BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1067

Length=847
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008456300.1|  PREDICTED: phosphoglycerate kinase, chloropl...    366   1e-120   Cucumis melo [Oriental melon]
ref|XP_011095719.1|  PREDICTED: phosphoglycerate kinase, chloropl...    365   2e-120   Sesamum indicum [beniseed]
ref|XP_004139904.1|  PREDICTED: phosphoglycerate kinase, chloropl...    365   2e-120   Cucumis sativus [cucumbers]
gb|KJB14026.1|  hypothetical protein B456_002G107300                    362   5e-119   Gossypium raimondii
gb|KJB14025.1|  hypothetical protein B456_002G107300                    362   6e-119   Gossypium raimondii
ref|XP_011086346.1|  PREDICTED: phosphoglycerate kinase, chloropl...    361   7e-119   Sesamum indicum [beniseed]
gb|KHG01489.1|  hypothetical protein F383_22605                         361   1e-118   Gossypium arboreum [tree cotton]
ref|XP_009763674.1|  PREDICTED: phosphoglycerate kinase, chloropl...    358   1e-117   Nicotiana sylvestris
sp|Q42961.1|PGKH_TOBAC  RecName: Full=Phosphoglycerate kinase, ch...    358   1e-117   Nicotiana tabacum [American tobacco]
ref|XP_010269369.1|  PREDICTED: phosphoglycerate kinase, chloropl...    358   2e-117   Nelumbo nucifera [Indian lotus]
ref|XP_009622055.1|  PREDICTED: phosphoglycerate kinase, chloropl...    358   2e-117   Nicotiana tomentosiformis
ref|XP_012087352.1|  PREDICTED: phosphoglycerate kinase, chloropl...    356   9e-117   Jatropha curcas
gb|ADR71054.1|  phosphoglycerate kinase                                 356   1e-116   Nicotiana benthamiana
ref|XP_002513353.1|  phosphoglycerate kinase, putative                  355   2e-116   Ricinus communis
ref|XP_004243968.1|  PREDICTED: phosphoglycerate kinase, chloropl...    355   3e-116   Solanum lycopersicum
ref|XP_008383150.1|  PREDICTED: phosphoglycerate kinase, chloropl...    355   3e-116   Malus domestica [apple tree]
gb|AAC26785.1|  phosphoglycerate kinase precursor                       354   4e-116   Solanum tuberosum [potatoes]
gb|ABB86255.1|  phosphoglycerate kinase precursor-like                  354   4e-116   Solanum tuberosum [potatoes]
ref|NP_001275227.1|  phosphoglycerate kinase, chloroplastic-like        354   5e-116   Solanum tuberosum [potatoes]
ref|XP_008786111.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    354   5e-116   Phoenix dactylifera
ref|XP_010936574.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    354   5e-116   Elaeis guineensis
ref|XP_008805983.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    354   6e-116   Phoenix dactylifera
ref|XP_010060861.1|  PREDICTED: phosphoglycerate kinase, chloropl...    354   7e-116   Eucalyptus grandis [rose gum]
emb|CBI24182.3|  unnamed protein product                                351   8e-116   Vitis vinifera
ref|XP_008371996.1|  PREDICTED: phosphoglycerate kinase, chloropl...    353   2e-115   
ref|XP_008346077.1|  PREDICTED: phosphoglycerate kinase, chloropl...    353   2e-115   
ref|XP_002263796.1|  PREDICTED: phosphoglycerate kinase, chloropl...    352   2e-115   Vitis vinifera
ref|XP_007022578.1|  Phosphoglycerate kinase 1                          353   2e-115   
gb|KDO61594.1|  hypothetical protein CISIN_1g011942mg                   352   2e-115   Citrus sinensis [apfelsine]
ref|XP_004488763.1|  PREDICTED: phosphoglycerate kinase, chloropl...    352   3e-115   Cicer arietinum [garbanzo]
ref|XP_006422251.1|  hypothetical protein CICLE_v10004891mg             352   3e-115   Citrus clementina [clementine]
gb|EMT12348.1|  Phosphoglycerate kinase, chloroplastic                  348   3e-115   
ref|XP_008226130.1|  PREDICTED: phosphoglycerate kinase, chloropl...    352   4e-115   Prunus mume [ume]
ref|XP_004306579.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    351   6e-115   Fragaria vesca subsp. vesca
ref|XP_003531482.1|  PREDICTED: phosphoglycerate kinase, chloropl...    351   9e-115   Glycine max [soybeans]
ref|XP_003546820.1|  PREDICTED: phosphoglycerate kinase, chloropl...    351   1e-114   
ref|XP_008349091.1|  PREDICTED: phosphoglycerate kinase, chloropl...    350   1e-114   
gb|ADV16381.1|  chloroplast phosphoglycerate kinase 3                   350   1e-114   Helianthus annuus
ref|XP_007213965.1|  hypothetical protein PRUPE_ppa005031mg             350   1e-114   Prunus persica
ref|XP_010094703.1|  Phosphoglycerate kinase                            350   2e-114   Morus notabilis
ref|XP_002315066.1|  PHOSPHOGLYCERATE KINASE 1 family protein           350   2e-114   
sp|P12782.1|PGKH_WHEAT  RecName: Full=Phosphoglycerate kinase, ch...    350   3e-114   Triticum aestivum [Canadian hard winter wheat]
gb|AAA79705.1|  phosphoglycerate kinase                                 341   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397212.1|  PREDICTED: phosphoglycerate kinase, chloropl...    349   3e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654593.1|  PREDICTED: phosphoglycerate kinase, chloropl...    346   6e-114   Oryza brachyantha
gb|EMS54865.1|  Phosphoglycerate kinase, chloroplastic                  348   7e-114   Triticum urartu
gb|ACJ85441.1|  unknown                                                 341   7e-114   Medicago truncatula
ref|XP_003596091.1|  Phosphoglycerate kinase                            348   7e-114   Medicago truncatula
ref|XP_002441313.1|  hypothetical protein SORBIDRAFT_09g024340          348   1e-113   Sorghum bicolor [broomcorn]
ref|XP_004961633.1|  PREDICTED: phosphoglycerate kinase, chloropl...    348   1e-113   Setaria italica
ref|XP_010923458.1|  PREDICTED: phosphoglycerate kinase, chloropl...    348   1e-113   Elaeis guineensis
ref|XP_009402843.1|  PREDICTED: phosphoglycerate kinase, chloropl...    348   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU33792.1|  hypothetical protein MIMGU_mgv1a005422mg                347   2e-113   Erythranthe guttata [common monkey flower]
ref|NP_001117503.1|  phosphoglycerate kinase                            343   7e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDP13574.1|  unnamed protein product                                343   9e-113   Coffea canephora [robusta coffee]
ref|NP_176015.1|  phosphoglycerate kinase                               345   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016496.1|  PREDICTED: phosphoglycerate kinase, chloropl...    345   1e-112   Populus euphratica
ref|XP_002891879.1|  hypothetical protein ARALYDRAFT_474689             345   2e-112   
ref|XP_007149208.1|  hypothetical protein PHAVU_005G050700g             345   2e-112   Phaseolus vulgaris [French bean]
gb|ACN32155.1|  unknown                                                 342   3e-112   Zea mays [maize]
gb|AFW78533.1|  phosphoglycerate kinase                                 344   5e-112   
gb|AFW78532.1|  phosphoglycerate kinase                                 343   7e-112   
ref|XP_006858226.1|  PREDICTED: phosphoglycerate kinase, chloropl...    343   9e-112   Amborella trichopoda
ref|NP_001147628.1|  phosphoglycerate kinase                            343   1e-111   
gb|AFW82396.1|  hypothetical protein ZEAMMB73_945417                    343   1e-111   
gb|EPS66037.1|  phosphoglycerate kinase, chloroplastic                  343   2e-111   Genlisea aurea
gb|ABK96267.1|  unknown                                                 342   2e-111   Populus trichocarpa x Populus deltoides
ref|XP_003568189.1|  PREDICTED: phosphoglycerate kinase, chloropl...    342   2e-111   
ref|XP_010669994.1|  PREDICTED: phosphoglycerate kinase, chloropl...    342   3e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002312238.1|  hypothetical protein POPTR_0008s08410g             341   6e-111   Populus trichocarpa [western balsam poplar]
ref|XP_002884926.1|  hypothetical protein ARALYDRAFT_478641             341   6e-111   Arabidopsis lyrata subsp. lyrata
ref|XP_006297559.1|  hypothetical protein CARUB_v10013582mg             341   8e-111   Capsella rubella
ref|XP_010544343.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoglyce...    340   1e-110   Tarenaya hassleriana [spider flower]
ref|XP_010499471.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    340   1e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010487004.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    339   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010465058.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    339   4e-110   Camelina sativa [gold-of-pleasure]
dbj|BAH57185.1|  AT1G79550                                              330   5e-110   Arabidopsis thaliana [mouse-ear cress]
gb|AAB60303.1|  phosphoglycerate kinase                                 336   5e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008656415.1|  PREDICTED: phosphoglycerate kinase, chloropl...    343   7e-110   
ref|NP_187884.1|  phosphoglycerate kinase 1                             338   1e-109   Arabidopsis thaliana [mouse-ear cress]
gb|KHN21386.1|  Phosphoglycerate kinase, chloroplastic                  327   1e-109   Glycine soja [wild soybean]
ref|XP_006407295.1|  hypothetical protein EUTSA_v10020621mg             337   2e-109   Eutrema salsugineum [saltwater cress]
emb|CDX73803.1|  BnaA03g32440D                                          337   2e-109   
gb|AFK48886.1|  unknown                                                 326   2e-109   Lotus japonicus
emb|CDY00798.1|  BnaC03g37820D                                          337   3e-109   
ref|XP_002972334.1|  hypothetical protein SELMODRAFT_231942             334   3e-109   
ref|XP_010275944.1|  PREDICTED: phosphoglycerate kinase, cytosolic      333   6e-109   Nelumbo nucifera [Indian lotus]
ref|NP_178073.1|  phosphoglycerate kinase                               332   2e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61185.1|  phosphoglycerate kinase, putative                       331   4e-108   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43401.1|  BnaA01g30320D                                          334   4e-108   Brassica napus [oilseed rape]
gb|KEH15368.1|  phosphoglycerate kinase-like protein                    325   5e-108   Medicago truncatula
ref|XP_004970258.1|  PREDICTED: phosphoglycerate kinase, chloropl...    334   5e-108   Setaria italica
ref|XP_004970259.1|  PREDICTED: phosphoglycerate kinase, chloropl...    334   5e-108   Setaria italica
ref|XP_002971814.1|  hypothetical protein SELMODRAFT_267533             333   8e-108   
ref|XP_009135249.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    333   9e-108   Brassica rapa
ref|XP_006300323.1|  hypothetical protein CARUB_v10020404mg             330   9e-108   
emb|CDY24247.1|  BnaC01g38270D                                          333   1e-107   Brassica napus [oilseed rape]
ref|XP_010472814.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    330   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_003546821.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    330   1e-107   Glycine max [soybeans]
ref|XP_002889253.1|  hypothetical protein ARALYDRAFT_477124             329   3e-107   
gb|AIZ68220.1|  phosphoglycerate kinase                                 329   4e-107   Ornithogalum longebracteatum [sea-onion]
gb|ABI18157.1|  cytosolic phosphoglycerate kinase                       328   4e-107   Helianthus annuus
ref|XP_003531483.1|  PREDICTED: phosphoglycerate kinase, cytosolic      328   5e-107   
gb|KDO61597.1|  hypothetical protein CISIN_1g040813mg                   328   6e-107   Citrus sinensis [apfelsine]
ref|XP_010417621.1|  PREDICTED: phosphoglycerate kinase, cytosolic      328   7e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006389877.1|  hypothetical protein EUTSA_v10018657mg             328   8e-107   Eutrema salsugineum [saltwater cress]
ref|XP_011468861.1|  PREDICTED: phosphoglycerate kinase, cytosolic      328   8e-107   Fragaria vesca subsp. vesca
ref|XP_009124670.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    330   8e-107   Brassica rapa
ref|NP_001055937.1|  Os05g0496200                                       319   1e-106   
ref|NP_001167912.1|  phosphoglycerate kinase                            326   1e-106   Zea mays [maize]
sp|P29409.2|PGKH_SPIOL  RecName: Full=Phosphoglycerate kinase, ch...    328   1e-106   Spinacia oleracea
ref|XP_009791377.1|  PREDICTED: phosphoglycerate kinase, cytosolic      327   2e-106   Nicotiana sylvestris
ref|XP_009607754.1|  PREDICTED: phosphoglycerate kinase, cytosolic      327   2e-106   Nicotiana tomentosiformis
ref|XP_009384174.1|  PREDICTED: phosphoglycerate kinase, cytosolic      327   3e-106   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX87375.1|  BnaA07g34980D                                          326   3e-106   
ref|XP_006422250.1|  hypothetical protein CICLE_v10005101mg             326   3e-106   Citrus clementina [clementine]
ref|XP_007022579.1|  Phosphoglycerate kinase isoform 1                  326   4e-106   
emb|CDX67989.1|  BnaA07g20290D                                          324   4e-106   
gb|AAF85975.1|AF275639_1  cytosolic phosphoglycerate kinase             326   4e-106   Pisum sativum [garden pea]
ref|XP_010324204.1|  PREDICTED: phosphoglycerate kinase, cytosolic      326   5e-106   
emb|CBL95264.1|  phosphoglycerate kinase 1                              329   6e-106   Pinus pinaster [cluster pine]
gb|AIZ74346.1|  phosphoglycerate kinase 1                               329   8e-106   Pinus massoniana [Chinese red pine]
emb|CDX88547.1|  BnaC06g39910D                                          323   8e-106   
ref|XP_003596092.1|  Phosphoglycerate kinase                            325   9e-106   Medicago truncatula
ref|XP_003596093.1|  Phosphoglycerate kinase                            325   1e-105   Medicago truncatula
ref|XP_009106677.1|  PREDICTED: phosphoglycerate kinase, cytosolic      325   1e-105   Brassica rapa
ref|XP_010094705.1|  Phosphoglycerate kinase                            325   1e-105   Morus notabilis
emb|CDY49746.1|  BnaA02g19260D                                          324   1e-105   Brassica napus [oilseed rape]
ref|XP_009146585.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    327   1e-105   Brassica rapa
ref|XP_009128369.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    325   1e-105   Brassica rapa
gb|ABS19537.1|  CT114                                                   318   2e-105   [Lycopersicon] peruvianum var. humifusum
ref|XP_006858233.1|  PREDICTED: phosphoglycerate kinase, cytosolic      324   2e-105   Amborella trichopoda
gb|AAX57323.1|  putative phospho-glycerate kinase                       318   2e-105   Solanum habrochaites
gb|EEC71648.1|  hypothetical protein OsI_04088                          326   2e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_011016588.1|  PREDICTED: phosphoglycerate kinase, cytosolic      324   2e-105   Populus euphratica
gb|AAX57302.1|  putative phospho-glycerate kinase                       318   2e-105   Solanum peruvianum [Peruvian tomato]
gb|ABS19535.1|  CT114                                                   318   2e-105   Solanum chilense
ref|XP_011095716.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    324   2e-105   Sesamum indicum [beniseed]
gb|ABS19544.1|  CT114                                                   318   3e-105   [Lycopersicon] peruvianum var. humifusum
ref|XP_012087351.1|  PREDICTED: phosphoglycerate kinase, cytosolic      324   3e-105   Jatropha curcas
ref|XP_011013857.1|  PREDICTED: phosphoglycerate kinase, chloropl...    326   4e-105   Populus euphratica
gb|AFK46712.1|  unknown                                                 323   4e-105   Medicago truncatula
gb|EYU33791.1|  hypothetical protein MIMGU_mgv1a006853mg                324   5e-105   Erythranthe guttata [common monkey flower]
gb|AAZ85273.1|  putative phosphoglycerate kinase                        317   6e-105   Solanum chmielewskii
ref|XP_010669985.1|  PREDICTED: phosphoglycerate kinase, cytosolic      323   6e-105   Beta vulgaris subsp. vulgaris [field beet]
gb|ABS19556.1|  CT114                                                   317   7e-105   [Lycopersicon] peruvianum var. humifusum
gb|ABS19536.1|  CT114                                                   317   7e-105   Solanum chilense
gb|AGT16255.1|  phosphoglycerate kinase                                 326   7e-105   Saccharum hybrid cultivar R570
ref|XP_008226131.1|  PREDICTED: phosphoglycerate kinase, cytosolic      323   9e-105   Prunus mume [ume]
ref|NP_001275451.1|  phosphoglycerate kinase, cytosolic-like            323   1e-104   Solanum tuberosum [potatoes]
ref|XP_010936568.1|  PREDICTED: phosphoglycerate kinase, cytosolic      322   1e-104   Elaeis guineensis
gb|KJB14020.1|  hypothetical protein B456_002G107200                    321   1e-104   Gossypium raimondii
gb|ABS19538.1|  CT114                                                   316   1e-104   [Lycopersicon] peruvianum var. humifusum
ref|XP_002513352.1|  phosphoglycerate kinase, putative                  322   2e-104   Ricinus communis
emb|CDY70232.1|  BnaC02g46710D                                          322   2e-104   Brassica napus [oilseed rape]
ref|XP_008383158.1|  PREDICTED: phosphoglycerate kinase, cytosolic      322   2e-104   Malus domestica [apple tree]
ref|XP_010537804.1|  PREDICTED: phosphoglycerate kinase, cytosolic      322   2e-104   Tarenaya hassleriana [spider flower]
dbj|BAA33801.1|  cytosolic phosphoglycerate kinase 1                    321   3e-104   Populus nigra [black poplar]
ref|XP_007213914.1|  hypothetical protein PRUPE_ppa005669mg             323   3e-104   
gb|KJB14019.1|  hypothetical protein B456_002G107200                    321   4e-104   Gossypium raimondii
emb|CDX79326.1|  BnaC06g19770D                                          319   4e-104   
gb|AGV54662.1|  phosphoglycerate kinase chloroplastic-like protein      323   4e-104   Phaseolus vulgaris [French bean]
ref|XP_009777860.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    321   5e-104   Nicotiana sylvestris
gb|ABK92531.1|  unknown                                                 320   6e-104   Populus trichocarpa [western balsam poplar]
gb|AAO63774.1|  3-phosphoglycerate kinase                               320   7e-104   Populus tremuloides
gb|ABS19547.1|  CT114                                                   314   7e-104   [Lycopersicon] peruvianum var. humifusum
ref|XP_007149209.1|  hypothetical protein PHAVU_005G050800g             320   8e-104   Phaseolus vulgaris [French bean]
ref|XP_010941661.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    320   1e-103   Elaeis guineensis
gb|ABB86242.1|  phosphoglycerate kinase-like                            320   1e-103   Solanum tuberosum [potatoes]
ref|XP_010941660.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    320   2e-103   
gb|ACJ11718.1|  phosphoglycerate kinase                                 319   2e-103   Gossypium hirsutum [American cotton]
ref|XP_002315067.1|  cytosolic phosphoglycerate kinase family pro...    319   2e-103   
gb|ABK24564.1|  unknown                                                 323   2e-103   Picea sitchensis
emb|CBI24183.3|  unnamed protein product                                317   3e-103   Vitis vinifera
ref|XP_009414502.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    319   3e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312237.1|  hypothetical protein POPTR_0008s08400g             318   5e-103   
ref|XP_002263950.1|  PREDICTED: phosphoglycerate kinase, cytosolic      318   6e-103   Vitis vinifera
gb|ABF69999.1|  phosphoglycerate kinase, putative                       318   6e-103   Musa acuminata [banana]
emb|CDY52872.1|  BnaCnng23600D                                          329   6e-103   Brassica napus [oilseed rape]
emb|CDP13576.1|  unnamed protein product                                318   6e-103   Coffea canephora [robusta coffee]
ref|XP_009399252.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    318   8e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004488762.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    317   1e-102   Cicer arietinum [garbanzo]
ref|XP_009618219.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    317   2e-102   Nicotiana tomentosiformis
ref|XP_010544342.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    316   3e-102   Tarenaya hassleriana [spider flower]
ref|XP_008447095.1|  PREDICTED: phosphoglycerate kinase, cytosolic      316   5e-102   Cucumis melo [Oriental melon]
ref|XP_004139837.1|  PREDICTED: phosphoglycerate kinase, cytosolic      315   5e-102   Cucumis sativus [cucumbers]
ref|XP_010557291.1|  PREDICTED: phosphoglycerate kinase, cytosolic      316   7e-102   Tarenaya hassleriana [spider flower]
dbj|BAA33802.1|  cytosolic phosphoglycerate kinase 1                    315   7e-102   Populus nigra [black poplar]
ref|XP_011086347.1|  PREDICTED: phosphoglycerate kinase, cytosolic      315   7e-102   Sesamum indicum [beniseed]
ref|XP_008798227.1|  PREDICTED: phosphoglycerate kinase, cytosolic      315   8e-102   Phoenix dactylifera
ref|XP_011013882.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    314   2e-101   Populus euphratica
emb|CDP16886.1|  unnamed protein product                                314   2e-101   Coffea canephora [robusta coffee]
ref|XP_002977295.1|  hypothetical protein SELMODRAFT_107116             313   3e-101   Selaginella moellendorffii
gb|ADV16380.1|  cytosolic phosphoglycerate kinase 2                     313   4e-101   Helianthus annuus
gb|KCW71393.1|  hypothetical protein EUGRSUZ_F04463                     311   5e-101   Eucalyptus grandis [rose gum]
ref|XP_002972143.1|  hypothetical protein SELMODRAFT_96742              313   6e-101   Selaginella moellendorffii
ref|XP_008805982.1|  PREDICTED: phosphoglycerate kinase, cytosolic      313   7e-101   Phoenix dactylifera
dbj|BAJ88371.1|  predicted protein                                      312   7e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010064085.1|  PREDICTED: phosphoglycerate kinase, cytosolic      312   9e-101   Eucalyptus grandis [rose gum]
sp|P12783.1|PGKY_WHEAT  RecName: Full=Phosphoglycerate kinase, cy...    312   1e-100   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004951776.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    310   7e-100   Setaria italica
ref|XP_009104523.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    310   7e-100   Brassica rapa
ref|XP_003570108.1|  PREDICTED: phosphoglycerate kinase, cytosolic      308   5e-99    Brachypodium distachyon [annual false brome]
ref|NP_001058317.1|  Os06g0668200                                       307   8e-99    
ref|NP_001142404.1|  uncharacterized protein LOC100274579               306   3e-98    Zea mays [maize]
ref|XP_004966316.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    305   6e-98    Setaria italica
gb|EPS64076.1|  phosphoglycerate kinase                                 305   7e-98    Genlisea aurea
gb|EMT08517.1|  Phosphoglycerate kinase, cytosolic                      303   2e-97    
gb|AFW70281.1|  phosphoglycerate kinase                                 309   3e-97    
ref|XP_006656354.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    302   8e-97    Oryza brachyantha
ref|XP_009417722.1|  PREDICTED: phosphoglycerate kinase, cytosolic      301   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011013868.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    301   6e-96    Populus euphratica
dbj|BAJ85222.1|  predicted protein                                      299   1e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006646936.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    298   4e-95    Oryza brachyantha
gb|AFH41102.1|  plastid 3-phosphoglycerate kinase                       294   4e-95    Triticum aestivum [Canadian hard winter wheat]
gb|ACO40271.1|  3-phosphoglycerate kinase                               294   5e-95    Leymus pseudoracemosus
gb|EMT29203.1|  Phosphoglycerate kinase, cytosolic                      300   5e-95    
gb|AFH41108.1|  plastid 3-phosphoglycerate kinase                       294   6e-95    Triticum aestivum subsp. yunnanense
gb|AFH41091.1|  plastid 3-phosphoglycerate kinase                       294   6e-95    Triticum compactum
gb|ACO40274.1|  3-phosphoglycerate kinase                               294   6e-95    Leymus duthiei
gb|AFH41121.1|  plastid 3-phosphoglycerate kinase                       294   6e-95    Triticum spelta [spelt]
gb|AAM51702.1|AF343476_1  3-phosphoglycerate kinase                     294   6e-95    Triticum dicoccoides [wild emmer wheat]
gb|AAM51700.1|AF343474_1  3-phosphoglycerate kinase                     294   6e-95    Triticum urartu
gb|ACO40272.1|  3-phosphoglycerate kinase                               294   6e-95    Leymus secalinus
gb|ACO40247.1|  3-phosphoglycerate kinase                               294   6e-95    Psathyrostachys fragilis
ref|WP_011377868.1|  MULTISPECIES: phosphoglycerate kinase              297   6e-95    Synechococcus
gb|AID16262.1|  phosphoglycerate kinase                                 294   6e-95    Triticum petropavlovskyi
