BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1052

Length=1039
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007018150.1|  Pyridoxin (pyrodoxamine) 5'-phosphate oxidas...    442   1e-149   
ref|XP_007018149.1|  Pyridoxin (pyrodoxamine) 5'-phosphate oxidas...    442   2e-149   
ref|XP_007018154.1|  Pyridoxin (pyrodoxamine) 5'-phosphate oxidas...    441   5e-149   
emb|CBI19229.3|  unnamed protein product                                441   2e-148   Vitis vinifera
ref|XP_007018153.1|  Pyridoxin 5'-phosphate oxidase isoform 6           441   4e-148   
ref|XP_002283933.2|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    441   4e-148   Vitis vinifera
ref|XP_007018148.1|  Pyridoxin (pyrodoxamine) 5'-phosphate oxidas...    441   5e-148   
ref|XP_006345007.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    440   1e-147   Solanum tuberosum [potatoes]
ref|XP_011071781.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    439   2e-147   
ref|XP_011071782.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    438   4e-147   
ref|XP_004236150.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    438   5e-147   Solanum lycopersicum
ref|XP_011016883.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    438   7e-147   Populus euphratica
gb|EYU42519.1|  hypothetical protein MIMGU_mgv1a004179mg                435   8e-146   Erythranthe guttata [common monkey flower]
ref|XP_009607524.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    431   4e-145   
ref|XP_009799743.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    433   4e-145   Nicotiana sylvestris
gb|KJB59897.1|  hypothetical protein B456_009G279800                    433   4e-145   Gossypium raimondii
ref|XP_009607523.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    431   3e-144   Nicotiana tomentosiformis
gb|KDP41449.1|  hypothetical protein JCGZ_15856                         429   1e-143   Jatropha curcas
ref|XP_012067952.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    430   1e-143   Jatropha curcas
ref|XP_008219378.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    427   1e-142   Prunus mume [ume]
ref|XP_007222244.1|  hypothetical protein PRUPE_ppa003886mg             426   3e-142   Prunus persica
ref|XP_006345004.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    423   5e-142   Solanum tuberosum [potatoes]
ref|XP_008338908.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    422   1e-141   
ref|XP_004501612.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    423   2e-141   Cicer arietinum [garbanzo]
ref|XP_011464635.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    423   4e-141   Fragaria vesca subsp. vesca
ref|XP_006433878.1|  hypothetical protein CICLE_v10000790mg             420   5e-141   
ref|XP_006345005.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    418   5e-141   
ref|XP_007136346.1|  hypothetical protein PHAVU_009G037700g             422   6e-141   Phaseolus vulgaris [French bean]
ref|XP_003602963.1|  Pyridoxine/pyridoxamine 5'-phosphate oxidase       420   6e-141   
ref|XP_006433880.1|  hypothetical protein CICLE_v10000790mg             422   6e-141   
ref|XP_009373660.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    421   1e-140   
ref|XP_006433879.1|  hypothetical protein CICLE_v10000790mg             422   1e-140   Citrus clementina [clementine]
ref|XP_010272954.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    422   2e-140   Nelumbo nucifera [Indian lotus]
ref|XP_003522762.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    420   7e-140   Glycine max [soybeans]
gb|KEH35735.1|  pyridoxine/pyridoxamine 5'-phosphate oxidase            419   9e-140   Medicago truncatula
ref|XP_006345003.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    417   1e-139   Solanum tuberosum [potatoes]
gb|AFK45476.1|  unknown                                                 419   1e-139   Medicago truncatula
ref|XP_010675447.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    419   2e-139   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010098667.1|  NAD(P)H-hydrate epimerase                          421   2e-139   
gb|AAM83249.1|  AT5g49970/K9P8_11                                       415   6e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390271.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    416   6e-139   
ref|XP_002514004.1|  pyridoxamine 5-phosphate oxidase, putative         417   9e-139   
ref|NP_568717.2|  pyridoxine/pyridoxamine 5'-phosphate oxidase 1        417   9e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008466184.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    414   9e-139   Cucumis melo [Oriental melon]
ref|XP_006578271.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    416   1e-138   
ref|XP_008466183.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    415   2e-138   Cucumis melo [Oriental melon]
ref|XP_009390268.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    416   3e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008466182.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    415   5e-138   Cucumis melo [Oriental melon]
gb|AAM65907.1|  contains similarity to pyridoxamine 5-phosphate o...    412   5e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782184.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    415   7e-138   
ref|XP_010520769.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    414   1e-137   Tarenaya hassleriana [spider flower]
ref|XP_002864023.1|  AT5g49970/K9P8_11                                  414   1e-137   
ref|XP_010520771.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    414   1e-137   Tarenaya hassleriana [spider flower]
ref|XP_010442476.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    412   1e-137   Camelina sativa [gold-of-pleasure]
ref|XP_006280380.1|  hypothetical protein CARUB_v10026308mg             411   3e-137   
gb|EPS61585.1|  hypothetical protein M569_13210                         407   5e-137   Genlisea aurea
ref|XP_006472520.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    411   9e-137   Citrus sinensis [apfelsine]
ref|XP_006472519.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    411   2e-136   Citrus sinensis [apfelsine]
ref|XP_006402201.1|  hypothetical protein EUTSA_v10013217mg             411   2e-136   Eutrema salsugineum [saltwater cress]
ref|XP_006433885.1|  hypothetical protein CICLE_v10001057mg             405   4e-136   
ref|XP_010482299.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    410   6e-136   Camelina sativa [gold-of-pleasure]
ref|XP_006433887.1|  hypothetical protein CICLE_v10001057mg             405   7e-136   
ref|XP_010441368.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    407   4e-135   Camelina sativa [gold-of-pleasure]
ref|XP_006433886.1|  hypothetical protein CICLE_v10001057mg             404   9e-135   Citrus clementina [clementine]
gb|KCW68464.1|  hypothetical protein EUGRSUZ_F02123                     404   1e-134   Eucalyptus grandis [rose gum]
gb|KFK26631.1|  hypothetical protein AALP_AA8G273600                    404   2e-134   Arabis alpina [alpine rockcress]
ref|XP_008338909.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    402   2e-134   
ref|XP_010926347.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    406   2e-134   
ref|XP_011071779.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    403   2e-134   Sesamum indicum [beniseed]
ref|XP_011652570.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    403   3e-134   Cucumis sativus [cucumbers]
ref|XP_011652569.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    404   7e-134   Cucumis sativus [cucumbers]
ref|XP_004236151.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    401   1e-133   Solanum lycopersicum
emb|CAN80597.1|  hypothetical protein VITISV_002641                     412   1e-133   Vitis vinifera
ref|XP_010520770.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    403   2e-133   Tarenaya hassleriana [spider flower]
ref|XP_004136264.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    403   2e-133   Cucumis sativus [cucumbers]
ref|XP_010318945.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    401   2e-133   Solanum lycopersicum
ref|XP_006386420.1|  pyridoxamine 5'-phosphate oxidase-related fa...    400   3e-133   
ref|XP_010061501.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    403   3e-133   Eucalyptus grandis [rose gum]
ref|XP_009134036.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    402   5e-133   Brassica rapa
ref|XP_002301080.2|  hypothetical protein POPTR_0002s10300g             401   1e-132   
gb|ERN02919.1|  hypothetical protein AMTR_s00135p00077960               401   2e-132   Amborella trichopoda
ref|XP_006841244.2|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    401   2e-132   Amborella trichopoda
ref|XP_009775274.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    397   2e-132   Nicotiana sylvestris
ref|XP_009775272.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    398   3e-132   Nicotiana sylvestris
gb|EYU42518.1|  hypothetical protein MIMGU_mgv1a006341mg                397   3e-132   Erythranthe guttata [common monkey flower]
ref|XP_009775273.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    397   5e-132   Nicotiana sylvestris
ref|XP_010318947.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    396   7e-132   Solanum lycopersicum
emb|CDX83173.1|  BnaA03g23330D                                          399   7e-132   
emb|CDP04610.1|  unnamed protein product                                396   1e-131   Coffea canephora [robusta coffee]
gb|AAM08545.1|AC079935_17  Putative pyridoxamine 5-phosphate oxidase    395   2e-131   Oryza sativa Japonica Group [Japonica rice]
emb|CDY21440.1|  BnaC03g27570D                                          397   3e-131   Brassica napus [oilseed rape]
ref|XP_010318946.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    395   4e-131   Solanum lycopersicum
ref|XP_010318944.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    395   6e-131   Solanum lycopersicum
ref|NP_001064477.1|  Os10g0377800                                       397   8e-131   
ref|XP_007018152.1|  Pyridoxin 5'-phosphate oxidase isoform 5           392   1e-130   
ref|XP_004983070.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    393   2e-129   
ref|XP_004983069.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    393   3e-129   
ref|NP_974918.1|  pyridoxine/pyridoxamine 5'-phosphate oxidase 1        389   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008643596.1|  PREDICTED: uncharacterized protein LOC100381...    391   2e-128   
tpg|DAA46907.1|  TPA: hypothetical protein ZEAMMB73_094953              391   2e-125   
dbj|BAJ96979.1|  predicted protein                                      381   1e-124   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006662307.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    377   2e-124   Oryza brachyantha
emb|CDP16400.1|  unnamed protein product                                377   1e-123   Coffea canephora [robusta coffee]
ref|XP_003573859.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    375   5e-122   
gb|EMS63931.1|  Apolipoprotein A-I-binding protein                      367   5e-122   Triticum urartu
ref|XP_010234690.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    375   6e-122   Brachypodium distachyon [annual false brome]
ref|XP_011071780.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    370   7e-122   
gb|EMT04755.1|  Apolipoprotein A-I-binding protein                      368   1e-120   
ref|XP_002964596.1|  hypothetical protein SELMODRAFT_81184              358   4e-117   
gb|KJB59898.1|  hypothetical protein B456_009G279800                    357   4e-117   Gossypium raimondii
ref|XP_002988799.1|  hypothetical protein SELMODRAFT_159735             356   5e-116   
ref|XP_006433883.1|  hypothetical protein CICLE_v10000790mg             349   3e-114   
ref|XP_001782628.1|  predicted protein                                  349   3e-113   
ref|XP_009390272.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    279   1e-87    
ref|XP_005646534.1|  pyridoxamine 5'-phosphate oxidase                  280   2e-86    Coccomyxa subellipsoidea C-169
ref|XP_005847413.1|  hypothetical protein CHLNCDRAFT_134278             273   1e-83    Chlorella variabilis
gb|ABK24840.1|  unknown                                                 249   4e-76    Picea sitchensis
ref|XP_011400606.1|  Pyridoxine/pyridoxamine 5'-phosphate oxidase       253   8e-76    Auxenochlorella protothecoides
ref|XP_006345006.1|  PREDICTED: pyridoxine/pyridoxamine 5'-phosph...    245   7e-74    Solanum tuberosum [potatoes]
gb|KHN09005.1|  NAD(P)H-hydrate epimerase                               237   3e-71    Glycine soja [wild soybean]
ref|XP_002509162.1|  pyridoxal 5'-phosphate synthase                    229   7e-69    Micromonas commoda
ref|XP_005841510.1|  hypothetical protein GUITHDRAFT_156874             215   4e-64    Guillardia theta CCMP2712
gb|ESA19734.1|  hypothetical protein GLOINDRAFT_133680                  211   1e-62    
gb|KDO81093.1|  hypothetical protein CISIN_1g0369522mg                  209   1e-62    Citrus sinensis [apfelsine]
ref|XP_001694250.1|  hypothetical protein CHLREDRAFT_103444             214   3e-61    Chlamydomonas reinhardtii
ref|XP_006433882.1|  hypothetical protein CICLE_v10000790mg             207   7e-61    
emb|CBN77089.1|  pyridoxamine 5-phosphate oxidase, putative             202   5e-59    Ectocarpus siliculosus
ref|XP_011293548.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    192   1e-55    Musca domestica
ref|XP_005185985.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    192   3e-55    Musca domestica
ref|XP_002055771.1|  GJ19543                                            187   2e-53    
sp|B4M2R8.2|NNRE_DROVI  RecName: Full=NAD(P)H-hydrate epimerase; ...    186   3e-53    Drosophila virilis
ref|XP_008891775.1|  YjeF family domain-containing protein              186   8e-53    Phytophthora parasitica INRA-310
ref|NP_001232952.1|  uncharacterized protein LOC100165916               186   1e-52    Acyrthosiphon pisum
ref|XP_008049215.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    186   2e-52    Carlito syrichta
ref|XP_003886180.1|  hypothetical protein NCLIV_065800                  184   3e-52    Neospora caninum Liverpool
gb|EWM28046.1|  pyridoxamine 5-phosphate oxidase, putative              191   3e-52    Nannochloropsis gaditana
ref|XP_004518861.1|  PREDICTED: NAD(P)H-hydrate epimerase-like is...    184   5e-52    Ceratitis capitata [medfly]
ref|XP_002011712.1|  GI11178                                            182   1e-51    
dbj|GAM17859.1|  hypothetical protein SAMD00019534_010340               182   2e-51    Acytostelium subglobosum LB1
sp|B3NW64.2|NNRE_DROER  RecName: Full=NAD(P)H-hydrate epimerase; ...    181   6e-51    Drosophila erecta
ref|XP_011550997.1|  PREDICTED: NAD(P)H-hydrate epimerase               181   9e-51    Plutella xylostella [cabbage moth]
ref|XP_008568728.1|  PREDICTED: NAD(P)H-hydrate epimerase               182   9e-51    Galeopterus variegatus [Malayan flying lemur]
ref|XP_970501.2|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2       180   9e-51    Tribolium castaneum [rust-red flour beetle]
ref|XP_011364683.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    182   9e-51    Pteropus vampyrus
ref|XP_001977270.1|  GG18945                                            181   9e-51    Drosophila erecta
ref|XP_011191093.1|  PREDICTED: NAD(P)H-hydrate epimerase               181   1e-50    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_008195014.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    180   1e-50    Tribolium castaneum [rust-red flour beetle]
dbj|GAA95330.1|  hypothetical protein E5Q_01987                         180   1e-50    Mixia osmundae IAM 14324
ref|XP_001967143.1|  GF19489                                            179   2e-50    
gb|KIY46724.1|  YjeF N-terminal domain-like protein                     179   2e-50    Fistulina hepatica ATCC 64428
ref|XP_003415203.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    181   2e-50    Loxodonta africana [African bush elephant]
dbj|GAA33511.2|  YjeF N-terminal domain-containing protein GK25285      179   2e-50    Clonorchis sinensis [oriental liver fluke]
ref|XP_002041832.1|  GM11335                                            179   3e-50    Drosophila sechellia
gb|ACJ13219.1|  FI07335p                                                180   4e-50    Drosophila melanogaster
ref|NP_572604.2|  CG2974                                                178   4e-50    Drosophila melanogaster
ref|XP_011202325.1|  PREDICTED: NAD(P)H-hydrate epimerase               178   5e-50    Bactrocera dorsalis [papaya fruit fly]
ref|XP_002605536.1|  hypothetical protein BRAFLDRAFT_104103             179   6e-50    Branchiostoma floridae
gb|KEI41176.1|  hypothetical protein L969DRAFT_92409                    179   7e-50    Mixia osmundae IAM 14324
sp|B4PXF5.2|NNRE_DROYA  RecName: Full=NAD(P)H-hydrate epimerase; ...    177   9e-50    Drosophila yakuba
gb|KIK92572.1|  hypothetical protein PAXRUDRAFT_792304                  177   1e-49    Paxillus rubicundulus Ve08.2h10
gb|AAM11267.1|  RH19667p                                                179   1e-49    Drosophila melanogaster
gb|KFD56549.1|  hypothetical protein M513_02653                         177   2e-49    Trichuris suis
ref|XP_004388533.1|  PREDICTED: LOW QUALITY PROTEIN: NAD(P)H-hydr...    179   2e-49    
gb|KIY96224.1|  hypothetical protein MNEG_11737                         179   2e-49    Monoraphidium neglectum
ref|XP_006861660.1|  PREDICTED: NAD(P)H-hydrate epimerase               178   2e-49    Chrysochloris asiatica
gb|KHJ48649.1|  YjeF-like protein                                       177   2e-49    Trichuris suis
ref|XP_007946623.1|  PREDICTED: NAD(P)H-hydrate epimerase               178   3e-49    Orycteropus afer afer
ref|XP_008049216.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    177   3e-49    Carlito syrichta
ref|XP_002101798.1|  GE15417                                            177   3e-49    Drosophila yakuba
ref|XP_004821745.1|  PREDICTED: NAD(P)H-hydrate epimerase               178   3e-49    
ref|XP_005739811.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          177   3e-49    
ref|XP_003327886.2|  YjeF                                               176   4e-49    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_009021779.1|  hypothetical protein HELRODRAFT_192690             186   5e-49    Helobdella robusta
ref|XP_004619376.1|  PREDICTED: NAD(P)H-hydrate epimerase               177   6e-49    Sorex araneus [Eurasian shrew]
gb|EAW52943.1|  apolipoprotein A-I binding protein, isoform CRA_c       175   7e-49    Homo sapiens [man]
ref|XP_004436279.1|  PREDICTED: NAD(P)H-hydrate epimerase               176   1e-48    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006744324.1|  PREDICTED: NAD(P)H-hydrate epimerase               175   1e-48    
ref|XP_007333047.1|  hypothetical protein AGABI1DRAFT_108868            175   2e-48    Agaricus bisporus var. burnettii JB137-S8
ref|XP_005495381.1|  PREDICTED: NAD(P)H-hydrate epimerase               175   2e-48    
ref|XP_001991181.1|  GH12525                                            174   2e-48    Drosophila grimshawi
gb|EHJ67260.1|  apolipoprotein a binding protein                        175   2e-48    
ref|XP_001116635.2|  PREDICTED: apolipoprotein A-I-binding protei...    176   2e-48    Macaca mulatta [rhesus macaque]
ref|XP_010952189.1|  PREDICTED: NAD(P)H-hydrate epimerase               176   2e-48    Camelus bactrianus [camel]
ref|XP_004027026.1|  PREDICTED: NAD(P)H-hydrate epimerase               176   2e-48    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_005541489.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    176   2e-48    Macaca fascicularis [crab eating macaque]
ref|XP_003259513.1|  PREDICTED: NAD(P)H-hydrate epimerase               176   3e-48    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007974930.1|  PREDICTED: NAD(P)H-hydrate epimerase               176   3e-48    Chlorocebus sabaeus
sp|E3XA68.1|NNRE_ANODA  RecName: Full=NAD(P)H-hydrate epimerase; ...    173   3e-48    
ref|XP_006155254.1|  PREDICTED: NAD(P)H-hydrate epimerase               174   3e-48    
ref|XP_003742116.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          174   3e-48    
ref|XP_011783825.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    176   3e-48    Colobus angolensis palliatus
gb|KIY71990.1|  YjeF N-terminal domain-like protein                     174   3e-48    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_010354715.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    176   3e-48    Rhinopithecus roxellana
emb|CDS07645.1|  hypothetical protein LRAMOSA01594                      174   3e-48    Lichtheimia ramosa
ref|XP_513889.1|  PREDICTED: NAD(P)H-hydrate epimerase                  175   3e-48    Pan troglodytes
emb|CAC86580.1|  apoA-I binding protein                                 175   4e-48    Homo sapiens [man]
ref|NP_658985.2|  NAD(P)H-hydrate epimerase precursor                   175   4e-48    Homo sapiens [man]
ref|XP_003821095.1|  PREDICTED: NAD(P)H-hydrate epimerase               176   4e-48    Pan paniscus [bonobo]
ref|XP_007457946.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    175   4e-48    Lipotes vexillifer [baiji]
dbj|BAG60492.1|  unnamed protein product                                176   4e-48    Homo sapiens [man]
ref|XP_004284599.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform 1     175   4e-48    Orcinus orca [Orca]
ref|XP_006895814.1|  PREDICTED: NAD(P)H-hydrate epimerase               175   4e-48    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002413577.1|  apolipoprotein A-I-binding protein, putative       174   5e-48    
ref|XP_004311921.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform 1     174   5e-48    
ref|XP_002296768.1|  predicted protein                                  173   6e-48    Thalassiosira pseudonana CCMP1335
gb|EAW52941.1|  apolipoprotein A-I binding protein, isoform CRA_a       175   6e-48    Homo sapiens [man]
ref|XP_002164619.2|  PREDICTED: NAD(P)H-hydrate epimerase-like          174   6e-48    Hydra vulgaris
ref|XP_007110412.1|  PREDICTED: NAD(P)H-hydrate epimerase               174   6e-48    Physeter catodon
ref|XP_003937893.1|  PREDICTED: NAD(P)H-hydrate epimerase               174   7e-48    Saimiri boliviensis boliviensis
ref|XP_004480658.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform 2     175   7e-48    Dasypus novemcinctus
ref|XP_004693907.1|  PREDICTED: NAD(P)H-hydrate epimerase               174   7e-48    
ref|XP_002760154.1|  PREDICTED: NAD(P)H-hydrate epimerase               175   7e-48    Callithrix jacchus [common marmoset]
ref|XP_003061593.1|  predicted protein                                  172   7e-48    Micromonas pusilla CCMP1545
ref|XP_003373968.1|  meiotically up-regulated protein 182 protein       174   7e-48    Trichinella spiralis
gb|ELU17607.1|  hypothetical protein CAPTEDRAFT_226012                  176   8e-48    Capitella teleta
ref|XP_003475685.2|  PREDICTED: NAD(P)H-hydrate epimerase               174   8e-48    Cavia porcellus [guinea pig]
dbj|BAM18021.1|  apolipoprotein a binding protein                       173   8e-48    Papilio xuthus [Chinese swallowtail]
ref|XP_008515064.1|  PREDICTED: NAD(P)H-hydrate epimerase               172   9e-48    Equus przewalskii [Przewalski horse]
ref|XP_006232671.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    174   9e-48    Rattus norvegicus [brown rat]
ref|XP_002715421.2|  PREDICTED: NAD(P)H-hydrate epimerase               174   1e-47    Oryctolagus cuniculus [domestic rabbit]
ref|XP_001500364.1|  PREDICTED: NAD(P)H-hydrate epimerase               174   1e-47    Equus caballus [domestic horse]
ref|NP_001072132.1|  NAD(P)H-hydrate epimerase precursor                174   1e-47    Sus scrofa [pigs]
ref|XP_007171916.1|  PREDICTED: NAD(P)H-hydrate epimerase               174   1e-47    Balaenoptera acutorostrata scammoni
ref|XP_009861136.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          174   1e-47    
sp|B4NEH6.2|NNRE_DROWI  RecName: Full=NAD(P)H-hydrate epimerase; ...    172   1e-47    Drosophila willistoni
ref|XP_005943617.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          173   1e-47    Haplochromis burtoni
ref|XP_006794459.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          173   1e-47    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006174648.1|  PREDICTED: NAD(P)H-hydrate epimerase               174   2e-47    
ref|XP_003892881.1|  PREDICTED: NAD(P)H-hydrate epimerase               174   2e-47    
ref|XP_002810067.1|  PREDICTED: NAD(P)H-hydrate epimerase               174   2e-47    
