            IGVDSLG+D+RV +G ++QT RF+FK RA+S  +AE+Q+  LLFP +++ + R
Sbjct  396  IGVDSLGMDVRVFTGVEIQTHRFSFKVRATSAAAAEKQIQQLLFPPSRRKKFR  448



>ref|XP_007034031.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOY04957.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 
[Theobroma cacao]
Length=467

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/240 (34%), Positives = 133/240 (55%), Gaps = 35/240 (15%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM----SDHKTSN  767
            HP++FA+ LT+    +    M+ P  G++I G LRPAF +E   +++      +D  TS+
Sbjct  250  HPIYFAKCLTKAVHMEHDRKMDHPSNGVSIVGCLRPAFYDEESYLRRLFHFEDNDGYTSD  309

Query  766  ADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKI  587
                + S+++     +                        + D TL      Y++E++++
Sbjct  310  WKDGETSRSSSKYGGS------------------------KSDSTL------YRMEIMRM  339

Query  586  QLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVE  407
            +L S +G Q+ + ++DF+ A  D + HS   IL R   +G +   ALK+LC + KG+Q+E
Sbjct  340  ELFSIYGVQSLISLQDFQDAEPDVLVHSTSAILERFSQNGIRCNVALKALC-KKKGLQIE  398

Query  406  EVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKEA  227
              +LIGVDSLGID+R+ SG +V+T RF FK RA SE +AE+Q+  LLFPR+ + + R + 
Sbjct  399  GANLIGVDSLGIDVRIFSGVEVRTHRFPFKVRAMSETAAEKQILKLLFPRSHRKKFRTDG  458



>ref|XP_008802364.1| PREDICTED: uncharacterized protein At3g49140 isoform X3 [Phoenix 
dactylifera]
Length=477

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 132/260 (51%), Gaps = 55/260 (21%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T+R  HPM+FA+ L++  +      M+ P  GL+I G LRPAF++E   +++    +   
Sbjct  242  TLRWVHPMYFAKCLSKAVNTKQERKMDRPSNGLSIVGCLRPAFIDEESYLRRLFHSN---  298

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGT---------  617
                                 +G  + S     +PN A+E EK+E   +GT         
Sbjct  299  ---------------------DGDDYMSDWRALSPNPADESEKEEEQVAGTYDLVDGEML  337

Query  616  -------------SFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLK  476
                         + YKLE++ ++L S +G Q          A  D +AHSA  I+ R  
Sbjct  338  RFNSKYDGGNISSTLYKLEIMSMELHSVYGGQD---------AEPDVLAHSASAIIERSN  388

Query  475  TSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEY  296
              G +   AL+SLC R KG+ VE  +LIGVDSLG+D+RV SG + QT+RF+F  RA+SE 
Sbjct  389  EYGVQCNAALRSLCRRRKGLVVERANLIGVDSLGMDVRVFSGMEAQTIRFSFNARATSES  448

Query  295  SAERQLNNLLFPRTQKLQQR  236
            +AE+++  +LFPR  + + R
Sbjct  449  AAEKKIKRMLFPRYYRKKLR  468



>ref|XP_011462599.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=501

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 134/238 (56%), Gaps = 28/238 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  +      M+ P  G++I G L PAF +E   +++ +  H+ S+ D  
Sbjct  285  HPIYFAKCLTKAINIRHDRKMDHPSNGVSILGCLIPAFADEEFYVRR-LFHHEDSDYD--  341

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                 +D K+   V I+                    K +   + ++ Y+LE+++I+L S
Sbjct  342  -----SDEKDGKGVSISS-------------------KSDRSKTRSTLYRLEIMRIELFS  377

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ + ++DF+ A  D + +S   I+ R    G +   ALK+LC R KG+QVE   L
Sbjct  378  VYGVQSAISLQDFQDAEPDFLINSISDIVERFNERGIRCDVALKALCKR-KGLQVEGAHL  436

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKEAQQ  221
            IGVDSLG+D+RV SG++VQT RF F+ RA SE  AE+Q+  LLFPR+++ + R +   
Sbjct  437  IGVDSLGMDVRVFSGSEVQTHRFPFRVRAKSELVAEKQIEQLLFPRSRRKKLRSQGNN  494



>ref|XP_004296717.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   133 bits (335),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 133/238 (56%), Gaps = 28/238 (12%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  +      M+ P  G++I G L PAF +E   +++ +  H+ S+ D +
Sbjct  247  HPIYFAKCLTKAINIRHDRKMDHPSNGVSILGCLIPAFADEEFYVRR-LFHHEDSDYDSD  305

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
            +     D K  +I                        K +   + ++ Y+LE+++I+L S
Sbjct  306  E----KDGKGVSIS----------------------SKSDRSKTRSTLYRLEIMRIELFS  339

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G Q+ + ++DF+ A  D + +S   I+ R    G +   ALK+LC R KG+QVE   L
Sbjct  340  VYGVQSAISLQDFQDAEPDFLINSISDIVERFNERGIRCDVALKALCKR-KGLQVEGAHL  398

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKEAQQ  221
            IGVDSLG+D+RV SG++VQT RF F+ RA SE  AE+Q+  LLFPR+++ + R +   
Sbjct  399  IGVDSLGMDVRVFSGSEVQTHRFPFRVRAKSELVAEKQIEQLLFPRSRRKKLRSQGNN  456



>ref|XP_002302882.1| hypothetical protein POPTR_0002s23140g [Populus trichocarpa]
 gb|EEE82155.1| hypothetical protein POPTR_0002s23140g [Populus trichocarpa]
Length=469

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 131/231 (57%), Gaps = 31/231 (13%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM--SDHKTSNAD  761
            HP++FA+ +T+  + +    M+ P  G++I G LRPAF +E + ++      D    N+D
Sbjct  252  HPIYFAKCMTKAINMEYYRKMDHPSNGVSIVGCLRPAFSDEELYLRTSFHCGDSDGYNSD  311

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
            R         K+T I+  N                    K +   SG++ + LE+++I+L
Sbjct  312  R---------KDTEILSFN-------------------SKSDVSSSGSTLHCLEIMRIEL  343