gb|AFH41131.1|  plastid 3-phosphoglycerate kinase                       294   7e-95    Triticum turgidum subsp. turanicum
gb|AEQ59408.1|  3-phosphoglycerate kinase                               294   7e-95    Kengyilia rigidula
gb|AID16252.1|  phosphoglycerate kinase                                 294   7e-95    Triticum aestivum subsp. yunnanense
gb|AFH41101.1|  plastid 3-phosphoglycerate kinase                       294   7e-95    Triticum aestivum [Canadian hard winter wheat]
gb|AGL91125.1|  3-phosphoglycerate kinase                               293   8e-95    Elymus kamoji
gb|AEQ59379.1|  3-phosphoglycerate kinase                               293   8e-95    Kengyilia hirsuta
gb|AEQ59377.1|  3-phosphoglycerate kinase                               293   8e-95    Kengyilia kokonorica
gb|ACO40277.1|  3-phosphoglycerate kinase                               293   8e-95    Leymus arenarius
gb|ACO40261.1|  3-phosphoglycerate kinase                               293   8e-95    Heteranthelium piliferum
gb|AID16255.1|  phosphoglycerate kinase                                 293   9e-95    Triticum petropavlovskyi
gb|AEQ59380.1|  3-phosphoglycerate kinase                               293   9e-95    Kengyilia hirsuta
gb|AFH41149.1|  plastid 3-phosphoglycerate kinase                       293   9e-95    Triticum timopheevii [Sanduri wheat]
gb|AEQ59398.1|  3-phosphoglycerate kinase                               293   9e-95    Kengyilia alatavica
gb|AFH41130.1|  plastid 3-phosphoglycerate kinase                       293   9e-95    Triticum petropavlovskyi
gb|ACO40268.1|  3-phosphoglycerate kinase                               293   1e-94    Peridictyon sanctum
gb|ACO40256.1|  3-phosphoglycerate kinase                               293   1e-94    Australopyrum retrofractum
gb|AFH41088.1|  plastid 3-phosphoglycerate kinase                       293   1e-94    Triticum carthlicum [Persian black wheat]
gb|ACO40262.1|  3-phosphoglycerate kinase                               293   2e-94    Psathyrostachys juncea
ref|WP_015184203.1|  phosphoglycerate kinase                            296   2e-94    Microcoleus sp. PCC 7113
gb|AFH41155.1|  plastid 3-phosphoglycerate kinase                       293   2e-94    Triticum aestivum subsp. yunnanense
gb|AFH41074.1|  plastid 3-phosphoglycerate kinase                       293   2e-94    Triticum aestivum [Canadian hard winter wheat]
ref|WP_041032823.1|  phosphoglycerate kinase                            296   2e-94    Tolypothrix campylonemoides
gb|AEQ59407.1|  3-phosphoglycerate kinase                               292   2e-94    Kengyilia tahelacana
gb|AEQ59375.1|  3-phosphoglycerate kinase                               292   2e-94    Kengyilia batalinii var. nana
gb|AFH41104.1|  plastid 3-phosphoglycerate kinase                       292   3e-94    Triticum macha
ref|WP_035992253.1|  phosphoglycerate kinase                            295   3e-94    Leptolyngbya sp. KIOST-1
ref|WP_016865730.1|  phosphoglycerate kinase                            295   3e-94    Fischerella muscicola
gb|AFH41144.1|  plastid 3-phosphoglycerate kinase                       292   3e-94    Triticum spelta [spelt]
ref|WP_011242745.1|  phosphoglycerate kinase                            295   4e-94    Synechococcus elongatus
gb|AEQ59383.1|  3-phosphoglycerate kinase                               292   4e-94    Kengyilia zhaosuensis
gb|AFH41099.1|  plastid 3-phosphoglycerate kinase                       292   4e-94    Triticum turgidum [cone wheat]
gb|AGL91123.1|  3-phosphoglycerate kinase                               292   4e-94    Elymus nutans
gb|AEQ59378.1|  3-phosphoglycerate kinase                               291   5e-94    Kengyilia hirsuta
dbj|BAA21478.1|  phosphoglycerate kinase                                289   5e-94    Robinia pseudoacacia [black locust]
gb|AFH41095.1|  plastid 3-phosphoglycerate kinase                       291   5e-94    Triticum carthlicum [Persian black wheat]
gb|ACO40270.1|  3-phosphoglycerate kinase                               291   5e-94    Elymus caninus
ref|WP_029637902.1|  phosphoglycerate kinase [                          295   5e-94    [Scytonema hofmanni] UTEX B 1581
gb|AFH41081.1|  plastid 3-phosphoglycerate kinase                       291   5e-94    Aegilops tauschii subsp. tauschii x Triticum turgidum subsp. polonicum
gb|ACO40239.1|  3-phosphoglycerate kinase                               291   5e-94    Elymus canadensis
gb|AGL91113.1|  3-phosphoglycerate kinase                               291   5e-94    Elymus elytrigioides
gb|AGL91045.1|  3-phosphoglycerate kinase                               291   5e-94    Elymus alashanicus
gb|ACO40243.1|  3-phosphoglycerate kinase                               291   5e-94    Elymus hystrix
gb|ACO40269.1|  3-phosphoglycerate kinase                               291   5e-94    Leymus akmolinensis
gb|ACO40241.1|  3-phosphoglycerate kinase                               291   5e-94    Elymus wawawaiensis [Snake River wheatgrass]
gb|ACO40276.1|  3-phosphoglycerate kinase                               291   6e-94    Leymus komarovii
gb|AGL91127.1|  3-phosphoglycerate kinase                               291   6e-94    Anthosachne rectiseta
gb|AFH41073.1|  plastid 3-phosphoglycerate kinase                       291   7e-94    Triticum aestivum [Canadian hard winter wheat]
ref|WP_017300589.1|  phosphoglycerate kinase                            295   8e-94    Nodosilinea nodulosa
gb|AFH41140.1|  plastid 3-phosphoglycerate kinase                       291   8e-94    Triticum sphaerococcum
gb|AID16253.1|  phosphoglycerate kinase                                 291   9e-94    Triticum aestivum subsp. yunnanense
ref|NP_001046020.1|  Os02g0169300                                       295   9e-94    
gb|ACO40267.1|  3-phosphoglycerate kinase                               291   9e-94    Thinopyrum bessarabicum
gb|AEQ59418.1|  3-phosphoglycerate kinase                               291   9e-94    
gb|AEQ59384.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AGL91112.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AAM51708.1|AF343482_1  3-phosphoglycerate kinase                     291   1e-93    
gb|AEQ59435.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AEQ59427.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|ABI74567.1|  phosphoglycerate kinase                                 294   1e-93    
gb|ACO40260.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AEQ59436.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|ACO40259.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AEQ59386.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AEQ59432.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|ACO40251.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AGL91108.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AID16261.1|  phosphoglycerate kinase                                 291   1e-93    
gb|AAM51720.1|AF343494_1  3-phosphoglycerate kinase                     291   1e-93    
gb|AGL91121.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AFH41139.1|  plastid 3-phosphoglycerate kinase                       291   1e-93    
gb|AEQ59417.1|  3-phosphoglycerate kinase                               291   1e-93    
gb|AGL91103.1|  3-phosphoglycerate kinase                               290   1e-93    
gb|ACO40273.1|  3-phosphoglycerate kinase                               290   1e-93    
gb|AID16249.1|  phosphoglycerate kinase                                 290   1e-93    
gb|AGL91128.1|  3-phosphoglycerate kinase                               290   1e-93    
gb|AEQ59402.1|  3-phosphoglycerate kinase                               290   1e-93    
gb|AEQ59382.1|  3-phosphoglycerate kinase                               290   1e-93    
ref|WP_026734580.1|  phosphoglycerate kinase                            293   2e-93    
gb|AEQ59403.1|  3-phosphoglycerate kinase                               290   2e-93    
gb|AID16246.1|  phosphoglycerate kinase                                 290   2e-93    
gb|ACO40257.1|  3-phosphoglycerate kinase                               290   2e-93    
gb|ACO40266.1|  3-phosphoglycerate kinase                               290   2e-93    
ref|WP_026135280.1|  phosphoglycerate kinase                            293   3e-93    
gb|AFH41084.1|  plastid 3-phosphoglycerate kinase                       290   3e-93    
gb|ACO40263.1|  3-phosphoglycerate kinase                               290   3e-93    
gb|ACO40249.1|  3-phosphoglycerate kinase                               290   3e-93    
gb|AGL91104.1|  3-phosphoglycerate kinase                               290   3e-93    
gb|AFH41124.1|  plastid 3-phosphoglycerate kinase                       290   3e-93    
gb|AEQ59415.1|  3-phosphoglycerate kinase                               290   3e-93    
gb|AGL91124.1|  3-phosphoglycerate kinase                               289   4e-93    
gb|AEQ59399.1|  3-phosphoglycerate kinase                               289   4e-93    
gb|AEQ59396.1|  3-phosphoglycerate kinase                               289   4e-93    
ref|WP_013321558.1|  phosphoglycerate kinase                            293   4e-93    
gb|AGL91129.1|  3-phosphoglycerate kinase                               289   4e-93    
gb|AEQ59411.1|  3-phosphoglycerate kinase                               289   4e-93    
ref|WP_017309094.1|  MULTISPECIES: phosphoglycerate kinase              293   4e-93    
gb|AEQ59421.1|  3-phosphoglycerate kinase                               289   5e-93    
ref|WP_016861411.1|  phosphoglycerate kinase                            292   5e-93    
gb|AEQ59420.1|  3-phosphoglycerate kinase                               289   5e-93    
gb|AEQ59414.1|  3-phosphoglycerate kinase                               289   5e-93    
gb|AFH41106.1|  plastid 3-phosphoglycerate kinase                       289   6e-93    
gb|AEQ59434.1|  3-phosphoglycerate kinase                               289   6e-93    
ref|WP_009454679.1|  MULTISPECIES: phosphoglycerate kinase              292   7e-93    
ref|WP_039739530.1|  phosphoglycerate kinase                            292   8e-93    
gb|ACO40254.1|  3-phosphoglycerate kinase                               288   8e-93    
gb|AFH41137.1|  plastid 3-phosphoglycerate kinase                       288   8e-93    
gb|ACO40255.1|  3-phosphoglycerate kinase                               288   9e-93    
gb|AEQ59412.1|  3-phosphoglycerate kinase                               288   9e-93    
gb|AAM51719.1|AF343493_1  3-phosphoglycerate kinase                     288   9e-93    
ref|WP_015149149.1|  phosphoglycerate kinase                            292   9e-93    
ref|WP_026098466.1|  phosphoglycerate kinase                            292   1e-92    
gb|AEQ59393.1|  3-phosphoglycerate kinase                               288   1e-92    
gb|ABI74568.1|  phosphoglycerate kinase                                 291   1e-92    
ref|WP_027842190.1|  phosphoglycerate kinase                            291   1e-92    
gb|AEQ59413.1|  3-phosphoglycerate kinase                               288   1e-92    
gb|AEQ59422.1|  3-phosphoglycerate kinase                               288   1e-92    
gb|AEQ59392.1|  3-phosphoglycerate kinase                               288   1e-92    
ref|WP_026719925.1|  phosphoglycerate kinase                            291   1e-92    
gb|KIE11439.1|  phosphoglycerate kinase                                 291   1e-92    
gb|ACO40264.1|  3-phosphoglycerate kinase                               288   1e-92    
gb|AEQ59387.1|  3-phosphoglycerate kinase                               288   2e-92    
ref|WP_011936642.1|  phosphoglycerate kinase                            291   2e-92    
gb|AEQ59391.1|  3-phosphoglycerate kinase                               287   2e-92    
ref|WP_016873269.1|  phosphoglycerate kinase                            291   2e-92    
ref|WP_028089947.1|  phosphoglycerate kinase                            291   2e-92    
ref|WP_039728851.1|  MULTISPECIES: phosphoglycerate kinase              291   2e-92    
gb|AEQ59409.1|  3-phosphoglycerate kinase                               287   2e-92    
gb|AGL91126.1|  3-phosphoglycerate kinase                               287   3e-92    
dbj|BAQ61019.1|  phosphoglycerate kinase                                291   3e-92    
ref|WP_040940054.1|  phosphoglycerate kinase                            291   3e-92    
gb|ACO40242.1|  3-phosphoglycerate kinase                               287   3e-92    
ref|WP_006528046.1|  phosphoglycerate kinase                            290   4e-92    
ref|WP_015190859.1|  phosphoglycerate kinase                            290   4e-92    
gb|ACO40279.1|  3-phosphoglycerate kinase                               286   4e-92    
gb|ACO40258.1|  3-phosphoglycerate kinase                               286   6e-92    
ref|WP_040931032.1|  phosphoglycerate kinase                            290   6e-92    
ref|WP_035831895.1|  phosphoglycerate kinase                            290   6e-92    
dbj|BAA18521.1|  phosphoglycerate kinase                                289   7e-92    
ref|WP_041765481.1|  phosphoglycerate kinase                            289   9e-92    
sp|P74421.2|PGK_SYNY3  RecName: Full=Phosphoglycerate kinase            289   9e-92    
ref|WP_010873144.1|  phosphoglycerate kinase                            289   9e-92    
gb|AEQ59430.1|  3-phosphoglycerate kinase                               286   1e-91    
ref|WP_015166011.1|  phosphoglycerate kinase                            289   1e-91    
ref|WP_007099195.1|  phosphoglycerate kinase                            289   1e-91    
gb|AFY38465.1|  phosphoglycerate kinase                                 289   1e-91    
ref|WP_017294263.1|  phosphoglycerate kinase                            289   1e-91    
ref|WP_028085373.1|  phosphoglycerate kinase                            289   1e-91    
gb|ACO40245.1|  3-phosphoglycerate kinase                               285   1e-91    
ref|WP_015218887.1|  phosphoglycerate kinase                            288   2e-91    
ref|WP_026097925.1|  phosphoglycerate kinase                            288   2e-91    
ref|WP_015119342.1|  phosphoglycerate kinase                            288   2e-91    
ref|WP_017323648.1|  phosphoglycerate kinase                            288   3e-91    
gb|AEQ59431.1|  3-phosphoglycerate kinase                               285   3e-91    
ref|WP_006105635.1|  phosphoglycerate kinase                            288   3e-91    
ref|WP_015145174.1|  phosphoglycerate kinase                            288   3e-91    
ref|WP_028953033.1|  phosphoglycerate kinase                            288   4e-91    
ref|WP_011827369.1|  phosphoglycerate kinase                            288   4e-91    
ref|WP_038552523.1|  phosphoglycerate kinase                            288   4e-91    
ref|WP_016924803.1|  phosphoglycerate kinase                            287   5e-91    
gb|AEQ59423.1|  3-phosphoglycerate kinase                               284   6e-91    
ref|WP_011129182.1|  phosphoglycerate kinase                            287   6e-91    
dbj|BAQ65449.1|  phosphoglycerate kinase                                287   6e-91    
ref|WP_017289328.1|  phosphoglycerate kinase                            287   6e-91    
ref|WP_009628155.1|  phosphoglycerate kinase                            286   9e-91    
ref|WP_011620601.1|  phosphoglycerate kinase                            286   9e-91    
ref|WP_015198799.1|  phosphoglycerate kinase                            286   1e-90    
ref|WP_036911068.1|  MULTISPECIES: phosphoglycerate kinase              286   1e-90    
gb|ABR25550.1|  phosphoglycerate kinase                                 278   1e-90    
ref|WP_017303631.1|  phosphoglycerate kinase                            286   2e-90    
ref|WP_019495207.1|  phosphoglycerate kinase                            286   2e-90    
ref|WP_006850489.1|  phosphoglycerate kinase                            286   2e-90    
ref|WP_011131470.1|  phosphoglycerate kinase                            286   2e-90    
ref|WP_011058101.1|  phosphoglycerate kinase                            285   2e-90    
ref|WP_011365387.1|  phosphoglycerate kinase                            285   3e-90    
ref|WP_012194769.1|  phosphoglycerate kinase                            285   3e-90    
gb|AGH55660.1|  phosphoglycerate kinase                                 284   3e-90    
ref|WP_043693415.1|  phosphoglycerate kinase                            285   3e-90    
gb|KGG29033.1|  Phosphoglycerate kinase                                 286   3e-90    
ref|WP_008189591.1|  phosphoglycerate kinase                            285   3e-90    
ref|WP_024125258.1|  phosphoglycerate kinase                            285   5e-90    
ref|WP_008234716.1|  phosphoglycerate kinase                            285   5e-90    
ref|WP_012598967.1|  phosphoglycerate kinase                            285   6e-90    
ref|WP_015785332.1|  MULTISPECIES: phosphoglycerate kinase              284   8e-90    
ref|WP_006042911.1|  phosphoglycerate kinase                            284   1e-89    
ref|WP_011360883.1|  phosphoglycerate kinase                            284   1e-89    
ref|WP_009788740.1|  phosphoglycerate kinase                            284   1e-89    
ref|WP_017317549.1|  phosphoglycerate kinase                            283   2e-89    
ref|WP_015167138.1|  phosphoglycerate kinase                            283   2e-89    
ref|WP_035157181.1|  phosphoglycerate kinase                            283   2e-89    
ref|WP_006507734.1|  phosphoglycerate kinase                            283   2e-89    
ref|WP_011934238.1|  phosphoglycerate kinase                            283   2e-89    
ref|WP_028947361.1|  phosphoglycerate kinase                            282   4e-89    
ref|WP_006854064.1|  phosphoglycerate kinase                            282   5e-89    
ref|WP_036901530.1|  phosphoglycerate kinase                            282   6e-89    
ref|WP_009631644.1|  phosphoglycerate kinase                            282   6e-89    
ref|WP_015193656.1|  phosphoglycerate kinase                            281   8e-89    
ref|WP_045868399.1|  phosphoglycerate kinase                            281   8e-89    
gb|AGL76992.1|  phosphoglycerate kinase                                 280   9e-89    
ref|WP_006173249.1|  phosphoglycerate kinase                            281   9e-89    
ref|YP_002049002.1|  Phosphoglycerate kinase                            281   1e-88    
ref|XP_001699523.1|  phosphoglycerate kinase                            283   1e-88    
ref|WP_007352879.1|  MULTISPECIES: phosphoglycerate kinase              281   2e-88    
ref|WP_019502041.1|  phosphoglycerate kinase                            280   3e-88    
ref|WP_038547249.1|  phosphoglycerate kinase                            280   4e-88    
ref|WP_023076270.1|  phosphoglycerate kinase                            280   4e-88    
ref|WP_006911676.1|  phosphoglycerate kinase                            279   9e-88    
ref|WP_030007016.1|  phosphoglycerate kinase                            278   1e-87    
gb|KGG11463.1|  Phosphoglycerate kinase                                 278   1e-87    
ref|WP_012307199.1|  phosphoglycerate kinase                            278   2e-87    
ref|WP_019507461.1|  phosphoglycerate kinase                            278   2e-87    
ref|WP_011124376.1|  MULTISPECIES: phosphoglycerate kinase              278   2e-87    
ref|WP_036484843.1|  phosphoglycerate kinase                            278   3e-87    
ref|XP_002951648.1|  phosphoglycerate kinase                            279   4e-87    
ref|WP_036916478.1|  MULTISPECIES: phosphoglycerate kinase              277   6e-87    
gb|ABR16231.1|  unknown                                                 278   9e-87    
ref|WP_009343450.1|  phosphoglycerate kinase                            276   1e-86    
ref|WP_024545807.1|  phosphoglycerate kinase                            276   1e-86    
ref|WP_006278490.1|  phosphoglycerate kinase                            276   1e-86    
ref|WP_027404640.1|  phosphoglycerate kinase                            276   1e-86    
ref|WP_039205250.1|  phosphoglycerate kinase                            276   2e-86    
ref|WP_011429225.1|  phosphoglycerate kinase                            275   3e-86    
ref|WP_011317630.1|  phosphoglycerate kinase                            275   3e-86    
ref|XP_005646469.1|  phosphoglycerate kinase precursor                  276   4e-86    
ref|WP_034417079.1|  phosphoglycerate kinase                            274   7e-86    
gb|AJW30303.1|  Phosphoglycerate kinase                                 274   7e-86    
gb|AAM51721.1|AF343495_1  3-phosphoglycerate kinase                     271   7e-86    
ref|WP_036904641.1|  phosphoglycerate kinase                            274   1e-85    
ref|WP_037220338.1|  phosphoglycerate kinase                            273   1e-85    
ref|WP_010998270.1|  phosphoglycerate kinase                            273   1e-85    
gb|KIZ02489.1|  phosphoglycerate kinase                                 265   1e-85    
ref|WP_015204810.1|  phosphoglycerate kinase                            273   2e-85    
ref|WP_026101118.1|  phosphoglycerate kinase                            273   2e-85    
ref|WP_011823052.1|  phosphoglycerate kinase                            273   3e-85    
ref|WP_015080710.1|  phosphoglycerate kinase                            273   3e-85    
ref|WP_012412172.1|  phosphoglycerate kinase                            272   4e-85    
gb|KIJ83619.1|  phosphoglycerate kinase                                 272   4e-85    
ref|WP_006515662.1|  phosphoglycerate kinase                            272   5e-85    
ref|WP_015110302.1|  phosphoglycerate kinase                            272   5e-85    
ref|WP_015162225.1|  phosphoglycerate kinase                            271   7e-85    
ref|WP_011294195.1|  phosphoglycerate kinase                            271   7e-85    
ref|WP_015153171.1|  phosphoglycerate kinase                            271   1e-84    
ref|WP_038650981.1|  phosphoglycerate kinase                            271   1e-84    
sp|P41758.1|PGKH_CHLRE  RecName: Full=Phosphoglycerate kinase, ch...    273   1e-84    
ref|WP_008311068.1|  phosphoglycerate kinase                            271   2e-84    
ref|WP_010305334.1|  phosphoglycerate kinase                            270   2e-84    
ref|XP_005851590.1|  hypothetical protein CHLNCDRAFT_29609              270   2e-84    
ref|WP_025980179.1|  phosphoglycerate kinase                            264   2e-84    
ref|WP_025980856.1|  phosphoglycerate kinase                            263   3e-84    
ref|WP_011433296.1|  phosphoglycerate kinase                            270   3e-84    
ref|WP_045054377.1|  phosphoglycerate kinase                            270   5e-84    
ref|WP_010313479.1|  phosphoglycerate kinase                            269   5e-84    
ref|WP_039715776.1|  phosphoglycerate kinase                            269   5e-84    
ref|WP_015224558.1|  phosphoglycerate kinase                            269   5e-84    
ref|WP_022604954.1|  phosphoglycerate kinase                            269   6e-84    
ref|WP_025942147.1|  phosphoglycerate kinase                            266   6e-84    
gb|EMS46092.1|  Phosphoglycerate kinase, cytosolic                      270   8e-84    
ref|WP_002781096.1|  phosphoglycerate kinase                            268   1e-83    
ref|WP_007101320.1|  phosphoglycerate kinase                            268   2e-83    
ref|WP_002747672.1|  phosphoglycerate kinase                            268   2e-83    
ref|WP_025943278.1|  phosphoglycerate kinase                            268   2e-83    
ref|WP_002802732.1|  phosphoglycerate kinase                            268   2e-83    
ref|WP_025934740.1|  phosphoglycerate kinase                            268   3e-83    
ref|WP_025913196.1|  MULTISPECIES: phosphoglycerate kinase              268   3e-83    
ref|WP_025924106.1|  phosphoglycerate kinase                            268   3e-83    
ref|WP_025925003.1|  MULTISPECIES: phosphoglycerate kinase              267   3e-83    
ref|WP_025968960.1|  phosphoglycerate kinase                            267   3e-83    
ref|WP_025943564.1|  MULTISPECIES: phosphoglycerate kinase              267   3e-83    
ref|WP_025934229.1|  phosphoglycerate kinase                            267   3e-83    
ref|WP_032517310.1|  phosphoglycerate kinase                            267   3e-83    
ref|WP_025962791.1|  phosphoglycerate kinase                            267   3e-83    
ref|WP_011817688.1|  MULTISPECIES: phosphoglycerate kinase              267   3e-83    
ref|WP_025922800.1|  phosphoglycerate kinase                            267   3e-83    
ref|WP_025906011.1|  MULTISPECIES: phosphoglycerate kinase              267   3e-83    