ref|XP_011848179.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    175   2e-47    Mandrillus leucophaeus
ref|XP_010593142.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    172   2e-47    Loxodonta africana [African bush elephant]
ref|XP_003969245.1|  PREDICTED: NAD(P)H-hydrate epimerase               172   2e-47    Takifugu rubripes [tiger puffer]
ref|XP_005532346.1|  PREDICTED: NAD(P)H-hydrate epimerase               173   2e-47    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006456548.1|  hypothetical protein AGABI2DRAFT_181137            171   3e-47    Agaricus bisporus var. bisporus H97
emb|CCD75736.1|  n-terminal yjef related                                171   3e-47    Schistosoma mansoni
ref|XP_009097515.1|  PREDICTED: NAD(P)H-hydrate epimerase               171   3e-47    
ref|NP_001232543.1|  putative apolipoprotein A-I binding protein ...    173   3e-47    Taeniopygia guttata
gb|AAW27603.1|  SJCHGC06839 protein                                     171   3e-47    Schistosoma japonicum
gb|EHA99546.1|  Apolipoprotein A-I-binding protein                      171   3e-47    Heterocephalus glaber [naked mole rat]
ref|XP_007535603.1|  PREDICTED: NAD(P)H-hydrate epimerase               172   3e-47    Erinaceus europaeus [common hedgehog]
gb|KGB39934.1|  NAD(P)H-hydrate epimerase                               171   3e-47    Schistosoma haematobium
sp|E2QRY6.1|NNRE_CANFA  RecName: Full=NAD(P)H-hydrate epimerase; ...    172   4e-47    Canis lupus familiaris [dogs]
gb|ETN67052.1|  apolipoprotein a binding protein                        172   4e-47    Anopheles darlingi [American malaria mosquito]
emb|CDH59648.1|  n-terminal domain-like protein                         171   4e-47    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002177085.1|  predicted protein                                  171   4e-47    Phaeodactylum tricornutum CCAP 1055/1
gb|ERE87402.1|  apolipoprotein A-I-binding protein                      172   4e-47    Cricetulus griseus [Chinese hamsters]
ref|NP_659146.1|  NAD(P)H-hydrate epimerase precursor                   172   4e-47    Mus musculus [mouse]
gb|EDL15317.1|  apolipoprotein A-I binding protein                      172   4e-47    Mus musculus [mouse]
gb|KFH10801.1|  putative apolipoprotein A-I binding protein             174   5e-47    Toxoplasma gondii MAS
ref|XP_004589097.1|  PREDICTED: NAD(P)H-hydrate epimerase               172   5e-47    Ochotona princeps [southern American pika]
emb|CAX16804.1|  apolipoprotein AI binding protein                      171   5e-47    Echinococcus multilocularis
gb|KDQ25689.1|  hypothetical protein PLEOSDRAFT_1044314                 171   5e-47    Pleurotus ostreatus PC15
ref|NP_991365.1|  NAD(P)H-hydrate epimerase precursor                   172   5e-47    Bos taurus [bovine]
ref|XP_793166.3|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1       173   5e-47    
gb|KFG64259.1|  putative apolipoprotein A-I binding protein             173   6e-47    Toxoplasma gondii RUB
ref|XP_004002670.1|  PREDICTED: NAD(P)H-hydrate epimerase               172   6e-47    
gb|KFG48893.1|  putative apolipoprotein A-I binding protein             173   6e-47    Toxoplasma gondii p89
dbj|GAC71797.1|  uncharacterized conserved protein                      171   6e-47    Moesziomyces antarcticus T-34
ref|XP_006052031.1|  PREDICTED: NAD(P)H-hydrate epimerase               172   6e-47    Bubalus bubalis [domestic water buffalo]
ref|XP_004569282.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          172   6e-47    Maylandia zebra
ref|XP_006032674.1|  PREDICTED: NAD(P)H-hydrate epimerase               170   6e-47    
ref|XP_007892352.1|  PREDICTED: NAD(P)H-hydrate epimerase               170   7e-47    Callorhinchus milii [Australian ghost shark]
gb|ETS64774.1|  hypothetical protein PaG_00733                          171   7e-47    Moesziomyces aphidis DSM 70725
ref|XP_005331451.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    172   7e-47    
ref|XP_003795298.1|  PREDICTED: NAD(P)H-hydrate epimerase               172   7e-47    Otolemur garnettii
gb|EFA82667.1|  hypothetical protein PPL_04361                          174   7e-47    Heterostelium album PN500
ref|XP_004402962.1|  PREDICTED: NAD(P)H-hydrate epimerase               172   7e-47    
ref|XP_003447247.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          171   7e-47    Oreochromis niloticus
ref|XP_004480657.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform 1     173   7e-47    
ref|XP_010388118.1|  PREDICTED: NAD(P)H-hydrate epimerase               171   7e-47    
gb|ELR54284.1|  Apolipoprotein A-I-binding protein                      172   7e-47    Bos mutus
ref|XP_003385500.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          171   8e-47    Amphimedon queenslandica
gb|EPR63371.1|  putative apolipoprotein A-I binding protein             173   8e-47    Toxoplasma gondii GT1
ref|XP_008851717.1|  PREDICTED: NAD(P)H-hydrate epimerase               171   8e-47    Nannospalax galili
ref|XP_005677396.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    171   8e-47    Capra hircus [domestic goat]
ref|XP_006266559.1|  PREDICTED: NAD(P)H-hydrate epimerase               171   8e-47    
gb|KFG46160.1|  putative apolipoprotein A-I binding protein             173   8e-47    Toxoplasma gondii GAB2-2007-GAL-DOM2
ref|XP_005961936.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    171   9e-47    
ref|XP_004778697.1|  PREDICTED: NAD(P)H-hydrate epimerase               171   1e-46    
gb|KIK69786.1|  hypothetical protein GYMLUDRAFT_90804                   169   1e-46    
ref|XP_007768609.1|  YjeF N-terminal domain-like protein                170   1e-46    
ref|XP_004871277.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    171   1e-46    
ref|XP_005429474.1|  PREDICTED: NAD(P)H-hydrate epimerase               170   1e-46    
gb|AIC64261.1|  APOA1BP                                                 171   1e-46    
ref|XP_004924309.1|  PREDICTED: NAD(P)H-hydrate epimerase-like is...    169   2e-46    
ref|XP_004366463.1|  hypothetical protein DFA_04053                     169   2e-46    
ref|XP_007319891.1|  hypothetical protein SERLADRAFT_470916             169   2e-46    
ref|NP_001187647.1|  apolipoprotein A-I-binding protein                 169   2e-46    
gb|EFB18487.1|  hypothetical protein PANDA_016700                       169   2e-46    
ref|XP_854934.3|  PREDICTED: apolipoprotein A-I binding protein         172   2e-46    
ref|XP_011364682.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    172   3e-46    
ref|XP_003725195.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    170   3e-46    
ref|XP_008153861.1|  PREDICTED: NAD(P)H-hydrate epimerase               170   3e-46    
ref|NP_001290667.1|  apolipoprotein A-I binding protein precursor       169   4e-46    
dbj|GAK64424.1|  yjeF N-terminal domain-like protein                    169   4e-46    
ref|XP_004924306.1|  PREDICTED: NAD(P)H-hydrate epimerase-like is...    169   4e-46    
gb|KFB41340.1|  AGAP003324-PA-like protein                              168   4e-46    
ref|XP_006943179.1|  PREDICTED: NAD(P)H-hydrate epimerase               169   4e-46    
ref|XP_010354716.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    168   5e-46    
ref|XP_005356950.1|  PREDICTED: NAD(P)H-hydrate epimerase               170   5e-46    
emb|CDS24247.1|  apolipoprotein A I binding protein                     172   6e-46    
gb|EMC88789.1|  Apolipoprotein A-I-binding protein                      167   6e-46    
ref|XP_008888603.1|  apolipoprotein A-I binding protein, putative       172   7e-46    
ref|XP_008329312.1|  PREDICTED: NAD(P)H-hydrate epimerase               169   7e-46    
ref|XP_004074166.1|  PREDICTED: NAD(P)H-hydrate epimerase               169   7e-46    
ref|XP_006775795.1|  PREDICTED: NAD(P)H-hydrate epimerase               167   8e-46    
gb|ACI70044.1|  Apolipoprotein A-I-binding protein precursor            169   8e-46    
gb|ENN73864.1|  hypothetical protein YQE_09556                          176   9e-46    
ref|NP_001002618.1|  NAD(P)H-hydrate epimerase precursor                169   9e-46    
ref|XP_004879255.1|  PREDICTED: NAD(P)H-hydrate epimerase               171   9e-46    
gb|KIL66881.1|  hypothetical protein M378DRAFT_185903                   167   1e-45    
gb|ACH45045.1|  putative apolipoprotein A-I binding protein             169   1e-45    
ref|XP_006097852.1|  PREDICTED: NAD(P)H-hydrate epimerase               168   2e-45    
ref|XP_001367473.1|  PREDICTED: NAD(P)H-hydrate epimerase               168   2e-45    
ref|XP_012138080.1|  PREDICTED: NAD(P)H-hydrate epimerase               166   2e-45    
gb|KIM51603.1|  hypothetical protein SCLCIDRAFT_1224350                 166   2e-45    
gb|KIJ64409.1|  hypothetical protein HYDPIDRAFT_175402                  166   2e-45    
emb|CCF52884.1|  uncharacterized protein UHOR_04255                     167   3e-45    
ref|XP_010740581.1|  PREDICTED: NAD(P)H-hydrate epimerase               167   3e-45    
ref|XP_002367297.1|  apolipoprotein A-I binding protein, putative       170   3e-45    
ref|XP_005811842.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          167   4e-45    
gb|KFM70286.1|  NAD(P)H-hydrate epimerase                               165   4e-45    
ref|XP_009462818.1|  PREDICTED: NAD(P)H-hydrate epimerase               166   4e-45    
ref|XP_007560121.1|  PREDICTED: NAD(P)H-hydrate epimerase               167   4e-45    
ref|XP_007364044.1|  YjeF N-terminal domain-like protein                165   5e-45    
gb|KDQ62699.1|  hypothetical protein JAAARDRAFT_30597                   165   5e-45    
ref|XP_319557.4|  AGAP003324-PA                                         165   6e-45    
gb|KDN51931.1|  hypothetical protein RSAG8_00482                        165   6e-45    
gb|KFQ91123.1|  NAD(P)H-hydrate epimerase                               166   7e-45    
ref|XP_004629787.1|  PREDICTED: NAD(P)H-hydrate epimerase               166   7e-45    
emb|CBQ73044.1|  conserved hypothetical protein                         165   1e-44    
gb|KIK34750.1|  hypothetical protein CY34DRAFT_26783                    164   1e-44    
ref|XP_009054177.1|  hypothetical protein LOTGIDRAFT_117600             164   1e-44    
ref|XP_002111767.1|  hypothetical protein TRIADDRAFT_23664              164   1e-44    
pdb|2DG2|A  Chain A, Crystal Structure Of Mouse Apolipoprotein A-...    165   1e-44    
pdb|2O8N|A  Chain A, Crystal Structure Of Mouse Apolipoprotein A-...    165   1e-44    
ref|XP_007641739.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    167   1e-44    
ref|XP_004667343.1|  PREDICTED: NAD(P)H-hydrate epimerase               166   1e-44    
gb|ESW96225.1|  NAD(P)H-hydrate epimerase                               164   1e-44    
sp|Q17GW6.2|NNRE_AEDAE  RecName: Full=NAD(P)H-hydrate epimerase; ...    164   1e-44    
ref|XP_005434867.1|  PREDICTED: NAD(P)H-hydrate epimerase               169   2e-44    
gb|KIM89439.1|  hypothetical protein PILCRDRAFT_813380                  164   2e-44    
gb|KEP53007.1|  NAD(P)H-hydrate epimerase                               164   2e-44    
ref|XP_003138668.1|  hypothetical protein LOAG_03083                    165   2e-44    
ref|XP_005515415.1|  PREDICTED: NAD(P)H-hydrate epimerase               166   2e-44    
ref|XP_003768183.1|  PREDICTED: NAD(P)H-hydrate epimerase               166   2e-44    
ref|XP_006682358.1|  hypothetical protein BATDEDRAFT_14547              163   2e-44    
emb|CEG78043.1|  Putative YjeF                                          163   2e-44    
gb|KIP08985.1|  hypothetical protein PHLGIDRAFT_126694                  164   2e-44    
ref|XP_005236476.1|  PREDICTED: NAD(P)H-hydrate epimerase               170   2e-44    
ref|XP_008299304.1|  PREDICTED: NAD(P)H-hydrate epimerase               165   3e-44    
ref|XP_007230855.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          164   3e-44    
ref|XP_011173359.1|  PREDICTED: NAD(P)H-hydrate epimerase               164   3e-44    
gb|EPT05270.1|  hypothetical protein FOMPIDRAFT_1057550                 163   3e-44    
gb|ADO27982.1|  apolipoprotein A-I-binding protein                      164   4e-44    
ref|XP_007261814.1|  YjeF N-terminal domain-like protein                163   4e-44    
ref|XP_007850171.1|  protein-binding protein                            163   4e-44    
ref|XP_005867781.1|  PREDICTED: NAD(P)H-hydrate epimerase               164   4e-44    
gb|EJW86581.1|  YjeF domain-containing protein                          164   4e-44    
gb|KII86818.1|  hypothetical protein PLICRDRAFT_114096                  163   5e-44    
gb|AAH87311.1|  LOC496142 protein                                       164   5e-44    
ref|XP_007064662.1|  PREDICTED: NAD(P)H-hydrate epimerase               162   5e-44    
dbj|GAC93546.1|  hypothetical protein PHSY_001111                       163   5e-44    
gb|EUC62005.1|  NAD(P)H-hydrate epimerase                               163   6e-44    
ref|XP_010562409.1|  PREDICTED: NAD(P)H-hydrate epimerase               164   6e-44    
ref|XP_002422732.1|  conserved hypothetical protein                     162   6e-44    
gb|AAI06227.1|  LOC496142 protein                                       164   6e-44    
ref|XP_001656090.1|  AAEL002874-PA                                      164   8e-44    
ref|XP_011389188.1|  hypothetical protein UMAG_10306                    163   8e-44    
emb|CDJ02534.1|  apolipoprotein A I binding protein                     168   9e-44    
ref|XP_005411745.1|  PREDICTED: NAD(P)H-hydrate epimerase               162   9e-44    
ref|XP_011595538.1|  PREDICTED: NAD(P)H-hydrate epimerase               164   9e-44    
ref|XP_005059104.1|  PREDICTED: LOW QUALITY PROTEIN: NAD(P)H-hydr...    163   9e-44    
gb|KFH66327.1|  YjeF                                                    161   1e-43    
emb|CEF69358.1|  NAD(P)H-hydrate epimerase                              162   1e-43    
ref|XP_008037779.1|  YjeF N-terminal domain-like protein                162   1e-43    
ref|XP_008924277.1|  PREDICTED: NAD(P)H-hydrate epimerase               161   1e-43    
ref|XP_007380130.1|  YjeF N-terminal domain-like protein                162   1e-43    
ref|XP_011502309.1|  PREDICTED: NAD(P)H-hydrate epimerase               161   2e-43    
ref|XP_003174247.1|  guanylate kinase                                   161   2e-43    
ref|XP_008621135.1|  YjeF                                               161   2e-43    
ref|XP_002848712.1|  AI-BP family protein                               161   2e-43    
gb|KFW82696.1|  NAD(P)H-hydrate epimerase                               160   2e-43    
emb|CEL52057.1|  hypothetical protein RSOLAG1IB_00594                   161   2e-43    
ref|XP_007406448.1|  hypothetical protein MELLADRAFT_103562             160   2e-43    
ref|XP_001901435.1|  YjeF-related protein N-terminus containing p...    162   3e-43    
ref|XP_007441318.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          163   3e-43    
ref|XP_001638694.1|  predicted protein                                  160   3e-43    
ref|XP_005541488.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    165   3e-43    
gb|ELW59862.1|  Tetratricopeptide repeat protein 24                     168   4e-43    
emb|CEJ00729.1|  Putative YjeF                                          160   4e-43    
gb|KIJ54152.1|  hypothetical protein M422DRAFT_58315                    160   5e-43    
gb|ERG84919.1|  apolipoprotein a-i-binding protein                      161   5e-43    
ref|XP_001603812.2|  PREDICTED: NAD(P)H-hydrate epimerase               161   6e-43    
ref|XP_008170189.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    164   6e-43    
gb|KHN83827.1|  NAD(P)H-hydrate epimerase                               165   7e-43    
ref|XP_002938991.2|  PREDICTED: NAD(P)H-hydrate epimerase               161   7e-43    
gb|KFO55362.1|  NAD(P)H-hydrate epimerase                               159   8e-43    
gb|KIM48816.1|  hypothetical protein M413DRAFT_437990                   159   9e-43    
ref|XP_005280754.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X1    164   9e-43    
emb|CEG64189.1|  Putative YjeF                                          159   1e-42    
gb|EST05529.1|  NAD(P)H-hydrate epimerase                               160   1e-42    
ref|XP_011059222.1|  PREDICTED: NAD(P)H-hydrate epimerase               160   1e-42    
ref|XP_007401671.1|  hypothetical protein PHACADRAFT_265146             159   1e-42    
emb|CDI53520.1|  n-terminal domain-like protein                         160   1e-42    
ref|XP_003488601.1|  PREDICTED: yjeF N-terminal domain-containing...    160   1e-42    
ref|XP_012062542.1|  PREDICTED: NAD(P)H-hydrate epimerase               160   1e-42    
gb|KIJ95974.1|  hypothetical protein K443DRAFT_134267                   159   2e-42    
ref|XP_008123376.1|  PREDICTED: LOW QUALITY PROTEIN: NAD(P)H-hydr...    158   2e-42    
ref|XP_007635278.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    160   2e-42    
emb|CDW57456.1|  apolipoprotein A I binding protein                     157   5e-42    
gb|KDR73554.1|  hypothetical protein GALMADRAFT_100297                  157   5e-42    
ref|XP_011306119.1|  PREDICTED: NAD(P)H-hydrate epimerase               158   5e-42    
sp|E9HCD7.1|NNRE_DAPPU  RecName: Full=NAD(P)H-hydrate epimerase; ...    157   5e-42    
emb|CBK24546.2|  unnamed protein product                                157   6e-42    
ref|XP_007297251.1|  putative apolipoprotein A-I binding protein        157   6e-42    
gb|EFN81989.1|  Apolipoprotein A-I-binding protein                      156   1e-41    
gb|EMD39917.1|  hypothetical protein CERSUDRAFT_150693                  157   1e-41    
ref|XP_001487773.1|  hypothetical protein PGUG_01150                    156   1e-41    
ref|XP_646381.1|  hypothetical protein DDB_G0269890                     156   2e-41    
ref|XP_011143384.1|  PREDICTED: NAD(P)H-hydrate epimerase               157   2e-41    
ref|XP_001876069.1|  predicted protein                                  156   2e-41    
ref|XP_005021770.1|  PREDICTED: NAD(P)H-hydrate epimerase               154   3e-41    
ref|XP_002023024.1|  GL16587                                            155   3e-41    
gb|EOA99725.1|  Apolipoprotein A-I-binding protein                      154   4e-41    
ref|XP_001354421.2|  GA15549                                            155   4e-41    
sp|F7DL67.1|NNRE_XENTR  RecName: Full=NAD(P)H-hydrate epimerase; ...    157   4e-41    
ref|XP_008718612.1|  YjeF family domain-containing protein              155   4e-41    
gb|EZF32431.1|  YjeF family domain-containing protein                   155   4e-41    
ref|XP_007870424.1|  YjeF N-terminal domain-like protein                155   5e-41    
emb|CEP11674.1|  hypothetical protein                                   154   5e-41    
ref|XP_003231540.1|  YjeF N                                             154   6e-41    
ref|XP_007340127.1|  YjeF N-terminal domain-like protein                155   6e-41    
ref|XP_002738520.1|  PREDICTED: NAD(P)H-hydrate epimerase-like          154   6e-41    
gb|EGD93201.1|  YjeF N                                                  155   6e-41    
emb|CCM03512.1|  predicted protein                                      159   7e-41    
gb|KIO29816.1|  hypothetical protein M407DRAFT_162462                   154   7e-41    
dbj|GAA91277.1|  AI-BP family protein                                   154   7e-41    
ref|XP_003689621.1|  PREDICTED: yjeF N-terminal domain-containing...    154   8e-41    
gb|KDO35668.1|  YjeF                                                    155   8e-41    
gb|KIW70695.1|  YjeF family domain-containing protein                   155   9e-41    
gb|KJA27486.1|  hypothetical protein HYPSUDRAFT_63167                   154   1e-40    
ref|XP_005712039.1|  unnamed protein product                            155   1e-40    
gb|EPY88652.1|  NAD(P)H-hydrate epimerase precursor                     157   1e-40    
gb|EFN61302.1|  Apolipoprotein A-I-binding protein                      153   2e-40    
ref|XP_011266605.1|  PREDICTED: NAD(P)H-hydrate epimerase               154   2e-40    
gb|ELR04690.1|  YjeF                                                    153   2e-40    
ref|XP_008627024.1|  PREDICTED: tetratricopeptide repeat protein ...    159   2e-40    
gb|EJT98745.1|  YjeF N-terminal domain-containing protein               153   2e-40    
emb|CAF89685.1|  unnamed protein product                                153   3e-40    
emb|CAK38253.1|  unnamed protein product                                152   3e-40    
ref|XP_009227990.1|  YjeF protein                                       152   4e-40    
ref|XP_011343121.1|  PREDICTED: NAD(P)H-hydrate epimerase               153   4e-40    
ref|XP_003034046.1|  hypothetical protein SCHCODRAFT_66970              152   5e-40    
gb|EPB86840.1|  YjeF                                                    152   5e-40    
gb|KFY81091.1|  hypothetical protein V499_00129                         152   5e-40    
ref|XP_006957511.1|  YjeF N-terminal domain-like protein                152   6e-40    
gb|KFY17384.1|  hypothetical protein V492_00717                         152   6e-40    
ref|XP_011643848.1|  PREDICTED: NAD(P)H-hydrate epimerase               152   6e-40    
gb|KFY34325.1|  hypothetical protein V494_06863                         152   7e-40    
ref|XP_011865099.1|  PREDICTED: NAD(P)H-hydrate epimerase               152   7e-40    
gb|KDQ20926.1|  hypothetical protein BOTBODRAFT_26937                   152   7e-40    
ref|XP_001390342.2|  hypothetical protein ANI_1_550034                  152   7e-40    
ref|XP_009835808.1|  YjeF family domain-containing protein              151   8e-40    
ref|XP_002378961.1|  AI-BP family protein                               152   8e-40    
dbj|GAE00088.1|  AI-BP family protein                                   151   9e-40    
ref|XP_004714768.1|  PREDICTED: NAD(P)H-hydrate epimerase               150   1e-39    
ref|XP_005793827.1|  apolipo protein A-I binding protein                151   1e-39    
gb|KFX88131.1|  hypothetical protein V490_07821                         150   2e-39    
gb|KFY94944.1|  hypothetical protein V498_03638                         150   2e-39    
gb|KFY68944.1|  hypothetical protein V496_00674                         150   2e-39    
ref|XP_002493219.1|  Putative protein of unknown function               150   2e-39    
gb|EJT50078.1|  hypothetical protein A1Q1_00733                         151   2e-39    
gb|EAS31333.3|  NAD(P)H-hydrate epimerase                               151   2e-39    
gb|KJK82733.1|  hypothetical protein H634G_01870                        150   2e-39    
ref|XP_003196511.1|  protein-binding protein                            150   2e-39    
gb|KGK40071.1|  hypothetical protein JL09_g806                          150   2e-39    
emb|CEJ90800.1|  Putative NAD(P)H-hydrate epimerase                     150   3e-39    
emb|CDM36065.1|  Meiotically up-regulated gene 182 protein              150   3e-39    
gb|KIR80211.1|  NAD(P)H-hydrate epimerase                               150   3e-39    
ref|XP_004199395.1|  Piso0_002833                                       150   4e-39    
ref|XP_003721201.1|  YjeF                                               149   5e-39    
gb|ADD24575.1|  YjeF N-terminal domain-containing protein GH12525       150   5e-39    
ref|XP_003285725.1|  hypothetical protein DICPUDRAFT_149615             149   6e-39    
gb|KJJ13269.1|  hypothetical protein U727_00433970271                   149   6e-39    
gb|ADD84611.1|  hypothetical protein                                    149   7e-39    
ref|XP_006976461.1|  PREDICTED: NAD(P)H-hydrate epimerase               148   8e-39    
ref|XP_011848180.1|  PREDICTED: NAD(P)H-hydrate epimerase isoform X2    148   8e-39    
gb|KIJ17643.1|  hypothetical protein PAXINDRAFT_129890                  147   9e-39    
ref|NP_001099910.1|  NAD(P)H-hydrate epimerase                          147   1e-38    
ref|XP_007717527.1|  hypothetical protein COCCADRAFT_41268              148   1e-38    
gb|ACO12281.1|  YjeF N-terminal domain-containing protein CG2974 ...    149   1e-38    
emb|CDK24594.1|  unnamed protein product                                148   2e-38    
ref|XP_011232716.1|  PREDICTED: NAD(P)H-hydrate epimerase               147   2e-38    
ref|XP_009040248.1|  hypothetical protein AURANDRAFT_31365              148   2e-38    
ref|XP_001615790.1|  hypothetical protein                               149   2e-38    
ref|XP_002628028.1|  AI-BP family protein                               148   2e-38    
gb|EGW07049.1|  Apolipoprotein A-I-binding protein                      147   2e-38    
ref|XP_004200254.1|  Piso0_002833                                       147   3e-38    