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
             S +G+Q+ V ++DF+ A  D +AHS   IL      G +   ALK+LC + KG+ VE  
Sbjct  344  FSLYGSQSAVSLQDFQEAEPDVLAHSTPAILEHFSEKGSRCNIALKALCKK-KGLHVERA  402

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            +LIGVDSLG+D+R+ SG + +T RF FK RA+ + +A++Q++ LLFPR ++
Sbjct  403  NLIGVDSLGMDVRIFSGVEARTHRFPFKVRATCKTAAQKQIHQLLFPRARR  453



>ref|XP_009765199.1| PREDICTED: uncharacterized protein At3g49140 isoform X2 [Nicotiana 
sylvestris]
Length=501

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 130/269 (48%), Gaps = 62/269 (23%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  G++I G L+PAFLEE   +++  SD +  +    
Sbjct  248  HPVYFAKCLTKAVEMEHAKMMDHPSNGISIWGHLKPAFLEEEFYVRRLFSDDEVGDG---  304

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                 +D K+   +       KS                    S ++ Y+LE++KI+L S
Sbjct  305  ---YISDWKDGETLSFGSSYDKSC-------------------SLSTIYRLEILKIELFS  342

Query  574  AHGNQT------------------------------------FVEIEDFRRARADAIAHS  503
             +G Q                                      V + DF+ A  D + HS
Sbjct  343  VYGAQIQHCEERCLQGFGGTEISKGKINEGGKRPKVWLGSKLAVNLHDFQDAEPDILVHS  402

Query  502  AVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFA  323
               I+   K  G K   ALK+LC R KG+  E   LIGVDSLG+D+RV SGT+VQT RF 
Sbjct  403  TPAIVEWFKQQGIKCKFALKALC-RKKGLHAERAKLIGVDSLGMDVRVLSGTEVQTHRFP  461

Query  322  FKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            FK RA+SE +AE+Q+  LLFPR+++ + R
Sbjct  462  FKVRATSEVAAEKQIRQLLFPRSRRKKFR  490



>ref|XP_009765198.1| PREDICTED: uncharacterized protein At3g49140 isoform X1 [Nicotiana 
sylvestris]
Length=503

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 130/269 (48%), Gaps = 62/269 (23%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  G++I G L+PAFLEE   +++  SD +  +    
Sbjct  250  HPVYFAKCLTKAVEMEHAKMMDHPSNGISIWGHLKPAFLEEEFYVRRLFSDDEVGDG---  306

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                 +D K+   +       KS                    S ++ Y+LE++KI+L S
Sbjct  307  ---YISDWKDGETLSFGSSYDKSC-------------------SLSTIYRLEILKIELFS  344

Query  574  AHGNQT------------------------------------FVEIEDFRRARADAIAHS  503
             +G Q                                      V + DF+ A  D + HS
Sbjct  345  VYGAQIQHCEERCLQGFGGTEISKGKINEGGKRPKVWLGSKLAVNLHDFQDAEPDILVHS  404

Query  502  AVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFA  323
               I+   K  G K   ALK+LC R KG+  E   LIGVDSLG+D+RV SGT+VQT RF 
Sbjct  405  TPAIVEWFKQQGIKCKFALKALC-RKKGLHAERAKLIGVDSLGMDVRVLSGTEVQTHRFP  463

Query  322  FKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            FK RA+SE +AE+Q+  LLFPR+++ + R
Sbjct  464  FKVRATSEVAAEKQIRQLLFPRSRRKKFR  492



>ref|XP_009765200.1| PREDICTED: uncharacterized protein At3g49140 isoform X3 [Nicotiana 
sylvestris]
Length=493

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 130/269 (48%), Gaps = 62/269 (23%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  G++I G L+PAFLEE   +++  SD +  +    
Sbjct  240  HPVYFAKCLTKAVEMEHAKMMDHPSNGISIWGHLKPAFLEEEFYVRRLFSDDEVGDG---  296

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                 +D K+   +       KS                    S ++ Y+LE++KI+L S
Sbjct  297  ---YISDWKDGETLSFGSSYDKSC-------------------SLSTIYRLEILKIELFS  334

Query  574  AHGNQT------------------------------------FVEIEDFRRARADAIAHS  503
             +G Q                                      V + DF+ A  D + HS
Sbjct  335  VYGAQIQHCEERCLQGFGGTEISKGKINEGGKRPKVWLGSKLAVNLHDFQDAEPDILVHS  394

Query  502  AVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFA  323
               I+   K  G K   ALK+LC R KG+  E   LIGVDSLG+D+RV SGT+VQT RF 
Sbjct  395  TPAIVEWFKQQGIKCKFALKALC-RKKGLHAERAKLIGVDSLGMDVRVLSGTEVQTHRFP  453

Query  322  FKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            FK RA+SE +AE+Q+  LLFPR+++ + R
Sbjct  454  FKVRATSEVAAEKQIRQLLFPRSRRKKFR  482



>ref|XP_012066226.1| PREDICTED: uncharacterized protein At3g49140 [Jatropha curcas]
 gb|KDP42858.1| hypothetical protein JCGZ_23800 [Jatropha curcas]
Length=459

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 126/238 (53%), Gaps = 37/238 (16%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ L +  D +    M+ P  G++I G LRPAF +E   +++             
Sbjct  242  HPIYFAKCLAKATDMEYDREMDHPSNGVSIVGCLRPAFADEESYLRRLF-----------  290

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEE-----LEKDETLGSGTSFYKLEMIK  590
                                H    D+ + +W +E       K E   + ++FY+L++++
Sbjct  291  --------------------HNEDSDEYDSDWKDEEVLSFSSKSEGSSTNSTFYRLDIMR  330

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L S +G Q  + ++DF+ A  D + HS   IL      G     ALK+LC + KG+  
Sbjct  331  IELFSVYGIQYTIALQDFQDAEPDFLLHSTSAILEHFSEKGIWCNAALKALC-KKKGLHA  389