>ref|XP_008456300.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Cucumis melo]
Length=485

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/192 (95%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDV+I
Sbjct  293  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVII  352

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  353  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  412

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  413  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  472

Query  291  GVIALDEAVPVA  256
            GV+ALDEAVPVA
Sbjct  473  GVLALDEAVPVA  484



>ref|XP_011095719.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/192 (96%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTF+DALETTKTVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFSDALETTKTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++A KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  409  VGTEAIANKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  468

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  469  GVLALDEATPVA  480



>ref|XP_004139904.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN46797.1| hypothetical protein Csa_6G136020 [Cucumis sativus]
Length=485

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/192 (95%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDV+I
Sbjct  293  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVII  352

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  353  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  412

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELP
Sbjct  413  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELP  472

Query  291  GVIALDEAVPVA  256
            GV+ALDEAVPVA
Sbjct  473  GVLALDEAVPVA  484



>gb|KJB14026.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=488

 Score =   362 bits (929),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/192 (95%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVI
Sbjct  296  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVI  355

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  356  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTIIWNGPMGVFEFDKFA  415

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  416  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  475

Query  291  GVIALDEAVPVA  256
            GVIALDEAVPVA
Sbjct  476  GVIALDEAVPVA  487



>gb|KJB14025.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=491

 Score =   362 bits (929),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 182/192 (95%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVI
Sbjct  296  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVI  355

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  356  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTIIWNGPMGVFEFDKFA  415

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  416  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  475

Query  291  GVIALDEAVPVA  256
            GVIALDEAVPVA
Sbjct  476  GVIALDEAVPVA  487



>ref|XP_011086346.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   361 bits (927),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 183/192 (95%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA SKVVPASAIPDGWMGLDIGPDSVKTF+DALETTKTVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDAESKVVPASAIPDGWMGLDIGPDSVKTFSDALETTKTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++A KLAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELP
Sbjct  409  VGTEAIANKLAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELP  468

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  469  GVLALDEATPVA  480



>gb|KHG01489.1| hypothetical protein F383_22605 [Gossypium arboreum]
Length=488

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/192 (94%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVI
Sbjct  296  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVI  355

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+T+IWNGPMGVFEF+KFA
Sbjct  356  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTIIWNGPMGVFEFEKFA  415

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  416  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  475

Query  291  GVIALDEAVPVA  256
            GVIALDEAVPVA
Sbjct  476  GVIALDEAVPVA  487



>ref|XP_009763674.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
sylvestris]
Length=481

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/193 (95%), Positives = 189/193 (98%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LP
Sbjct  408  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLP  467

Query  291  GVIALDEA-VPVA  256
            GVIALDEA  PVA
Sbjct  468  GVIALDEADAPVA  480



>sp|Q42961.1|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
Length=481

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/193 (95%), Positives = 189/193 (98%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LP
Sbjct  408  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLP  467

Query  291  GVIALDEA-VPVA  256
            GVIALDEA  PVA
Sbjct  468  GVIALDEADAPVA  480



>ref|XP_010269369.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Nelumbo 
nucifera]
Length=486

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/192 (93%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAK+KGVSLLLP+DVV+
Sbjct  294  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPSDVVV  353

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+KTFN+AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  354  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKTFNEALDTTKTIIWNGPMGVFEFDKFA  413

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  414  VGTEAVAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  473

Query  291  GVIALDEAVPVA  256
            GV+ALDEAV VA
Sbjct  474  GVLALDEAVAVA  485



>ref|XP_009622055.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=481

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/193 (95%), Positives = 189/193 (98%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LP
Sbjct  408  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLP  467

Query  291  GVIALDEA-VPVA  256
            GVIALDEA  PVA
Sbjct  468  GVIALDEADAPVA  480



>ref|XP_012087352.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Jatropha curcas]
 gb|KDP25067.1| hypothetical protein JCGZ_22602 [Jatropha curcas]
Length=487

 Score =   356 bits (914),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 180/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  295  LEKVDVLLLGGGMIFTFYKAQGLSVGSSLVEEDKLNLATSLLEKAKAKGVSLLLPSDVVI  354

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPASAIPDGWMGLDIGP+SVKTF++ALETTKTVIWNGPMGVFEFDKFA
Sbjct  355  ADKFAPDANSKVVPASAIPDGWMGLDIGPESVKTFSEALETTKTVIWNGPMGVFEFDKFA  414

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  415  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  474

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  475  GVLALDEATPVA  486



>gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
Length=481

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LP
Sbjct  408  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLP  467

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  468  GVVALDEA  475



>ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=479

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/192 (94%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLPTDVVI
Sbjct  287  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLAKAKLKGVSLLLPTDVVI  346

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVV ASAIPDGWMGLD+GP+SVKTFN+ALETTKTVIWNGPMGVFEFDKFA
Sbjct  347  ADKFAPDANSKVVAASAIPDGWMGLDVGPESVKTFNEALETTKTVIWNGPMGVFEFDKFA  406

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  407  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVAEVMSHISTGGGASLELLEGKELP  466

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  467  GVLALDEATPVA  478



>ref|XP_004243968.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   355 bits (911),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 188/193 (97%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LP
Sbjct  409  TGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEA-VPVA  256
            GVIALDEA  PVA
Sbjct  469  GVIALDEADAPVA  481



>ref|XP_008383150.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KA AKGVSLLLPTDVVI
Sbjct  288  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLMAKANAKGVSLLLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  408  EGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  467

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  468  GVLALDEATPV  478



>gb|AAC26785.1| phosphoglycerate kinase precursor [Solanum tuberosum]
Length=482

 Score =   354 bits (909),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 188/193 (97%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LP
Sbjct  409  TGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEA-VPVA  256
            GVIALDEA  PVA
Sbjct  469  GVIALDEADAPVA  481



>gb|ABB86255.1| phosphoglycerate kinase precursor-like [Solanum tuberosum]
Length=482

 Score =   354 bits (909),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 188/193 (97%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LP
Sbjct  409  TGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEA-VPVA  256
            GVIALDEA  PVA
Sbjct  469  GVIALDEADAPVA  481



>ref|NP_001275227.1| phosphoglycerate kinase, chloroplastic-like [Solanum tuberosum]
 gb|ABB72817.1| phosphoglycerate kinase precursor-like protein [Solanum tuberosum]
Length=482

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 188/193 (97%), Gaps = 1/193 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LP
Sbjct  409  AGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEA-VPVA  256
            GVIALDEA  PVA
Sbjct  469  GVIALDEADAPVA  481



>ref|XP_008786111.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=491

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCD+LLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK++GVSL+LPTDVV+
Sbjct  299  LEKCDVLLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLVKAKSRGVSLMLPTDVVV  358

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDAN+KVVP++AIPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEFDKFA
Sbjct  359  ADKFAPDANTKVVPSTAIPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFDKFA  418

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  419  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  478

Query  291  GVIALDEAVPVA  256
            GV+ALDEAVPVA
Sbjct  479  GVVALDEAVPVA  490



>ref|XP_010936574.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Elaeis guineensis]
Length=490

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 177/192 (92%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL+KAK+KGVSL+LPTDVVI
Sbjct  298  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLKKAKSKGVSLMLPTDVVI  357

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVP++AIPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEF+KFA
Sbjct  358  ADKFAADANSKVVPSTAIPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFEKFA  417

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTT+IGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  418  VGTEAIAKKLAELSGKGVTTVIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  477

Query  291  GVIALDEAVPVA  256
            GV+ALDEAVPVA
Sbjct  478  GVVALDEAVPVA  489



>ref|XP_008805983.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
 ref|XP_008776889.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=488

 Score =   354 bits (909),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 178/192 (93%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL+KAK+KGVSL+LP DVVI
Sbjct  296  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLKKAKSKGVSLMLPADVVI  355

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVP++AIPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEFDKFA
Sbjct  356  ADKFAADANSKVVPSTAIPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFDKFA  415

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  416  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  475

Query  291  GVIALDEAVPVA  256
            GV+ALDEAVPVA
Sbjct  476  GVVALDEAVPVA  487



>ref|XP_010060861.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW67742.1| hypothetical protein EUGRSUZ_F01476 [Eucalyptus grandis]
Length=484

 Score =   354 bits (908),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL+KAKAKGVSLLLPTDVVI
Sbjct  292  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLKKAKAKGVSLLLPTDVVI  351

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+KTFNDAL TTKTVIWNGPMGVFEFDKFA
Sbjct  352  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKTFNDALGTTKTVIWNGPMGVFEFDKFA  411

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAKKLAELS  GVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  412  AGTEAVAKKLAELSAAGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  471

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  472  GVVALDEATPV  482



>emb|CBI24182.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   351 bits (900),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVI
Sbjct  213  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLSLATSLLEKAKAKGVSLLLPTDVVI  272

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+K FN+ALETTKTVIWNGPMGVFEFDKFA
Sbjct  273  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKIFNEALETTKTVIWNGPMGVFEFDKFA  332

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT +VAKKLAELSGK VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  333  EGTVAVAKKLAELSGKDVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  392

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  393  GVVALDEATPV  403



>ref|XP_008371996.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVI
Sbjct  288  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLMAKAKAKGVSLLLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  408  EGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  467

Query  291  GVIALDEAVPV  259
            GV+ALDEA+ V
Sbjct  468  GVLALDEAILV  478



>ref|XP_008346077.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Malus domestica]
Length=480

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/191 (93%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVI
Sbjct  288  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLMAKAKAKGVSLLLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  408  EGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  467

Query  291  GVIALDEAVPV  259
            GV+ALDEA+ V
Sbjct  468  GVLALDEAILV  478



>ref|XP_002263796.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Vitis vinifera]
 emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
Length=478

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/191 (94%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVI
Sbjct  286  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLSLATSLLEKAKAKGVSLLLPTDVVI  345

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+K FN+ALETTKTVIWNGPMGVFEFDKFA
Sbjct  346  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKIFNEALETTKTVIWNGPMGVFEFDKFA  405

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT +VAKKLAELSGK VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  406  EGTVAVAKKLAELSGKDVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  465

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  466  GVVALDEATPV  476



>ref|XP_007022578.1| Phosphoglycerate kinase 1 [Theobroma cacao]
 gb|EOY14103.1| Phosphoglycerate kinase 1 [Theobroma cacao]
Length=491

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVVI
Sbjct  296  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATLLLAKAKAKGVSLLLPTDVVI  355

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+VVPASAIPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  356  ADKFAPDANSQVVPASAIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFA  415