>ref|XP_007018150.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 3 [Theobroma 
cacao]
 ref|XP_007018151.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 3 [Theobroma 
cacao]
 gb|EOY15375.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 3 [Theobroma 
cacao]
 gb|EOY15376.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 3 [Theobroma 
cacao]
Length=468

 Score =   442 bits (1137),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 221/347 (64%), Positives = 257/347 (74%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I+YLT +EA EID +LMGPLGFS+DQLMELAGLS+AT++AEVY P EY R+L ICGPG+N
Sbjct  11    ITYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSMAEVYKPSEYNRVLAICGPGNN  70

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  71    GGDGLVAARHLYHFGYKPFVCYPKRTSKPLYSGLVTQLESLSIPFLSVDELPVDWSNDFD  130

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LI++LV L N +   +KSPVIVSVDIPSGWHV+ GD+NG
Sbjct  131   ILVDAMFGFSFHGAPRPPFDNLIEKLVHLNNYKQRQQKSPVIVSVDIPSGWHVEEGDVNG  190

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSI +K+KL LP YPGTSMCVRIG+P
Sbjct  191   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPSIAEKYKLHLPPYPGTSMCVRIGKP  250

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEADP DQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  251   PQIDISALRENYMSPDFLEEQVEADPIDQFRKWFDDAVAAGLKEPNAMALSTTGKDGKPS  310

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+ V+KDGFVWYT+YESRKARE+SEN HASLLFYW  LN QV
Sbjct  311   SRMVLLKSVDKDGFVWYTNYESRKARELSENSHASLLFYWDGLNRQV  357



>ref|XP_007018149.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 2 [Theobroma 
cacao]
 ref|XP_007018155.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 2 [Theobroma 
cacao]
 gb|EOY15374.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 2 [Theobroma 
cacao]
 gb|EOY15380.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 2 [Theobroma 
cacao]
Length=461

 Score =   442 bits (1136),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 221/347 (64%), Positives = 257/347 (74%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I+YLT +EA EID +LMGPLGFS+DQLMELAGLS+AT++AEVY P EY R+L ICGPG+N
Sbjct  11    ITYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSMAEVYKPSEYNRVLAICGPGNN  70

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  71    GGDGLVAARHLYHFGYKPFVCYPKRTSKPLYSGLVTQLESLSIPFLSVDELPVDWSNDFD  130

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LI++LV L N +   +KSPVIVSVDIPSGWHV+ GD+NG
Sbjct  131   ILVDAMFGFSFHGAPRPPFDNLIEKLVHLNNYKQRQQKSPVIVSVDIPSGWHVEEGDVNG  190

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSI +K+KL LP YPGTSMCVRIG+P
Sbjct  191   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPSIAEKYKLHLPPYPGTSMCVRIGKP  250

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEADP DQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  251   PQIDISALRENYMSPDFLEEQVEADPIDQFRKWFDDAVAAGLKEPNAMALSTTGKDGKPS  310

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+ V+KDGFVWYT+YESRKARE+SEN HASLLFYW  LN QV
Sbjct  311   SRMVLLKSVDKDGFVWYTNYESRKARELSENSHASLLFYWDGLNRQV  357



>ref|XP_007018154.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 7, partial 
[Theobroma cacao]
 gb|EOY15379.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 7, partial 
[Theobroma cacao]
Length=486

 Score =   441 bits (1135),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 221/347 (64%), Positives = 257/347 (74%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I+YLT +EA EID +LMGPLGFS+DQLMELAGLS+AT++AEVY P EY R+L ICGPG+N
Sbjct  43    ITYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSMAEVYKPSEYNRVLAICGPGNN  102

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  103   GGDGLVAARHLYHFGYKPFVCYPKRTSKPLYSGLVTQLESLSIPFLSVDELPVDWSNDFD  162

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LI++LV L N +   +KSPVIVSVDIPSGWHV+ GD+NG
Sbjct  163   ILVDAMFGFSFHGAPRPPFDNLIEKLVHLNNYKQRQQKSPVIVSVDIPSGWHVEEGDVNG  222

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSI +K+KL LP YPGTSMCVRIG+P
Sbjct  223   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPSIAEKYKLHLPPYPGTSMCVRIGKP  282

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEADP DQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  283   PQIDISALRENYMSPDFLEEQVEADPIDQFRKWFDDAVAAGLKEPNAMALSTTGKDGKPS  342

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+ V+KDGFVWYT+YESRKARE+SEN HASLLFYW  LN QV
Sbjct  343   SRMVLLKSVDKDGFVWYTNYESRKARELSENSHASLLFYWDGLNRQV  389



>emb|CBI19229.3| unnamed protein product [Vitis vinifera]
Length=523

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 257/347 (74%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICGPG+N
Sbjct  66    ISYLLQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYRPSEYNRVLAICGPGNN  125

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ ++CYP +TPK  YTGLVTQ                       
Sbjct  126   GGDGLVAARHLHHFGYKPYICYPKRTPKPLYTGLVTQLESLSVPFLSVEDLPLDLSNDFD  185

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LI+R++ L N   + +K PVIVS+DIPSGWHV+ GDI+G
Sbjct  186   ILVDAMFGFSFHGAPRPPFDDLIRRMICLHNYGQTRQKPPVIVSIDIPSGWHVEEGDIDG  245

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I DKFKL LP YPGT+MCVRIG+P
Sbjct  246   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPFIADKFKLHLPPYPGTAMCVRIGKP  305

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L  +VEADP DQF+KWFD A+VAG+KEPN MALST  KDGKPS
Sbjct  306   PQIDISALRENYISPEFLEEYVEADPMDQFRKWFDDAVVAGLKEPNAMALSTAGKDGKPS  365

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+KDGFVWYT+Y SRKA EISENPHASLLFYW  LN QV
Sbjct  366   SRIVLLKGVDKDGFVWYTNYGSRKAHEISENPHASLLFYWDGLNRQV  412



>ref|XP_007018153.1| Pyridoxin 5'-phosphate oxidase isoform 6 [Theobroma cacao]
 gb|EOY15378.1| Pyridoxin 5'-phosphate oxidase isoform 6 [Theobroma cacao]
Length=537

 Score =   441 bits (1134),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 221/347 (64%), Positives = 257/347 (74%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I+YLT +EA EID +LMGPLGFS+DQLMELAGLS+AT++AEVY P EY R+L ICGPG+N
Sbjct  80    ITYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSMAEVYKPSEYNRVLAICGPGNN  139

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  140   GGDGLVAARHLYHFGYKPFVCYPKRTSKPLYSGLVTQLESLSIPFLSVDELPVDWSNDFD  199

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LI++LV L N +   +KSPVIVSVDIPSGWHV+ GD+NG
Sbjct  200   ILVDAMFGFSFHGAPRPPFDNLIEKLVHLNNYKQRQQKSPVIVSVDIPSGWHVEEGDVNG  259

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSI +K+KL LP YPGTSMCVRIG+P
Sbjct  260   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPSIAEKYKLHLPPYPGTSMCVRIGKP  319

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEADP DQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  320   PQIDISALRENYMSPDFLEEQVEADPIDQFRKWFDDAVAAGLKEPNAMALSTTGKDGKPS  379

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+ V+KDGFVWYT+YESRKARE+SEN HASLLFYW  LN QV
Sbjct  380   SRMVLLKSVDKDGFVWYTNYESRKARELSENSHASLLFYWDGLNRQV  426



>ref|XP_002283933.2| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Vitis vinifera]
Length=533

 Score =   441 bits (1133),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 257/347 (74%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICGPG+N
Sbjct  76    ISYLLQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYRPSEYNRVLAICGPGNN  135

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ ++CYP +TPK  YTGLVTQ                       
Sbjct  136   GGDGLVAARHLHHFGYKPYICYPKRTPKPLYTGLVTQLESLSVPFLSVEDLPLDLSNDFD  195

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LI+R++ L N   + +K PVIVS+DIPSGWHV+ GDI+G
Sbjct  196   ILVDAMFGFSFHGAPRPPFDDLIRRMICLHNYGQTRQKPPVIVSIDIPSGWHVEEGDIDG  255

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I DKFKL LP YPGT+MCVRIG+P
Sbjct  256   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPFIADKFKLHLPPYPGTAMCVRIGKP  315

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L  +VEADP DQF+KWFD A+VAG+KEPN MALST  KDGKPS
Sbjct  316   PQIDISALRENYISPEFLEEYVEADPMDQFRKWFDDAVVAGLKEPNAMALSTAGKDGKPS  375

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+KDGFVWYT+Y SRKA EISENPHASLLFYW  LN QV
Sbjct  376   SRIVLLKGVDKDGFVWYTNYGSRKAHEISENPHASLLFYWDGLNRQV  422



>ref|XP_007018148.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 1 [Theobroma 
cacao]
 gb|EOY15373.1| Pyridoxin (pyrodoxamine) 5'-phosphate oxidase isoform 1 [Theobroma 
cacao]
Length=555

 Score =   441 bits (1135),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 221/347 (64%), Positives = 257/347 (74%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I+YLT +EA EID +LMGPLGFS+DQLMELAGLS+AT++AEVY P EY R+L ICGPG+N
Sbjct  98    ITYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSMAEVYKPSEYNRVLAICGPGNN  157

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  158   GGDGLVAARHLYHFGYKPFVCYPKRTSKPLYSGLVTQLESLSIPFLSVDELPVDWSNDFD  217

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LI++LV L N +   +KSPVIVSVDIPSGWHV+ GD+NG
Sbjct  218   ILVDAMFGFSFHGAPRPPFDNLIEKLVHLNNYKQRQQKSPVIVSVDIPSGWHVEEGDVNG  277

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSI +K+KL LP YPGTSMCVRIG+P
Sbjct  278   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPSIAEKYKLHLPPYPGTSMCVRIGKP  337

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEADP DQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  338   PQIDISALRENYMSPDFLEEQVEADPIDQFRKWFDDAVAAGLKEPNAMALSTTGKDGKPS  397

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+ V+KDGFVWYT+YESRKARE+SEN HASLLFYW  LN QV
Sbjct  398   SRMVLLKSVDKDGFVWYTNYESRKARELSENSHASLLFYWDGLNRQV  444



>ref|XP_006345007.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
[Solanum tuberosum]
Length=535

 Score =   440 bits (1131),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 219/347 (63%), Positives = 255/347 (73%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA EID +LMGPLGFS+DQLMELAGLS+A AIAEVY P EY R+L ICGPG+N
Sbjct  78    ISYLNQKEAAEIDEILMGPLGFSVDQLMELAGLSVAAAIAEVYRPSEYSRVLTICGPGNN  137

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y GLVTQ                       
Sbjct  138   GGDGLVAARHLYHFGYKPFICYPKRTAKPLYDGLVTQLESMSVPFLSLEDLPKDLSDSFD  197

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRLV+LK   D+H+KSP I+S+DIPSGWHV+ GD++G
Sbjct  198   ILVDAIFGFSFHGSPRPPFDDLIQRLVALKINGDTHQKSPAIISIDIPSGWHVEEGDLSG  257

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAKRF G HHFLGGRF+PPSI +KF L LP YPGTSMCVRIG+P
Sbjct  258   EGIKPDMLVSLTAPKLCAKRFSGSHHFLGGRFVPPSIRNKFNLQLPAYPGTSMCVRIGKP  317

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I            ALL   V ADPFDQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  318   PKIDISSLRENYISPALLEEEVVADPFDQFQKWFDDAMAAGLKEPNAMALSTTGKDGKPS  377

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+KDGFVWYT+YE RK ++I+ENPHA+LLFYW  LN QV
Sbjct  378   SRIVLLKGVDKDGFVWYTNYEGRKGQQIAENPHAALLFYWDDLNRQV  424



>ref|XP_011071781.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=536

 Score =   439 bits (1128),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 255/347 (73%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P E +RIL ICGPG+N
Sbjct  79    ISYLNQREAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPDERKRILAICGPGNN  138

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ F+CYP +T K  Y GLVTQ                       
Sbjct  139   GGDGLVAARHLHHFGYKPFICYPKRTAKALYNGLVTQLESLSIPFLSVEDLPMDLSTSFD  198

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LI+RLV+L  P   + KSPVIVSVDIPSGWHV+ GD++G
Sbjct  199   IVVDAIFGFSFHGSPRPPFDDLIRRLVALGTPNQKNEKSPVIVSVDIPSGWHVEEGDVSG  258

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +KFKL LP YPGTSMCVRIG+P
Sbjct  259   EGIKPDMLVSLTAPKLCAKRFSGPHHFLGGRFVPPSVAEKFKLDLPAYPGTSMCVRIGKP  318

Query  399   PEIYPLALLGMHV---------EADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +    L   ++         EA+PFDQF+KWFD A+ +G+KEPN MALST  KDGKPS
Sbjct  319   PRVDISTLRENYISPEFSEDQAEANPFDQFQKWFDDAMASGLKEPNAMALSTTGKDGKPS  378

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G++KDGFVWYT+YESRKA +ISENP A+LLFYW  LN QV
Sbjct  379   SRMVLLKGLDKDGFVWYTNYESRKAHQISENPRAALLFYWDALNRQV  425



>ref|XP_011071782.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=532

 Score =   438 bits (1127),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 255/347 (73%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P E +RIL ICGPG+N
Sbjct  75    ISYLNQREAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPDERKRILAICGPGNN  134

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ F+CYP +T K  Y GLVTQ                       
Sbjct  135   GGDGLVAARHLHHFGYKPFICYPKRTAKALYNGLVTQLESLSIPFLSVEDLPMDLSTSFD  194

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LI+RLV+L  P   + KSPVIVSVDIPSGWHV+ GD++G
Sbjct  195   IVVDAIFGFSFHGSPRPPFDDLIRRLVALGTPNQKNEKSPVIVSVDIPSGWHVEEGDVSG  254

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +KFKL LP YPGTSMCVRIG+P
Sbjct  255   EGIKPDMLVSLTAPKLCAKRFSGPHHFLGGRFVPPSVAEKFKLDLPAYPGTSMCVRIGKP  314

Query  399   PEIYPLALLGMHV---------EADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +    L   ++         EA+PFDQF+KWFD A+ +G+KEPN MALST  KDGKPS
Sbjct  315   PRVDISTLRENYISPEFSEDQAEANPFDQFQKWFDDAMASGLKEPNAMALSTTGKDGKPS  374

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G++KDGFVWYT+YESRKA +ISENP A+LLFYW  LN QV
Sbjct  375   SRMVLLKGLDKDGFVWYTNYESRKAHQISENPRAALLFYWDALNRQV  421



>ref|XP_004236150.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
[Solanum lycopersicum]
Length=529