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
            E   LIGVDSLGID+R+ SG +V+T RF FK RA+ E +AE+Q++ LLFPR+++ + R
Sbjct  390  EGADLIGVDSLGIDVRIFSGVEVRTHRFPFKVRATCEAAAEKQIHQLLFPRSRRKKFR  447



>ref|XP_002530542.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31833.1| conserved hypothetical protein [Ricinus communis]
Length=409

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 128/243 (53%), Gaps = 40/243 (16%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  D +    M+ P  G++I G LRPAF +E   +++             
Sbjct  195  HPIYFAKCLTKATDMECDRKMDHPSNGVSILGCLRPAFADEESYLRRLFH----------  244

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAE-ELEKDETLGSGTS----FYKLEMIK  590
                   C+++              D  N +W + E+    + G G+S     Y+LE+++
Sbjct  245  -------CQDS--------------DNYNSDWTDVEILSFSSKGDGSSRGSTLYRLEIMR  283

Query  589  IQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQV  410
            I+L S +G Q     +D   A  D + HS   IL     +G +   ALK+LC + KG+ V
Sbjct  284  IELFSVYGAQACTYFQD---AEPDVLVHSTSAILDHFSNNGIRCNAALKALC-KKKGLHV  339

Query  409  EEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
            E  +LIG+DSLGID+R  SG +VQT RF FK RA+ E +AE+Q++ LLFP +++ + R  
Sbjct  340  EGANLIGIDSLGIDVRTFSGVEVQTQRFPFKVRATCEAAAEKQIHQLLFPPSRRKKFRSH  399

Query  229  AQQ  221
              +
Sbjct  400  GDR  402



>gb|KJB61304.1| hypothetical protein B456_009G350800 [Gossypium raimondii]
Length=375

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 120/209 (57%), Gaps = 27/209 (13%)
 Frame = -3

Query  874  MELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRNQISKAADCKETTIVPINGHR  695
            M+ P  G++I G LRPAF +E   +++        + D ++    +D K           
Sbjct  179  MDHPSNGVSIVGCLRPAFADEESYLRRLF------HFDYDE-GYTSDWK-----------  220

Query  694  HKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADA  515
                 D + P  + +    +   SG+  Y+LE+++I+L S +G Q+ + ++DF+ A  D 
Sbjct  221  -----DGEAPKPSSKYGGSK---SGSILYRLEIMQIELFSVYGAQSLISLKDFQDAEPDV  272

Query  514  IAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQT  335
            + HS   IL R    G     ALKSLC + KG+Q+EE +LIGVDSLGID+R+ SG +V+T
Sbjct  273  LVHSTSAILERFSEKGIWCNVALKSLCKK-KGLQIEEANLIGVDSLGIDVRIFSGVEVRT  331

Query  334  LRFAFKKRASSEYSAERQLNNLLFPRTQK  248
             RF FK RA SE +AE+++  LLFPR+++
Sbjct  332  CRFPFKIRAMSEAAAEKKIRQLLFPRSRR  360



>ref|XP_010097509.1| hypothetical protein L484_024718 [Morus notabilis]
 gb|EXB68700.1| hypothetical protein L484_024718 [Morus notabilis]
Length=459

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 126/245 (51%), Gaps = 50/245 (20%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+V + +    M+ P  G++I G LRPAF +E   I++             
Sbjct  247  HPIYFAKCLTKVVNMEYDRKMDHPSNGVSILGCLRPAFADEESHIRRLF-----------  295

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETL---------GSGTSFYKL  602
                   C E                 D   +  E    ETL          SG++ Y+L
Sbjct  296  -------CYE-----------------DGDGYHSEWSDGETLSSNSRRDRGNSGSTLYRL  331

Query  601  EMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCK  422
            E+++I+L S+      + ++DF+ A  D + HS   I+ R    G +   ALK+LC + K
Sbjct  332  EILRIELFSSA-----ISLQDFQDAEPDFLVHSTSAIVERFSEKGIRCDVALKALC-KKK  385

Query  421  GIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQ  242
            G+ VE   LIGVDSLG+D+RV  G++VQT RF FK RA+SE +AE+Q+  L+FPR ++ +
Sbjct  386  GLHVEGAHLIGVDSLGMDVRVSVGSEVQTHRFPFKVRATSEIAAEKQIRQLMFPRARRKK  445

Query  241  QRKEA  227
             R   
Sbjct  446  LRSHG  450



>ref|XP_001763992.1| predicted protein [Physcomitrella patens]
 gb|EDQ71131.1| predicted protein [Physcomitrella patens]
Length=672

 Score =   130 bits (326),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 95/145 (66%), Gaps = 0/145 (0%)
 Frame = -3

Query  658  AEELEKDETLGSGTSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRL  479
            +E +E   +   GT+FYKLEM+ +QL    G Q  +EI+DF   + D +AHSA  I+ R+
Sbjct  519  SEWVEDRSSWHVGTTFYKLEMLSMQLDLNSGLQKSIEIQDFCNGQPDILAHSAAAIMERV  578

Query  478  KTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSE  299
               G KT +ALK+LC R  G++VEE  +IGVD LGIDLRV +G +VQTLRF F ++A+ E
Sbjct  579  NQGGSKTERALKALCRRELGLEVEEAKVIGVDFLGIDLRVSAGIEVQTLRFQFNRKATCE  638

Query  298  YSAERQLNNLLFPRTQKLQQRKEAQ  224
              A++ ++ LLFPR    + RK  Q
Sbjct  639  KVADQLIDQLLFPRPGLKRPRKSQQ  663



>gb|KHG13029.1| hypothetical protein F383_17155 [Gossypium arboreum]
Length=461

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 128/229 (56%), Gaps = 32/229 (14%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ L +    +    M+ P  G++I G LRPAF +E   +++        + D +
Sbjct  250  HPIYFAKCLMKAVHVEHDRKMDHPSNGVSIVGCLRPAFADEESYLRRLF------HFDYD  303