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  416  TGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  475

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  476  GVVALDEATPV  486



>gb|KDO61594.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=474

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 187/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LE CDILLLGGGMIFTFYKAQG+SVGSSLVEEDKL LAT+LL KAKAKGV+LLLP+DVVI
Sbjct  282  LETCDILLLGGGMIFTFYKAQGISVGSSLVEEDKLDLATTLLAKAKAKGVNLLLPSDVVI  341

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPA+AIPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  342  ADKFAPDANSKVVPATAIPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFA  401

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  402  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKELP  461

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  462  GVVALDEATPVA  473



>ref|XP_004488763.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cicer 
arietinum]
Length=479

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 187/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LE  DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKAKGVSLLLP+DVVI
Sbjct  287  LENVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATTLLAKAKAKGVSLLLPSDVVI  346

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+VVPASAIPDGWMGLDIGPDS+KTFN+AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  347  ADKFAPDANSQVVPASAIPDGWMGLDIGPDSIKTFNEALDTTKTIIWNGPMGVFEFDKFA  406

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  407  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  466

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  467  GVLALDEATPVA  478



>ref|XP_006422251.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
 ref|XP_006493789.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR35491.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
Length=474

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 187/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LE CDILLLGGGMIFTFYKAQG+SVGSSLVEEDKL LAT+LL KAKAKGV+LLLP+DVVI
Sbjct  282  LETCDILLLGGGMIFTFYKAQGISVGSSLVEEDKLDLATTLLAKAKAKGVNLLLPSDVVI  341

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPA+AIPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  342  ADKFAPDANSKVVPATAIPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFA  401

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  402  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKELP  461

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  462  GVVALDEATPVA  473



>gb|EMT12348.1| Phosphoglycerate kinase, chloroplastic [Aegilops tauschii]
Length=376

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  181  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  240

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  241  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  300

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  301  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  360

Query  291  GVIALDEAV  265
            GV+ALDE V
Sbjct  361  GVVALDEGV  369



>ref|XP_008226130.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Prunus mume]
Length=480

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVI
Sbjct  288  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLIAKAKAKGVSLLLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS+IPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASSIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK+LP
Sbjct  408  EGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKQLP  467

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  468  GVLALDEATPV  478



>ref|XP_004306579.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   351 bits (901),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D L+LGGGMIFTFYKAQG+SVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVI
Sbjct  288  LEKVDYLILGGGMIFTFYKAQGISVGSSLVEEDKLELATSLIAKAKAKGVSLLLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTQTIIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  408  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  467

Query  291  GVIALDEAVPV  259
            GV+ALDEAVPV
Sbjct  468  GVLALDEAVPV  478



>ref|XP_003531482.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Glycine 
max]
Length=485

 Score =   351 bits (901),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 177/192 (92%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVI
Sbjct  293  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPSDVVI  352

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVK+F++AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  353  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKSFSEALDTTQTIIWNGPMGVFEFDKFA  412

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  413  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  472

Query  291  GVIALDEAVPVA  256
            GV+ALDEAVPVA
Sbjct  473  GVLALDEAVPVA  484



>ref|XP_003546820.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Glycine max]
Length=483

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/192 (92%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVI
Sbjct  291  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPSDVVI  350

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVK+F++AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  351  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKSFSEALDTTQTIIWNGPMGVFEFDKFA  410

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  411  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  470

Query  291  GVIALDEAVPVA  256
            GV+ALDEAVPVA
Sbjct  471  GVLALDEAVPVA  482



>ref|XP_008349091.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/191 (93%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQ LSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVI
Sbjct  288  LEKVDILLLGGGMIFTFYKAQXLSVGSSLVEEDKLELATSLMAKAKAKGVSLLLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS+IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASSIPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  408  EGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  467

Query  291  GVIALDEAVPV  259
            GV+ALDEA+ V
Sbjct  468  GVLALDEAILV  478



>gb|ADV16381.1| chloroplast phosphoglycerate kinase 3 [Helianthus annuus]
Length=481

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKAKGVSLLLPTDVV+
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLAKAKAKGVSLLLPTDVVV  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPA+AIPDGWMGLDIGPDSVKTFN+ALETTKTVIWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKVVPAAAIPDGWMGLDIGPDSVKTFNEALETTKTVIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  408  VGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKVLP  467

Query  291  GVIALDEAV  265
            GV ALDEAV
Sbjct  468  GVDALDEAV  476



>ref|XP_007213965.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
 gb|EMJ15164.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
Length=480

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVI
Sbjct  288  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLIAKAKAKGVSLLLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS+IPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSKIVPASSIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGK+LP
Sbjct  408  EGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKQLP  467

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  468  GVLALDEATPV  478



>ref|XP_010094703.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56749.1| Phosphoglycerate kinase [Morus notabilis]
Length=478

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKAKGVSLLLP+DVVI
Sbjct  286  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLAKAKAKGVSLLLPSDVVI  345

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VP+SAIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  346  ADKFAPDANSKIVPSSAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFA  405

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  406  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  465

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  466  GVLALDEATPVA  477



>ref|XP_002315066.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
 gb|EEF01237.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
Length=481

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGL VGSSLVEEDKLGLATSLLEKAKAKGVSLLLP+DV+I
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLPVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVII  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDANSKIVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  409  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  468

Query  291  GVIALDEAVPVA  256
            GV+ALDE   VA
Sbjct  469  GVLALDEVERVA  480



>sp|P12782.1|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Triticum aestivum]
 emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
Length=480

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  285  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  344

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  345  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  404

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  405  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  464

Query  291  GVIALDEAV  265
            GV+ALDE V
Sbjct  465  GVVALDEGV  473



>gb|AAA79705.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=231

 Score =   341 bits (874),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKA+GVSLLLPTDVVI
Sbjct  39   LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVI  98

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA
Sbjct  99   ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFA  158

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+V  KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  159  KGTEAVRNKLAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  218

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  219  GVVALDEATPV  229



>ref|XP_009397212.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 gb|ABF70168.1| phosphoglycerate kinase, chloroplast, putative [Musa acuminata]
Length=479

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQG  VGSSLVE+DKL LATSLL KAKAKGVSLLLPTDVVI
Sbjct  287  LEKCDILLLGGGMIFTFYKAQGFPVGSSLVEDDKLELATSLLAKAKAKGVSLLLPTDVVI  346

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA SKVVPAS IPDGWMGLD+GPDSVKTFNDAL+TTKT+IWNGPMGVFEFDKFA
Sbjct  347  ADKFAPDAQSKVVPASEIPDGWMGLDVGPDSVKTFNDALDTTKTIIWNGPMGVFEFDKFA  406

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  407  TGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  466

Query  291  GVIALDEAVPVA  256
            GV+ALDEAV VA
Sbjct  467  GVVALDEAVVVA  478



>ref|XP_006654593.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Oryza 
brachyantha]
Length=405

 Score =   346 bits (888),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 177/192 (92%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGV+LLLP+DVVI
Sbjct  213  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVALLLPSDVVI  272

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPASAIPDGWMGLDIGPDSV +F+  LETTKTVIWNGPMGVFEFDKFA
Sbjct  273  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVASFSSTLETTKTVIWNGPMGVFEFDKFA  332

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  333  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  392

Query  291  GVIALDEAVPVA  256
            GVIALDEAV VA
Sbjct  393  GVIALDEAVTVA  404



>gb|EMS54865.1| Phosphoglycerate kinase, chloroplastic [Triticum urartu]
Length=460

 Score =   348 bits (893),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  213  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  272

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  273  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  332

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  333  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  392

Query  291  GVIALDEAV  265
            GV+ALDE V
Sbjct  393  GVVALDEGV  401



>gb|ACJ85441.1| unknown [Medicago truncatula]
Length=260

 Score =   341 bits (874),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGL+VGSSLVEEDKL LAT+L+ KAKAKGVSLLLP+DVVI
Sbjct  68   LEKVDILLLGGGMIFTFYKAQGLAVGSSLVEEDKLELATTLIAKAKAKGVSLLLPSDVVI  127

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  128  ADKFAPDANSQIVPASAIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFA  187

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE +AKKLA+LSGKGVTTIIGGGD VAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  188  VGTEFIAKKLADLSGKGVTTIIGGGDFVAAVEKVGVADVMSHISTGGGASLELLEGKELP  247

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  248  GVLALDEATPVA  259



>ref|XP_003596091.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66342.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=479

 Score =   348 bits (894),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 187/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGL+VGSSLVEEDKL LAT+L+ KAKAKGVSLLLP+DVVI
Sbjct  287  LEKVDILLLGGGMIFTFYKAQGLAVGSSLVEEDKLELATTLIAKAKAKGVSLLLPSDVVI  346

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  347  ADKFAPDANSQIVPASAIPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFA  406

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTES+AKKLA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  407  VGTESIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  466

Query  291  GVIALDEAVPVA  256
            GV+ALDEA PVA
Sbjct  467  GVLALDEATPVA  478



>ref|XP_002441313.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
 gb|EES19743.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
Length=483

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVG+SLVEEDKL LATSLL KAK KGVSLLLPTDVVI
Sbjct  291  LEKCDILLLGGGMIFTFYKAQGLSVGASLVEEDKLDLATSLLAKAKEKGVSLLLPTDVVI  350

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPD+V +FN AL+T +TVIWNGPMGVFEFDKFA
Sbjct  351  ADKFAPDANSQIVPASAIPDGWMGLDIGPDAVTSFNAALDTCQTVIWNGPMGVFEFDKFA  410

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  411  VGTEAVAKKLAELSAKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  470

Query  291  GVIALDEAVPVA  256
            GV+ALDEA+PVA
Sbjct  471  GVVALDEAIPVA  482



>ref|XP_004961633.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Setaria 
italica]
Length=480

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPDSV +FN AL+TT+TVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDANSQIVPASAIPDGWMGLDIGPDSVASFNAALDTTQTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  409  VGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  468

Query  291  GVIALDEAV  265
            GVIALDEAV
Sbjct  469  GVIALDEAV  477



>ref|XP_010923458.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Elaeis 
guineensis]
Length=492

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCD LLLGGGMIFTFYKAQG SVGSSLVEEDKL LATSLL KA +KGVSL+LP+DVV+
Sbjct  300  LEKCDTLLLGGGMIFTFYKAQGCSVGSSLVEEDKLELATSLLAKAVSKGVSLMLPSDVVV  359

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVP++AIPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEFDKFA
Sbjct  360  ADKFAPDANSKVVPSTAIPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFDKFA  419

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  420  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  479

Query  291  GVIALDEAVPVA  256
            GV+ALDE+VPVA
Sbjct  480  GVLALDESVPVA  491



>ref|XP_009402843.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQG SVGSSLVE+DKL LA+SLL KAKAKGVSLLLPTDV+I
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGFSVGSSLVEDDKLELASSLLAKAKAKGVSLLLPTDVII  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SKVVPAS IPDGWMGLDIGPDSVKTF+DAL+TTKT+IWNGPMGVFEFDKFA
Sbjct  348  ADKFAADAESKVVPASEIPDGWMGLDIGPDSVKTFSDALDTTKTIIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTES+AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  408  VGTESIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  467

Query  291  GVIALDEAVPVA  256
            GV+ALDEAV VA
Sbjct  468  GVVALDEAVAVA  479



>gb|EYU33792.1| hypothetical protein MIMGU_mgv1a005422mg [Erythranthe guttata]
Length=484

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L  CDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVI
Sbjct  292  LSSCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVI  351

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            A+KFAPDA SK+VPA+ IPDGWMGLDIGPDS+KTFN AL+TTKTVIWNGPMGVFEF+KFA
Sbjct  352  ANKFAPDAESKIVPATEIPDGWMGLDIGPDSIKTFNAALDTTKTVIWNGPMGVFEFEKFA  411

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP
Sbjct  412  AGTEAIANKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  471

Query  291  GVIALDEAVPVA  256
            GV+ALDEA+PVA
Sbjct  472  GVLALDEAIPVA  483



>ref|NP_001117503.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=405

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKA+GVSLLLPTDVVI
Sbjct  213  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVI  272

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA
Sbjct  273  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFA  332

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  333  KGTEAVANKLAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  392

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  393  GVVALDEATPV  403



>emb|CDP13574.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   343 bits (880),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DV+I
Sbjct  213  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVII  272

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+VVPASAIPDGWMGLDIGPDS+KTF++ LET KTVIWNGPMGVFEFDKFA
Sbjct  273  ADKFAPDANSQVVPASAIPDGWMGLDIGPDSIKTFSEVLETAKTVIWNGPMGVFEFDKFA  332

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+ AKKLA+LS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LP
Sbjct  333  VGTEATAKKLADLSRKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKQLP  392

Query  291  GVIALDEAVPV  259
            GVIALDEA PV
Sbjct  393  GVIALDEATPV  403



>ref|NP_176015.1| phosphoglycerate kinase [Arabidopsis thaliana]
 sp|P50318.3|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=478

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAKA+GVSLLLPTDVVI
Sbjct  286  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVI  345

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA
Sbjct  346  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFA  405

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  406  KGTEAVANKLAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  465

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  466  GVVALDEATPV  476



>ref|XP_011016496.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGL VGSSLVEEDKLGLATSLLEKAKAKGVSLLLP+DVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLPVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDANSKTVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            +GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  409  IGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKALP  468

Query  291  GVIALDEAVPVA  256
            GV+ALDE   VA
Sbjct  469  GVLALDEVERVA  480



>ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKA+GVSLLLPTDVVI
Sbjct  286  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKARGVSLLLPTDVVI  345

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA
Sbjct  346  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFA  405

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  406  QGTEAVANKLAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  465

Query  291  GVIALDEAVPV  259
            GV+ LDEA PV
Sbjct  466  GVVVLDEATPV  476



>ref|XP_007149208.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
 gb|ESW21202.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
Length=477

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAK KGVSLLLP+DVVI
Sbjct  285  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLAKAKEKGVSLLLPSDVVI  344

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVK+FN+AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  345  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKSFNEALDTTKTIIWNGPMGVFEFDKFA  404

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LS KGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELP
Sbjct  405  VGTEAIAKKLADLSEKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELP  464

Query  291  GVIALDEAVPV  259
            GV+ALDEA PV
Sbjct  465  GVVALDEATPV  475



>gb|ACN32155.1| unknown [Zea mays]
Length=411

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVI
Sbjct  216  LEKCDILLLGGGMIFTFYKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVI  275

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  276  ADKFAPDANSQIVPASAIPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFA  335

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  336  VGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  395

Query  291  GVIALDEAVPV  259
            GV+AL+EA  V
Sbjct  396  GVVALNEAATV  406



>gb|AFW78533.1| phosphoglycerate kinase [Zea mays]
Length=483

 Score =   344 bits (882),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVI
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSQIVPASAIPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  408  VGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  467

Query  291  GVIALDEAVPV  259
            GV+AL+EA  V
Sbjct  468  GVVALNEAATV  478



>gb|AFW78532.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   343 bits (881),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVI
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSQIVPASAIPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  408  VGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  467

Query  291  GVIALDEAVPV  259
            GV+AL+EA  V
Sbjct  468  GVVALNEAATV  478



>ref|XP_006858226.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Amborella 
trichopoda]
 gb|ERN19693.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
Length=481

 Score =   343 bits (880),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVE+DK+ LATSLLEKAKAKGVSLLLPTDVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEDDKIDLATSLLEKAKAKGVSLLLPTDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA SK+VPAS IPD WMGLDIGPDS+KTF++AL+TT+TVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDAESKIVPASGIPDRWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LS KGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LP
Sbjct  409  VGTEAIAKKLADLSAKGVTTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKALP  468

Query  291  GVIALDEAVPVAA  253
            GV+ALDE VPVAA
Sbjct  469  GVLALDEVVPVAA  481



>ref|NP_001147628.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28158.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28313.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVI
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVI  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  348  ADKFAPDANSQIVPASAIPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  408  VGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  467

Query  291  GVIALDEAVPV  259
            GV+AL+EA  V
Sbjct  468  GVVALNEAATV  478



>gb|AFW82396.1| hypothetical protein ZEAMMB73_945417 [Zea mays]
Length=477

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVI
Sbjct  285  LEKCDILLLGGGMIFTFYKAQGLSVGASLVEEDKLDLATSLLAKAKEKGVSLMLPTDVVI  344

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPDS+  FN ALETT+TVIWNGPMGVFE+DKFA
Sbjct  345  ADKFAPDANSQIVPASAIPDGWMGLDIGPDSIAAFNAALETTQTVIWNGPMGVFEYDKFA  404

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            +GTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  405  IGTEAVAKKLAELSRKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  464

Query  291  GVIALDEAVPV  259
            GV ALDEA  V
Sbjct  465  GVTALDEAATV  475



>gb|EPS66037.1| phosphoglycerate kinase, chloroplastic [Genlisea aurea]
Length=487

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVE DKL LATSLLEKAKAKGV LLLPTDVVI
Sbjct  295  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEADKLDLATSLLEKAKAKGVELLLPTDVVI  354

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA SK+VPASAIPDGWMGLDIGPDS+KTFN AL+ TKTVIWNGPMGVFEFDKFA
Sbjct  355  ADKFAPDATSKIVPASAIPDGWMGLDIGPDSIKTFNAALDKTKTVIWNGPMGVFEFDKFA  414

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            +GTE+VAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGK+LP
Sbjct  415  LGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKDLP  474

Query  291  GVIALDEAVPVA  256
            GV+ALDEA  VA
Sbjct  475  GVLALDEATLVA  486



>gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
Length=481

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGL+VGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEF+KFA
Sbjct  349  ADKFAPDANSKTVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  409  NGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  468

Query  291  GVIALDEAVPVA  256
            GV+ALDE   VA
Sbjct  469  GVLALDEVERVA  480



>ref|XP_003568189.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Brachypodium 
distachyon]
Length=482

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVI
Sbjct  287  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVSLLLPSDVVI  346

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ V ASAIPDGWMGLDIGPDSV TFN ALETT+T+IWNGPMGVFEFDKFA
Sbjct  347  ADKFAPDANSQTVAASAIPDGWMGLDIGPDSVATFNAALETTQTIIWNGPMGVFEFDKFA  406

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LP
Sbjct  407  VGTEAVAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKQLP  466

Query  291  GVIALDEAVPV  259
            GV+ALDEAV V
Sbjct  467  GVVALDEAVTV  477



>ref|XP_010669994.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   342 bits (877),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LLEKAKAKGVSLLLP DVVI
Sbjct  290  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLEKAKAKGVSLLLPPDVVI  349

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPDS+K F+DAL+TT+TVIWNGPMGVFEFDKFA
Sbjct  350  ADKFAADANSKIVPASEIPDGWMGLDIGPDSIKMFSDALDTTQTVIWNGPMGVFEFDKFA  409

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKL E+S KGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELP
Sbjct  410  VGTEAIAKKLEEISKKGVTTIIGGGDSVAAVEKVGVAESMSHISTGGGASLELLEGKELP  469

Query  291  GVIALDEAVPV  259
            GV+ALDEAVPV
Sbjct  470  GVLALDEAVPV  480



>ref|XP_002312238.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
 dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gb|EEE89605.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
Length=481

 Score =   341 bits (875),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGL+VGSSLVEEDKL LAT+LLEKAKAKGVSLLLP+DVVI
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLAVGSSLVEEDKLDLATTLLEKAKAKGVSLLLPSDVVI  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEF+KFA
Sbjct  349  ADKFAPDANSKTVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  409  NGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  468

Query  291  GVIALDEAVPVA  256
            GV+ALDE   VA
Sbjct  469  GVLALDEVERVA  480



>ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   341 bits (875),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVV  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  349  ADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  409  AGTEAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEAVPV  259
            GVIALDEA+PV
Sbjct  469  GVIALDEAIPV  479



>ref|XP_006297559.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
 gb|EOA30457.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
Length=481