 Score =   438 bits (1126),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 218/347 (63%), Positives = 255/347 (73%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA +ID +LMGPLGFS+DQLMELAGLS+A AIAEVY P EY R+L ICGPG+N
Sbjct  72    ISYLNQKEAAQIDEILMGPLGFSVDQLMELAGLSVAAAIAEVYRPSEYSRVLTICGPGNN  131

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y GLVTQ                       
Sbjct  132   GGDGLVAARHLYHFGYKPFICYPKRTAKPLYDGLVTQLESLSVPFLSLEDLPKDLSDSFD  191

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRLV+LK   D+H+KSP I+S+DIPSGWHV+ GD++G
Sbjct  192   ILVDAMFGFSFHGSPRPPFDDLIQRLVALKLNGDTHQKSPAIISIDIPSGWHVEEGDLSG  251

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAKRF G HHFLGGRF+PPSI +KF L LP YPGTSMCVRIG+P
Sbjct  252   EGIQPDMLVSLTAPKLCAKRFSGSHHFLGGRFVPPSIRNKFNLQLPAYPGTSMCVRIGKP  311

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I            ALL   V ADPFDQF+KWFD A+VAG+KEPN MALST  KDGKPS
Sbjct  312   PKIDISSLRENYISPALLEEEVVADPFDQFQKWFDDAMVAGLKEPNAMALSTTGKDGKPS  371

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +KDGFVWYT+YE RK ++I+ENPHA+LLFYW  LN QV
Sbjct  372   SRIVLLKGFDKDGFVWYTNYEGRKGQQIAENPHAALLFYWDDLNRQV  418



>ref|XP_011016883.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Populus euphratica]
Length=543

 Score =   438 bits (1126),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 221/354 (62%), Positives = 258/354 (73%), Gaps = 44/354 (12%)
 Frame = -2

Query  1035  KMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILV  856
             +M ++  ISYLT +EA E+D +LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L 
Sbjct  79    RMQNSESISYLTQREAAEVDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYSRVLA  138

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------  724
             ICGPG+NGGDGLVAARHLH+FGY+  +CYP +T K  Y GLVTQ                
Sbjct  139   ICGPGNNGGDGLVAARHLHHFGYKPSVCYPKRTQKPLYNGLVTQLESLSVPFLSVEDLPV  198

Query  723   -------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHV  601
                                G   PPFD+LIQ+LV L N   +H+KS VIVSVDIPSGWHV
Sbjct  199   DLSEDFDILVDAMFGFSFHGSPRPPFDDLIQKLVQLCNFAQNHQKSTVIVSVDIPSGWHV  258

Query  600   DGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSM  421
             + GD++GEG++P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSI DKFKL LP YPGTSM
Sbjct  259   EEGDVSGEGVKPDMLVSLTAPKLCAKKFTGPHHFLGGRFVPPSIADKFKLHLPPYPGTSM  318

Query  420   CVRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTG  268
             CVRIG+P +I   A         LL   V ADP DQF+KWFD AL AG++EPN MALST 
Sbjct  319   CVRIGKPLQIDISALRQNYISPELLEEQVAADPIDQFRKWFDEALTAGLREPNAMALSTV  378

Query  267   TKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KDGKPSSR+V L+GV+KDGFVWYT+YES+KA E+SENP ASLLFYW  LN QV
Sbjct  379   GKDGKPSSRIVLLKGVDKDGFVWYTNYESQKAHELSENPQASLLFYWDGLNRQV  432



>gb|EYU42519.1| hypothetical protein MIMGU_mgv1a004179mg [Erythranthe guttata]
Length=540

 Score =   435 bits (1119),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 215/347 (62%), Positives = 255/347 (73%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P E+ R+L ICGPG+N
Sbjct  83    ISYLNQREAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPAEHNRVLAICGPGNN  142

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  143   GGDGLVAARHLHHFGYKPFICYPKRTDKALYSGLVTQLESLSIPFLSVEDLPADLSASFD  202

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRLV+L+NP   + KSPV+VSVDIPSGWHV+ GD++G
Sbjct  203   IVVDAIFGFSFHGSPRPPFDDLIQRLVALENPSQKNEKSPVVVSVDIPSGWHVEEGDLSG  262

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAKRF G HHFLGGRF+PPSI +KFKL LP YPGTSMCVRIG+P
Sbjct  263   NGIKPDMLVSLTAPKLCAKRFSGSHHFLGGRFVPPSIAEKFKLELPAYPGTSMCVRIGKP  322

Query  399   PEIYPLALLGMHV---------EADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +   AL   ++         EADPF QF+KWFD A+ A +KEPN MALST  KDGKPS
Sbjct  323   PRVDISALRENYISPEFSEDQAEADPFAQFQKWFDDAMAADLKEPNAMALSTTGKDGKPS  382

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G ++DGFVWYT+YES+KAR+ISENP A+LLF+W  LN QV
Sbjct  383   SRMVLLKGFDRDGFVWYTNYESQKARQISENPQAALLFHWDALNRQV  429



>ref|XP_009607524.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=472

 Score =   431 bits (1108),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 250/347 (72%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  QEA EID +LMG LGFS+DQLMELAGLS+ATAIAEVY P E+ R+L ICGPG+N
Sbjct  15    ISYLNQQEAAEIDEILMGHLGFSVDQLMELAGLSVATAIAEVYRPSEFSRVLTICGPGNN  74

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y GLVTQ                       
Sbjct  75    GGDGLVAARHLYHFGYKPFICYPKRTAKPLYNGLVTQLELLSVPFLSLEDLPKDLSNSFD  134

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRLV LK   D H+KSP IVS+DIPSGWHV+ GD++G
Sbjct  135   ILVDAMFGFSFHGSPRPPFDDLIQRLVGLKISDDKHQKSPAIVSIDIPSGWHVEEGDLSG  194

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAKRF GPHH LGGRF+PPSI +KF L LP YPGTSMCVRIG+P
Sbjct  195   EGIKPDMLVSLTAPKLCAKRFSGPHHILGGRFVPPSIKNKFHLQLPAYPGTSMCVRIGKP  254

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I            ALL   V ADPFDQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  255   PKIDISSMRENYISPALLEEEVAADPFDQFQKWFDDAMAAGLKEPNAMALSTTGKDGKPS  314

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +KDGFVWYT+YE  K ++I+ENP A+LLFYW  LN QV
Sbjct  315   SRIVLLKGFDKDGFVWYTNYEGSKGQQIAENPRAALLFYWDDLNRQV  361



>ref|XP_009799743.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=539

 Score =   433 bits (1114),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 215/347 (62%), Positives = 251/347 (72%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  Q+A EID +LMGPLGFS+DQLMELAGLS+ATAIAEVY P EY R+L ICGPG+N
Sbjct  82    ISYLNQQQAAEIDEMLMGPLGFSVDQLMELAGLSVATAIAEVYRPSEYSRVLTICGPGNN  141

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y GL+TQ                       
Sbjct  142   GGDGLVAARHLYHFGYKPFICYPKRTAKPLYNGLITQLKSLSVPFLSLEDLPKDLSDSFD  201

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G    PFD+LIQRLV+LK   D H+KSP IVS+DIPSGWHV+ GD++G
Sbjct  202   ILVDAMFGFSFHGSPRAPFDDLIQRLVALKISDDKHQKSPAIVSIDIPSGWHVEEGDLSG  261

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EG++P MLVSLTAPKLCAK F G HHFLGGRF+PPSI +KF L LP YPGTSMCVRIG+P
Sbjct  262   EGVKPDMLVSLTAPKLCAKSFSGTHHFLGGRFVPPSIRNKFNLQLPAYPGTSMCVRIGKP  321

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I            ALL   V ADPFDQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  322   PKIDISSMRENYISPALLEEEVAADPFDQFQKWFDDAMTAGLKEPNAMALSTTGKDGKPS  381

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +KDGFVWYT+YE  K ++I+ENPHA+LLFYW  LN QV
Sbjct  382   SRIVLLKGFDKDGFVWYTNYEGSKGQQIAENPHAALLFYWDDLNRQV  428



>gb|KJB59897.1| hypothetical protein B456_009G279800 [Gossypium raimondii]
Length=536

 Score =   433 bits (1113),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 214/347 (62%), Positives = 256/347 (74%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYLT +EA E+D  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICGPG+N
Sbjct  79    ISYLTQREAAEVDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYNRVLAICGPGNN  138

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  139   GGDGLVAARHLYHFGYKPFVCYPKRTQKPLYSGLVTQLESLSIPFLSVDELPMDLSKDFD  198

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LI++L++L     + RKSPVIVSVDIPSGWHV+ GD+ G
Sbjct  199   ILVDAMFGFSFHGAPRPPFDDLIKKLINLHYYEQAQRKSPVIVSVDIPSGWHVEEGDVGG  258

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             +GI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP+I +K+KL LP YPG SMCVRIG+P
Sbjct  259   DGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPAIAEKYKLQLPQYPGMSMCVRIGKP  318

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEADP DQF+KWFD A+ A +KEPN MALST  KDGKPS
Sbjct  319   PQIDISALRENYISPEFLEEQVEADPLDQFRKWFDDAMAANLKEPNAMALSTTGKDGKPS  378

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+KDGFVW+T+YES+KAR++SENPHA+LLFYW  LN QV
Sbjct  379   SRMVLLKGVDKDGFVWFTNYESQKARQLSENPHAALLFYWDGLNRQV  425



>ref|XP_009607523.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=556

 Score =   431 bits (1109),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 250/347 (72%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  QEA EID +LMG LGFS+DQLMELAGLS+ATAIAEVY P E+ R+L ICGPG+N
Sbjct  99    ISYLNQQEAAEIDEILMGHLGFSVDQLMELAGLSVATAIAEVYRPSEFSRVLTICGPGNN  158

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y GLVTQ                       
Sbjct  159   GGDGLVAARHLYHFGYKPFICYPKRTAKPLYNGLVTQLELLSVPFLSLEDLPKDLSNSFD  218

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRLV LK   D H+KSP IVS+DIPSGWHV+ GD++G
Sbjct  219   ILVDAMFGFSFHGSPRPPFDDLIQRLVGLKISDDKHQKSPAIVSIDIPSGWHVEEGDLSG  278

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAKRF GPHH LGGRF+PPSI +KF L LP YPGTSMCVRIG+P
Sbjct  279   EGIKPDMLVSLTAPKLCAKRFSGPHHILGGRFVPPSIKNKFHLQLPAYPGTSMCVRIGKP  338

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I            ALL   V ADPFDQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  339   PKIDISSMRENYISPALLEEEVAADPFDQFQKWFDDAMAAGLKEPNAMALSTTGKDGKPS  398

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +KDGFVWYT+YE  K ++I+ENP A+LLFYW  LN QV
Sbjct  399   SRIVLLKGFDKDGFVWYTNYEGSKGQQIAENPRAALLFYWDDLNRQV  445



>gb|KDP41449.1| hypothetical protein JCGZ_15856 [Jatropha curcas]
Length=536

 Score =   429 bits (1104),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 251/347 (72%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA EID +LMGPLGFS+DQLMELAGLS+AT+I EVY P EY R+L ICGPG+N
Sbjct  79    ISYLRQREAAEIDEMLMGPLGFSVDQLMELAGLSVATSIEEVYKPSEYNRVLAICGPGNN  138

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+  +CYP +T K  YTGLVTQ                       
Sbjct  139   GGDGLVAARHLHHFGYKPVICYPKRTAKQLYTGLVTQLESLSVPFLAVEDLPLDLSKDFD  198

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQ+LV L    + H K  V+VS+DIPSGWHV+ GD+ G
Sbjct  199   ILVDAMFGFSFHGAPRPPFDDLIQKLVYLHKCNEVHEKRSVVVSIDIPSGWHVEEGDVGG  258

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRFIPP IV+KFKL LP YPGTSMCVRIG+P
Sbjct  259   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFIPPIIVEKFKLHLPPYPGTSMCVRIGKP  318

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEA+P DQF+KWFD A+VAG+KEPN M LST  KDGKPS
Sbjct  319   PQIDMSALRENYISPEFLEEQVEANPIDQFRKWFDDAVVAGLKEPNAMCLSTVGKDGKPS  378

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+KDGFVW+T+YESRKA E+SENP A+LLFYW  LN QV
Sbjct  379   SRMVLLKGVDKDGFVWFTNYESRKAHELSENPRAALLFYWDGLNRQV  425



>ref|XP_012067952.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Jatropha curcas]
Length=545

 Score =   430 bits (1105),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 251/347 (72%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA EID +LMGPLGFS+DQLMELAGLS+AT+I EVY P EY R+L ICGPG+N
Sbjct  88    ISYLRQREAAEIDEMLMGPLGFSVDQLMELAGLSVATSIEEVYKPSEYNRVLAICGPGNN  147

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+  +CYP +T K  YTGLVTQ                       
Sbjct  148   GGDGLVAARHLHHFGYKPVICYPKRTAKQLYTGLVTQLESLSVPFLAVEDLPLDLSKDFD  207

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQ+LV L    + H K  V+VS+DIPSGWHV+ GD+ G
Sbjct  208   ILVDAMFGFSFHGAPRPPFDDLIQKLVYLHKCNEVHEKRSVVVSIDIPSGWHVEEGDVGG  267

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRFIPP IV+KFKL LP YPGTSMCVRIG+P
Sbjct  268   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFIPPIIVEKFKLHLPPYPGTSMCVRIGKP  327

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEA+P DQF+KWFD A+VAG+KEPN M LST  KDGKPS
Sbjct  328   PQIDMSALRENYISPEFLEEQVEANPIDQFRKWFDDAVVAGLKEPNAMCLSTVGKDGKPS  387

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+KDGFVW+T+YESRKA E+SENP A+LLFYW  LN QV
Sbjct  388   SRMVLLKGVDKDGFVWFTNYESRKAHELSENPRAALLFYWDGLNRQV  434



>ref|XP_008219378.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Prunus mume]
 ref|XP_008219379.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Prunus mume]
Length=542

 Score =   427 bits (1098),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 215/350 (61%), Positives = 254/350 (73%), Gaps = 45/350 (13%)
 Frame = -2

Query  1023  TTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGP  844
             T  ISYLT +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P ++ R+L ICGP
Sbjct  83    TEDISYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPSKHNRVLAICGP  142

Query  843   GSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ--------------------  724
             G+NGGDGLVAARHLH+FGY+  +CYP +T K  YTGLVTQ                    
Sbjct  143   GNNGGDGLVAARHLHHFGYKPSVCYPKRTAKPLYTGLVTQLESLSVPFISVEDLPLDLSK  202

Query  723   ---------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGD  589
                            G   PPFD LIQ+LV + N   +H+KS  IVS+DIPSGWHV+G D
Sbjct  203   DFDIIVDAMFGFSFHGSPRPPFDNLIQKLVCINNYDQTHQKSSAIVSIDIPSGWHVEG-D  261

Query  588   INGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
                EGI+P MLVSLTAPKLCAK+F+GPHHFLGGRF+PPSI DK+KL LP YPGTSMCVRI
Sbjct  262   GGAEGIKPDMLVSLTAPKLCAKKFFGPHHFLGGRFVPPSIADKYKLRLPPYPGTSMCVRI  321

Query  408   GRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDG  256
             GRP ++   AL         L   VEADPFDQF+KWFD  + AG++EPN MALST +K+G
Sbjct  322   GRPAQVDISALRENYISPEFLEEQVEADPFDQFRKWFDDVVAAGLREPNAMALSTASKNG  381

Query  255   KPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KPSSR+V L+G +K+GFVWYT+YESRKA E+SENPHASLLF+W  LN QV
Sbjct  382   KPSSRMVLLKGFDKNGFVWYTNYESRKAHELSENPHASLLFHWDGLNRQV  431



>ref|XP_007222244.1| hypothetical protein PRUPE_ppa003886mg [Prunus persica]
 gb|EMJ23443.1| hypothetical protein PRUPE_ppa003886mg [Prunus persica]
Length=542

 Score =   426 bits (1095),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 215/350 (61%), Positives = 253/350 (72%), Gaps = 45/350 (13%)
 Frame = -2

Query  1023  TTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGP  844
             T  IS+LT +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICGP
Sbjct  83    TEDISHLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYNRVLAICGP  142

Query  843   GSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ--------------------  724
             G+NGGDGLVAARHLH+FGY+  +CYP +T K  YT LVTQ                    
Sbjct  143   GNNGGDGLVAARHLHHFGYKPSVCYPKRTAKPLYTSLVTQLESLSVPFISVEDLPLDLSK  202

Query  723   ---------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGD  589
                            G   PPFD LIQ+LV +KN   + +KS  IVS+DIPSGWHV+GG 
Sbjct  203   DFDIIVDAMFGFSFHGSPRPPFDILIQKLVCIKNYDQTRQKSSAIVSIDIPSGWHVEGGG  262

Query  588   INGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
                EGI+P MLVSLTAPKLCAK+F+GPHHFLGGRF+PPS+ DK+KL LP YPGTSMCVRI
Sbjct  263   -GAEGIKPDMLVSLTAPKLCAKKFFGPHHFLGGRFVPPSVADKYKLRLPPYPGTSMCVRI  321

Query  408   GRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDG  256
             GRP ++   AL         L   VEADPFDQF+KWFD  + AG++EPN MALST +K+G
Sbjct  322   GRPAQVDISALRENYISPEFLEEQVEADPFDQFRKWFDDVVAAGLREPNAMALSTASKNG  381

Query  255   KPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KPSSR+V L+G +K+GFVWYT+YESRKA E+SENPHASLLFYW  LN QV
Sbjct  382   KPSSRMVLLKGFDKNGFVWYTNYESRKAHELSENPHASLLFYWDGLNRQV  431



>ref|XP_006345004.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=471

 Score =   423 bits (1087),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 248/351 (71%), Gaps = 42/351 (12%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M S   ISY++ QEA EID +LM PLGF++DQLMELAGLS+A+AI EVY+P EY  +LVI
Sbjct  1     MESKEEISYVSQQEAIEIDQMLMSPLGFTVDQLMELAGLSVASAIGEVYSPSEYTHVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHLH+FGY+  +CYP +  + P+ GLVTQ                 
Sbjct  61    CGPGNNGGDGLVAARHLHHFGYKPSICYPKRNTEPPFAGLVTQLESLSVPFLPVEDLPVQ  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G L PPFD LI+R+VS+K  + +H  + V++SVDIP GWHV+
Sbjct  121   LSSDFEIIVDAIFGFSFHGNLRPPFDSLIRRMVSIKTQQRTHEIAAVVISVDIPFGWHVE  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI GEGI P MLVSLTAPKLCAK F GPHHFLGGRF+P SI+DKFKL LP YPGTSMC
Sbjct  181   EGDICGEGIEPDMLVSLTAPKLCAKMFCGPHHFLGGRFVPRSIIDKFKLKLPSYPGTSMC  240

Query  417   VRIGRPPEIYPLALLG-------MHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             VRIG  PE    A  G       + VE +P DQF+KW   AL AGVKEP+YM LST  KD
Sbjct  241   VRIGNLPETNLSAQKGIFTASVNLEVEENPIDQFQKWLGDALEAGVKEPHYMVLSTAGKD  300

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KPSSR+VSLEGVNKDGFVW+T+Y S+KAREISENPHASLLFYW  + CQV
Sbjct  301   AKPSSRMVSLEGVNKDGFVWHTNYRSQKAREISENPHASLLFYWGPIKCQV  351



>ref|XP_008338908.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X1 [Malus domestica]
Length=463

 Score =   422 bits (1084),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 253/353 (72%), Gaps = 45/353 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   ISYLT +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+LVI
Sbjct  1     MQNPEDISYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYNRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHL++FGY+L +CYP +T K  Y GLVTQ                 
Sbjct  61    CGPGNNGGDGLVAARHLYHFGYKLSVCYPKRTAKPLYAGLVTQLESLSVPFISVEDLPLD  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD LIQ+LV +K    +  KS VIVSVDIPSGWHV+
Sbjct  121   LSKDFDIIVDAMFGFSFHGSPRPPFDNLIQKLVCVKKYDQTREKSSVIVSVDIPSGWHVE  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
             G D   EGI+P MLVSLTAPKLCAK+F+GPHHFLGGRF+PPSI DK+KL LP YPGTSMC
Sbjct  181   G-DGGVEGIKPDMLVSLTAPKLCAKKFFGPHHFLGGRFVPPSIADKYKLRLPPYPGTSMC  239

Query  417   VRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG PP++   AL         L   VEADPFDQF+KWFD  + AG++EPN MALST T
Sbjct  240   VRIGMPPQVDISALRENYISPEFLEEQVEADPFDQFRKWFDDVVAAGLREPNAMALSTAT  299

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             K+GK SSR+V L+G +K+GFVWYT+YES+KA E+SENP ASLLFYW  LN QV
Sbjct  300   KNGKISSRMVLLKGFDKNGFVWYTNYESQKAHELSENPRASLLFYWDGLNRQV  352



>ref|XP_004501612.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
[Cicer arietinum]
Length=532

 Score =   423 bits (1088),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 216/357 (61%), Positives = 254/357 (71%), Gaps = 46/357 (13%)
 Frame = -2

Query  1038  KKMGS--TTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR  865
             K MGS  +  ++YL  QEA  ID  LMGPLGFS+DQLMELAGLS+AT+I EVY P EY R
Sbjct  65    KTMGSVDSDSVTYLKQQEAAGIDETLMGPLGFSVDQLMELAGLSVATSIYEVYKPGEYSR  124