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
            +    +D K                D + P  + +    +   SG+  Y+LE+++IQL S
Sbjct  304  E-GYTSDWK----------------DGEAPKPSSKYGGSK---SGSILYRLEIMRIQLFS  343

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
                 + + ++DF+ A  D + HS   IL R    G +   ALKSLC + KG+Q+EE +L
Sbjct  344  -----SLISLKDFQDAEPDVLVHSTSAILERFSEKGIRCNVALKSLC-KKKGLQIEEANL  397

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            IGVDSLGID+R+ SG +V+T RF FK RA SE +AE+++  LLFPR+++
Sbjct  398  IGVDSLGIDVRIFSGVEVRTCRFPFKIRAMSEAAAEKKIRQLLFPRSRR  446



>ref|XP_010279051.1| PREDICTED: uncharacterized protein At3g49140-like isoform X3 
[Nelumbo nucifera]
Length=471

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 94/168 (56%), Gaps = 39/168 (23%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTE-------------------------------------VXDDDPI  881
            TMRSSHPM+FA++L E                                        D PI
Sbjct  268  TMRSSHPMYFAKKLAECLCRFYYRPVLSYIRMEWLKLWSPFLFLDHQHEIRELAASDLPI  327

Query  880  DFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNAD-RNQISKAADCKETTIVPIN  704
            D+ME P  GLAIQG+L P F+EE  VIQ+ + DH+ SN + +NQ+ +  + K   I  + 
Sbjct  328  DWMEQPSVGLAIQGLLTPVFVEE-AVIQEHIPDHEYSNGNSKNQVGEYVEDKLEDIGMVY  386

Query  703  GHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLISAHGNQ  560
            GH+H+    + N  WAE+LE DE+L +G SFYKLEM+KIQ+ISAHGNQ
Sbjct  387  GHQHELASSEGNSIWAEQLEIDESLRTGVSFYKLEMVKIQMISAHGNQ  434



>gb|KJB18781.1| hypothetical protein B456_003G069200 [Gossypium raimondii]
Length=405

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            TMRSSHPM+FA++LTE   DDP+D+ME P  GLAIQG+LRPA  EEH  IQK MS +++ 
Sbjct  274  TMRSSHPMYFAKKLTEAASDDPVDWMEQPSDGLAIQGLLRPALTEEHSEIQKHMSTNQSH  333

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIK  590
             +D NQ  K    K   +  ING+ ++S L + + + +E L K+E   +G+SFYKLEMIK
Sbjct  334  GSDTNQAEKDVGDKVEDLGIINGYGNESELSRKSSS-SERLGKNEISTNGSSFYKLEMIK  392

Query  589  IQLISAHGNQ  560
            IQLI+AHG+Q
Sbjct  393  IQLITAHGHQ  402



>ref|XP_007034030.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY04956.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
Length=486

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/259 (32%), Positives = 133/259 (51%), Gaps = 54/259 (21%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM----SDHKTSN  767
            HP++FA+ LT+    +    M+ P  G++I G LRPAF +E   +++      +D  TS+
Sbjct  250  HPIYFAKCLTKAVHMEHDRKMDHPSNGVSIVGCLRPAFYDEESYLRRLFHFEDNDGYTSD  309

Query  766  ADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKI  587
                + S+++     +                        + D TL      Y++E++++
Sbjct  310  WKDGETSRSSSKYGGS------------------------KSDSTL------YRMEIMRM  339

Query  586  QLISAHGNQTF-------------------VEIEDFRRARADAIAHSAVKILSRLKTSGE  464
            +L S +G Q F                   + ++DF+ A  D + HS   IL R   +G 
Sbjct  340  ELFSIYGVQAFLMKRIMEERLSSCFLYLSLISLQDFQDAEPDVLVHSTSAILERFSQNGI  399

Query  463  KTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAER  284
            +   ALK+LC + KG+Q+E  +LIGVDSLGID+R+ SG +V+T RF FK RA SE +AE+
Sbjct  400  RCNVALKALC-KKKGLQIEGANLIGVDSLGIDVRIFSGVEVRTHRFPFKVRAMSETAAEK  458

Query  283  QLNNLLFPRTQKLQQRKEA  227
            Q+  LLFPR+ + + R + 
Sbjct  459  QILKLLFPRSHRKKFRTDG  477



>gb|EMT08991.1| hypothetical protein F775_07025 [Aegilops tauschii]
Length=1216

 Score =   125 bits (315),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 120/232 (52%), Gaps = 32/232 (14%)
 Frame = -3

Query  865   PPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRNQISKAADCKETTIVPINGHRHKS  686
             P  G++I G LRPAF+EE   ++       +++   +    A+    +         H  
Sbjct  981   PSNGVSIVGYLRPAFIEEESYLRSLFGAECSADGYSSNWRGASQLAHSCFY------HSC  1034

Query  685   GLDQ----DNPNWAEELEKDETLGSGT----------------------SFYKLEMIKIQ  584
                Q       N  EE  ++    SGT                      + YKLEM+ I+
Sbjct  1035  ASIQLFVLMRVNLTEEYNREPQPASGTNGLIDGDKSRLDINNTESSIDSTIYKLEMMSIE  1094

Query  583   LISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEE  404
             L S +G Q  ++ +DF+ A  D +++ A  I+ R+K + ++   AL+SLC R KG+ VE+
Sbjct  1095  LFSVYGKQFMIDPQDFQDAEPDLLSNHASDIIKRVKENSDQCTMALRSLCSRKKGLTVED  1154

Query  403   VSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
              SLIGVDSLGID+R  SG + +T+RF+F  +A SE SAE+++  +LFPR +K
Sbjct  1155  ASLIGVDSLGIDVRAFSGLEARTVRFSFNAQALSERSAEKKIKRMLFPRYRK  1206



>emb|CDP14676.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 134/256 (52%), Gaps = 35/256 (14%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHK----TSN  767
            HP++FA+ LT+V   + +  ++ P  G+++ G L+PA+++E + +++   D      TS 
Sbjct  254  HPIYFAKCLTKVVSAEHVKMIDHPSNGVSVWGHLKPAYVDEELYLRRLFDDENNDGYTSG  313