 Score =   341 bits (874),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVV  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  349  ADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  409  AGTEAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEAVPV  259
            GV+ALDEA+PV
Sbjct  469  GVVALDEAIPV  479



>ref|XP_010544343.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglycerate kinase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=480

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 183/193 (95%), Gaps = 2/193 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVI
Sbjct  286  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVI  345

Query  651  ADKFAPDANSKVVPA--SAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDK  478
            ADKFAPDANSKV+ A    +PDGWMGLDIGPDSVKTFNDAL++T+T+IWNGPMGVFEFDK
Sbjct  346  ADKFAPDANSKVLNAVNCRLPDGWMGLDIGPDSVKTFNDALDSTQTIIWNGPMGVFEFDK  405

Query  477  FAVGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKE  298
            FAVGTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+
Sbjct  406  FAVGTEAVAKKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKQ  465

Query  297  LPGVIALDEAVPV  259
            LPGVIALDEA PV
Sbjct  466  LPGVIALDEAAPV  478



>ref|XP_010499471.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Camelina 
sativa]
Length=481

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVV  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  349  ADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  409  AGTEAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEAVPV  259
            GV+ALDEA+PV
Sbjct  469  GVVALDEAIPV  479



>ref|XP_010487004.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL +AKAKGVSLLLPTDVV+
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAEAKAKGVSLLLPTDVVV  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  349  ADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  409  AGTEAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEAVPV  259
            GV+ALDEA+PV
Sbjct  469  GVVALDEAIPV  479



>ref|XP_010465058.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVV  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  349  ADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  409  AGTEAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEAVPV  259
            GV ALDEA+PV
Sbjct  469  GVTALDEAIPV  479



>dbj|BAH57185.1| AT1G79550 [Arabidopsis thaliana]
Length=226

 Score =   330 bits (845),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  39   LNTVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  98

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  99   ADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFA  158

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  159  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  218

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  219  GVLALDEA  226



>gb|AAB60303.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=399

 Score =   336 bits (861),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+
Sbjct  207  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVV  266

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  267  ADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  326

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  327  AGTEAIANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  386

Query  291  GVIALDEAVPV  259
            GVIALDEA+PV
Sbjct  387  GVIALDEAIPV  397



>ref|XP_008656415.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Zea mays]
Length=627

 Score =   343 bits (880),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVI
Sbjct  435  LEKCDILLLGGGMIFTFYKAQGLSVGASLVEEDKLDLATSLLAKAKEKGVSLMLPTDVVI  494

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS++VPASAIPDGWMGLDIGPDS+  FN ALETT+TVIWNGPMGVFE+DKFA
Sbjct  495  ADKFAPDANSQIVPASAIPDGWMGLDIGPDSIAAFNAALETTQTVIWNGPMGVFEYDKFA  554

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            +GTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELP
Sbjct  555  IGTEAVAKKLAELSRKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELP  614

Query  291  GVIALDEAVPV  259
            GV ALDEA  V
Sbjct  615  GVTALDEAATV  625



>ref|NP_187884.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
 sp|Q9LD57.1|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
Length=481

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVV  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  349  ADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  409  AGTEAIANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEAVPV  259
            GVIALDEA+PV
Sbjct  469  GVIALDEAIPV  479



>gb|KHN21386.1| Phosphoglycerate kinase, chloroplastic [Glycine soja]
Length=181

 Score =   327 bits (838),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -2

Query  795  MIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKV  616
            MIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANSKV
Sbjct  1    MIFTFYKAQGLSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSKV  60

Query  615  VPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAE  436
            VPASAIPDGWMGLDIGPDSVK+F++AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLA+
Sbjct  61   VPASAIPDGWMGLDIGPDSVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAD  120

Query  435  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  256
            LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  121  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  180



>ref|XP_006407295.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
 gb|ESQ48748.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
Length=481

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVV  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  349  ADKFAPDANSKVVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  409  AGTEAVANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEAVPV  259
            GVIALDEA+ V
Sbjct  469  GVIALDEAITV  479



>emb|CDX73803.1| BnaA03g32440D [Brassica napus]
Length=484

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+
Sbjct  292  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVV  351

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  352  ADKFAPDANSKVVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  411

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  412  AGTEAVANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  471

Query  291  GVIALDEAVPV  259
            GVIALDEA+ V
Sbjct  472  GVIALDEAITV  482



>gb|AFK48886.1| unknown [Lotus japonicus]
Length=181

 Score =   326 bits (836),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = -2

Query  795  MIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKV  616
            MIFTFYKAQGLSVGSSLVEEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDANSK+
Sbjct  1    MIFTFYKAQGLSVGSSLVEEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDANSKI  60

Query  615  VPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAE  436
            VP+SAIPDGWMGLDIGPDS+K+F+DAL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLA+
Sbjct  61   VPSSAIPDGWMGLDIGPDSIKSFSDALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAD  120

Query  435  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  256
            LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  121  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  180



>emb|CDY00798.1| BnaC03g37820D [Brassica napus]
Length=482

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+
Sbjct  290  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVV  349

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  350  ADKFAPDANSKVVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  409

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  410  AGTEAVANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  469

Query  291  GVIALDEAVPV  259
            GVIALDEA+ V
Sbjct  470  GVIALDEAITV  480



>ref|XP_002972334.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
 gb|EFJ26420.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
Length=412

 Score =   334 bits (857),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKC+ILLLGGGMIFTFYKAQGLSVGSSLVEEDK+ LA SL+  AK KGVSLLLPTDVV+
Sbjct  219  LEKCNILLLGGGMIFTFYKAQGLSVGSSLVEEDKIDLAKSLMRTAKDKGVSLLLPTDVVV  278

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VP++AIPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  279  ADKFAADANSKIVPSTAIPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFA  338

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LP
Sbjct  339  VGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLP  398

Query  291  GVIALDEAV  265
            GV ALDEAV
Sbjct  399  GVAALDEAV  407



>ref|XP_010275944.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nelumbo nucifera]
Length=402

 Score =   333 bits (855),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVVI
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANS+VVPAS+IPDGWMGLDIGPDS+KTFN++L+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSQVVPASSIPDGWMGLDIGPDSIKTFNESLDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLP  393

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  394  GVLALNDA  401



>ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana]
 ref|NP_849907.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs 
gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140, gb|T46295, 
gb|H37082, gb|T46076, gb|N37132, gb|AA597649, gb|AI100648 
and gb|Z48462 come from this gene [Arabidopsis thaliana]
 gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=401

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LNTVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  394  GVLALDEA  401



>gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
Length=401

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LNTVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLEL+EGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELIEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  394  GVLALDEA  401



>emb|CDY43401.1| BnaA01g30320D [Brassica napus]
Length=480

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVV  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  348  ADKFAPDANSKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  408  AGTEAIANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  467

Query  291  GVIALDEAVPV  259
            GVIALDEA+ V
Sbjct  468  GVIALDEAIAV  478



>gb|KEH15368.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=226

 Score =   325 bits (832),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG S+GSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVI
Sbjct  39   LEKVDILLLGGGMIFTFYKAQGYSIGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVI  98

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DAN K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA
Sbjct  99   ADKFAADANDKIVPASSIPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFA  158

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAE+SGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  159  AGTEAIAKKLAEVSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  218

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  219  GVLALDDA  226



>ref|XP_004970258.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Setaria italica]
Length=485

 Score =   334 bits (856),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L KCDILLLGGGMIFTFYKAQG SVGSSLVE DKL LATSLL KAK KGVSL+LPTDVV+
Sbjct  298  LAKCDILLLGGGMIFTFYKAQGFSVGSSLVEADKLELATSLLSKAKEKGVSLMLPTDVVV  357

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA S+VVPASAIPDGWMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEF KFA
Sbjct  358  ADKFAPDARSQVVPASAIPDGWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFKKFA  417

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELP
Sbjct  418  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGRELP  477

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  478  GVVALDEA  485



>ref|XP_004970259.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Setaria italica]
Length=484

 Score =   334 bits (856),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L KCDILLLGGGMIFTFYKAQG SVGSSLVE DKL LATSLL KAK KGVSL+LPTDVV+
Sbjct  297  LAKCDILLLGGGMIFTFYKAQGFSVGSSLVEADKLELATSLLSKAKEKGVSLMLPTDVVV  356

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA S+VVPASAIPDGWMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEF KFA
Sbjct  357  ADKFAPDARSQVVPASAIPDGWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFKKFA  416

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELP
Sbjct  417  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGRELP  476

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  477  GVVALDEA  484



>ref|XP_002971814.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
 gb|EFJ26731.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
Length=472

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKC+ILLLGGGMIFTF+KAQGLSVGSSLVEEDK+ LA SL++ AK KGVSLLLPTDVV+
Sbjct  279  LEKCNILLLGGGMIFTFFKAQGLSVGSSLVEEDKIDLAKSLMKTAKDKGVSLLLPTDVVV  338

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VP++AIPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  339  ADKFAADANSKIVPSTAIPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFA  398

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE+VAKKLAELSGKGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LP
Sbjct  399  VGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLP  458

Query  291  GVIALDEAV  265
            GV ALDEAV
Sbjct  459  GVAALDEAV  467



>ref|XP_009135249.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=484

 Score =   333 bits (854),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+
Sbjct  292  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVV  351

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  352  ADKFAPDANSKVVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  411

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA KLAELS KGVTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LP
Sbjct  412  AGTEAVANKLAELSEKGVTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLP  471

Query  291  GVIALDEAVPV  259
            GVIALDEA+ V
Sbjct  472  GVIALDEAITV  482



>ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 ref|XP_006300324.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33221.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33222.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
Length=401

 Score =   330 bits (847),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   +ILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LSTVNILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>emb|CDY24247.1| BnaC01g38270D [Brassica napus]
Length=481

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVV  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  349  ADKFAPDANSKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  409  AGTEAIANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  468

Query  291  GVIALDEAVPV  259
            GVIALDEA+ V
Sbjct  469  GVIALDEAIAV  479



>ref|XP_010472814.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Camelina 
sativa]
Length=401

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LSSVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKF PDANSK+VPASAIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFCPDANSKIVPASAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  394  GVLALDEA  401



>ref|XP_003546821.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Glycine max]
 gb|KHN48876.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK ++LLLGGGMIFTFYKAQG SVGSSLVEEDKL LAT+LLEKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVNVLLLGGGMIFTFYKAQGYSVGSSLVEEDKLSLATTLLEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK VPAS+IPDGWMGLDIGPDS+KTF +AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKTVPASSIPDGWMGLDIGPDSIKTFGEALDTTQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  TGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   329 bits (843),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LSTVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|AIZ68220.1| phosphoglycerate kinase [Ornithogalum saundersiae]
Length=401

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDIL++GGGMIFTFYKAQG SVGSSLVEEDKL LAT+LLEKAK+KGVSLLLPTD+V+
Sbjct  214  LEKCDILIMGGGMIFTFYKAQGHSVGSSLVEEDKLSLATALLEKAKSKGVSLLLPTDIVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPASAIPDGWMGLDIGPDS+KTF ++L+TTKTVIWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVPASAIPDGWMGLDIGPDSIKTFGESLDTTKTVIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLP  393

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  394  GVLALNDA  401



>gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
Length=401

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DIL+LGGGMIFTFYKAQGL+VGSSLVEEDKL LAT+LLEKAK+KGVSLLLP+DVVI
Sbjct  214  LEKVDILVLGGGMIFTFYKAQGLAVGSSLVEEDKLDLATTLLEKAKSKGVSLLLPSDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS+IPDGWMGLDIGPDS+K+F++AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKIVPASSIPDGWMGLDIGPDSIKSFSEALDTTKTVIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV ALDEA
Sbjct  394  GVPALDEA  401



>ref|XP_003531483.1| PREDICTED: phosphoglycerate kinase, cytosolic [Glycine max]
 gb|KHN21385.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK ++LLLGGGMIFTFYKAQG SVGSSLVEEDKL LAT+LLEKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVNVLLLGGGMIFTFYKAQGYSVGSSLVEEDKLSLATTLLEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK VPAS+IPDGWMGLDIGPDS+KTF +AL+ T+TVIWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKTVPASSIPDGWMGLDIGPDSIKTFGEALDKTQTVIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  TGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|KDO61597.1| hypothetical protein CISIN_1g040813mg [Citrus sinensis]
Length=401

 Score =   328 bits (841),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKAK+KGVSLLLPTDVVI
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPA+AIPDGWMGLD+GPD++K+F++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_010417621.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429848.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429849.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
Length=401

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMI+TFYKAQG SVGSSL+EEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LSSVDILLLGGGMIYTFYKAQGYSVGSSLLEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPASAIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKIVPASAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  394  GVLALDEA  401



>ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
 gb|ESQ27163.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
Length=401

 Score =   328 bits (840),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LSTVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_011468861.1| PREDICTED: phosphoglycerate kinase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   328 bits (840),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK +IL+LGGGMIFTFYKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVS+LLPTDVVI
Sbjct  214  LEKVNILVLGGGMIFTFYKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSILLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPASAIPDGWMGLDIGPDS+KTF++AL+TT+TVIWNGPMGVFEF+KFA
Sbjct  274  ADKFAADANSKVVPASAIPDGWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  394  GVLALDEA  401



>ref|XP_009124670.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Brassica 
rapa]
Length=480

 Score =   330 bits (847),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+
Sbjct  288  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVV  347

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  348  ADKFAPDANSKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  407

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELS KGVTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LP
Sbjct  408  AGTEAIANKLAELSEKGVTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLP  467

Query  291  GVIALDEAVPV  259
            GVIALDEA+ V
Sbjct  468  GVIALDEAIAV  478



>ref|NP_001055937.1| Os05g0496200 [Oryza sativa Japonica Group]
 gb|AAU44053.1| putative phosphoglycerate kinase [Oryza sativa Japonica Group]
 dbj|BAF17851.1| Os05g0496200 [Oryza sativa Japonica Group]
 gb|EEE64225.1| hypothetical protein OsJ_19058 [Oryza sativa Japonica Group]
Length=181

 Score =   319 bits (818),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -2

Query  795  MIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKV  616
            MIFTFYKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DV+IADKFAPDANS+V
Sbjct  1    MIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVSLLLPSDVIIADKFAPDANSQV  60

Query  615  VPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAE  436
            VPASAIPDGWMGLDIGPDSV +F+  LETT+TVIWNGPMGVFEFDKFAVGTE++AKKLA+
Sbjct  61   VPASAIPDGWMGLDIGPDSVASFSSTLETTQTVIWNGPMGVFEFDKFAVGTEAIAKKLAD  120

Query  435  LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  256
            LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV VA
Sbjct  121  LSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAVTVA  180



>ref|NP_001167912.1| phosphoglycerate kinase [Zea mays]
 gb|ACN26497.1| unknown [Zea mays]
 tpg|DAA57247.1| TPA: phosphoglycerate kinase [Zea mays]
Length=371

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQG S+GSSLVE+DKL LATSLL KAK KGVSL+LP D+V+
Sbjct  184  LEKCDILLLGGGMIFTFYKAQGHSIGSSLVEDDKLELATSLLRKAKEKGVSLMLPFDLVV  243

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA+S+VVPASAIPD WMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEFDKFA
Sbjct  244  ADKFAPDASSQVVPASAIPDAWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFDKFA  303

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGT+++AKKLAELSGKGVTTI+GGGDS+AAVEKVGVA  +SHISTGGGASLELLEGKELP
Sbjct  304  VGTKAIAKKLAELSGKGVTTIVGGGDSIAAVEKVGVADSLSHISTGGGASLELLEGKELP  363

Query  291  GVIALDEA  268
            GV ALDEA
Sbjct  364  GVAALDEA  371



>sp|P29409.2|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor, partial [Spinacia oleracea]
 emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
Length=433

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQG+SVGSSLVEEDKL LATSLL KAK KGVSLLLPTDVVI
Sbjct  241  LEKCDILLLGGGMIFTFYKAQGMSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPTDVVI  300

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA+SK+VPAS IPDGWMGLDIGPDS+KTF++AL+TT+TVIWNGPMGVFEF+KFA
Sbjct  301  ADKFAADADSKIVPASGIPDGWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFEKFA  360

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKL E+S KG TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK+LP
Sbjct  361  AGTEAIAKKLEEISKKGATTIIGGGDSVAAVEKVGVAEAMSHISTGGGASLELLEGKQLP  420

Query  291  GVIALDEAVPV  259
            GV+AL+EA PV
Sbjct  421  GVLALNEADPV  431



>ref|XP_009791377.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana sylvestris]
Length=401

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIGPD++K+F  AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTVIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_009607754.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana tomentosiformis]
 sp|Q42962.1|PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic [Nicotiana tabacum]
 emb|CAA88840.1| phosphoglycerate kinase (PGK) [Nicotiana tabacum]
Length=401

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIGPD++K+F  AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTVIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_009384174.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DIL+LGGGMIFTFYKAQG SVGSSLVEEDKLGLATSLLEKAK+KGVSLLLPTDVVI
Sbjct  214  LEKVDILILGGGMIFTFYKAQGYSVGSSLVEEDKLGLATSLLEKAKSKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA+SK+VPAS IPDGWMGLDIGPDS+KTF+ ALE+TKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADADSKIVPASGIPDGWMGLDIGPDSIKTFSGALESTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSG GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIAKKLADLSGTGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>emb|CDX87375.1| BnaA07g34980D [Brassica napus]
Length=401

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LSTVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+V A+AIPDGWMGLDIGPDS+KTF+DAL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAPDANSKIVAATAIPDGWMGLDIGPDSIKTFSDALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_006422250.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
 ref|XP_006493790.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Citrus sinensis]
 gb|ESR35490.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
Length=401

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKL L TSL+EKAK+KGVSLLLPTDVVI
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLGTSLMEKAKSKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPA+AIPDGWMGLD+GPD++K+F++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_007022579.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022580.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022581.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14104.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14105.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14106.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
Length=401

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVI
Sbjct  214  LAKVDILLLGGGMIFTFYKAQGYSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVV AS IPDGWMGLDIGPDS+ TF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKVVSASEIPDGWMGLDIGPDSINTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>emb|CDX67989.1| BnaA07g20290D [Brassica napus]
Length=348

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMI+TFYKAQG SVGSSL+EEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  161  LSTVDILLLGGGMIYTFYKAQGHSVGSSLLEEDKLDLARSLMEKAKAKGVSLLLPTDVVI  220

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  221  ADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  280

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  281  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  340

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  341  GVLALDDA  348



>gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum]
Length=401

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGM+FTFYKAQG SVG+SLVEEDKLGLATSL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVDILLLGGGMVFTFYKAQGYSVGTSLVEEDKLGLATSLIEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKF+ DAN K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++TVIWNGPMGVFEFDKFA
Sbjct  274  ADKFSADANDKIVPASSIPDGWMGLDIGPDSIKTFNEALDKSQTVIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAE+SGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAEISGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_010324204.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
 ref|XP_010324205.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
Length=401

 Score =   326 bits (835),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  214  LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
Length=507

 Score =   329 bits (844),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGL VGSSLVE+DK+ LA +L++KAK KGVSLLLPTDVVI
Sbjct  315  LEKVDILLLGGGMIFTFYKAQGLKVGSSLVEDDKIELAKTLMQKAKEKGVSLLLPTDVVI  374

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  375  ADKFAADANSKVVPASDIPDGWMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFA  434

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTES+AKKLAELSGKGV TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LP
Sbjct  435  AGTESIAKKLAELSGKGVITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLP  494

Query  291  GVIALDEAVPV  259
            GV+ALDEAVPV
Sbjct  495  GVLALDEAVPV  505



>gb|AIZ74346.1| phosphoglycerate kinase 1 [Pinus massoniana]
Length=507

 Score =   329 bits (843),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGL VGSSLVE+DK+ LA +L++KAK KGVSLLLPTDVVI
Sbjct  315  LEKVDILLLGGGMIFTFYKAQGLKVGSSLVEDDKIELAKTLMQKAKEKGVSLLLPTDVVI  374