Query  864   ILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------  724
             +L +CGPG+NGGDGLVAARHLH+FGY+  +CYP +TPK  Y GLVTQ             
Sbjct  125   VLTVCGPGNNGGDGLVAARHLHHFGYKPLVCYPKRTPKTLYAGLVTQLEALSIPFLSVED  184

Query  723   ----------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSG  610
                                   G   PPFD+LIQRLVSL N     +K PVIVSVDIPSG
Sbjct  185   LPSDFSKDFDILVDAMFGFSFHGSPRPPFDDLIQRLVSLSNHNQIGQKRPVIVSVDIPSG  244

Query  609   WHVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPG  430
             WHV+ GD+NG GI+P +LVSLTAPKLCAK+F GPHHFLGGRF+PP+I +K+KL LP YPG
Sbjct  245   WHVEEGDVNGTGIKPDLLVSLTAPKLCAKKFGGPHHFLGGRFVPPAIAEKYKLILPPYPG  304

Query  429   TSMCVRIGRPPEIYPLALLGMH---------VEADPFDQFKKWFDHALVAGVKEPNYMAL  277
             TSMCVRIG+PP+I   AL   +         VEADP +QF+KWFD AL AG+KEPN M L
Sbjct  305   TSMCVRIGKPPQIDISALRENYISPEFHEDQVEADPNNQFRKWFDDALAAGLKEPNAMGL  364

Query  276   STGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             ST  KDGKPSSR+V L+G+ KDGFVWYT+YES+K  E++ENPHASLLF+W  LN QV
Sbjct  365   STVGKDGKPSSRIVLLKGLEKDGFVWYTNYESQKGHELAENPHASLLFHWDGLNRQV  421



>ref|XP_011464635.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=538

 Score =   423 bits (1087),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 214/353 (61%), Positives = 251/353 (71%), Gaps = 45/353 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   ISYLT  +A EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L I
Sbjct  76    MQNREAISYLTQSQAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYNRVLTI  135

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHLH+FGY+ F+CYP +T K  YTGLVTQ                 
Sbjct  136   CGPGNNGGDGLVAARHLHHFGYKPFICYPKRTAKPLYTGLVTQLESLSVPFISVEDLPLD  195

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD LIQ+L+ +     + +KS V+VS+DIPSGW V+
Sbjct  196   LSKDFDIVVDAMFGFSFHGAPRPPFDNLIQKLICINQYDQTRQKSCVVVSIDIPSGWQVE  255

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
             G D   EGI+P MLVSLTAPKLCAK F GPHHFLGGRF+PPSI DKFKL LP YPGTSMC
Sbjct  256   G-DGGPEGIQPDMLVSLTAPKLCAKNFCGPHHFLGGRFVPPSIADKFKLRLPPYPGTSMC  314

Query  417   VRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+PP++   AL         L   VEADPFDQF++WFD  + AG++EPN MALST  
Sbjct  315   VRIGKPPQVEISALRENYISPEFLEEQVEADPFDQFRQWFDDVVAAGLREPNAMALSTAC  374

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KDGKPSSR+V L+G +K+GFVWYT+YESRKA+E+ ENPHASLLFYW  LN QV
Sbjct  375   KDGKPSSRMVLLKGFDKNGFVWYTNYESRKAQELFENPHASLLFYWDGLNRQV  427



>ref|XP_006433878.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
 ref|XP_006433881.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
 gb|ESR47118.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
 gb|ESR47121.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
Length=467

 Score =   420 bits (1080),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 213/351 (61%), Positives = 252/351 (72%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICG
Sbjct  6     NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYDRVLAICG  65

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHL++FGY+ F+CYP +T K  YTGLVTQ                   
Sbjct  66    PGNNGGDGLVAARHLYHFGYKPFVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  125

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     +H+K PVIVSVDIPSGWHV+ G
Sbjct  126   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTHQKRPVIVSVDIPSGWHVEEG  185

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             DI  EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I DK+KL LP YPGTSMCVR
Sbjct  186   DIGDEGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPVIADKYKLRLPPYPGTSMCVR  245

Query  411   IGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+ P +   AL         L   VE+DP +QF+KWFD A+ AG++EPN MALST  KD
Sbjct  246   IGKAPSVDISALRENYISPEFLEEQVESDPINQFRKWFDDAIAAGLREPNAMALSTVGKD  305

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             GKPSSR+V L+GV++DGFVWYT+YESRKA E+ ENPHASLLFYW   N QV
Sbjct  306   GKPSSRMVLLKGVDRDGFVWYTNYESRKACELCENPHASLLFYWDGRNRQV  356



>ref|XP_006345005.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=402

 Score =   418 bits (1074),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 212/356 (60%), Positives = 248/356 (70%), Gaps = 47/356 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M S   ISY++ QEA EID +LM PLGF++DQLMELAGLS+A+AI EVY+P EY  +LVI
Sbjct  1     MESKEEISYVSQQEAIEIDQMLMSPLGFTVDQLMELAGLSVASAIGEVYSPSEYTHVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHLH+FGY+  +CYP +  + P+ GLVTQ                 
Sbjct  61    CGPGNNGGDGLVAARHLHHFGYKPSICYPKRNTEPPFAGLVTQLESLSVPFLPVEDLPVQ  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G L PPFD LI+R+VS+K  + +H  + V++SVDIP GWHV+
Sbjct  121   LSSDFEIIVDAIFGFSFHGNLRPPFDSLIRRMVSIKTQQRTHEIAAVVISVDIPFGWHVE  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI GEGI P MLVSLTAPKLCAK F GPHHFLGGRF+P SI+DKFKL LP YPGTSMC
Sbjct  181   EGDICGEGIEPDMLVSLTAPKLCAKMFCGPHHFLGGRFVPRSIIDKFKLKLPSYPGTSMC  240

Query  417   VRIGRPPEIYPLALLG-------MHVEADPFDQ-----FKKWFDHALVAGVKEPNYMALS  274
             VRIG  PE    A  G       + VE +P DQ     F+KW   AL AGVKEP+YM LS
Sbjct  241   VRIGNLPETNLSAQKGIFTASVNLEVEENPIDQVELYKFQKWLGDALEAGVKEPHYMVLS  300

Query  273   TGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             T  KD KPSSR+VSLEGVNKDGFVW+T+Y S+KAREISENPHASLLFYW  + CQV
Sbjct  301   TAGKDAKPSSRMVSLEGVNKDGFVWHTNYRSQKAREISENPHASLLFYWGPIKCQV  356



>ref|XP_007136346.1| hypothetical protein PHAVU_009G037700g [Phaseolus vulgaris]
 gb|ESW08340.1| hypothetical protein PHAVU_009G037700g [Phaseolus vulgaris]
Length=540

 Score =   422 bits (1086),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 213/347 (61%), Positives = 253/347 (73%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ++YLT +EA EID  LMGPLGFS+DQLMELAGLS+A +I+EVY P E+ R+L ICGPG+N
Sbjct  84    VTYLTQREAAEIDETLMGPLGFSVDQLMELAGLSVAASISEVYKPSEHSRVLTICGPGNN  143

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ F+CYP +TPK  Y GLVTQ                       
Sbjct  144   GGDGLVAARHLHHFGYKPFVCYPKRTPKPLYAGLVTQLEALSIPFLSVEELPSDLSNDFD  203

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRLVSL +     +K  VIVSVDIPSGWHV+ GD++G
Sbjct  204   ILVDAMFGFSFHGSPRPPFDDLIQRLVSLHDNNQIGQKRSVIVSVDIPSGWHVEEGDVDG  263

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKL AK+F GPHHFLGGRF+PP+I +K+KL LP YPGTSMCVRIG+P
Sbjct  264   AGIKPDMLVSLTAPKLGAKKFGGPHHFLGGRFVPPAIAEKYKLVLPPYPGTSMCVRIGKP  323

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEA+P +QF+KWFD A+ AG+KEPN MALST  +DGKPS
Sbjct  324   PQIDISALRENYISPEFLEEQVEANPINQFRKWFDDAMAAGLKEPNAMALSTVGEDGKPS  383

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G++KDGFVWYT+YESRKARE+SENP ASLLFYW  LN QV
Sbjct  384   SRMVLLKGLDKDGFVWYTNYESRKARELSENPQASLLFYWDGLNRQV  430



>ref|XP_003602963.1| Pyridoxine/pyridoxamine 5'-phosphate oxidase [Medicago truncatula]
Length=467

 Score =   420 bits (1080),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 211/348 (61%), Positives = 249/348 (72%), Gaps = 45/348 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ++YL  QEA EID  LMGPLGFS+DQLMELAGLS+AT+I EVY P EY R+L ICGPG+N
Sbjct  9     VTYLKQQEAVEIDETLMGPLGFSVDQLMELAGLSVATSIYEVYKPGEYSRVLTICGPGNN  68

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+  +CYP +TPK  Y GLVTQ                       
Sbjct  69    GGDGLVAARHLHHFGYKPLVCYPKRTPKPLYAGLVTQLEALSIPFLSVEDLPSDFSKDFD  128

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDS-HRKSPVIVSVDIPSGWHVDGGDIN  583
                         G   PPFD+LIQR +SL+N  +   +K PVIVSVDIPSGWHV+ GD+N
Sbjct  129   ILVDAMFGFSFHGSPRPPFDDLIQRFISLRNNHNQIGQKRPVIVSVDIPSGWHVEEGDVN  188

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
             G GI+  ML+SLTAPK CAK+F GPHHFLGGRF+PP+I +K+KL LP YPGTSMCVRIG+
Sbjct  189   GTGIKSDMLISLTAPKFCAKKFRGPHHFLGGRFVPPAIAEKYKLILPPYPGTSMCVRIGK  248

Query  402   PPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             PP+I   AL         L   VEADP +QF+KWFD AL A +KEPN MALST  KDGKP
Sbjct  249   PPQIDISALRENYISPEFLEDQVEADPINQFRKWFDDALAASLKEPNAMALSTVGKDGKP  308

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+G +KDGFVW+T+YES+K R +SENPHAS+LFYW  LN QV
Sbjct  309   SSRIVLLKGFDKDGFVWFTNYESQKGRALSENPHASILFYWDGLNRQV  356



>ref|XP_006433880.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
 gb|ESR47120.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
Length=526

 Score =   422 bits (1085),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 213/351 (61%), Positives = 252/351 (72%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICG
Sbjct  79    NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYDRVLAICG  138

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHL++FGY+ F+CYP +T K  YTGLVTQ                   
Sbjct  139   PGNNGGDGLVAARHLYHFGYKPFVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  198

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     +H+K PVIVSVDIPSGWHV+ G
Sbjct  199   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTHQKRPVIVSVDIPSGWHVEEG  258

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             DI  EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I DK+KL LP YPGTSMCVR
Sbjct  259   DIGDEGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPVIADKYKLRLPPYPGTSMCVR  318

Query  411   IGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+ P +   AL         L   VE+DP +QF+KWFD A+ AG++EPN MALST  KD
Sbjct  319   IGKAPSVDISALRENYISPEFLEEQVESDPINQFRKWFDDAIAAGLREPNAMALSTVGKD  378

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             GKPSSR+V L+GV++DGFVWYT+YESRKA E+ ENPHASLLFYW   N QV
Sbjct  379   GKPSSRMVLLKGVDRDGFVWYTNYESRKACELCENPHASLLFYWDGRNRQV  429



>ref|XP_009373660.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Pyrus x bretschneideri]
Length=532

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 216/354 (61%), Positives = 254/354 (72%), Gaps = 47/354 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   ISYLT +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+LVI
Sbjct  70    MQNPEDISYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPTEYNRVLVI  129

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVA+RHL++FGY+L +CYP +T K  Y GLVTQ                 
Sbjct  130   CGPGNNGGDGLVASRHLYHFGYKLSVCYPKRTAKPLYAGLVTQLESLSVPFISVEDLPLD  189

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD LI++LV +     +  KS VIVSVDIPSGWHV+
Sbjct  190   LSKDFDIIVDAMFGFSFHGSPRPPFDNLIEKLVCVNKYDQTREKSSVIVSVDIPSGWHVE  249

Query  597   -GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSM  421
              GG +  EGI+P MLVSLTAPKLCAK+F+GPHHFLGGRF+PPSI DK+KL LP YPGTSM
Sbjct  250   RGGGV--EGIKPDMLVSLTAPKLCAKKFFGPHHFLGGRFVPPSIADKYKLRLPPYPGTSM  307

Query  420   CVRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTG  268
             CVRIGRPP++   AL         L   VEADPFDQF+KWFD  + AG++EPN MALST 
Sbjct  308   CVRIGRPPQVDISALRENYISPEFLEEQVEADPFDQFRKWFDDVVAAGLREPNAMALSTA  367

Query  267   TKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             TK+GK SSR+V L+G +K+GFVWYT+YESRKA E+SENP ASLLFYW  LN QV
Sbjct  368   TKNGKISSRMVLLKGFDKNGFVWYTNYESRKAHELSENPRASLLFYWDGLNRQV  421



>ref|XP_006433879.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
 gb|ESR47119.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
Length=540

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/351 (61%), Positives = 252/351 (72%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICG
Sbjct  79    NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYDRVLAICG  138

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHL++FGY+ F+CYP +T K  YTGLVTQ                   
Sbjct  139   PGNNGGDGLVAARHLYHFGYKPFVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  198

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     +H+K PVIVSVDIPSGWHV+ G
Sbjct  199   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTHQKRPVIVSVDIPSGWHVEEG  258

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             DI  EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I DK+KL LP YPGTSMCVR
Sbjct  259   DIGDEGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPVIADKYKLRLPPYPGTSMCVR  318

Query  411   IGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+ P +   AL         L   VE+DP +QF+KWFD A+ AG++EPN MALST  KD
Sbjct  319   IGKAPSVDISALRENYISPEFLEEQVESDPINQFRKWFDDAIAAGLREPNAMALSTVGKD  378

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             GKPSSR+V L+GV++DGFVWYT+YESRKA E+ ENPHASLLFYW   N QV
Sbjct  379   GKPSSRMVLLKGVDRDGFVWYTNYESRKACELCENPHASLLFYWDGRNRQV  429



>ref|XP_010272954.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Nelumbo nucifera]
Length=550

 Score =   422 bits (1084),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 214/347 (62%), Positives = 252/347 (73%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +SYLT +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY   +Y R+L ICGPG+N
Sbjct  93    LSYLTQKEAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKSSDYSRVLAICGPGNN  152

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+  +CYP +T K  YTGLVTQ                       
Sbjct  153   GGDGLVAARHLHHFGYKPSVCYPKRTSKALYTGLVTQLESLYIPFLSVDDLPVDLSNDFD  212

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRL+SL++   + ++SPVIVSVDIPSGWHV+ GD++G
Sbjct  213   ILVDAMFGFSFHGTPRPPFDDLIQRLLSLQSHDQTRQRSPVIVSVDIPSGWHVEEGDVSG  272

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F G HHFLGGRF+PPSI DK+KL LP YPGTSMCVRIG+ 
Sbjct  273   EGIKPDMLVSLTAPKLCAKKFCGCHHFLGGRFVPPSIADKYKLCLPPYPGTSMCVRIGKL  332

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P I            A L  HVE DP DQF+KWF  A+ AG++EPN MALST  KDGK S
Sbjct  333   PSIDISSLRENYISPAFLEDHVEPDPIDQFQKWFGDAVAAGLREPNAMALSTANKDGKLS  392

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K+GFVWYT+Y SRKARE+SENP ASLLFYW  LN QV
Sbjct  393   SRMVLLKGVDKEGFVWYTNYGSRKARELSENPRASLLFYWDGLNRQV  439



>ref|XP_003522762.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN08257.1| NAD(P)H-hydrate epimerase [Glycine soja]
Length=550

 Score =   420 bits (1080),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 214/348 (61%), Positives = 253/348 (73%), Gaps = 45/348 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ++YL  ++A EID  LMGPLGFS+DQLMELAGLS+AT+I+EVY P EY R+L ICGPG+N
Sbjct  92    VTYLKQRDAAEIDETLMGPLGFSVDQLMELAGLSVATSISEVYKPSEYSRVLTICGPGNN  151

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ F+CYP +TPK  Y GLVTQ                       
Sbjct  152   GGDGLVAARHLHHFGYKPFVCYPKRTPKPLYAGLVTQLEALSIPFFSVEELPSDLSNGFD  211

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDS-HRKSPVIVSVDIPSGWHVDGGDIN  583
                         G   PPFD+LIQRLVSL N  +   +K  VIVSVDIPSGWHV+ GD++
Sbjct  212   VVIDAMFGFSFHGSPRPPFDDLIQRLVSLHNNNNQIGQKRSVIVSVDIPSGWHVEEGDVD  271

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
             G GI+P MLVSLTAPKL AK+F GPHHFLGGRF+PP+I +K+KL LP YPGTSMCVRIG+
Sbjct  272   GTGIKPDMLVSLTAPKLGAKKFGGPHHFLGGRFVPPAIAEKYKLILPPYPGTSMCVRIGK  331

Query  402   PPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             PP I   AL         L   VEADPF+QF KWF+ AL AG+KEPN M+LST  KDGKP
Sbjct  332   PPRIDISALRENYISPEFLEEQVEADPFNQFHKWFNDALAAGLKEPNAMSLSTVGKDGKP  391

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+G++K+GFVWYT+YES+KARE+SENP ASLLFYW  LN QV
Sbjct  392   SSRMVLLKGLDKEGFVWYTNYESQKARELSENPRASLLFYWDGLNRQV  439



>gb|KEH35735.1| pyridoxine/pyridoxamine 5'-phosphate oxidase [Medicago truncatula]
Length=526

 Score =   419 bits (1077),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 211/348 (61%), Positives = 249/348 (72%), Gaps = 45/348 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ++YL  QEA EID  LMGPLGFS+DQLMELAGLS+AT+I EVY P EY R+L ICGPG+N
Sbjct  83    VTYLKQQEAVEIDETLMGPLGFSVDQLMELAGLSVATSIYEVYKPGEYSRVLTICGPGNN  142

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+  +CYP +TPK  Y GLVTQ                       
Sbjct  143   GGDGLVAARHLHHFGYKPLVCYPKRTPKPLYAGLVTQLEALSIPFLSVEDLPSDFSKDFD  202

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDS-HRKSPVIVSVDIPSGWHVDGGDIN  583
                         G   PPFD+LIQR +SL+N  +   +K PVIVSVDIPSGWHV+ GD+N
Sbjct  203   ILVDAMFGFSFHGSPRPPFDDLIQRFISLRNNHNQIGQKRPVIVSVDIPSGWHVEEGDVN  262

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
             G GI+  ML+SLTAPK CAK+F GPHHFLGGRF+PP+I +K+KL LP YPGTSMCVRIG+
Sbjct  263   GTGIKSDMLISLTAPKFCAKKFRGPHHFLGGRFVPPAIAEKYKLILPPYPGTSMCVRIGK  322

Query  402   PPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             PP+I   AL         L   VEADP +QF+KWFD AL A +KEPN MALST  KDGKP
Sbjct  323   PPQIDISALRENYISPEFLEDQVEADPINQFRKWFDDALAASLKEPNAMALSTVGKDGKP  382

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+G +KDGFVW+T+YES+K R +SENPHAS+LFYW  LN QV
Sbjct  383   SSRIVLLKGFDKDGFVWFTNYESQKGRALSENPHASILFYWDGLNRQV  430



>ref|XP_006345003.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=476

 Score =   417 bits (1072),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/356 (60%), Positives = 248/356 (70%), Gaps = 47/356 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M S   ISY++ QEA EID +LM PLGF++DQLMELAGLS+A+AI EVY+P EY  +LVI
Sbjct  1     MESKEEISYVSQQEAIEIDQMLMSPLGFTVDQLMELAGLSVASAIGEVYSPSEYTHVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHLH+FGY+  +CYP +  + P+ GLVTQ                 
Sbjct  61    CGPGNNGGDGLVAARHLHHFGYKPSICYPKRNTEPPFAGLVTQLESLSVPFLPVEDLPVQ  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G L PPFD LI+R+VS+K  + +H  + V++SVDIP GWHV+
Sbjct  121   LSSDFEIIVDAIFGFSFHGNLRPPFDSLIRRMVSIKTQQRTHEIAAVVISVDIPFGWHVE  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI GEGI P MLVSLTAPKLCAK F GPHHFLGGRF+P SI+DKFKL LP YPGTSMC
Sbjct  181   EGDICGEGIEPDMLVSLTAPKLCAKMFCGPHHFLGGRFVPRSIIDKFKLKLPSYPGTSMC  240

Query  417   VRIGRPPEIYPLALLG-------MHVEADPFDQ-----FKKWFDHALVAGVKEPNYMALS  274
             VRIG  PE    A  G       + VE +P DQ     F+KW   AL AGVKEP+YM LS
Sbjct  241   VRIGNLPETNLSAQKGIFTASVNLEVEENPIDQVELYKFQKWLGDALEAGVKEPHYMVLS  300