Query  766  ADRNQISKAADC---KETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEM  596
                +   ++DC   K +TI  ++  +    +D  +          E    G   YKL +
Sbjct  314  WTDGEGFSSSDCGSHKRSTIYRLDIMK----MDLFSV-------YGEQACDGCMSYKLLL  362

Query  595  IKIQLISAHGNQTFV----------------EIEDFRRARADAIAHSAVKILSRLKTSGE  464
            + I     +  Q +V                 +EDF+ A  D + HS   ++ R    G 
Sbjct  363  LDILYACGNHFQAYVGSCICDRCQLFLLLAISLEDFQDAEPDILVHSTAALVERFDEPGV  422

Query  463  KTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAER  284
            +   ALK+LC + KG+ VE  +LIGVDSLG+D+RV SG++V T RF FK RA+SE +A++
Sbjct  423  RCNFALKALCKK-KGLLVEGANLIGVDSLGMDVRVFSGSEVLTHRFPFKVRATSEAAADK  481

Query  283  QLNNLLFPRTQKLQQR  236
            Q+  LLFPR+ + + R
Sbjct  482  QIQQLLFPRSHRKKHR  497



>ref|XP_011042801.1| PREDICTED: uncharacterized protein At3g49140 [Populus euphratica]
Length=469

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 130/231 (56%), Gaps = 30/231 (13%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQM--SDHKTSNAD  761
            HP++FA+ +T+  + +    M+ P  G++I G LRPAF +E + ++      D    N+D
Sbjct  252  HPIYFAKCMTKAINMEYYRKMDHPSNGVSIVGCLRPAFSDEELYLRTSFHCEDSDGYNSD  311

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
            R         K+T I+  N                    K +   SG++ + LE+++I+L
Sbjct  312  R---------KDTEILSFN-------------------SKSDVSSSGSTLHCLEIMRIEL  343

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
             S +G+Q+ V ++DF+ A  D + HS   IL      G +   ALK+LC + KG+ VE  
Sbjct  344  FSLYGSQSVVSLQDFQEAEPDVLVHSTPAILEHFNEKGSRCNIALKALCKKKKGLHVERA  403

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            +L+GVDSLG+D+R+ SG + +T RF FK RA+ + +A++Q++ LLFPR ++
Sbjct  404  NLVGVDSLGMDVRIFSGVEARTHRFPFKVRATCKTAAQKQIHQLLFPRARR  454



>ref|XP_003617306.1| hypothetical protein MTR_5g090150 [Medicago truncatula]
 gb|AET00265.1| PPR superfamily protein [Medicago truncatula]
Length=445

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/239 (33%), Positives = 129/239 (54%), Gaps = 36/239 (15%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++F++ L +  + +    M+ P  G++I G LRPA+ +E   I+     + T + D  
Sbjct  235  HPIYFSKCLEKAVNVEYDKRMDHPSNGVSILGYLRPAYADEESYIRMI---YHTEDDD--  289

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
                ++D K+     IN  R  + +                       YKLE+ KI+L  
Sbjct  290  --GYSSDWKDFYSNSINDQRDANLI----------------------LYKLEIEKIKLHC  325

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSL  395
             +G+Q+ + + +F+ A  D I +S   IL R+  +G   +QA    C + KG+  EE  L
Sbjct  326  VYGSQSEISLLEFQDAEPDIIVYSTSAILERINRNGHDALQA---FC-KKKGLDAEEAHL  381

Query  394  IGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKEAQQA  218
            IGVD LG+D+RV SG++V+T RFAFK +A+S Y AE+Q+  LL+PR+++   ++  QQ+
Sbjct  382  IGVDHLGVDVRVLSGSEVKTHRFAFKVQANSGYMAEKQIVQLLYPRSRR---KRNMQQS  437



>ref|XP_010069339.1| PREDICTED: uncharacterized protein At3g49140 isoform X3 [Eucalyptus 
grandis]
Length=424

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 116/216 (54%), Gaps = 34/216 (16%)
 Frame = -3

Query  934  HPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRN  755
            HP++FA+ LT+  + +    M+ P  GL+I G LRPAF +E   ++K     ++ +AD +
Sbjct  237  HPVYFAKCLTKAVNAEYDKKMDTPSNGLSILGCLRPAFSDEESYLRKLF---QSEDADNH  293

Query  754  QISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLIS  575
             +    D K+  +V +     K                    G  +  Y+LE+I+I+L S
Sbjct  294  NL----DWKDADVVTLASSDRK--------------------GCNSIIYRLEIIRIELFS  329

Query  574  AHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVE----  407
             +G+Q  + ++DF  A  D + HS   IL R    G +   ALK+LC R KG+ VE    
Sbjct  330  VYGSQCEIHLQDFLDAEPDILVHSTSAILDRFSEKGIRCNVALKALCKR-KGLHVEVKET  388

Query  406  --EVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRAS  305
                ++IGVDSLG+D+R+ SGT+V+T RF FK ++S
Sbjct  389  ASGANIIGVDSLGMDVRIYSGTEVRTHRFPFKIQSS  424



>ref|XP_004491268.1| PREDICTED: uncharacterized protein LOC101512598 isoform X2 [Cicer 
arietinum]
Length=471

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/241 (32%), Positives = 125/241 (52%), Gaps = 37/241 (15%)
 Frame = -3

Query  940  SSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNAD  761
            S HP++F++ L +  + +    +  P  G++I G LRPA+ +E   I+     + T + D
Sbjct  260  SLHPIYFSKCLEKAINTECDKRVNHPSNGVSILGYLRPAYADEESYIRMI---YDTEDGD  316

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
                                     G + D  ++      D+   +    Y+LE+ KI+L
Sbjct  317  -------------------------GYNSDWKDFYSNNNNDQR-DTNLILYRLEIEKIKL  350

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
               +G+Q+ +  ++FRRA  D + +S+++IL       +    AL++ C + KG+ VE  
Sbjct  351  HCVYGSQSEINFQEFRRAEPDTLVYSSLEILEHFN---QNCHDALRAFC-KKKGLNVEGA  406