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKFA
Sbjct  375  ADKFAADANSKVVPASDIPDGWMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFA  434

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTES+AKKLAELSGKGV TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LP
Sbjct  435  AGTESIAKKLAELSGKGVITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLP  494

Query  291  GVIALDEAVPV  259
            GV+ALDEAVPV
Sbjct  495  GVLALDEAVPV  505



>emb|CDX88547.1| BnaC06g39910D [Brassica napus]
Length=352

 Score =   323 bits (829),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  165  LSTVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  224

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+V A+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  225  ADKFAPDANSKIVAATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFA  284

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  285  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  344

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  345  GVLALDDA  352



>ref|XP_003596092.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66343.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   325 bits (833),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG +VGSSLVEEDKL LAT+L+EKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLATTLIEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DAN K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANDKIVPASSIPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAE+SGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAEVSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_003596093.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66344.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMI+TFYKAQG S+GSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVDILLLGGGMIYTFYKAQGYSIGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKF+ DAN K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA
Sbjct  274  ADKFSADANDKIVPASSIPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAE+SGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAEVSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_009106677.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
 ref|XP_009106678.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
Length=401

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LSTVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+V A+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAPDANSKIVAATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_010094705.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis]
Length=401

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK ++L LGGGMIFTFYKAQG SVGSSLVEEDK  LAT+LLEKAKAKGVS+LLPTDVVI
Sbjct  214  LEKVNLLFLGGGMIFTFYKAQGYSVGSSLVEEDKYDLATTLLEKAKAKGVSILLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPAS+IPDGWMGLDIGPDS+KTF++ L+TT+T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKIVPASSIPDGWMGLDIGPDSIKTFSETLDTTQTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAE+SGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  AGTEAIAKKLAEISGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>emb|CDY49746.1| BnaA02g19260D [Brassica napus]
Length=388

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  201  LSTVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  260

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLD+GPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA
Sbjct  261  ADKFAPDANSKIVPATAIPDGWMGLDVGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFA  320

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  321  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  380

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  381  GVLALDDA  388



>ref|XP_009146585.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=477

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+
Sbjct  290  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVV  349

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  350  ADKFAPDANSKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  409

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELS KGVTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LP
Sbjct  410  AGTEAIANKLAELSEKGVTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLP  469

Query  291  GVIALDEA  268
            GVIALDEA
Sbjct  470  GVIALDEA  477



>ref|XP_009128369.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LSTVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLD+GPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKIVPATAIPDGWMGLDVGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|ABS19537.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   318 bits (815),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  41   LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A+KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIARKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>ref|XP_006858233.1| PREDICTED: phosphoglycerate kinase, cytosolic [Amborella trichopoda]
 gb|ERN19700.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
Length=401

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILL+GGGMIFTFY+AQG SVGSSLVEEDKL LATSLLEKAKAKGV+LLLPTDVV+
Sbjct  214  LEKCDILLMGGGMIFTFYEAQGFSVGSSLVEEDKLDLATSLLEKAKAKGVALLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA SKVVPAS IP+GWMGLDIGPDS+KTFNDALE  KT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDAESKVVPASEIPEGWMGLDIGPDSIKTFNDALEPAKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AKKLAELS KGVTTIIGGGDSVAAVE+ G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTKAIAKKLAELSEKGVTTIIGGGDSVAAVEQAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|AAX57323.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAZ85276.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85278.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85282.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|ABS19539.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19540.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19541.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19542.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19543.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19545.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19546.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19548.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19550.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19551.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19553.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19554.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19555.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19558.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19559.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   318 bits (815),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  41   LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>gb|EEC71648.1| hypothetical protein OsI_04088 [Oryza sativa Indica Group]
Length=449

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQG  VG+SLVE+DKL LATSLL KAK KGVSL+LPTDV++
Sbjct  262  LEKCDILLLGGGMIFTFYKAQGFPVGASLVEDDKLELATSLLAKAKEKGVSLMLPTDVIV  321

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAP+AN +VV A AIPDGWMGLDIGPDSV  F+ ALETT+TVIWNGPMGVFEF+KFA
Sbjct  322  ADKFAPEANCQVVSAYAIPDGWMGLDIGPDSVAAFSSALETTQTVIWNGPMGVFEFEKFA  381

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGG DSVAAVEKVGVA+VMSHISTGGGASLELLEGKELP
Sbjct  382  VGTEAIAKKLAELSGKGVTTIIGGKDSVAAVEKVGVANVMSHISTGGGASLELLEGKELP  441

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  442  GVVALDEA  449



>ref|XP_011016588.1| PREDICTED: phosphoglycerate kinase, cytosolic [Populus euphratica]
Length=401

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+L LGGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DVV+
Sbjct  214  LEKVDLLFLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKV+PAS IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKVLPASEIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++A+KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIARKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|AAX57302.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57303.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57304.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57305.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57306.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57307.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57308.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57309.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57310.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57311.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57312.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57313.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57314.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57315.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57316.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57317.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57318.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57319.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57320.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57321.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57322.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57324.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57325.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57326.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57327.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57328.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57329.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAZ85283.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85284.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85285.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85286.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85287.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85288.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85289.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85290.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85291.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85292.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|ABS19549.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19552.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19557.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  41   LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>gb|ABS19535.1| CT114 [Solanum chilense]
Length=224

 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LE+ D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  41   LERVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>ref|XP_011095716.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095717.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095718.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
Length=401

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG +VGSSLVE DKL LATSL+EKAKAKGVSLLLP+DVVI
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGHAVGSSLVEADKLDLATSLIEKAKAKGVSLLLPSDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIGPDS+K+F +ALETTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVPASQIPDGWMGLDIGPDSIKSFGEALETTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  394  GVLALNDA  401



>gb|ABS19544.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   318 bits (814),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  41   LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSG+GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIAKKLAELSGRGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>ref|XP_012087351.1| PREDICTED: phosphoglycerate kinase, cytosolic [Jatropha curcas]
 gb|KDP25066.1| hypothetical protein JCGZ_22601 [Jatropha curcas]
Length=401

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DIL+LGGGMIFTFYKAQG SVGSSLVEEDKL LA +L+EKAKAKGV LLLPTDVVI
Sbjct  214  LEKVDILILGGGMIFTFYKAQGHSVGSSLVEEDKLDLANTLMEKAKAKGVFLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS+IPDGW+GLD+GPDS++TF +AL+TTKTVIWNGPMGVFEF+KFA
Sbjct  274  ADKFAADANSKVVPASSIPDGWLGLDVGPDSIQTFCEALDTTKTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_011013857.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGL VGSSLVEEDKLGLATSLLEKAKAKGVSLLLP+DV+I
Sbjct  289  LEKCDILLLGGGMIFTFYKAQGLPVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVII  348

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK VPASAIPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEFDKFA
Sbjct  349  ADKFAPDANSKTVPASAIPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFA  408

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELP
Sbjct  409  VGTEAIAKKLAELSSKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGEELP  468

Query  291  GVIALDEAVPVA  256
            GV+ALDE   VA
Sbjct  469  GVLALDEVERVA  480



>gb|AFK46712.1| unknown [Medicago truncatula]
Length=401

 Score =   323 bits (829),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG +VGSSLVEEDKL LAT+L+EKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLATTLIEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DAN K+VPAS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANDKIVPASSIPDGWMGLDIGPDSIKTFNEALDRSQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAE+SGKGVTTIIGGGDSVAAVEKVG+   MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAEVSGKGVTTIIGGGDSVAAVEKVGLEDKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|EYU33791.1| hypothetical protein MIMGU_mgv1a006853mg [Erythranthe guttata]
Length=429

 Score =   324 bits (831),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQGL+VGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVI
Sbjct  242  LEKVDVLLLGGGMIFTFYKAQGLAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVI  301

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKF+PDANSK+VPAS IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  302  ADKFSPDANSKIVPASEIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  361

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAEL  KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  362  AGTEAIAKKLAELGDKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLP  421

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  422  GVLALNDA  429



>gb|AAZ85273.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85274.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85275.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85277.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85279.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85280.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85281.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
Length=224

 Score =   317 bits (811),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPT+VVI
Sbjct  41   LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTNVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>ref|XP_010669985.1| PREDICTED: phosphoglycerate kinase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K D L+LGGGMIFTFYKAQG+SVGSSLVEEDKL LATSL+EKAKAKGVSL+LPTDVVI
Sbjct  214  LAKVDYLILGGGMIFTFYKAQGISVGSSLVEEDKLELATSLIEKAKAKGVSLMLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK VPASAIPDGWMGLDIGPDS+KTFN+AL+ T+T+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADAESKTVPASAIPDGWMGLDIGPDSIKTFNEALDKTQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VA+KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVARKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|ABS19556.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   317 bits (811),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATS +EKAK KGVSLLLPTDVVI
Sbjct  41   LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLELATSFMEKAKTKGVSLLLPTDVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>gb|ABS19536.1| CT114 [Solanum chilense]
Length=224

 Score =   317 bits (811),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYK QG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  41   LEKVDVLLLGGGMIFTFYKVQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>gb|AGT16255.1| phosphoglycerate kinase [Saccharum hybrid cultivar R570]
Length=489

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQG S+GSSLVE+DKL LA SLL+KAK KGVSL+LP DVVI
Sbjct  302  LEKCDILLLGGGMIFTFYKAQGHSIGSSLVEDDKLELAISLLKKAKEKGVSLMLPIDVVI  361

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA+S+VVPASAIPD WMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEFDKF+
Sbjct  362  ADKFAPDASSQVVPASAIPDAWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFDKFS  421

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGT+++AKKLAELSGKGVTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEGKELP
Sbjct  422  VGTKAIAKKLAELSGKGVTTIIGGGDSVAAVEKAGVADSMSHISTGGGASLELLEGKELP  481

Query  291  GVIALDEA  268
            GV ALDEA
Sbjct  482  GVAALDEA  489



>ref|XP_008226131.1| PREDICTED: phosphoglycerate kinase, cytosolic [Prunus mume]
Length=401

 Score =   323 bits (827),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK +ILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SLLEKAKAKGVS+LLPTDVVI
Sbjct  214  LEKVNILLLGGGMIFTFYKAQGYSVGSSLVEEDKLDLAKSLLEKAKAKGVSILLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPASAIPDGWMGLDIGPDS+KTF++AL TT+T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADANSKVVPASAIPDGWMGLDIGPDSIKTFSEALVTTQTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELS KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSDKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKSLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|NP_001275451.1| phosphoglycerate kinase, cytosolic-like [Solanum tuberosum]
 gb|ABB87110.1| unknown [Solanum tuberosum]
Length=401

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  214  LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTK +IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKNIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_010936568.1| PREDICTED: phosphoglycerate kinase, cytosolic [Elaeis guineensis]
Length=401

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV+
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA+SKVVPAS IPDGWMGLDIGPDS+KTF + LE+TK +IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADADSKVVPASGIPDGWMGLDIGPDSIKTFCETLESTKAIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|KJB14020.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=349

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGM+FTFYKAQG +VGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVV+
Sbjct  162  LAKVDILILGGGMMFTFYKAQGYAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVV  221

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIGPDS+KTF+++L+TT+T+IWNGPMGVFEF+KFA
Sbjct  222  ADKFAADANSKVVPASGIPDGWMGLDIGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFA  281

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAKKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LP
Sbjct  282  AGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLP  341

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  342  GVLALNDA  349



>gb|ABS19538.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   316 bits (810),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  41   LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGG DSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIAKKLAELSGKGVTTIIGGSDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=401

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DIL+LGGGMIFTFYKAQG SVGSSLVE DKL LA+SL+EKAKAKGV LLLPTDVVI
Sbjct  214  LEKVDILILGGGMIFTFYKAQGHSVGSSLVEGDKLDLASSLIEKAKAKGVDLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS+IPDGWMGLD+GPD++KTF +AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVPASSIPDGWMGLDVGPDAIKTFCEALDTTQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>emb|CDY70232.1| BnaC02g46710D [Brassica napus]
Length=401

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKA+AKGVSLLLPTDVVI
Sbjct  214  LSTVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLMEKAEAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLD+GPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKIVPATAIPDGWMGLDVGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVA+VEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAVAKQLAELSGKGVTTIIGGGDSVASVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_008383158.1| PREDICTED: phosphoglycerate kinase, cytosolic [Malus domestica]
Length=401

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K ++LLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SLLEKAK+KGVS+LLPTDVVI
Sbjct  214  LAKVNVLLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLAKSLLEKAKSKGVSILLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPASAIPDGWMGLDIGPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADANSKVVPASAIPDGWMGLDIGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_010537804.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
 ref|XP_010537805.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=401

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLP+DVVI
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLELAKSLMEKAKAKGVSLLLPSDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            A+KFA DA+SKVV AS IPDGWMGLDIGPDS+KTF +AL+TT+T+IWNGPMGVFEFDKFA
Sbjct  274  ANKFAADADSKVVSASDIPDGWMGLDIGPDSIKTFGEALDTTQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++A+KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  VGTETIARKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+L LGGGMI+TFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DVV+
Sbjct  214  LEKVDLLFLGGGMIYTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKVVPASEIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A+KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIARKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
 gb|EMJ15113.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
Length=449

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK +ILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SLLEKAKAKGVS+LLPTDVVI
Sbjct  262  LEKVNILLLGGGMIFTFYKAQGYSVGSSLVEEDKLDLAKSLLEKAKAKGVSILLPTDVVI  321

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPASAIPDGWMGLDIGPDS+KTF++AL TT+T+IWNGPMGVFEF+KFA
Sbjct  322  ADKFAADANSKVVPASAIPDGWMGLDIGPDSIKTFSEALVTTQTIIWNGPMGVFEFEKFA  381

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELS KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  382  AGTEAIAKKLAELSDKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKSLP  441

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  442  GVLALDDA  449



>gb|KJB14019.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14021.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14022.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14023.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14024.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=401

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGM+FTFYKAQG +VGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVV+
Sbjct  214  LAKVDILILGGGMMFTFYKAQGYAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIGPDS+KTF+++L+TT+T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADANSKVVPASGIPDGWMGLDIGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAKKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  AGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  394  GVLALNDA  401



>emb|CDX79326.1| BnaC06g19770D [Brassica napus]
Length=353

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMI+TFYKAQG +VGSSL+EEDKL LA SL+EKA+ KGVSLLLPTDVVI
Sbjct  166  LSTVDILLLGGGMIYTFYKAQGHAVGSSLLEEDKLDLARSLMEKAQDKGVSLLLPTDVVI  225

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+VPA+AIPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  226  ADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  285

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAK+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  286  AGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  345

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  346  GVLALDDA  353



>gb|AGV54662.1| phosphoglycerate kinase chloroplastic-like protein [Phaseolus 
vulgaris]
Length=477

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LAT+LL KAK KGV  LLP+DVVI
Sbjct  285  LEKVDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATTLLAKAKEKGVFFLLPSDVVI  344

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPA AIPDGWMGLDIGPD VK+FN+AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  345  ADKFAPDANSKVVPAFAIPDGWMGLDIGPDFVKSFNEALDTTKTIIWNGPMGVFEFDKFA  404

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+ S KGV  IIGGGD VAAVEKVGVA+VMSHI TGGGASLELLEGKELP
Sbjct  405  VGTEAIAKKLADFSEKGVPPIIGGGDFVAAVEKVGVANVMSHIFTGGGASLELLEGKELP  464

Query  291  GVIALDEAVPV  259
            GV+A DEA PV
Sbjct  465  GVVAFDEAPPV  475



>ref|XP_009777860.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
sylvestris]
Length=401

 Score =   321 bits (822),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK ++LLLGGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKAKAKGVSLLLP DVVI
Sbjct  214  LEKVNVLLLGGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLIEKAKAKGVSLLLPADVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKF+ DANSK+VPAS IPDGWMGLDIGPD++K+F +AL+TTKT+IWNGPMGVFEF+ FA
Sbjct  274  ADKFSADANSKIVPASEIPDGWMGLDIGPDAIKSFGEALDTTKTIIWNGPMGVFEFENFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|ABK92531.1| unknown [Populus trichocarpa]
Length=401

 Score =   320 bits (821),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+L LGGGMI+TFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DV++
Sbjct  214  LEKVDLLFLGGGMIYTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKVVPASEIPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A+KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIARKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
Length=401

 Score =   320 bits (821),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+L LGGGMI+TFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DVV+
Sbjct  214  LEKVDLLFLGGGMIYTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVV AS IPDGWMGLDIGPDS+KTFN+AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKVVAASEIPDGWMGLDIGPDSIKTFNEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A+KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIARKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|ABS19547.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   314 bits (804),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  41   LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVI  100

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK+VPAS IPDG MGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  101  ADKFAADANSKIVPASEIPDGRMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  160

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  161  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLP  220

Query  291  GVIA  280
            GV+A
Sbjct  221  GVLA  224



>ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 ref|XP_007149210.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21203.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21204.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
Length=401

 Score =   320 bits (821),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK ++LLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVNVLLLGGGMIFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK V AS+IPDGWMGLDIGPDS+KTF++AL+ T+TVIWNGPMGVFEF+KFA
Sbjct  274  ADKFAADANSKTVSASSIPDGWMGLDIGPDSIKTFSEALDATQTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  394  GVLALNDA  401



>ref|XP_010941661.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Elaeis 
guineensis]
Length=401

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
             E  DILLLGGGM+FTFYKAQG SVGSSLVEEDKL LAT+L+EKAK+KGVSLLLPTDVV+
Sbjct  214  FENVDILLLGGGMMFTFYKAQGYSVGSSLVEEDKLDLATALIEKAKSKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA+SKVVPAS IPDGWMGLDIGPDS+KTF++ LE+TKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADADSKVVPASGIPDGWMGLDIGPDSIKTFSETLESTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|ABB86242.1| phosphoglycerate kinase-like [Solanum tuberosum]
Length=402

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLV+EDKL LATSL+EKAK KGVSLLLPTDVVI
Sbjct  215  LEKVDVLLLGGGMIFTFYKAQGYAVGSSLVKEDKLDLATSLMEKAKTKGVSLLLPTDVVI  274

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA +ANSK+VPAS IPDGWMGLD GPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  275  ADKFAANANSKIVPASEIPDGWMGLDFGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFA  334

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  335  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLP  394

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  395  GVLALDDA  402



>ref|XP_010941660.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
             E  DILLLGGGM+FTFYKAQG SVGSSLVEEDKL LAT+L+EKAK+KGVSLLLPTDVV+
Sbjct  222  FENVDILLLGGGMMFTFYKAQGYSVGSSLVEEDKLDLATALIEKAKSKGVSLLLPTDVVV  281

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA+SKVVPAS IPDGWMGLDIGPDS+KTF++ LE+TKT+IWNGPMGVFEFDKFA
Sbjct  282  ADKFAADADSKVVPASGIPDGWMGLDIGPDSIKTFSETLESTKTIIWNGPMGVFEFDKFA  341

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  342  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLP  401

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  402  GVLALDDA  409



>gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
 gb|KHG14087.1| Phosphoglycerate kinase, cytosolic [Gossypium arboreum]
Length=401

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMI+TFYKAQG +VGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVV+
Sbjct  214  LAKVDILILGGGMIYTFYKAQGHAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIGPDS+KTF+++L+TT+T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADANSKVVPASGIPDGWMGLDIGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+VAKKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  AGTEAVAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  394  GVLALNDA  401



>ref|XP_002315067.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
 gb|EEF01238.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
Length=401

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D L LGGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLPTDVV+
Sbjct  214  LEKVDFLFLGGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS I DGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKVVPASEIADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAWKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|ABK24564.1| unknown [Picea sitchensis]
Length=507