Query  273   TGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             T  KD KPSSR+VSLEGVNKDGFVW+T+Y S+KAREISENPHASLLFYW  + CQV
Sbjct  301   TAGKDAKPSSRMVSLEGVNKDGFVWHTNYRSQKAREISENPHASLLFYWGPIKCQV  356



>gb|AFK45476.1| unknown [Medicago truncatula]
 gb|AES73214.2| pyridoxine/pyridoxamine 5'-phosphate oxidase [Medicago truncatula]
Length=541

 Score =   419 bits (1078),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/348 (61%), Positives = 249/348 (72%), Gaps = 45/348 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ++YL  QEA EID  LMGPLGFS+DQLMELAGLS+AT+I EVY P EY R+L ICGPG+N
Sbjct  83    VTYLKQQEAVEIDETLMGPLGFSVDQLMELAGLSVATSIYEVYKPGEYSRVLTICGPGNN  142

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+  +CYP +TPK  Y GLVTQ                       
Sbjct  143   GGDGLVAARHLHHFGYKPLVCYPKRTPKPLYAGLVTQLEALSIPFLSVEDLPSDFSKDFD  202

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDS-HRKSPVIVSVDIPSGWHVDGGDIN  583
                         G   PPFD+LIQR +SL+N  +   +K PVIVSVDIPSGWHV+ GD+N
Sbjct  203   ILVDAMFGFSFHGSPRPPFDDLIQRFISLRNNHNQIGQKRPVIVSVDIPSGWHVEEGDVN  262

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
             G GI+  ML+SLTAPK CAK+F GPHHFLGGRF+PP+I +K+KL LP YPGTSMCVRIG+
Sbjct  263   GTGIKSDMLISLTAPKFCAKKFRGPHHFLGGRFVPPAIAEKYKLILPPYPGTSMCVRIGK  322

Query  402   PPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             PP+I   AL         L   VEADP +QF+KWFD AL A +KEPN MALST  KDGKP
Sbjct  323   PPQIDISALRENYISPEFLEDQVEADPINQFRKWFDDALAASLKEPNAMALSTVGKDGKP  382

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+G +KDGFVW+T+YES+K R +SENPHAS+LFYW  LN QV
Sbjct  383   SSRIVLLKGFDKDGFVWFTNYESQKGRALSENPHASILFYWDGLNRQV  430



>ref|XP_010675447.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010675454.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=539

 Score =   419 bits (1076),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/347 (61%), Positives = 250/347 (72%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL+ +EA E+D  LMGPLGFS+DQLMELAGLS+A AIAEV+   EY+R+L ICGPG+N
Sbjct  82    ISYLSQREAAEVDDTLMGPLGFSVDQLMELAGLSVACAIAEVFKSSEYKRVLAICGPGNN  141

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGYEL +CYP +TPK  Y+GLVTQ                       
Sbjct  142   GGDGLVAARHLYHFGYELSICYPKRTPKPLYSGLVTQLESLSVPFLSVEDLPIDLSDNFD  201

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LIQRLVS +N   +  KS VI S+DIPSGWHV+ GD+ G
Sbjct  202   IIIDAIFGFSFHGTPRPPFDALIQRLVSCQNHHHTGLKSTVIASIDIPSGWHVEEGDVTG  261

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI P MLVSLTAPKLCAK+F GPHHF+GGRF+PP+I++K+KL LP YPGTSMCVRIG+P
Sbjct  262   EGINPDMLVSLTAPKLCAKKFGGPHHFMGGRFVPPAILEKYKLHLPPYPGTSMCVRIGKP  321

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P++            ALL   V+ADP  QF+KWFD A+ AG+KEPN MALST  KDGK S
Sbjct  322   PQVDISSLRENYISPALLEEQVDADPLVQFRKWFDDAIAAGLKEPNAMALSTAAKDGKLS  381

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+ DGFVW+T+YESRKA EISENP A+LLFYW  LN QV
Sbjct  382   SRMVLLKGVDTDGFVWFTNYESRKAYEISENPRAALLFYWDGLNRQV  428



>ref|XP_010098667.1| NAD(P)H-hydrate epimerase [Morus notabilis]
 gb|EXB75570.1| NAD(P)H-hydrate epimerase [Morus notabilis]
Length=603

 Score =   421 bits (1081),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 251/352 (71%), Gaps = 44/352 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   ISYLT +EA EID  LMGPLGFS+DQLMELAGLS+A +IAEVY   EY R+L I
Sbjct  1     MQNPESISYLTQREAAEIDETLMGPLGFSVDQLMELAGLSVAASIAEVYKSSEYSRVLAI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHL++FGY+  +CYP +TPK  YTGLVTQ                 
Sbjct  61    CGPGNNGGDGLVAARHLYHFGYKPVICYPKRTPKPLYTGLVTQLESLSVPFISVEDLPLN  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD LIQ L+SL+N   + +KSPVIVSVDIPSGWHV+
Sbjct  121   LLEEFDIIVDAIFGFSYHGSPRPPFDGLIQMLISLRNYDQTCQKSPVIVSVDIPSGWHVE  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GD  GEGIRP MLVSLTAPKLCAK+F GPHHFLGGRF+PP I +++KL LP YPGTSMC
Sbjct  181   EGDAGGEGIRPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPFIAEQYKLHLPSYPGTSMC  240

Query  417   VRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+P +I   AL         L   V++DP DQF+KWF+ A+ AG KEPN MALST  
Sbjct  241   VRIGKPQKIDVSALRENYISPEFLEEQVDSDPIDQFRKWFEEAVAAGSKEPNAMALSTAG  300

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQ  109
             K+GKPSSR+V L+G +++GFVWYT+YES+KA E+SENPHASLLFYW  LN Q
Sbjct  301   KNGKPSSRMVLLKGFDENGFVWYTNYESQKAHELSENPHASLLFYWDGLNRQ  352



>gb|AAM83249.1| AT5g49970/K9P8_11 [Arabidopsis thaliana]
 gb|AAN18174.1| At5g49970/K9P8_11 [Arabidopsis thaliana]
Length=466

 Score =   415 bits (1066),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 249/348 (72%), Gaps = 44/348 (13%)
 Frame = -2

Query  1017  PISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             P+SYLT +EA EID  LMGPLGFSIDQLMELAGLS+A +IAEVY P+EY R+L ICGPG+
Sbjct  8     PLSYLTQREAAEIDETLMGPLGFSIDQLMELAGLSVAASIAEVYKPEEYSRVLAICGPGN  67

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------------  724
             NGGDGLVAARHLH+FGY+ F+CYP +T K  YTGLVTQ                      
Sbjct  68    NGGDGLVAARHLHHFGYKPFICYPKRTAKPLYTGLVTQLDSLSVPFVSVEDLPDDLSKDF  127

Query  723   -------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDIN  583
                          G   PPFD+LI+RLVSL+N   + +K PVIVSVDIPSGWHV+ GD  
Sbjct  128   DVIVDAMFGFSFHGAPRPPFDDLIRRLVSLQNYEQTLQKHPVIVSVDIPSGWHVEEGDHE  187

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
               GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP YPGTSMCVRIG+
Sbjct  188   DGGIKPDMLVSLTAPKLCAKRFRGPHHFLGGRFVPPSVAEKYKLELPSYPGTSMCVRIGK  247

Query  402   PPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             PP++   A         LL   VE DP  QF+KWFD A+ AG++E N MALST  KD KP
Sbjct  248   PPKVDISAMRVNYVSPELLEEQVETDPTVQFRKWFDEAVAAGLRETNAMALSTANKDKKP  307

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+G +++GFVW+T+YES+K  ++SENP A+LLFYW  LN QV
Sbjct  308   SSRMVLLKGFDENGFVWFTNYESKKGSDLSENPSAALLFYWEILNRQV  355



>ref|XP_009390271.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=501

 Score =   416 bits (1069),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 209/347 (60%), Positives = 245/347 (71%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +SYLT +EA EID +LMGPLGFS+DQLMELAGLS+A AI+EVY   EYRR+L ICGPG+N
Sbjct  81    VSYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVAAAISEVYKSSEYRRVLAICGPGNN  140

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGYE F+CYP +TPK  Y GLVTQ                       
Sbjct  141   GGDGLVAARHLHHFGYEPFICYPKRTPKPLYNGLVTQLESLSISFISVDDLPQNLTENFD  200

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRL SL       ++S  IVSVDIPSGWHV+ GDI G
Sbjct  201   LIVDAMFGFSFHGQPRPPFDDLIQRLASLSRVDCGRKRSSAIVSVDIPSGWHVEEGDITG  260

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EG  P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSI+ K+KL LP YPGTSMCVRIG+P
Sbjct  261   EGFEPDMLVSLTAPKLCAKKFVGPHHFLGGRFVPPSIISKYKLKLPQYPGTSMCVRIGKP  320

Query  399   PEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +   +         LL   V + P DQF KWFD A+ AG++EPN MALST   +GKPS
Sbjct  321   PSVDIASLRENYISPELLEDQVLSHPVDQFHKWFDEAVAAGLREPNAMALSTSGHEGKPS  380

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +K GFVW+T+Y S+KA+E+SENPHASLLFYW+ LN QV
Sbjct  381   SRIVLLKGADKQGFVWFTNYGSQKAKELSENPHASLLFYWNPLNRQV  427



>ref|XP_002514004.1| pyridoxamine 5-phosphate oxidase, putative [Ricinus communis]
 gb|EEF48587.1| pyridoxamine 5-phosphate oxidase, putative [Ricinus communis]
Length=546

 Score =   417 bits (1072),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 214/347 (62%), Positives = 253/347 (73%), Gaps = 46/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYLT  +A EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P E+ R+L ICGPG+N
Sbjct  91    ISYLTQHDAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPSEFNRVLAICGPGNN  150

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAA HL++FGY+ F+CYP +T K  Y GLVTQ                       
Sbjct  151   GGDGLVAAHHLYHFGYKPFVCYPKRTSKSLYNGLVTQLESLSVPFLAVEDLPSDLSKDFD  210

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LI ++V L N  +  RKS VIVSVDIPSGWHV+ GD++G
Sbjct  211   ILLDAMFGFSFHGAPRPPFDDLIHKMVHL-NKCNQTRKS-VIVSVDIPSGWHVEEGDVDG  268

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EG++P MLVSLTAPKLCA++F GPHHFLGGRF+PPSIV+K+KL LP YPGTSMCVRIG+P
Sbjct  269   EGMKPDMLVSLTAPKLCARKFSGPHHFLGGRFVPPSIVEKYKLHLPPYPGTSMCVRIGKP  328

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEA+P DQFKKWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  329   PQIDISALRENYISPEFLEEQVEANPVDQFKKWFDDAVAAGLKEPNAMALSTVGKDGKPS  388

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+KDGFVWYT+YES+K RE+ ENP A+LLFYW  LN QV
Sbjct  389   SRMVLLKGVDKDGFVWYTNYESQKGRELFENPRAALLFYWDGLNRQV  435



>ref|NP_568717.2| pyridoxine/pyridoxamine 5'-phosphate oxidase 1 [Arabidopsis thaliana]
 sp|Q9LTX3.1|PPOX1_ARATH RecName: Full=Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, 
chloroplastic; Short=AtPPOX1; Includes: RecName: Full=Pyridoxine/pyridoxamine 
5'-phosphate oxidase; AltName: Full=PNP/PMP 
oxidase; Short=PNPOx; AltName: Full=Pyridoxal 5'-phosphate 
synthase; Includes: RecName: Full=Probable NAD(P)HX epimerase; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA97018.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95879.1| pyridoxine/pyridoxamine 5'-phosphate oxidase 1 [Arabidopsis thaliana]
Length=530

 Score =   417 bits (1071),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 249/348 (72%), Gaps = 44/348 (13%)
 Frame = -2

Query  1017  PISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             P+SYLT +EA EID  LMGPLGFSIDQLMELAGLS+A +IAEVY P+EY R+L ICGPG+
Sbjct  72    PLSYLTQREAAEIDETLMGPLGFSIDQLMELAGLSVAASIAEVYKPEEYSRVLAICGPGN  131

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------------  724
             NGGDGLVAARHLH+FGY+ F+CYP +T K  YTGLVTQ                      
Sbjct  132   NGGDGLVAARHLHHFGYKPFICYPKRTAKPLYTGLVTQLDSLSVPFVSVEDLPDDLSKDF  191

Query  723   -------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDIN  583
                          G   PPFD+LI+RLVSL+N   + +K PVIVSVDIPSGWHV+ GD  
Sbjct  192   DVIVDAMFGFSFHGAPRPPFDDLIRRLVSLQNYEQTLQKHPVIVSVDIPSGWHVEEGDHE  251

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
               GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP YPGTSMCVRIG+
Sbjct  252   DGGIKPDMLVSLTAPKLCAKRFRGPHHFLGGRFVPPSVAEKYKLELPSYPGTSMCVRIGK  311

Query  402   PPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             PP++   A         LL   VE DP  QF+KWFD A+ AG++E N MALST  KD KP
Sbjct  312   PPKVDISAMRVNYVSPELLEEQVETDPTVQFRKWFDEAVAAGLRETNAMALSTANKDKKP  371

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+G +++GFVW+T+YES+K  ++SENP A+LLFYW  LN QV
Sbjct  372   SSRMVLLKGFDENGFVWFTNYESKKGSDLSENPSAALLFYWEILNRQV  419



>ref|XP_008466184.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X3 [Cucumis melo]
Length=464

 Score =   414 bits (1065),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 204/353 (58%), Positives = 255/353 (72%), Gaps = 44/353 (12%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   ISYL+ +EA E+D +LMG LGFS+DQLMELAGLS+AT++AEVY   EY+R+LVI
Sbjct  1     MQNLEAISYLSQREAAEVDEILMGSLGFSVDQLMELAGLSVATSVAEVYKASEYKRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHL +FGY+  +CYP +T K  YTGLVTQ                 
Sbjct  61    CGPGNNGGDGLVAARHLFHFGYKPSICYPKRTAKPLYTGLVTQLESLSVPFLTVDDLPLD  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD+LIQRL SL + ++++++SP IVSVDIPSGWHV+
Sbjct  121   LSKDFDIIIDAIFGFSFHGAPRPPFDDLIQRLTSLNDYKEANQRSPAIVSVDIPSGWHVE  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI+    +P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSIV+K+ L LP YPGT+MC
Sbjct  181   EGDISDSSFKPDMLVSLTAPKLCAKKFNGPHHFLGGRFVPPSIVNKYNLHLPPYPGTAMC  240

Query  417   VRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+PP++   AL         L  +V+ADP  QF+KWFD A+ A ++EPN M+LST T
Sbjct  241   VRIGKPPQVDIAALRENYISPEFLEENVDADPIRQFRKWFDDAVAANLREPNAMSLSTAT  300

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              DGKPSSR+V L+GV++DGFVWYT+YESRKA +++ENP ASLLF+W  LN QV
Sbjct  301   SDGKPSSRMVLLKGVDEDGFVWYTNYESRKAHDLAENPRASLLFFWEGLNRQV  353



>ref|XP_006578271.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X2 [Glycine max]
Length=506

 Score =   416 bits (1068),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 214/353 (61%), Positives = 253/353 (72%), Gaps = 45/353 (13%)
 Frame = -2

Query  1029  GSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVIC  850
              +  P+  L  ++A EID  LMGPLGFS+DQLMELAGLS+AT+I+EVY P EY R+L IC
Sbjct  43    NNRNPLFQLFSRDAAEIDETLMGPLGFSVDQLMELAGLSVATSISEVYKPSEYSRVLTIC  102

Query  849   GPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ------------------  724
             GPG+NGGDGLVAARHLH+FGY+ F+CYP +TPK  Y GLVTQ                  
Sbjct  103   GPGNNGGDGLVAARHLHHFGYKPFVCYPKRTPKPLYAGLVTQLEALSIPFFSVEELPSDL  162

Query  723   -----------------GPLSPPFDELIQRLVSLKNPRDS-HRKSPVIVSVDIPSGWHVD  598
                              G   PPFD+LIQRLVSL N  +   +K  VIVSVDIPSGWHV+
Sbjct  163   SNGFDVVIDAMFGFSFHGSPRPPFDDLIQRLVSLHNNNNQIGQKRSVIVSVDIPSGWHVE  222

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GD++G GI+P MLVSLTAPKL AK+F GPHHFLGGRF+PP+I +K+KL LP YPGTSMC
Sbjct  223   EGDVDGTGIKPDMLVSLTAPKLGAKKFGGPHHFLGGRFVPPAIAEKYKLILPPYPGTSMC  282

Query  417   VRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+PP I   AL         L   VEADPF+QF KWF+ AL AG+KEPN M+LST  
Sbjct  283   VRIGKPPRIDISALRENYISPEFLEEQVEADPFNQFHKWFNDALAAGLKEPNAMSLSTVG  342

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KDGKPSSR+V L+G++K+GFVWYT+YES+KARE+SENP ASLLFYW  LN QV
Sbjct  343   KDGKPSSRMVLLKGLDKEGFVWYTNYESQKARELSENPRASLLFYWDGLNRQV  395



>ref|XP_008466183.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X2 [Cucumis melo]
Length=514

 Score =   415 bits (1067),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/355 (57%), Positives = 256/355 (72%), Gaps = 44/355 (12%)
 Frame = -2

Query  1038  KKMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRIL  859
             + M +   ISYL+ +EA E+D +LMG LGFS+DQLMELAGLS+AT++AEVY   EY+R+L
Sbjct  65    EAMQNLEAISYLSQREAAEVDEILMGSLGFSVDQLMELAGLSVATSVAEVYKASEYKRVL  124

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------  724
             VICGPG+NGGDGLVAARHL +FGY+  +CYP +T K  YTGLVTQ               
Sbjct  125   VICGPGNNGGDGLVAARHLFHFGYKPSICYPKRTAKPLYTGLVTQLESLSVPFLTVDDLP  184

Query  723   --------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWH  604
                                 G   PPFD+LIQRL SL + ++++++SP IVSVDIPSGWH
Sbjct  185   LDLSKDFDIIIDAIFGFSFHGAPRPPFDDLIQRLTSLNDYKEANQRSPAIVSVDIPSGWH  244

Query  603   VDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTS  424
             V+ GDI+    +P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSIV+K+ L LP YPGT+
Sbjct  245   VEEGDISDSSFKPDMLVSLTAPKLCAKKFNGPHHFLGGRFVPPSIVNKYNLHLPPYPGTA  304

Query  423   MCVRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALST  271
             MCVRIG+PP++   AL         L  +V+ADP  QF+KWFD A+ A ++EPN M+LST
Sbjct  305   MCVRIGKPPQVDIAALRENYISPEFLEENVDADPIRQFRKWFDDAVAANLREPNAMSLST  364

Query  270   GTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              T DGKPSSR+V L+GV++DGFVWYT+YESRKA +++ENP ASLLF+W  LN QV
Sbjct  365   ATSDGKPSSRMVLLKGVDEDGFVWYTNYESRKAHDLAENPRASLLFFWEGLNRQV  419



>ref|XP_009390268.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390269.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390270.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=538

 Score =   416 bits (1068),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 209/347 (60%), Positives = 245/347 (71%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +SYLT +EA EID +LMGPLGFS+DQLMELAGLS+A AI+EVY   EYRR+L ICGPG+N
Sbjct  81    VSYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVAAAISEVYKSSEYRRVLAICGPGNN  140

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGYE F+CYP +TPK  Y GLVTQ                       
Sbjct  141   GGDGLVAARHLHHFGYEPFICYPKRTPKPLYNGLVTQLESLSISFISVDDLPQNLTENFD  200

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRL SL       ++S  IVSVDIPSGWHV+ GDI G
Sbjct  201   LIVDAMFGFSFHGQPRPPFDDLIQRLASLSRVDCGRKRSSAIVSVDIPSGWHVEEGDITG  260

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EG  P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSI+ K+KL LP YPGTSMCVRIG+P
Sbjct  261   EGFEPDMLVSLTAPKLCAKKFVGPHHFLGGRFVPPSIISKYKLKLPQYPGTSMCVRIGKP  320

Query  399   PEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +   +         LL   V + P DQF KWFD A+ AG++EPN MALST   +GKPS
Sbjct  321   PSVDIASLRENYISPELLEDQVLSHPVDQFHKWFDEAVAAGLREPNAMALSTSGHEGKPS  380

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +K GFVW+T+Y S+KA+E+SENPHASLLFYW+ LN QV
Sbjct  381   SRIVLLKGADKQGFVWFTNYGSQKAKELSENPHASLLFYWNPLNRQV  427



>ref|XP_008466182.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X1 [Cucumis melo]
Length=530

 Score =   415 bits (1066),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 204/355 (57%), Positives = 256/355 (72%), Gaps = 44/355 (12%)
 Frame = -2

Query  1038  KKMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRIL  859
             + M +   ISYL+ +EA E+D +LMG LGFS+DQLMELAGLS+AT++AEVY   EY+R+L
Sbjct  65    EAMQNLEAISYLSQREAAEVDEILMGSLGFSVDQLMELAGLSVATSVAEVYKASEYKRVL  124

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------  724
             VICGPG+NGGDGLVAARHL +FGY+  +CYP +T K  YTGLVTQ               
Sbjct  125   VICGPGNNGGDGLVAARHLFHFGYKPSICYPKRTAKPLYTGLVTQLESLSVPFLTVDDLP  184