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKEAQQ  221
             LIGVD LG+D+RV SGT+V+T RF FK RA SE  AE+Q+  LL+PR+     RK+  Q
Sbjct  407  HLIGVDCLGVDVRVFSGTEVKTHRFPFKVRAKSESMAEKQIVQLLYPRS----WRKKHMQ  462

Query  220  A  218
            A
Sbjct  463  A  463



>ref|XP_007141480.1| hypothetical protein PHAVU_008G199500g [Phaseolus vulgaris]
 gb|ESW13474.1| hypothetical protein PHAVU_008G199500g [Phaseolus vulgaris]
Length=453

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 130/238 (55%), Gaps = 34/238 (14%)
 Frame = -3

Query  940  SSHPMHFARRLTE-VXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNA  764
            S HP++F++ LT+ V + + I  M  P  G++I G LRP + EE   ++   + H    A
Sbjct  242  SVHPIYFSKCLTKAVNNVEYIKRMNHPSNGVSIIGFLRPIYDEERSYLR--WTYHTEDGA  299

Query  763  DRNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQ  584
                IS + D    +I            DQ N N               + Y+LE++KI+
Sbjct  300  --VYISGSRDSYSNSID-----------DQGNTN--------------LTLYRLEILKIK  332

Query  583  LISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEE  404
            L S +G Q+ + + +F+ A  D +AHS+ +IL R     +     LK+LC + KG++ E 
Sbjct  333  LHSMYGYQSEISVLEFQDAEPDILAHSSSEILERFNRFCDDD---LKALC-KKKGLEAEG  388

Query  403  VSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKE  230
              L+GVDSLG+D+RV SG +V+T RF FK +A++  +A +Q+  LLFPR+++ +  K+
Sbjct  389  AYLVGVDSLGVDVRVFSGAEVKTHRFPFKIQAATINAAAKQIWQLLFPRSRRKKNMKK  446



>ref|XP_002320457.2| hypothetical protein POPTR_0014s14980g [Populus trichocarpa]
 gb|EEE98772.2| hypothetical protein POPTR_0014s14980g [Populus trichocarpa]
Length=538

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 116/218 (53%), Gaps = 37/218 (17%)
 Frame = -3

Query  874  MELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADRNQISKAADCKETTIVPINGHR  695
            M+ P  G++I G LRP+F +E   +++                                 
Sbjct  342  MDHPSNGVSIVGCLRPSFADEESYLRRSF-------------------------------  370

Query  694  HKSGLDQDNPNWAE-----ELEKDETLGSGTSFYKLEMIKIQLISAHGNQTFVEIEDFRR  530
            H    D  N +W +        K +   SG++ ++LE+++I+L S +G+Q+ V ++DF+ 
Sbjct  371  HCEDSDGCNSDWKDGEILSFSSKSDGSSSGSTLHRLEILRIELFSLYGSQSVVSLQDFQD  430

Query  529  ARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSG  350
            A  D +A S   IL      G +   ALK+LC + KG+ VE  +L+G+DSLG+D+R+  G
Sbjct  431  AEPDVLAPSTSAILEHFSGKGSRCNVALKALCKK-KGLHVEAANLVGIDSLGMDVRIFCG  489

Query  349  TQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
             + +T RF FK RA+ E +A++Q++ LLFPR+++ + R
Sbjct  490  VEARTHRFPFKVRATCEVAAQKQMHQLLFPRSRRKKFR  527



>gb|KHN12012.1| Hypothetical protein glysoja_019985 [Glycine soja]
Length=444

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/246 (33%), Positives = 131/246 (53%), Gaps = 40/246 (16%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDD-DPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKT  773
            T +S HP++F++ L +  ++ + +  M  P  G++I G LRP + EE   ++     + T
Sbjct  234  TTKSVHPIYFSKCLAKAINNMEYVKRMNHPSNGVSIIGFLRPVYGEEKSYLRWM---YHT  290

Query  772  SNADRNQISKAADCKETTIVPINGHR-HKSGLDQDNPNWAEELEKDETLGSGTSFYKLEM  596
             + D               V I+  R   S  D D+       E+D  L    + Y+LE+
Sbjct  291  EDGD---------------VYISDWRDFYSNSDDDD-------ERDTNL----TLYRLEI  324

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            + I+L S +G Q +     F+ A  D +AHS+ +IL R     +  I   K+LC + KG+
Sbjct  325  LSIELHSMYGYQAY-----FQDAEPDILAHSSSEILERFNQFCDDEI---KALC-KKKGL  375

Query  415  QVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQR  236
              E   L+GVDSLG+D+RV SG +V+T RF FK +A++  +AE+Q+  LLFPR+++ +  
Sbjct  376  YGEGAYLVGVDSLGVDVRVLSGAEVKTHRFPFKVQAANANAAEKQIWQLLFPRSRRKKNM  435

Query  235  KEAQQA  218
            K+   A
Sbjct  436  KKWWSA  441



>ref|XP_004491270.1| PREDICTED: uncharacterized protein LOC101512598 isoform X4 [Cicer 
arietinum]
Length=465

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 77/241 (32%), Positives = 122/241 (51%), Gaps = 43/241 (18%)
 Frame = -3

Query  940  SSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNAD  761
            S HP++F++ L +  + +    +  P  G++I G LRPA+ +E   I+     + T + D
Sbjct  260  SLHPIYFSKCLEKAINTECDKRVNHPSNGVSILGYLRPAYADEESYIRMI---YDTEDGD  316

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
                                     G + D  ++      D+   +    Y+LE+ KI+L
Sbjct  317  -------------------------GYNSDWKDFYSNNNNDQR-DTNLILYRLEIEKIKL  350

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
               +G+Q      +FRRA  D + +S+++IL       +    AL++ C + KG+ VE  
Sbjct  351  HCVYGSQ------EFRRAEPDTLVYSSLEILEHFN---QNCHDALRAFC-KKKGLNVEGA  400