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DIL LGGGMIFTFYKAQGL VGSSLVE+DK+ LA++L++KAK KGVSLLLPTDVVI
Sbjct  315  LEKVDILFLGGGMIFTFYKAQGLKVGSSLVEDDKIELASTLMKKAKEKGVSLLLPTDVVI  374

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKF+
Sbjct  375  ADKFAADANSKVVPASDIPDGWMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFS  434

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            +GT S+AKKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  435  LGTTSIAKKLAELSGKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLP  494

Query  291  GVIALDEAVPV  259
            GV+ALD+AVPV
Sbjct  495  GVLALDDAVPV  505



>emb|CBI24183.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K D+LLLGGGMIFTFYKAQG  VGSSLVEEDKL LATSLLEKAK+KGVSLLLP DVVI
Sbjct  162  LGKVDVLLLGGGMIFTFYKAQGYGVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPADVVI  221

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIGPDS+KTF ++L+TTKT+IWNGPMGVFEFDKFA
Sbjct  222  ADKFAADANSKVVPASCIPDGWMGLDIGPDSIKTFGESLDTTKTIIWNGPMGVFEFDKFA  281

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            +GTE++AKKLA+LS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  282  LGTEAIAKKLADLSEKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLP  341

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  342  GVLALDDA  349



>ref|XP_009414502.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDV+I
Sbjct  214  LSKVDILLLGGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVLI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANS VVPAS IPDGWMGLDIGPDS+KTF+++L+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADANSMVVPASGIPDGWMGLDIGPDSIKTFSESLDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            +GTE++AKKLAELS  GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  LGTEAIAKKLAELSASGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_002312237.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
 gb|EEE89604.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
Length=401

 Score =   318 bits (815),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+L LGGGMI+TFYKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DV++
Sbjct  214  LEKVDLLFLGGGMIYTFYKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS IPDGWMGLDIGPDS+ TF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKVVPASEIPDGWMGLDIGPDSITTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A+KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIARKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_002263950.1| PREDICTED: phosphoglycerate kinase, cytosolic [Vitis vinifera]
 emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
Length=401

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K D+LLLGGGMIFTFYKAQG  VGSSLVEEDKL LATSLLEKAK+KGVSLLLP DVVI
Sbjct  214  LGKVDVLLLGGGMIFTFYKAQGYGVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPADVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIGPDS+KTF ++L+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVPASCIPDGWMGLDIGPDSIKTFGESLDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            +GTE++AKKLA+LS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  LGTEAIAKKLADLSEKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
Length=401

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DIL+LGGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV+
Sbjct  214  LEKVDILILGGGMIFTFYKAQGYSVGSSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK+VPAS IPDGWMGLDIGPDS+K+F+  LE+TKT+IWNGPMGVFE++KFA
Sbjct  274  ADKFAADAESKIVPASGIPDGWMGLDIGPDSIKSFSGTLESTKTIIWNGPMGVFEYEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSG GVTTIIGGGDSVAAVEKVG+A+ MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIAKKLADLSGSGVTTIIGGGDSVAAVEKVGLAAKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  394  GVLALEDA  401



>emb|CDY52872.1| BnaCnng23600D [Brassica napus]
Length=797

 Score =   329 bits (844),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+
Sbjct  610  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVV  669

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVV AS I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA
Sbjct  670  ADKFAPDANSKVVSASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFA  729

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  730  AGTEAIANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  789

Query  291  GVIALDEA  268
            GVIALDEA
Sbjct  790  GVIALDEA  797



>emb|CDP13576.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DILLLGGGMIFTFYKAQG SVGSSLVEED+L LA SL+EKAKAKGV LLLPTDVV 
Sbjct  214  LAKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDRLDLALSLIEKAKAKGVPLLLPTDVVA  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS IPDGWMGLDIGPD++K+F++AL+ TKT+IWNGPMGVFE+DKFA
Sbjct  274  ADKFAPDANSKVVPASGIPDGWMGLDIGPDAIKSFSEALDATKTIIWNGPMGVFEYDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSG GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  TGTEAIAKKLAELSGNGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_009399252.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   318 bits (814),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LE  DIL+LGGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV+
Sbjct  214  LETVDILILGGGMIFTFYKAQGYSVGSSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK+VPAS IPDGWMGLDIGPDS+K+F+  LE+TKT+IWNGPMGVFE++KFA
Sbjct  274  ADKFAADAESKIVPASGIPDGWMGLDIGPDSIKSFSGTLESTKTIIWNGPMGVFEYEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSG GVTTIIGGGDSVAAVEKVG+A+ MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIAKKLADLSGSGVTTIIGGGDSVAAVEKVGLAAKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_004488762.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cicer arietinum]
Length=401

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA +L+EKAKAKGVSLLLPTDVVI
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGYSVGSSLVEEDKLELANTLIEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DAN K+V AS+IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANDKIVSASSIPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAE+S KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAEVSDKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_009618219.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
tomentosiformis]
Length=401

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK ++LLLGGGMIFTFYKA G SVGSSLVE+DKL LATSL+EKAKAKGVSLLLP DVVI
Sbjct  214  LEKVNVLLLGGGMIFTFYKALGYSVGSSLVEDDKLDLATSLIEKAKAKGVSLLLPADVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPA+ IPDGWMGLDIGPD++K+F +AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAVDANSKVVPATEIPDGWMGLDIGPDAIKSFGEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LP
Sbjct  334  SGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_010544342.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Tarenaya 
hassleriana]
Length=401

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQGLSVGSSLVE DKL LA+SL+EKAKAKGVSLLLPTDVV+
Sbjct  214  LEKVDVLLLGGGMIFTFYKAQGLSVGSSLVEGDKLELASSLMEKAKAKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVV AS IP+GWMGLDIGPDSV TFN+AL+ T+T+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVSASEIPEGWMGLDIGPDSVTTFNEALDKTQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAEL  KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAMAKKLAELGEKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD A
Sbjct  394  GVLALDHA  401



>ref|XP_008447095.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis melo]
Length=401

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK ++L LGGGMIFTFYKAQGL+VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+
Sbjct  214  LEKVNLLFLGGGMIFTFYKAQGLAVGKSLVEEDKLDLATSLIEKAKAKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA+SKVV AS+IPDGWMGLDIGPDS+K+F +AL++T+T+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADADSKVVAASSIPDGWMGLDIGPDSIKSFGEALDSTQTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV ALD+A
Sbjct  394  GVSALDDA  401



>ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis sativus]
 gb|KGN44288.1| hypothetical protein Csa_7G239010 [Cucumis sativus]
Length=401

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK ++L+LGGGMIFTFYKAQGL+VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+
Sbjct  214  LEKVNLLVLGGGMIFTFYKAQGLAVGKSLVEEDKLDLATSLIEKAKAKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA+SKVV AS+IPDGWMGLDIGPDS+K+F +AL++T+T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADADSKVVAASSIPDGWMGLDIGPDSIKSFGEALDSTQTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_010557291.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=432

 Score =   316 bits (810),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D+LLLGGGMIFTFYKAQG +VGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVV+
Sbjct  245  LEKVDVLLLGGGMIFTFYKAQGHAVGSSLVEEDKLSLANSLMEKAKAKGVSLLLPTDVVV  304

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSK V AS IP+GWMGLDIGPDS++TF++AL+ T+T+IWNGPMGVFEFDKFA
Sbjct  305  ADKFAADANSKTVSASEIPEGWMGLDIGPDSIETFSEALDETQTIIWNGPMGVFEFDKFA  364

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  365  VGTEAIAKKLAELSDKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  424

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  425  GVLALDDA  432



>dbj|BAA33802.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   315 bits (807),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D L LGGGMIFTFYKAQG SVGSSLVEEDKL LATSL+EKA+ KGV LLLPTDVV+
Sbjct  214  LEKVDFLFLGGGMIFTFYKAQGYSVGSSLVEEDKLDLATSLIEKARVKGVKLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS I DGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFASDANSKVVPASEIADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAWKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_011086347.1| PREDICTED: phosphoglycerate kinase, cytosolic [Sesamum indicum]
Length=401

 Score =   315 bits (807),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -2

Query  804  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  625
            GGGMIFTFYKAQG +VGSSLVEEDKLGLATSL+EKAK KGVSLLLP+DVVIADKFA DAN
Sbjct  223  GGGMIFTFYKAQGHAVGSSLVEEDKLGLATSLMEKAKTKGVSLLLPSDVVIADKFAADAN  282

Query  624  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  445
            SKVVPAS IPDGWMGLDIGPDS+K+F +ALETTKT+IWNGPMGVFEFDKFA GTE++AKK
Sbjct  283  SKVVPASQIPDGWMGLDIGPDSIKSFGEALETTKTIIWNGPMGVFEFDKFAAGTEAIAKK  342

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_008798227.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=401

 Score =   315 bits (807),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
             E  DILLLGGGM+FTFYKAQGLSVGSSLVEEDKL LAT+L+EKAK+KGVSLLLPTDVV+
Sbjct  214  FENVDILLLGGGMMFTFYKAQGLSVGSSLVEEDKLDLATALIEKAKSKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            A+KFA DA++KVVPAS IPDGWMGLDIGPDS+K F++ L++TKT+IWNGPMGVFEFDKFA
Sbjct  274  ANKFAADADTKVVPASGIPDGWMGLDIGPDSIKIFSETLDSTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKG TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIAKKLADLSGKGATTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_011013882.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Populus euphratica]
Length=401

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D L LGGGMI+TFYKAQG S+GSSLVEEDKL LATSL+EKAK KGV LLLP DVV+
Sbjct  214  LEKVDFLFLGGGMIYTFYKAQGYSIGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSKVVPAS I DGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKVVPASEIADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++A KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTEAIAWKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>emb|CDP16886.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DILLLGGGMIFTFYKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVV 
Sbjct  214  LAKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLALSLIEKAKAKGVSLLLPTDVVA  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPAS IPDGWMGLDIGP S+K+F++AL+TTKT+IWNGPMGVFEFDKFA
Sbjct  274  ADKFAADANSKVVPASGIPDGWMGLDIGPVSIKSFSEALDTTKTIIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AKKLAELSG GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTDTIAKKLAELSGNGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLP  393

Query  291  GVIALDEA  268
            GV+ALD A
Sbjct  394  GVLALDNA  401



>ref|XP_002977295.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
 gb|EFJ21299.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
Length=402

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCD+LLLGGGMIFTF+KAQGLSVGSSLVEEDKL LAT L+EKAK KGV+LLLPTDVV+
Sbjct  215  LEKCDVLLLGGGMIFTFFKAQGLSVGSSLVEEDKLILATKLMEKAKLKGVTLLLPTDVVV  274

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA+SK+V ASAIPDGWMGLDIGPDS+K F++AL++T T+IWNGPMGVFEF  FA
Sbjct  275  ADKFAPDASSKIVSASAIPDGWMGLDIGPDSIKAFSEALDSTNTIIWNGPMGVFEFKNFA  334

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++A KLAELS KGVTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEG+ LP
Sbjct  335  VGTEAIAAKLAELSDKGVTTIIGGGDSVAAVEKAGVADQMSHISTGGGASLELLEGRILP  394

Query  291  GVIALDEA  268
            GV ALD+A
Sbjct  395  GVAALDDA  402



>gb|ADV16380.1| cytosolic phosphoglycerate kinase 2 [Helianthus annuus]
Length=400

 Score =   313 bits (802),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 175/188 (93%), Gaps = 1/188 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK +IL+LGGGMIFTFYKAQG  VGSSLVEEDKL LATSL+EKAKAKGVSLLLP+DVVI
Sbjct  214  LEKVNILVLGGGMIFTFYKAQGYKVGSSLVEEDKLDLATSLIEKAKAKGVSLLLPSDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DANSKVVPA  IPDGWMGLDIGPDS+K+F++ L+TTKTVIWNGPMGVFEF+KFA
Sbjct  274  ADKFAADANSKVVPAKEIPDGWMGLDIGPDSIKSFSETLDTTKTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE++AKKLAELSGKGVTTII GGDSVAAVEKVG+A  MSHISTGGGASL+LLEGK LP
Sbjct  334  AGTEAIAKKLAELSGKGVTTII-GGDSVAAVEKVGLADKMSHISTGGGASLQLLEGKTLP  392

Query  291  GVIALDEA  268
            GV+AL+EA
Sbjct  393  GVLALNEA  400



>gb|KCW71393.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=345

 Score =   311 bits (797),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -2

Query  804  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  625
            GGGM+FTFYKAQGLSVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVVIA+KFA DA+
Sbjct  167  GGGMMFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVIANKFAADAD  226

Query  624  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  445
            SK+VPASAIPDGWMGLDIGPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GTE+VAKK
Sbjct  227  SKIVPASAIPDGWMGLDIGPDSIKTFGEALDTTKTVIWNGPMGVFEFEKFAAGTEAVAKK  286

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  287  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  345



>ref|XP_002972143.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
 gb|EFJ27060.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
Length=402

 Score =   313 bits (802),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCD+LLLGGGMIFTF+KAQGLSVGSSLVEEDKL LAT L+EKAK KGV+LLLPTDVV+
Sbjct  215  LEKCDVLLLGGGMIFTFFKAQGLSVGSSLVEEDKLILATKLMEKAKLKGVTLLLPTDVVV  274

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA+SK+V ASAIPDGWMGLDIGPDS+K F+ AL +T T+IWNGPMGVFEF  FA
Sbjct  275  ADKFAPDASSKIVSASAIPDGWMGLDIGPDSIKAFSQALNSTNTIIWNGPMGVFEFKNFA  334

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++A KLAELS KGVTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEG+ LP
Sbjct  335  VGTEAIAAKLAELSDKGVTTIIGGGDSVAAVEKAGVADRMSHISTGGGASLELLEGRILP  394

Query  291  GVIALDEA  268
            GV ALD+A
Sbjct  395  GVAALDDA  402



>ref|XP_008805982.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
 ref|XP_008776888.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=400

 Score =   313 bits (801),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 178/188 (95%), Gaps = 1/188 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK DILLLGGGMIFTFYKAQG  VGSSLVE D+L LAT+LLEKAK+KGVSLLLPTDVV+
Sbjct  214  LEKVDILLLGGGMIFTFYKAQGHPVGSSLVE-DQLDLATALLEKAKSKGVSLLLPTDVVV  272

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA+SKVVPAS IPDGWMGLDIGPDS+KTF+++L++TKT+IWNGPMGVFEF+KFA
Sbjct  273  ADKFAADADSKVVPASGIPDGWMGLDIGPDSIKTFSESLDSTKTIIWNGPMGVFEFEKFA  332

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++AKKLA+LSGKGVTTIIGGGDSVAAVEK+G+A  MSHISTGGGASLELLEGK LP
Sbjct  333  VGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKMGLADKMSHISTGGGASLELLEGKSLP  392

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  393  GVLALDDA  400



>dbj|BAJ88371.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   312 bits (799),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMIFTFYKAQGL+VG SLVEEDKL LATSL+E AK+KGV LLLPTDVV+
Sbjct  195  LAKVDILILGGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVV  254

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK+VPA+AIPDGWMGLD+GPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA
Sbjct  255  ADKFAADAESKIVPATAIPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFA  314

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AK+LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  315  AGTDAIAKQLAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  374

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  375  GVLALDEA  382



>ref|XP_010064085.1| PREDICTED: phosphoglycerate kinase, cytosolic [Eucalyptus grandis]
 gb|KCW71390.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=401

 Score =   312 bits (800),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -2

Query  804  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  625
            GGGM+FTFYKAQGLSVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVVIA+KFA DA+
Sbjct  223  GGGMMFTFYKAQGLSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVIANKFAADAD  282

Query  624  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  445
            SK+VPASAIPDGWMGLDIGPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GTE+VAKK
Sbjct  283  SKIVPASAIPDGWMGLDIGPDSIKTFGEALDTTKTVIWNGPMGVFEFEKFAAGTEAVAKK  342

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic [Triticum aestivum]
 emb|CAA33302.1| unnamed protein product [Triticum aestivum]
Length=401

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMIFTFYKAQGL+VG SLVEEDKL LATSL+E AK+KGV LLLPTDVV+
Sbjct  214  LAKVDILILGGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK+VPA+AIPDGWMGLD+GPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA
Sbjct  274  ADKFAADAESKIVPATAIPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AK+LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTDAIAKQLAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  394  GVLALDEA  401



>ref|XP_004951776.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=402

 Score =   310 bits (794),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMI+TFYKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTD+V+
Sbjct  214  LAKVDILILGGGMIYTFYKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDA SK+VPA+AIPD WMGLD+GPD+ KTFNDAL+ T+T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDAESKIVPATAIPDDWMGLDVGPDATKTFNDALDKTQTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKEL  295
             GTE++AKKLAEL + KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK L
Sbjct  334  AGTEAIAKKLAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTL  393

Query  294  PGVIALDEA  268
            PGV+ALDEA
Sbjct  394  PGVLALDEA  402



>ref|XP_009104523.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   310 bits (794),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L   DILLLGGGMI+TFYKAQG +VGSSL+EEDKL LA SL+EKAKAKGVSLLLPTDVVI
Sbjct  214  LSTVDILLLGGGMIYTFYKAQGHAVGSSLLEEDKLDLARSLMEKAKAKGVSLLLPTDVVI  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANSK+V A+AIPDGWMGLDIGPDS+KTF++AL+T KT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAPDANSKIVLATAIPDGWMGLDIGPDSIKTFSEALDTAKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GTE+V K+LAELSGKGVT IIGGGDSVAAVEKVG+A  MSHISTGGGA LELLEGK  P
Sbjct  334  AGTEAVVKQLAELSGKGVTKIIGGGDSVAAVEKVGLADKMSHISTGGGARLELLEGKPRP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_003570108.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brachypodium distachyon]
Length=401

 Score =   308 bits (789),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMIFTFYKAQGL+VG SLVEEDKL LATSL+E AKAKGV LLLP DVV+
Sbjct  214  LAKVDILILGGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETAKAKGVKLLLPIDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SKVVPASAIPDGWMGLD+GPD++KTF++AL+T KT+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADAESKVVPASAIPDGWMGLDVGPDAIKTFSEALDTCKTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AK+LAEL+ KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTDAIAKQLAELTAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393

Query  291  GVIALDEA  268
            GV+ALDEA
Sbjct  394  GVLALDEA  401



>ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   307 bits (787),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMI+TFYKAQG +VG SLVEEDKL LATSL+EKAK+KGVSLLLPTD+V+
Sbjct  214  LAKVDILILGGGMIYTFYKAQGYAVGKSLVEEDKLELATSLIEKAKSKGVSLLLPTDIVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK VPASAIPDGWMGLDIGPDS+KTF++ L+TTKTVIWNGPMGVFEF+KFA
Sbjct  274  ADKFAADAESKTVPASAIPDGWMGLDIGPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AKKLA+++ KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTDAIAKKLADITAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+AL++A
Sbjct  394  GVLALNDA  401



>ref|NP_001142404.1| uncharacterized protein LOC100274579 [Zea mays]
 ref|XP_008681565.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 ref|XP_008681566.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 gb|ACF87897.1| unknown [Zea mays]
 gb|ACF88413.1| unknown [Zea mays]
 gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
 gb|AFW70282.1| phosphoglycerate kinase isoform 1 [Zea mays]
 gb|AFW70283.1| phosphoglycerate kinase isoform 2 [Zea mays]
 gb|AFW70284.1| phosphoglycerate kinase isoform 3 [Zea mays]
Length=402

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMI+TFYKAQG SVG SLVEEDKL LATSL+EKAKAKGVSLLLPTD+V+
Sbjct  214  LAKVDILILGGGMIYTFYKAQGYSVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK+VPA+AIPD WMGLD+GPD+ KTF++AL+TTKTVIWNGPMGVFEF KFA
Sbjct  274  ADKFAADAESKIVPATAIPDDWMGLDVGPDATKTFDEALDTTKTVIWNGPMGVFEFQKFA  333