Query  723   --------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWH  604
                                 G   PPFD+LIQRL SL + ++++++SP IVSVDIPSGWH
Sbjct  185   LDLSKDFDIIIDAIFGFSFHGAPRPPFDDLIQRLTSLNDYKEANQRSPAIVSVDIPSGWH  244

Query  603   VDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTS  424
             V+ GDI+    +P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSIV+K+ L LP YPGT+
Sbjct  245   VEEGDISDSSFKPDMLVSLTAPKLCAKKFNGPHHFLGGRFVPPSIVNKYNLHLPPYPGTA  304

Query  423   MCVRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALST  271
             MCVRIG+PP++   AL         L  +V+ADP  QF+KWFD A+ A ++EPN M+LST
Sbjct  305   MCVRIGKPPQVDIAALRENYISPEFLEENVDADPIRQFRKWFDDAVAANLREPNAMSLST  364

Query  270   GTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              T DGKPSSR+V L+GV++DGFVWYT+YESRKA +++ENP ASLLF+W  LN QV
Sbjct  365   ATSDGKPSSRMVLLKGVDEDGFVWYTNYESRKAHDLAENPRASLLFFWEGLNRQV  419



>gb|AAM65907.1| contains similarity to pyridoxamine 5-phosphate oxidase [Arabidopsis 
thaliana]
Length=466

 Score =   412 bits (1060),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 208/348 (60%), Positives = 248/348 (71%), Gaps = 44/348 (13%)
 Frame = -2

Query  1017  PISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             P+SYLT +EA EID  LMGPLGFSIDQLMELAGLS+A +IAEVY P+EY R+L ICGPG+
Sbjct  8     PLSYLTQREAAEIDETLMGPLGFSIDQLMELAGLSVAASIAEVYKPEEYSRVLAICGPGN  67

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------------  724
             NGGDGLVAARHLH+FGY+ F+CYP +T K  YTGLVTQ                      
Sbjct  68    NGGDGLVAARHLHHFGYKPFICYPKRTAKPLYTGLVTQLDSLSVPFVSVEDLPDDLSKDF  127

Query  723   -------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDIN  583
                          G   PPFD+LI+RLVSL+N   + +K PVIVSVDIP GWHV+ GD  
Sbjct  128   DVIVDAMFGFSFHGAPRPPFDDLIRRLVSLQNYEQTLQKHPVIVSVDIPYGWHVEEGDHE  187

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
               GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP YPGTSMCVRIG+
Sbjct  188   DGGIKPDMLVSLTAPKLCAKRFRGPHHFLGGRFVPPSVAEKYKLELPSYPGTSMCVRIGK  247

Query  402   PPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             PP++   A         LL   VE DP  QF+KWFD A+ AG++E N MALST  KD KP
Sbjct  248   PPKVDISAMRVNYVSPELLEEQVETDPTVQFRKWFDEAVAAGLRETNAMALSTANKDKKP  307

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+G +++GFVW+T+YES+K  ++SENP A+LLFYW  LN QV
Sbjct  308   SSRMVLLKGFDENGFVWFTNYESKKGSDLSENPSAALLFYWEILNRQV  355



>ref|XP_008782184.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Phoenix dactylifera]
Length=540

 Score =   415 bits (1066),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 210/347 (61%), Positives = 247/347 (71%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +SYL+ ++A EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY   EY R+L ICGPG+N
Sbjct  83    VSYLSQKDAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKLSEYNRVLAICGPGNN  142

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ F+CYP +T K  YTGLVTQ                       
Sbjct  143   GGDGLVAARHLHHFGYKPFVCYPKRTSKPLYTGLVTQLESLSIPFLSVEDLPQNLSDDFD  202

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LIQRL SL    +  ++   IVSVD+PSGWHV+ GDING
Sbjct  203   LIVDAMFGFSFHGQPRPPFDVLIQRLASLSGIDNGFKRKLAIVSVDVPSGWHVEEGDING  262

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSIV+K+ L LP YPGTSMCVRIG+P
Sbjct  263   EGIKPDMLVSLTAPKLCAKKFIGPHHFLGGRFVPPSIVNKYGLNLPPYPGTSMCVRIGKP  322

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +             LL   V ADP DQF KWFD A+ AG++EPN MALST  +DGK S
Sbjct  323   PSVDISSLRENYISPELLEDQVMADPVDQFHKWFDEAVAAGLQEPNAMALSTSGRDGKSS  382

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +K GFVWYT+Y SRKARE+SENPHASLLFYW+ L+ QV
Sbjct  383   SRMVLLKGADKQGFVWYTNYGSRKARELSENPHASLLFYWNSLHRQV  429



>ref|XP_010520769.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=527

 Score =   414 bits (1063),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/353 (59%), Positives = 250/353 (71%), Gaps = 44/353 (12%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   +SYL  +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY PK+Y R+L I
Sbjct  64    MQNPEAVSYLMQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPKDYNRVLAI  123

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHL++FGY+ F+CYP +T K  YTGLVTQ                 
Sbjct  124   CGPGNNGGDGLVAARHLYHFGYKPFICYPKRTSKPLYTGLVTQLESLSVPFLSVDDLPED  183

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD+LI+RLVSL N   + +  PVIVSVDIPSGWHV+
Sbjct  184   LSKDFDVVLDAIFGFSFHGAPRPPFDDLIRRLVSLHNRDQTLQSHPVIVSVDIPSGWHVE  243

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GD+ G GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP Y GTSMC
Sbjct  244   EGDVEGGGIKPDMLVSLTAPKLCAKRFCGPHHFLGGRFVPPSVAEKYKLQLPGYSGTSMC  303

Query  417   VRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+PP+I   A         LL   VEADP  QF+KWFD A+ AG++E N MAL+T  
Sbjct  304   VRIGKPPKIDISAMRENYISPELLEEQVEADPISQFRKWFDEAVTAGLREANAMALTTAN  363

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KD KPSSR+V L+G +++GFVW+T+YESRK  ++SENP A+LLFYW  LN QV
Sbjct  364   KDMKPSSRMVLLKGFDENGFVWFTNYESRKGSDLSENPFAALLFYWDSLNRQV  416



>ref|XP_002864023.1| AT5g49970/K9P8_11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40282.1| AT5g49970/K9P8_11 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   414 bits (1063),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/348 (60%), Positives = 247/348 (71%), Gaps = 44/348 (13%)
 Frame = -2

Query  1017  PISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             P+SYLT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVYNP EY R+L ICGPG+
Sbjct  66    PLSYLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYNPGEYSRVLAICGPGN  125

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------------  724
             NGGDGLVAARHLH+ GY+ F+CYP +T K  YTGLVTQ                      
Sbjct  126   NGGDGLVAARHLHHLGYKPFICYPKRTAKPLYTGLVTQLESLSVPFVSVDDLPENLSKDF  185

Query  723   -------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDIN  583
                          G   PPFD+LI+RLVSL+N   + +K PVIVSVDIPSGWHV+ GD  
Sbjct  186   DVIVDAMFGFSFHGAPRPPFDDLIRRLVSLQNYEQTLQKHPVIVSVDIPSGWHVEEGDHE  245

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
               GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP YPGTSMCVRIG+
Sbjct  246   DGGIKPDMLVSLTAPKLCAKRFRGPHHFLGGRFVPPSVAEKYKLELPSYPGTSMCVRIGK  305

Query  402   PPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             PP +   A         LL   VE DP  QF+KWFD A+ AG++E N MAL T  KD KP
Sbjct  306   PPRVDISAMRVNYVSPELLEEQVETDPTVQFRKWFDEAVAAGLRETNAMALCTANKDKKP  365

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+G +++GFVW+T+YES+K  ++SENP A+LLFYW  LN QV
Sbjct  366   SSRMVLLKGFDENGFVWFTNYESKKGSDLSENPSAALLFYWESLNRQV  413



>ref|XP_010520771.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X3 [Tarenaya hassleriana]
Length=521

 Score =   414 bits (1063),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/353 (59%), Positives = 250/353 (71%), Gaps = 44/353 (12%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   +SYL  +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY PK+Y R+L I
Sbjct  58    MQNPEAVSYLMQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPKDYNRVLAI  117

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHL++FGY+ F+CYP +T K  YTGLVTQ                 
Sbjct  118   CGPGNNGGDGLVAARHLYHFGYKPFICYPKRTSKPLYTGLVTQLESLSVPFLSVDDLPED  177

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD+LI+RLVSL N   + +  PVIVSVDIPSGWHV+
Sbjct  178   LSKDFDVVLDAIFGFSFHGAPRPPFDDLIRRLVSLHNRDQTLQSHPVIVSVDIPSGWHVE  237

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GD+ G GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP Y GTSMC
Sbjct  238   EGDVEGGGIKPDMLVSLTAPKLCAKRFCGPHHFLGGRFVPPSVAEKYKLQLPGYSGTSMC  297

Query  417   VRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+PP+I   A         LL   VEADP  QF+KWFD A+ AG++E N MAL+T  
Sbjct  298   VRIGKPPKIDISAMRENYISPELLEEQVEADPISQFRKWFDEAVTAGLREANAMALTTAN  357

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KD KPSSR+V L+G +++GFVW+T+YESRK  ++SENP A+LLFYW  LN QV
Sbjct  358   KDMKPSSRMVLLKGFDENGFVWFTNYESRKGSDLSENPFAALLFYWDSLNRQV  410



>ref|XP_010442476.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
[Camelina sativa]
Length=483

 Score =   412 bits (1059),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 248/349 (71%), Gaps = 44/349 (13%)
 Frame = -2

Query  1020  TPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPG  841
             +P+SYLT +EA EID  LMGPLGFS+DQLMELAGLS+A +IAEVY P+EY R+L ICGPG
Sbjct  77    SPLSYLTQREAAEIDETLMGPLGFSVDQLMELAGLSVAASIAEVYKPEEYSRVLAICGPG  136

Query  840   SNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------------  724
             +NGGDGLVAARHLH+FGY+  +CYP +T K  Y GLVTQ                     
Sbjct  137   NNGGDGLVAARHLHHFGYKPSICYPKRTAKSLYAGLVTQLESLSVPFVSVDDLPEDLSKD  196

Query  723   --------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDI  586
                           G   PPFD+LI+RL+SL+N   + +K PV+VSVDIPSGWHV+ GD 
Sbjct  197   FDVIVDAMFGFSFHGAPRPPFDDLIRRLMSLQNYEQTLQKHPVVVSVDIPSGWHVEEGDH  256

Query  585   NGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIG  406
              G GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP YPGTSMCVRIG
Sbjct  257   EGGGIKPDMLVSLTAPKLCAKRFCGPHHFLGGRFVPPSVAEKYKLELPSYPGTSMCVRIG  316

Query  405   RPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGK  253
             +PP++   A         LL   VE DP  QF+KWFD A+ AG++E N MAL T  KD K
Sbjct  317   KPPKVDISAMRVNYVSPELLEEKVETDPTVQFRKWFDEAVAAGLRETNAMALCTANKDKK  376

Query  252   PSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             PSSR+V L+G +++GFVW+T+YES+K  E+SENP A+LLFYW  LN QV
Sbjct  377   PSSRMVLLKGFDENGFVWFTNYESKKGSELSENPCAALLFYWESLNRQV  425



>ref|XP_006280380.1| hypothetical protein CARUB_v10026308mg [Capsella rubella]
 gb|EOA13278.1| hypothetical protein CARUB_v10026308mg [Capsella rubella]
Length=484

 Score =   411 bits (1057),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/351 (58%), Positives = 250/351 (71%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             S +P+SYLT +EA EID  LMGPLGFS+DQLMELAGLS+A +++EVY P+EYRR+L ICG
Sbjct  76    SGSPLSYLTQREAAEIDETLMGPLGFSVDQLMELAGLSVAASVSEVYKPEEYRRVLAICG  135

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHLH+FGY+  +CYP +T K  YTGLVTQ                   
Sbjct  136   PGNNGGDGLVAARHLHHFGYKPSICYPKRTAKSLYTGLVTQLESLSVPFVSVDDLPEDLS  195

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RLVSL+    + +K PVIVSVDIPSGW+V+ G
Sbjct  196   KDFDVIIDAMFGFSFHGAPRPPFDDLIRRLVSLQTYEQTLQKHPVIVSVDIPSGWNVEEG  255

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             D  G GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP YPGTSMCVR
Sbjct  256   DHEGGGIKPDMLVSLTAPKLCAKRFCGPHHFLGGRFVPPSVAEKYKLELPSYPGTSMCVR  315

Query  411   IGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+PP++   A         LL   VE DP  QF+KWFD A+ +G++E N MAL T  KD
Sbjct  316   IGKPPKVDISAMRVNYVSPELLEEQVETDPTVQFRKWFDEAVASGLRETNAMALCTANKD  375

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KPSSR+V L+G +++GFVW+T+YES+K  E+SENP A+LLFYW  LN QV
Sbjct  376   KKPSSRMVLLKGFDENGFVWFTNYESKKGSELSENPCAALLFYWESLNRQV  426



>gb|EPS61585.1| hypothetical protein M569_13210, partial [Genlisea aurea]
Length=395

 Score =   407 bits (1047),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 204/347 (59%), Positives = 240/347 (69%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +SYL+ +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P E+ RIL ICGPG+N
Sbjct  6     VSYLSQREAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPVEHSRILAICGPGNN  65

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY  F+CYP +T K  Y GL+TQ                       
Sbjct  66    GGDGLVAARHLHHFGYRPFICYPKRTAKPLYDGLITQLESLSVPFLSAEELPEDLSESFD  125

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+L  RL  L +     RK P +VSVDIPSGWHV+ GD+NG
Sbjct  126   VVVDAIFGFSFHGTPRPPFDDLTHRLAILGDNDRKIRKLPAVVSVDIPSGWHVEEGDVNG  185

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             +GI+P MLVSLTAPKLCA++F G HHFLGGRF+PPSI +KF L LP YPGTSM VRIG+P
Sbjct  186   DGIKPDMLVSLTAPKLCARKFSGAHHFLGGRFVPPSIAEKFNLRLPQYPGTSMSVRIGKP  245

Query  399   PEIYPLALL---------GMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +   +L            H EADP+ QF+KWFD AL AG KEPN MALST  KDGKPS
Sbjct  246   PRVDISSLRENYISPEFSEAHAEADPYAQFQKWFDDALAAGSKEPNAMALSTAGKDGKPS  305

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G N DGFVWYT+Y SRKA +++EN  A+LLFYW  LN QV
Sbjct  306   SRMVLLKGFNADGFVWYTNYSSRKAHQMAENSQAALLFYWDKLNRQV  352



>ref|XP_006472520.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=521

 Score =   411 bits (1057),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 248/351 (71%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAE Y   EY R+L ICG
Sbjct  60    NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEAYKASEYDRVLAICG  119

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAAR L++FGY+ F+CYP +T K  YTGLVTQ                   
Sbjct  120   PGNNGGDGLVAARQLYHFGYKPFVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  179

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     + +K PVIVSVDIPSGWHV+ G
Sbjct  180   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTRQKRPVIVSVDIPSGWHVEEG  239

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             DI  EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I  K+KL LP YPGTSMCVR
Sbjct  240   DIGDEGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPVIAHKYKLRLPPYPGTSMCVR  299

Query  411   IGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+ P +   AL         L   VE+DP +QF+KWFD A+ AG++EPN MALST  KD
Sbjct  300   IGKAPSVDISALRENYISPEFLEEQVESDPINQFRKWFDDAIAAGLREPNAMALSTVGKD  359

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             GKPSSR+V L+GV++DGFVWYT+YESRKA E+ ENPHASLLFYW  LN QV
Sbjct  360   GKPSSRMVLLKGVDRDGFVWYTNYESRKACELCENPHASLLFYWDGLNRQV  410



>ref|XP_006472519.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=540

 Score =   411 bits (1057),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 248/351 (71%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAE Y   EY R+L ICG
Sbjct  79    NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEAYKASEYDRVLAICG  138

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAAR L++FGY+ F+CYP +T K  YTGLVTQ                   
Sbjct  139   PGNNGGDGLVAARQLYHFGYKPFVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  198

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     + +K PVIVSVDIPSGWHV+ G
Sbjct  199   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTRQKRPVIVSVDIPSGWHVEEG  258

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             DI  EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I  K+KL LP YPGTSMCVR
Sbjct  259   DIGDEGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPVIAHKYKLRLPPYPGTSMCVR  318

Query  411   IGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+ P +   AL         L   VE+DP +QF+KWFD A+ AG++EPN MALST  KD
Sbjct  319   IGKAPSVDISALRENYISPEFLEEQVESDPINQFRKWFDDAIAAGLREPNAMALSTVGKD  378

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             GKPSSR+V L+GV++DGFVWYT+YESRKA E+ ENPHASLLFYW  LN QV
Sbjct  379   GKPSSRMVLLKGVDRDGFVWYTNYESRKACELCENPHASLLFYWDGLNRQV  429



>ref|XP_006402201.1| hypothetical protein EUTSA_v10013217mg [Eutrema salsugineum]
 gb|ESQ43654.1| hypothetical protein EUTSA_v10013217mg [Eutrema salsugineum]
Length=533

 Score =   411 bits (1056),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 206/354 (58%), Positives = 250/354 (71%), Gaps = 44/354 (12%)
 Frame = -2

Query  1035  KMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILV  856
              M  +  +SYLT +EA EID  LMGPLGF++DQLMELAGLS+AT+IAEVY P EY R+L 
Sbjct  69    NMQDSGSVSYLTQREAAEIDETLMGPLGFTVDQLMELAGLSVATSIAEVYKPTEYSRVLA  128

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------  724
             ICGPG+NGGDGLVAARHLH+FGY+  +CYP +T K  YTGLVTQ                
Sbjct  129   ICGPGNNGGDGLVAARHLHHFGYKPSICYPKRTDKSLYTGLVTQLESLSIPFVSVDDLPE  188

Query  723   -------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHV  601
                                G   PPFD+LI+RLVSL+N   + +K PVI SVDIPSGWHV
Sbjct  189   DLSKDFDVIIDAIFGFSFHGAPRPPFDDLIRRLVSLQNSEKTLQKHPVIASVDIPSGWHV  248

Query  600   DGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSM  421
             + GD  GEGI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PP + +K+KL LP YPGTSM
Sbjct  249   EEGDHEGEGIKPDMLVSLTAPKLCAKRFCGPHHFLGGRFVPPQVAEKYKLELPSYPGTSM  308

Query  420   CVRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTG  268
             CVRIG+PP++   A         LL   VE+DP  QF+KWFD A+ AG++E N MALST 
Sbjct  309   CVRIGKPPKVDISAMRVNYVSPELLEDQVESDPTLQFRKWFDEAVAAGLRETNAMALSTT  368

Query  267   TKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KD KPSSR+V L+G +++GFVW+T+YES+K  +++ENP A+LLFYW  LN QV
Sbjct  369   NKDRKPSSRMVLLKGFDENGFVWFTNYESKKGIDLTENPCAALLFYWESLNRQV  422



>ref|XP_006433885.1| hypothetical protein CICLE_v10001057mg [Citrus clementina]
 gb|ESR47125.1| hypothetical protein CICLE_v10001057mg [Citrus clementina]
Length=403

 Score =   405 bits (1042),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 247/351 (70%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICG
Sbjct  6     NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYDRVLAICG  65

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PGSNGGDGLVAARHL++FGY+  +CYP +T K  YTGLVTQ                   
Sbjct  66    PGSNGGDGLVAARHLYHFGYKPSVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  125

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     + +K PVIVSVDIPSGWHV+ G
Sbjct  126   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTRQKRPVIVSVDIPSGWHVEEG  185

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             DI  EGI+P MLVSLTAPKLCAK+  GPHHFLGGRF+PP I DK+KL LP YPGTSMCVR
Sbjct  186   DIGDEGIKPDMLVSLTAPKLCAKKSSGPHHFLGGRFVPPVIADKYKLRLPPYPGTSMCVR  245

Query  411   IGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+ P +   AL         L   VE+DP +QF+KW D A+ AG++EPN MALST  KD
Sbjct  246   IGKAPNVDISALRENYISPEFLEEQVESDPINQFRKWVDDAIAAGLREPNAMALSTVGKD  305

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             GKPSSR+V L+GV++ GFVW T+YESRKA E+ +NPHASLLFYW  LN QV
Sbjct  306   GKPSSRMVLLKGVDRGGFVWCTNYESRKACELCDNPHASLLFYWDGLNRQV  356



>ref|XP_010482299.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010482300.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=537

 Score =   410 bits (1053),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 207/351 (59%), Positives = 248/351 (71%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             S +P+SYLT +EA EID  LMGPLGFS+DQLMELAGLS+A +IAEVY P+EY R+L ICG
Sbjct  76    SGSPLSYLTQREAAEIDETLMGPLGFSVDQLMELAGLSVAASIAEVYKPEEYSRVLAICG  135

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHLH+FGY+  +CYP +T K  Y GLVTQ                   
Sbjct  136   PGNNGGDGLVAARHLHHFGYKPSICYPKRTAKSLYAGLVTQLESLSVPFVSVDDLPEDLS  195