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQRKEAQQ  221
             LIGVD LG+D+RV SGT+V+T RF FK RA SE  AE+Q+  LL+PR+     RK+  Q
Sbjct  401  HLIGVDCLGVDVRVFSGTEVKTHRFPFKVRAKSESMAEKQIVQLLYPRS----WRKKHMQ  456

Query  220  A  218
            A
Sbjct  457  A  457



>dbj|BAH56735.1| AT3G59300 [Arabidopsis thaliana]
Length=182

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 77/122 (63%), Gaps = 4/122 (3%)
 Frame = -3

Query  673  DNPNWAEELEKDETLGSGTSFYKLEMIKIQLISAHGNQTFVEIEDFRRARADAIAHSAVK  494
            DNP  +   ++++     +S Y+LE++ I+L+S +G ++ + ++DF+ A  D + HS   
Sbjct  60   DNPITSSRRDENDM---SSSLYRLEIVGIELLSLYGAESSISLQDFQDAEPDILVHSTSA  116

Query  493  ILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDSLGIDLRVCSGTQVQTLRFAFKK  314
            I+ R    G  +  ALK+LC + KG+  EE +LI VDSLG+D+RV +G QVQT RF FK 
Sbjct  117  IIERFNNRGINSSIALKALCKK-KGLHAEEANLISVDSLGMDVRVFAGAQVQTHRFPFKT  175

Query  313  RA  308
            R 
Sbjct  176  RV  177



>gb|EYU45227.1| hypothetical protein MIMGU_mgv1a0208701mg, partial [Erythranthe 
guttata]
Length=104

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = -3

Query  559  TFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEVSLIGVDS  380
            + V++ DF+ A  D + H    IL R    G +   ALK+LC + KG  VE   LIGVDS
Sbjct  1    SVVDVLDFQYAEPDVLVHYVPSILERFGEMGTRCNCALKALCKK-KGFHVEGARLIGVDS  59

Query  379  LGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQK  248
            LG+D+RV SGT+V+T RF+FK +  SE +A++Q+  LLFPR+++
Sbjct  60   LGMDVRVSSGTEVRTHRFSFKVQVKSECAADKQIQQLLFPRSRR  103



>ref|XP_004491272.1| PREDICTED: uncharacterized protein LOC101512598 isoform X6 [Cicer 
arietinum]
Length=366

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 106/211 (50%), Gaps = 33/211 (16%)
 Frame = -3

Query  940  SSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNAD  761
            S HP++F++ L +  + +    +  P  G++I G LRPA+ +E   I+     + T + D
Sbjct  152  SLHPIYFSKCLEKAINTECDKRVNHPSNGVSILGYLRPAYADEESYIRMI---YDTEDGD  208

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
                                     G + D  ++      D+   +    Y+LE+ KI+L
Sbjct  209  -------------------------GYNSDWKDFYSNNNNDQR-DTNLILYRLEIEKIKL  242

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
               +G+Q+ +  ++FRRA  D + +S+++IL       +    AL++ C + KG+ VE  
Sbjct  243  HCVYGSQSEINFQEFRRAEPDTLVYSSLEILEHFN---QNCHDALRAFC-KKKGLNVEGA  298

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRA  308
             LIGVD LG+D+RV SGT+V+T RF FK R 
Sbjct  299  HLIGVDCLGVDVRVFSGTEVKTHRFPFKVRV  329



>ref|XP_004491271.1| PREDICTED: uncharacterized protein LOC101512598 isoform X5 [Cicer 
arietinum]
Length=454

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 106/211 (50%), Gaps = 33/211 (16%)
 Frame = -3

Query  940  SSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNAD  761
            S HP++F++ L +  + +    +  P  G++I G LRPA+ +E   I+     + T + D
Sbjct  240  SLHPIYFSKCLEKAINTECDKRVNHPSNGVSILGYLRPAYADEESYIRMI---YDTEDGD  296

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
                                     G + D  ++      D+   +    Y+LE+ KI+L
Sbjct  297  -------------------------GYNSDWKDFYSNNNNDQR-DTNLILYRLEIEKIKL  330

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
               +G+Q+ +  ++FRRA  D + +S+++IL       +    AL++ C + KG+ VE  
Sbjct  331  HCVYGSQSEINFQEFRRAEPDTLVYSSLEILEHFN---QNCHDALRAFCKK-KGLNVEGA  386

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRA  308
             LIGVD LG+D+RV SGT+V+T RF FK R 
Sbjct  387  HLIGVDCLGVDVRVFSGTEVKTHRFPFKVRV  417



>ref|XP_004491267.1| PREDICTED: uncharacterized protein LOC101512598 isoform X1 [Cicer 
arietinum]
Length=474

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 106/211 (50%), Gaps = 33/211 (16%)
 Frame = -3

Query  940  SSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNAD  761
            S HP++F++ L +  + +    +  P  G++I G LRPA+ +E   I+     + T + D
Sbjct  260  SLHPIYFSKCLEKAINTECDKRVNHPSNGVSILGYLRPAYADEESYIRMI---YDTEDGD  316

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
                                     G + D  ++      D+   +    Y+LE+ KI+L
Sbjct  317  -------------------------GYNSDWKDFYSNNNNDQR-DTNLILYRLEIEKIKL  350

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
               +G+Q+ +  ++FRRA  D + +S+++IL       +    AL++ C + KG+ VE  
Sbjct  351  HCVYGSQSEINFQEFRRAEPDTLVYSSLEILEHFN---QNCHDALRAFC-KKKGLNVEGA  406

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRA  308
             LIGVD LG+D+RV SGT+V+T RF FK R 
Sbjct  407  HLIGVDCLGVDVRVFSGTEVKTHRFPFKVRV  437



>ref|XP_008354286.1| PREDICTED: uncharacterized protein LOC103417906 [Malus domestica]
Length=383

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  406  EVSLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFPRTQKLQQ  239
            E  LIGVDSLG  LRVCSGTQVQTLRFA   RA+SEYSAERQLN+LLFPR Q+  Q
Sbjct  323  EAVLIGVDSLGFXLRVCSGTQVQTLRFALNTRATSEYSAERQLNDLLFPRMQQKPQ  378