Query  471  VGTESVAKKLAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKEL  295
             GTE++AKKLAEL + KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK L
Sbjct  334  AGTEAIAKKLAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTL  393

Query  294  PGVIALDEA  268
            PGV+ALD+A
Sbjct  394  PGVLALDDA  402



>ref|XP_004966316.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=401

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMIFTFYKAQG +VG SLVEEDKL LATSL+EKAK+KGVSLLLPTDVV+
Sbjct  214  LGKVDILILGGGMIFTFYKAQGYAVGKSLVEEDKLELATSLIEKAKSKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKF  +A SK+VPAS+IPDGWMGLDIGPDS+KTF+  L+TTKTVIWNGPMGVFEF+KFA
Sbjct  274  ADKFDANAESKIVPASSIPDGWMGLDIGPDSIKTFSQTLDTTKTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++A KLAEL+ KGVTTIIGGGDSVAAVEK G+A+ MSHISTGGGASLELLEGK LP
Sbjct  334  AGTDAIAMKLAELTAKGVTTIIGGGDSVAAVEKAGLANKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>gb|EPS64076.1| phosphoglycerate kinase [Genlisea aurea]
Length=401

 Score =   305 bits (781),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  804  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  625
            GGGMIFTFYKAQG SVGSSLVE DKL LATSL++KAKAKGVSLLLP+DVVIADKFA DA+
Sbjct  223  GGGMIFTFYKAQGQSVGSSLVEADKLDLATSLIDKAKAKGVSLLLPSDVVIADKFAADAS  282

Query  624  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  445
            SKVVPAS IPDGWMGLDIGPDS+K+F +AL++T+T+IWNGPMGVFEFDKFA GTE++A+K
Sbjct  283  SKVVPASEIPDGWMGLDIGPDSIKSFGEALDSTETIIWNGPMGVFEFDKFAAGTEAIARK  342

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  343  LAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  401



>gb|EMT08517.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=401

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMI+TFYKAQG +VG SLVEEDKL LA SL+EKAK+KGVSLLLPTD+V+
Sbjct  214  LSKVDILILGGGMIYTFYKAQGHAVGKSLVEEDKLELANSLIEKAKSKGVSLLLPTDIVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            AD FA DA SK+VPASAIPDGWMGLDIGPDS+K F++ L+TTKTVIWNGPMGVFEF+KFA
Sbjct  274  ADNFAADAESKIVPASAIPDGWMGLDIGPDSIKKFSETLDTTKTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AKKLA+++ KGVTTIIGGGDSVAAVEK G+AS MSHISTGGGASLELLEGK LP
Sbjct  334  AGTDAIAKKLADITAKGVTTIIGGGDSVAAVEKAGLASKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV++LD A
Sbjct  394  GVLSLDNA  401



>gb|AFW70281.1| phosphoglycerate kinase [Zea mays]
Length=572

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMI+TFYKAQG SVG SLVEEDKL LATSL+EKAKAKGVSLLLPTD+V+
Sbjct  384  LAKVDILILGGGMIYTFYKAQGYSVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVV  443

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK+VPA+AIPD WMGLD+GPD+ KTF++AL+TTKTVIWNGPMGVFEF KFA
Sbjct  444  ADKFAADAESKIVPATAIPDDWMGLDVGPDATKTFDEALDTTKTVIWNGPMGVFEFQKFA  503

Query  471  VGTESVAKKLAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKEL  295
             GTE++AKKLAEL + KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK L
Sbjct  504  AGTEAIAKKLAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTL  563

Query  294  PGVIALDEA  268
            PGV+ALD+A
Sbjct  564  PGVLALDDA  572



>ref|XP_006656354.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=401

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMIFTFYKAQG +VG SLVEEDKL LATSL+EKA +KGVSLLLPTDVV+
Sbjct  214  LGKVDILILGGGMIFTFYKAQGYAVGKSLVEEDKLELATSLIEKANSKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKF  DA SK V ASAIPDGWMGLDIGPDS+KTF++ L+TTKTVIWNGPMGVFEF+KFA
Sbjct  274  ADKFTADAESKTVLASAIPDGWMGLDIGPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AKKLA+++ KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTDAIAKKLADITAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_009417722.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417729.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  804  GGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAN  625
            GGGMIFTFYKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV ADKFA DAN
Sbjct  223  GGGMIFTFYKAQGYSVGSSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVAADKFAADAN  282

Query  624  SKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKK  445
              VVPAS IPDGWMGLDIGPDS+K F+++L+TTKT+IWNGPMGVFEF+KFAVGTE++AKK
Sbjct  283  CMVVPASGIPDGWMGLDIGPDSIKAFSESLDTTKTIIWNGPMGVFEFEKFAVGTEAIAKK  342

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LA+LS  GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  343  LADLSAAGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>ref|XP_011013868.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
 ref|XP_011013875.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
Length=429

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 172/216 (80%), Gaps = 28/216 (13%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEK D L LGGGMI+TFYKAQG S+GSSLVEEDKL LATSL+EKAK KGV LLLP DVV+
Sbjct  214  LEKVDFLFLGGGMIYTFYKAQGYSIGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVV  273

Query  651  ADKFAPDANSKV----------------------------VPASAIPDGWMGLDIGPDSV  556
            ADKFAPDANSKV                            VPAS I DGWMGLDIGPDS+
Sbjct  274  ADKFAPDANSKVCIIVRLNYVHSLEYVHVNLLFSAIFLQVVPASEIADGWMGLDIGPDSI  333

Query  555  KTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKGVTTIIGGGDSVAAVE  376
            KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A KLAELSGKGVTTIIGGGDSVAAVE
Sbjct  334  KTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAWKLAELSGKGVTTIIGGGDSVAAVE  393

Query  375  KVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            K G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  394  KAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  429



>dbj|BAJ85222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMI+TFYKAQG +VG SLVE+DKL LA SL+EKAK+KGVSLLLPTD+V+
Sbjct  214  LAKVDILILGGGMIYTFYKAQGHAVGKSLVEDDKLELANSLIEKAKSKGVSLLLPTDIVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            A+ FA DA SK VPASAIPDGWMGLDIGPDS++ F++ L+TTKTVIWNGPMGVFEF+KFA
Sbjct  274  ANNFAADAESKTVPASAIPDGWMGLDIGPDSIRKFSETLDTTKTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AKKLA+++ +GVTTIIGGGDSVAAVEK G+AS MSHISTGGGASLELLEGK LP
Sbjct  334  AGTDAIAKKLADITAQGVTTIIGGGDSVAAVEKAGLASKMSHISTGGGASLELLEGKTLP  393

Query  291  GVIALDEA  268
            GV+ALD+A
Sbjct  394  GVLALDDA  401



>ref|XP_006646936.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=402

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K D+L+LGGGMIFTFYKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+
Sbjct  214  LAKVDVLILGGGMIFTFYKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK V ASAIP+GWMGLD+GPD++KTF+ AL+T  T+IWNGPMGVFEF+KFA
Sbjct  274  ADKFAADAESKTVAASAIPEGWMGLDVGPDAIKTFSGALDTCNTIIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAEL-SGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKEL  295
             GT+++AKKLAEL + KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK L
Sbjct  334  AGTDAIAKKLAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTL  393

Query  294  PGVIALDEA  268
            PGV+ALDEA
Sbjct  394  PGVLALDEA  402



>gb|AFH41102.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
Length=298

 Score =   294 bits (753),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40271.1| 3-phosphoglycerate kinase, partial [Leymus pseudoracemosus]
 gb|AGL91047.1| 3-phosphoglycerate kinase, partial [Psathyrostachys huashanica]
Length=298

 Score =   294 bits (753),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAVAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=494

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L K DIL+LGGGMIFTFYKAQGL+VG SLVEEDKL LATSL+E AK+KGV LLLPTDVV+
Sbjct  214  LAKVDILILGGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFA DA SK+VPA+AIPDGWMGLD+GPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA
Sbjct  274  ADKFAADAESKIVPATAIPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
             GT+++AK+LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  334  AGTDAIAKQLAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393



>gb|AFH41108.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
Length=298

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41091.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41092.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
Length=298

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40274.1| 3-phosphoglycerate kinase, partial [Hystrix duthiei]
 gb|ACO40275.1| 3-phosphoglycerate kinase, partial [Hystrix duthiei subsp. longearistata]
Length=298

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAVAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41121.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
Length=298

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AAM51702.1|AF343476_1 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AAM51706.1|AF343480_1 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AAM51716.1|AF343490_1 3-phosphoglycerate kinase, partial [Aegilops speltoides var. 
ligustica]
 gb|AFH41077.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41080.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. durum]
 gb|AFH41082.1| plastid 3-phosphoglycerate kinase, partial [Aegilops tauschii 
subsp. tauschii x Triticum turgidum subsp. polonicum]
 gb|AFH41085.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41090.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41093.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41096.1| plastid 3-phosphoglycerate kinase, partial [Triticum carthlicum]
 gb|AFH41098.1| plastid 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AFH41100.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum]
 gb|AFH41105.1| plastid 3-phosphoglycerate kinase, partial [Triticum macha]
 gb|AFH41111.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41113.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41116.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41119.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41126.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41129.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41132.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
 gb|AFH41134.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
 gb|AFH41136.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum]
 gb|AFH41138.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. durum]
 gb|AFH41143.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41146.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41151.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41154.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AID16251.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
 gb|AID16258.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16264.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16267.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16269.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
Length=298

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AAM51700.1|AF343474_1 3-phosphoglycerate kinase, partial [Triticum urartu]
 gb|AAM51701.1|AF343475_1 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AAM51703.1|AF343477_1 3-phosphoglycerate kinase, partial [Triticum timopheevii subsp. 
armeniacum]
 gb|AAM51704.1|AF343478_1 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AAM51705.1|AF343479_1 3-phosphoglycerate kinase, partial [Aegilops tauschii subsp. 
tauschii]
 gb|AAM51707.1|AF343481_1 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AAM51711.1|AF343485_1 3-phosphoglycerate kinase, partial [Aegilops bicornis]
 gb|AAM51712.1|AF343486_1 3-phosphoglycerate kinase, partial [Aegilops sharonensis]
 gb|AAM51713.1|AF343487_1 3-phosphoglycerate kinase, partial [Aegilops longissima]
 gb|AAM51714.1|AF343488_1 3-phosphoglycerate kinase, partial [Triticum timopheevii subsp. 
armeniacum]
 gb|AAM51715.1|AF343489_1 3-phosphoglycerate kinase, partial [Aegilops searsii]
 gb|AAM51718.1|AF343492_1 3-phosphoglycerate kinase, partial [Aegilops speltoides subsp. 
speltoides]
 gb|ACO40252.1| 3-phosphoglycerate kinase, partial [Taeniatherum caput-medusae]
 gb|ACO40253.1| 3-phosphoglycerate kinase, partial [Triticum monococcum]
 gb|AFH41072.1| plastid 3-phosphoglycerate kinase, partial [Aegilops tauschii 
subsp. tauschii]
 gb|AFH41075.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41076.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41078.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41079.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. durum]
 gb|AFH41083.1| plastid 3-phosphoglycerate kinase, partial [Aegilops tauschii 
subsp. tauschii x Triticum turgidum subsp. polonicum]
 gb|AFH41086.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41087.1| plastid 3-phosphoglycerate kinase, partial [Triticum carthlicum]
 gb|AFH41089.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41094.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41097.1| plastid 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AFH41103.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41107.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41109.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41110.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41112.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41114.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41115.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41117.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41118.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41120.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41122.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41123.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41125.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41127.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41133.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
 gb|AFH41135.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum]
 gb|AFH41141.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41142.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41145.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41147.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41148.1| plastid 3-phosphoglycerate kinase, partial [Triticum timopheevii]
 gb|AFH41150.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41152.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41153.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AID16245.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16247.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16250.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16254.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16256.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16257.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16259.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16260.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16263.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16265.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16266.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16268.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16270.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
 gb|AID16271.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
Length=298

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40272.1| 3-phosphoglycerate kinase, partial [Leymus secalinus]
 gb|AGL91109.1| 3-phosphoglycerate kinase, partial [Elymus alashanicus]
 gb|AGL91118.1| 3-phosphoglycerate kinase, partial [Elymus magnicaespes]
Length=298

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAVAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40247.1| 3-phosphoglycerate kinase, partial [Psathyrostachys fragilis]
Length=298

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAVAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>ref|WP_011377868.1| MULTISPECIES: phosphoglycerate kinase [Synechococcus]
 sp|Q31P73.1|PGK_SYNE7 RecName: Full=Phosphoglycerate kinase [Synechococcus elongatus 
PCC 7942]
 gb|ABB57146.1| phosphoglycerate kinase [Synechococcus elongatus PCC 7942]
 gb|AJD58338.1| phosphoglycerate kinase [Synechococcus sp. UTEX 2973]
Length=402

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L+KCD LL+GGGMIFTFYKAQGLSVG SLVEEDKL LA SL+ KA+ KGV LLLP DVV+
Sbjct  214  LDKCDKLLIGGGMIFTFYKAQGLSVGGSLVEEDKLDLARSLMAKAQEKGVQLLLPVDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDAN+K V   AIPDGWMGLDIGP+SVK F +AL   ++VIWNGPMGVFEFD+FA
Sbjct  274  ADKFAPDANAKTVAIDAIPDGWMGLDIGPESVKQFEEALADCRSVIWNGPMGVFEFDQFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++A+ LA L+ KG TTIIGGGDSVAAVEKVGVAS MSHISTGGGASLELLEGK LP
Sbjct  334  VGTEAIARSLAGLTRKGATTIIGGGDSVAAVEKVGVASEMSHISTGGGASLELLEGKVLP  393

Query  291  GVIALDEA  268
            GV ALD+A
Sbjct  394  GVAALDDA  401



>gb|AID16262.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
Length=298

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41131.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
Length=298

 Score =   294 bits (752),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AEQ59408.1| 3-phosphoglycerate kinase, partial [Kengyilia rigidula]
Length=298

 Score =   294 bits (752),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AID16252.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
Length=298

 Score =   294 bits (752),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41101.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AID16248.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
Length=298

 Score =   294 bits (752),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AGL91125.1| 3-phosphoglycerate kinase, partial [Campeiostachys kamoji]
Length=298

 Score =   293 bits (751),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AEQ59379.1| 3-phosphoglycerate kinase, partial [Kengyilia hirsuta]
Length=298

 Score =   293 bits (751),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AEQ59377.1| 3-phosphoglycerate kinase, partial [Kengyilia kokonorica]
 gb|AEQ59394.1| 3-phosphoglycerate kinase, partial [Kengyilia melanthera]
 gb|AEQ59401.1| 3-phosphoglycerate kinase, partial [Kengyilia mutica]
 gb|AEQ59404.1| 3-phosphoglycerate kinase, partial [Kengyilia stenachyra]
 gb|AEQ59405.1| 3-phosphoglycerate kinase, partial [Kengyilia longiglumis]
 gb|AGL91046.1| 3-phosphoglycerate kinase, partial [Elymus ciliaris]
 gb|AGL91111.1| 3-phosphoglycerate kinase, partial [Elymus caucasicus]
 gb|AGL91116.1| 3-phosphoglycerate kinase, partial [Elymus ciliaris var. hackelianus]
 gb|AGL91120.1| 3-phosphoglycerate kinase, partial [Elymus pendulinus]
 gb|AGL91122.1| 3-phosphoglycerate kinase, partial [Elymus strictus]
 gb|AGL91130.1| 3-phosphoglycerate kinase, partial [Anthosachne scabra]
Length=298

 Score =   293 bits (751),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40277.1| 3-phosphoglycerate kinase, partial [Leymus arenarius]
Length=298

 Score =   293 bits (751),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDS+KTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSIKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAVAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40261.1| 3-phosphoglycerate kinase, partial [Heteranthelium piliferum]
Length=298

 Score =   293 bits (751),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AID16255.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
Length=298

 Score =   293 bits (751),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AEQ59380.1| 3-phosphoglycerate kinase, partial [Kengyilia hirsuta]
Length=298

 Score =   293 bits (751),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41149.1| plastid 3-phosphoglycerate kinase, partial [Triticum timopheevii]
Length=298

 Score =   293 bits (751),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+D++I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDIII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AEQ59398.1| 3-phosphoglycerate kinase, partial [Kengyilia alatavica]
Length=298

 Score =   293 bits (751),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41130.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
Length=298

 Score =   293 bits (751),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40268.1| 3-phosphoglycerate kinase, partial [Peridictyon sanctum]
Length=298

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40256.1| 3-phosphoglycerate kinase, partial [Australopyrum retrofractum]
Length=298

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41088.1| plastid 3-phosphoglycerate kinase, partial [Triticum carthlicum]
Length=298

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLA+LS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAQLSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|ACO40262.1| 3-phosphoglycerate kinase, partial [Psathyrostachys juncea]
Length=298

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVS+LLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSILLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE+VAKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAVAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>ref|WP_015184203.1| phosphoglycerate kinase [Microcoleus sp. PCC 7113]
 gb|AFZ20067.1| 3-phosphoglycerate kinase [Microcoleus sp. PCC 7113]
Length=401

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            L+K D LL+GGGMIFTFYKA+GLSVG SLVEEDKL LA SL  KAK +GV+LLLPTDVV+
Sbjct  214  LDKVDKLLIGGGMIFTFYKARGLSVGKSLVEEDKLELAKSLEAKAKERGVALLLPTDVVV  273

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            AD FAPDANS+ V   +IPDGWMGLDIGPDSVK F DAL   KTVIWNGPMGVFEFDKFA
Sbjct  274  ADNFAPDANSQTVSIDSIPDGWMGLDIGPDSVKVFQDALSDCKTVIWNGPMGVFEFDKFA  333

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++A  +A+L+ +G TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELP
Sbjct  334  VGTEAIAHTMADLTKQGATTIIGGGDSVAAVEKVGVAEQMSHISTGGGASLELLEGKELP  393

Query  291  GVIALDEA  268
            G+ ALD+A
Sbjct  394  GITALDDA  401



>gb|AFH41155.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
Length=298

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPFDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41074.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
Length=298

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL L TSLL KAKAKGVSLLLP+DV+I
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELTTSLLAKAKAKGVSLLLPSDVII  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDANS+ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTES+AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



>ref|WP_041032823.1| phosphoglycerate kinase [Tolypothrix campylonemoides]
 gb|KIJ78650.1| phosphoglycerate kinase [Tolypothrix campylonemoides VB511288]
Length=400

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCD L++GGGMIFTF+KA+GL+VG SLVEEDKL LA SL  KAK +GV LLLPTDVV+
Sbjct  213  LEKCDKLIIGGGMIFTFFKARGLNVGKSLVEEDKLELAKSLEAKAKERGVDLLLPTDVVV  272

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            AD FAPDANS+ V    IPDGWMGLDIGP+SVK F  AL  TKTVIWNGPMGVFEFDKFA
Sbjct  273  ADNFAPDANSQTVSVENIPDGWMGLDIGPESVKFFQQALADTKTVIWNGPMGVFEFDKFA  332

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            VGTE++A+ LA++S  G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELP
Sbjct  333  VGTEAIARTLADISKTGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKELP  392

Query  291  GVIALDEA  268
            G++ALDEA
Sbjct  393  GIVALDEA  400



>gb|AEQ59407.1| 3-phosphoglycerate kinase, partial [Kengyilia tahelacana]
Length=298

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  831  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVI  652
            LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DVVI
Sbjct  140  LEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVVI  199

Query  651  ADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFA  472
            ADKFAPDAN++ VPASAIPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFA
Sbjct  200  ADKFAPDANNQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFA  259

Query  471  VGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASV  355
            VGTE++AKKLAELS KGVTTIIGGGDSVAAVEKVGVA V
Sbjct  260  VGTEAIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADV  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1840026230422