>ref|XP_004491269.1| PREDICTED: uncharacterized protein LOC101512598 isoform X3 [Cicer 
arietinum]
Length=468

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 103/211 (49%), Gaps = 39/211 (18%)
 Frame = -3

Query  940  SSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNAD  761
            S HP++F++ L +  + +    +  P  G++I G LRPA+ +E   I+     + T + D
Sbjct  260  SLHPIYFSKCLEKAINTECDKRVNHPSNGVSILGYLRPAYADEESYIRMI---YDTEDGD  316

Query  760  RNQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQL  581
                                     G + D  ++      D+   +    Y+LE+ KI+L
Sbjct  317  -------------------------GYNSDWKDFYSNNNNDQR-DTNLILYRLEIEKIKL  350

Query  580  ISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVEEV  401
               +G+Q      +FRRA  D + +S+++IL       +    AL++ C + KG+ VE  
Sbjct  351  HCVYGSQ------EFRRAEPDTLVYSSLEILEHFN---QNCHDALRAFC-KKKGLNVEGA  400

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRA  308
             LIGVD LG+D+RV SGT+V+T RF FK R 
Sbjct  401  HLIGVDCLGVDVRVFSGTEVKTHRFPFKVRV  431



>ref|XP_011084165.1| PREDICTED: uncharacterized protein At3g49140 isoform X3 [Sesamum 
indicum]
Length=433

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 86/177 (49%), Gaps = 27/177 (15%)
 Frame = -3

Query  937  SHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTSNADR  758
            +HP++FA+ LT+  D +    M+ P  G+ + G L+P F++E   +++   D        
Sbjct  256  THPVYFAKCLTKAIDVEHAKLMDYPSNGVVLWGFLKPTFIDEEFYLRRLFHDEDNDG---  312

Query  757  NQISKAADCKETTIVPINGHRHKSGLDQDNPNWAEELEKDETLGSGTSFYKLEMIKIQLI  578
                 ++DC++  +  ++                     D + G  T  Y+LE+ KI+L 
Sbjct  313  ----YSSDCEDGDVASVSS------------------SHDGSCGRST-IYRLEITKIELF  349

Query  577  SAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGIQVE  407
            S +G Q+ V ++DF+ A  D + HS   IL R   S  +   ALK+LC + KG+ VE
Sbjct  350  SVYGVQSVVSVQDFQYAEPDVLVHSIPSILERFGESRTRCNIALKALC-KKKGLHVE  405



>ref|XP_008364257.1| PREDICTED: uncharacterized protein LOC103427952 isoform X1 [Malus 
domestica]
Length=389

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 86/183 (47%), Gaps = 34/183 (19%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP+ FA+ LT+  D++    M+ P  G++I G LRPAF +E   +++  +     
Sbjct  232  TCSSIHPICFAKYLTKAIDNEYNRKMDHPSNGVSILGCLRPAFADEEFYVRRLFN-----  286

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNW--AEELEKDETLGSGTSFYKLEM  596
                              V  +G+         N +W   + +         ++ Y+LE+
Sbjct  287  -----------------YVDSDGY---------NSDWKDGKSVSLSSESDRSSTLYRLEI  320

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            ++I+L S +G Q+ + + DF+ A  D + +S  +I+ R    G +   ALK LC R KG+
Sbjct  321  MRIELFSVYGVQSTISLHDFQDAEPDVLVNSTSEIVERFSERGIRCDVALKDLCKR-KGL  379

Query  415  QVE  407
             VE
Sbjct  380  HVE  382



>ref|XP_008364258.1| PREDICTED: uncharacterized protein LOC103427952 isoform X2 [Malus 
domestica]
Length=385

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 86/183 (47%), Gaps = 34/183 (19%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGILRPAFLEEHVVIQKQMSDHKTS  770
            T  S HP+ FA+ LT+  D++    M+ P  G++I G LRPAF +E   +++  +     
Sbjct  228  TCSSIHPICFAKYLTKAIDNEYNRKMDHPSNGVSILGCLRPAFADEEFYVRRLFN-----  282

Query  769  NADRNQISKAADCKETTIVPINGHRHKSGLDQDNPNW--AEELEKDETLGSGTSFYKLEM  596
                              V  +G+         N +W   + +         ++ Y+LE+
Sbjct  283  -----------------YVDSDGY---------NSDWKDGKSVSLSSESDRSSTLYRLEI  316

Query  595  IKIQLISAHGNQTFVEIEDFRRARADAIAHSAVKILSRLKTSGEKTIQALKSLCWRCKGI  416
            ++I+L S +G Q+ + + DF+ A  D + +S  +I+ R    G +   ALK LC R KG+
Sbjct  317  MRIELFSVYGVQSTISLHDFQDAEPDVLVNSTSEIVERFSERGIRCDVALKDLCKR-KGL  375

Query  415  QVE  407
             VE
Sbjct  376  HVE  378



>emb|CAN71237.1| hypothetical protein VITISV_014867 [Vitis vinifera]
Length=293

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = -3

Query  400  SLIGVDSLGIDLRVCSGTQVQTLRFAFKKRASSEYSAERQLNNLLFP--RTQKLQQ  239
            +LIGVDSLG+D+RV +G ++QT RF+FK RA+S  +AE+Q+  LLFP  R +K+Q 
Sbjct  233  NLIGVDSLGMDVRVFTGVEIQTHRFSFKVRATSAAAAEKQIQQLLFPPSRRKKVQN  288



>ref|XP_003590430.1| hypothetical protein MTR_1g062060 [Medicago truncatula]
Length=313

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  949  TMRSSHPMHFARRLTEVXDDDPIDFMELPPAGLAIQGIL  833
            TMR SHPM FA++LTE+  DDPID+ME PPA +  QG++
Sbjct  269  TMRFSHPMDFAKKLTEIASDDPIDWMEQPPACVVFQGVI  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2295928061616