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G    PFD+LI+RL+SL+N   + +K PVIVSVDIPSGWHV+ G
Sbjct  196   KDFDVIVDAMFGFSFHGAPRLPFDDLIRRLMSLQNYEQTLQKHPVIVSVDIPSGWHVEEG  255

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             D  G GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP YPGTSMCVR
Sbjct  256   DHEGAGIKPDMLVSLTAPKLCAKRFCGPHHFLGGRFVPPSVSEKYKLELPSYPGTSMCVR  315

Query  411   IGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IGRPP++   A         LL   VE DP  QF+KWFD A+ AG++E N MAL T  KD
Sbjct  316   IGRPPKVDISAMRVNYVSPELLEEKVETDPTVQFRKWFDEAVAAGLRETNAMALCTANKD  375

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KPSSR+V L+G +++GFVW+T+YES+K  E+SENP A+LLFYW  LN QV
Sbjct  376   KKPSSRMVLLKGFDENGFVWFTNYESKKGSELSENPCAALLFYWESLNRQV  426



>ref|XP_006433887.1| hypothetical protein CICLE_v10001057mg [Citrus clementina]
 gb|ESR47127.1| hypothetical protein CICLE_v10001057mg [Citrus clementina]
Length=403

 Score =   405 bits (1040),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 247/351 (70%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICG
Sbjct  6     NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYDRVLAICG  65

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PGSNGGDGLVAARHL++FGY+  +CYP +T K  YTGLVTQ                   
Sbjct  66    PGSNGGDGLVAARHLYHFGYKPSVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  125

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     + +K PVIVSVDIPSGWHV+ G
Sbjct  126   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTRQKRPVIVSVDIPSGWHVEEG  185

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             DI  EGI+P MLVSLTAPKLCAK+  GPHHFLGGRF+PP I DK+KL LP YPGTSMCVR
Sbjct  186   DIGDEGIKPDMLVSLTAPKLCAKKSSGPHHFLGGRFVPPVIADKYKLRLPPYPGTSMCVR  245

Query  411   IGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+ P +   AL         L   VE+DP +QF+KW D A+ AG++EPN MALST  KD
Sbjct  246   IGKAPNVDISALRENYISPEFLEEQVESDPINQFRKWVDDAIAAGLREPNAMALSTVGKD  305

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             GKPSSR+V L+GV++ GFVW T+YESRKA E+ +NPHASLLFYW  LN QV
Sbjct  306   GKPSSRMVLLKGVDRGGFVWCTNYESRKACELCDNPHASLLFYWDGLNRQV  356



>ref|XP_010441368.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Camelina sativa]
Length=536

 Score =   407 bits (1047),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 207/351 (59%), Positives = 249/351 (71%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             S +P+SYLT +EA EID  LMGPLGFSIDQLMELAGLS+A +IAEVY P+EY R+L ICG
Sbjct  75    SGSPLSYLTQREAAEIDETLMGPLGFSIDQLMELAGLSVAASIAEVYKPEEYSRVLAICG  134

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHLH+FGY+  +CYP +T K  YTGLVTQ                   
Sbjct  135   PGNNGGDGLVAARHLHHFGYKPSICYPKRTAKSLYTGLVTQLESLSVPFVSVDDLPEDLS  194

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RLVSL++   + +K PVIVSVDIPSGWHV+ G
Sbjct  195   KDFDVIVDAMFGFSFHGAPRPPFDDLIRRLVSLQHYEQTLQKHPVIVSVDIPSGWHVEEG  254

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             D  G GI+P MLVSLTAPKLCAKR+ GPHHFLGGRF+PPS+ +K+KL LP YPGTSMCVR
Sbjct  255   DHEGGGIKPDMLVSLTAPKLCAKRYCGPHHFLGGRFVPPSVAEKYKLELPSYPGTSMCVR  314

Query  411   IGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+P ++   A         LL   VE DP  QF+KWFD A+ AG++E N MAL T  KD
Sbjct  315   IGKPLKVDISAMRVNYVSPELLEEQVETDPTVQFRKWFDEAVAAGLRETNAMALCTANKD  374

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KPSSR+V L+G +++GFVW+T+YES+K  E+SENP A+LLFYW  LN QV
Sbjct  375   KKPSSRMVLLKGFDENGFVWFTNYESKKGSELSENPCAALLFYWEILNRQV  425



>ref|XP_006433886.1| hypothetical protein CICLE_v10001057mg [Citrus clementina]
 gb|ESR47126.1| hypothetical protein CICLE_v10001057mg [Citrus clementina]
Length=467

 Score =   404 bits (1039),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 247/351 (70%), Gaps = 44/351 (13%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICG
Sbjct  6     NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYDRVLAICG  65

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PGSNGGDGLVAARHL++FGY+  +CYP +T K  YTGLVTQ                   
Sbjct  66    PGSNGGDGLVAARHLYHFGYKPSVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  125

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     + +K PVIVSVDIPSGWHV+ G
Sbjct  126   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTRQKRPVIVSVDIPSGWHVEEG  185

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             DI  EGI+P MLVSLTAPKLCAK+  GPHHFLGGRF+PP I DK+KL LP YPGTSMCVR
Sbjct  186   DIGDEGIKPDMLVSLTAPKLCAKKSSGPHHFLGGRFVPPVIADKYKLRLPPYPGTSMCVR  245

Query  411   IGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+ P +   AL         L   VE+DP +QF+KW D A+ AG++EPN MALST  KD
Sbjct  246   IGKAPNVDISALRENYISPEFLEEQVESDPINQFRKWVDDAIAAGLREPNAMALSTVGKD  305

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             GKPSSR+V L+GV++ GFVW T+YESRKA E+ +NPHASLLFYW  LN QV
Sbjct  306   GKPSSRMVLLKGVDRGGFVWCTNYESRKACELCDNPHASLLFYWDGLNRQV  356



>gb|KCW68464.1| hypothetical protein EUGRSUZ_F02123 [Eucalyptus grandis]
Length=472

 Score =   404 bits (1038),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 248/345 (72%), Gaps = 44/345 (13%)
 Frame = -2

Query  1008  YLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGG  829
             YLT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY   EY+R+L ICGPG+NGG
Sbjct  17    YLTQREAAEIDEELMGPLGFSVDQLMELAGLSVATSIAEVYKASEYKRVLAICGPGNNGG  76

Query  828   DGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------------  724
             DGLVAARHL +FGY+ ++CYP +TPK  YTGLVTQ                         
Sbjct  77    DGLVAARHLFHFGYKPYICYPKRTPKPLYTGLVTQLESLRVPFLSVEDLPPDLSTEYDIL  136

Query  723   ----------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEG  574
                       G   PPFD++++RL+ ++    +++KSPVIVS+DIPSGWHV+ GDI+GEG
Sbjct  137   LDAVFGFSFHGAARPPFDDILRRLIGMRKSDQTNKKSPVIVSIDIPSGWHVEEGDISGEG  196

Query  573   IRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPE  394
             I+P MLVSLTAPKLCAK+F+GPHHFLGGRF+PP I +K+ L LP YPG SMCV IG+ P+
Sbjct  197   IKPDMLVSLTAPKLCAKQFHGPHHFLGGRFVPPPIAEKYNLRLPPYPGASMCVHIGKAPQ  256

Query  393   IYPLALLGMH---------VEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSR  241
             +   A+   +         V+ADP  QF KWF+ A+ AG++E N MALST  KDGKPSSR
Sbjct  257   VDISAMRENYISPEFHEEEVDADPIKQFCKWFEEAVAAGLREANAMALSTAGKDGKPSSR  316

Query  240   VVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             +V L+GV++DGFVWYT+YES+K  ++SENP ASLLFYW  LN QV
Sbjct  317   MVLLKGVDEDGFVWYTNYESQKGCQLSENPWASLLFYWESLNRQV  361



>gb|KFK26631.1| hypothetical protein AALP_AA8G273600 [Arabis alpina]
Length=461

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 205/353 (58%), Positives = 248/353 (70%), Gaps = 47/353 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M  +  +SYLT +EA +ID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L I
Sbjct  1     MQDSASLSYLTQREAAQIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPTEYNRVLAI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHLH+FGY+  +CYP +T K  YTGL+TQ                 
Sbjct  61    CGPGNNGGDGLVAARHLHHFGYKPSICYPKRTAKSLYTGLLTQLESLSLPFLSVDDLPED  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD+LI+ LVSL+N     RK PV+VSVDIPSGWHV+
Sbjct  121   LSKDFDVIVDAIFGFSFHGAPRPPFDDLIRTLVSLQN---YERKHPVLVSVDIPSGWHVE  177

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GD  G GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP YPGTSMC
Sbjct  178   QGDHEGGGIKPDMLVSLTAPKLCAKRFCGPHHFLGGRFVPPSVAEKYKLELPSYPGTSMC  237

Query  417   VRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+PP++   A         LL   VE DP  QF+KWFD A+ AG++E N MALST  
Sbjct  238   VRIGKPPQVDISAMRVNYVSPELLEDQVETDPTLQFRKWFDEAVAAGLRETNAMALSTTN  297

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KD KPSSR+V L+G +++GFVW+T+YES+K  ++S+NP A+LLFYW  LN QV
Sbjct  298   KDRKPSSRMVLLKGFDENGFVWFTNYESKKGSDLSDNPCAALLFYWESLNRQV  350



>ref|XP_008338909.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X2 [Malus domestica]
Length=430

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/327 (64%), Positives = 247/327 (76%), Gaps = 26/327 (8%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   ISYLT +EA EID +LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+LVI
Sbjct  1     MQNPEDISYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYNRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPFDELIQRLVS  676
             CGPG+NGGDGLVAARHL++FGY+L +CYP +T K  Y GLVTQ   LS PF       +S
Sbjct  61    CGPGNNGGDGLVAARHLYHFGYKLSVCYPKRTAKPLYAGLVTQLESLSVPF-------IS  113

Query  675   LKN-PRDSHRKSPVIVSV-------DIPSGWHVDGGDINGEGIRPSMLVSLTAPKLCAKR  520
             +++ P D  +   +IV         DIPSGWHV+ GD   EGI+P MLVSLTAPKLCAK+
Sbjct  114   VEDLPLDLSKDFDIIVDAMFGFSFHDIPSGWHVE-GDGGVEGIKPDMLVSLTAPKLCAKK  172

Query  519   FYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPEIYPLAL---------LGM  367
             F+GPHHFLGGRF+PPSI DK+KL LP YPGTSMCVRIG PP++   AL         L  
Sbjct  173   FFGPHHFLGGRFVPPSIADKYKLRLPPYPGTSMCVRIGMPPQVDISALRENYISPEFLEE  232

Query  366   HVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVVSLEGVNKDGFVWYTSY  187
              VEADPFDQF+KWFD  + AG++EPN MALST TK+GK SSR+V L+G +K+GFVWYT+Y
Sbjct  233   QVEADPFDQFRKWFDDVVAAGLREPNAMALSTATKNGKISSRMVLLKGFDKNGFVWYTNY  292

Query  186   ESRKAREISENPHASLLFYWSCLNCQV  106
             ES+KA E+SENP ASLLFYW  LN QV
Sbjct  293   ESQKAHELSENPRASLLFYWDGLNRQV  319



>ref|XP_010926347.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Elaeis guineensis]
Length=550

 Score =   406 bits (1043),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 246/347 (71%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +SYL+ ++A EID +LMGPLGFS+DQLMELAGLS+AT+I EVY   EY R+L ICGPG+N
Sbjct  93    VSYLSQKDAAEIDEILMGPLGFSVDQLMELAGLSVATSIPEVYRLSEYSRVLAICGPGNN  152

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ F+CYP +TPK  YTGLVTQ                       
Sbjct  153   GGDGLVAARHLHHFGYKPFVCYPKRTPKPLYTGLVTQLESLSVPFLSVGDLPQNLSDDFD  212

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LIQRL SL    +  ++   IVSVD+PSGWHV+ GDI+G
Sbjct  213   LIVDAMFGFSFHGQPRPPFDVLIQRLASLSGIDNGFKRKVAIVSVDVPSGWHVEEGDISG  272

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSIV K+ L LP YPGTSMCVRIG+ 
Sbjct  273   EGIKPDMLVSLTAPKLCAKKFIGPHHFLGGRFVPPSIVHKYGLNLPPYPGTSMCVRIGKL  332

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +             LL   V ADP DQF KWFD A+ AG++EPN MALST  ++GKPS
Sbjct  333   PSVDVSSLRENYISPELLEDQVMADPVDQFHKWFDEAVAAGLQEPNAMALSTCGREGKPS  392

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +K GFVWYT+Y SRKARE+SENPHASLLF+W+ L+ QV
Sbjct  393   SRMVLLKGADKQGFVWYTNYGSRKARELSENPHASLLFFWNPLHRQV  439



>ref|XP_011071779.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=456

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 204/348 (59%), Positives = 244/348 (70%), Gaps = 39/348 (11%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M     ISYLT Q+A EID LLMG LGFSIDQLMELAGLS+A+A+AEVY P EY R+LVI
Sbjct  1     MNEQESISYLTQQQAAEIDDLLMGNLGFSIDQLMELAGLSVASAVAEVYKPSEYNRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVT------------------  727
             CGPG+NGGDGLVAARHLH+FGY+  + YP +TPK  Y GLVT                  
Sbjct  61    CGPGNNGGDGLVAARHLHHFGYKPSIWYPKRTPKPLYAGLVTQLESLSVPFISIDSLPQE  120

Query  726   ----------------QGPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDG  595
                             QG   PPFD+LI  + SL      H+KSPVIVSVDIPSGWHV+ 
Sbjct  121   FLNFDIIVDAIFGFSFQGNPRPPFDDLIMSMASLSAHYPEHQKSPVIVSVDIPSGWHVED  180

Query  594   GDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             GD +G+G RP MLVSLTAPKLCA+ F G +HFLGGRF+PPS++ K+KL LP YPGT+MCV
Sbjct  181   GDRSGDGTRPDMLVSLTAPKLCARTFSGRYHFLGGRFVPPSVMQKYKLRLPKYPGTAMCV  240

Query  414   RIGRPPEI-----YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             +IG   +I      P   L  +VEADPF QF+KWFD A+  G+K+P+ MALST  KDGKP
Sbjct  241   QIGNSCQIKVEDPVPAKFLQKNVEADPFLQFQKWFDDAVATGLKDPDAMALSTANKDGKP  300

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+ V+++GFVW ++Y SRK  EI+ENPHASLLFYW+ LN QV
Sbjct  301   SSRMVQLKKVDREGFVWCSNYGSRKGHEIAENPHASLLFYWNTLNRQV  348



>ref|XP_011652570.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X3 [Cucumis sativus]
Length=464

 Score =   403 bits (1035),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 249/353 (71%), Gaps = 44/353 (12%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   ISYL+ +EA E+D +LMG LGFSIDQLMELAGLS+AT++AEV+   EY+R+LVI
Sbjct  1     MQNLEAISYLSQREAAEVDEILMGSLGFSIDQLMELAGLSVATSVAEVFKASEYKRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHL +FGY+  +CYP +T K  Y GLVTQ                 
Sbjct  61    CGPGNNGGDGLVAARHLFHFGYKPSICYPKKTAKPLYAGLVTQLESLAVPFLTVEDLPLD  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD+LIQRL SL   +++ ++SP IVSVDIPSGWHV+
Sbjct  121   LSKDFDIIIDAIFGFSFHGAPRPPFDDLIQRLSSLNVYKEADQRSPAIVSVDIPSGWHVE  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI+    +P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSIV+K+ L LP YPGT+MC
Sbjct  181   EGDISDSSFKPDMLVSLTAPKLCAKKFNGPHHFLGGRFVPPSIVNKYNLHLPPYPGTAMC  240

Query  417   VRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+PP++   AL         L   V+ADP  QF KWFD A+ A ++EPN M+LST T
Sbjct  241   VRIGKPPQVDIAALRENYISPEFLEETVDADPMRQFLKWFDDAVAANLREPNAMSLSTAT  300

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              DGKPSSR+V L+GV++DGFVWYT+YES+KA  ++ENP ASLLF+W  LN QV
Sbjct  301   SDGKPSSRMVLLKGVDEDGFVWYTNYESQKAHNLAENPRASLLFFWEGLNRQV  353



>ref|XP_011652569.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X2 [Cucumis sativus]
Length=514

 Score =   404 bits (1037),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 202/355 (57%), Positives = 250/355 (70%), Gaps = 44/355 (12%)
 Frame = -2

Query  1038  KKMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRIL  859
             + M +   ISYL+ +EA E+D +LMG LGFSIDQLMELAGLS+AT++AEV+   EY+R+L
Sbjct  65    EAMQNLEAISYLSQREAAEVDEILMGSLGFSIDQLMELAGLSVATSVAEVFKASEYKRVL  124

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------  724
             VICGPG+NGGDGLVAARHL +FGY+  +CYP +T K  Y GLVTQ               
Sbjct  125   VICGPGNNGGDGLVAARHLFHFGYKPSICYPKKTAKPLYAGLVTQLESLAVPFLTVEDLP  184

Query  723   --------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWH  604
                                 G   PPFD+LIQRL SL   +++ ++SP IVSVDIPSGWH
Sbjct  185   LDLSKDFDIIIDAIFGFSFHGAPRPPFDDLIQRLSSLNVYKEADQRSPAIVSVDIPSGWH  244

Query  603   VDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTS  424
             V+ GDI+    +P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSIV+K+ L LP YPGT+
Sbjct  245   VEEGDISDSSFKPDMLVSLTAPKLCAKKFNGPHHFLGGRFVPPSIVNKYNLHLPPYPGTA  304

Query  423   MCVRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALST  271
             MCVRIG+PP++   AL         L   V+ADP  QF KWFD A+ A ++EPN M+LST
Sbjct  305   MCVRIGKPPQVDIAALRENYISPEFLEETVDADPMRQFLKWFDDAVAANLREPNAMSLST  364

Query  270   GTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              T DGKPSSR+V L+GV++DGFVWYT+YES+KA  ++ENP ASLLF+W  LN QV
Sbjct  365   ATSDGKPSSRMVLLKGVDEDGFVWYTNYESQKAHNLAENPRASLLFFWEGLNRQV  419



>ref|XP_004236151.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X4 [Solanum lycopersicum]
Length=471

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 247/351 (70%), Gaps = 42/351 (12%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M ST  ISY+  QEA EID +LMGPLGF++DQLMELAGLS+A+AI EVY+  EY R+LVI
Sbjct  1     MESTDDISYVNQQEAIEIDQMLMGPLGFTVDQLMELAGLSVASAIGEVYSSSEYTRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGG+GLVAARHLH+FGY+  +CYP +  + P+ GLVTQ                 
Sbjct  61    CGPGNNGGNGLVAARHLHHFGYKPSICYPKRNTEPPFAGLVTQLESLSVPFLPVEDLPVQ  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD LI+RLVS+KN + +H K+ VI+SVD+PSGWHV 
Sbjct  121   LSSDFEIIVDAIFGFSFHGNPRPPFDSLIRRLVSIKNQQRTHEKAAVIISVDVPSGWHVV  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI GEGI P MLVSLTAPKLCAK F G HHFLGGRF+P SI+DKFKL LP YPGTSMC
Sbjct  181   EGDICGEGIEPDMLVSLTAPKLCAKMFCGLHHFLGGRFVPRSIIDKFKLKLPPYPGTSMC  240

Query  417   VRIGRPPEIYPLALLG-------MHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             VRIG  PE    A  G       + VE +P DQF KW   A  AGVKEP+YM LST  KD
Sbjct  241   VRIGNFPETNSSAQKGIFTASVNLEVEENPIDQFHKWLGDASEAGVKEPHYMVLSTAGKD  300

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KPSSR+VSLEGVNKDGFVW+T+Y SRKAREISENPHASLLFYW  + CQV
Sbjct  301   AKPSSRMVSLEGVNKDGFVWHTNYRSRKAREISENPHASLLFYWGPIKCQV  351



>emb|CAN80597.1| hypothetical protein VITISV_002641 [Vitis vinifera]
Length=787

 Score =   412 bits (1058),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 211/313 (67%), Positives = 241/313 (77%), Gaps = 13/313 (4%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL  +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICGPG+N
Sbjct  381   ISYLLQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYRPSEYNRVLAICGPGNN  440

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPFDELIQRLVSLKNPRD  658
             GGDGLVAARHLH+FGY+ ++CYP +TPK  YTGLVTQ   LS PF  +    + L N  D
Sbjct  441   GGDGLVAARHLHHFGYKPYICYPKRTPKPLYTGLVTQLESLSVPFLSVEDLPLDLSNDFD  500

Query  657   SHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIP  478
                 +    S     GWHV+ GDI+GEGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+P
Sbjct  501   ILVDAMFGFSF---HGWHVEEGDIDGEGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVP  557

Query  477   PSIVDKFKLGLPLYPGTSMCVRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWF  325
             P I DKFKL LP YPGT+MCVRIG+PP+I   AL         L  +VEADP DQF+KWF
Sbjct  558   PFIADKFKLHLPPYPGTAMCVRIGKPPQIDISALRENYISPEFLEEYVEADPMDQFRKWF  617

Query  324   DHALVAGVKEPNYMALSTGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHA  145
             D A+VAG+KEPN MALST  KDGKPSSR+V L+GV+KDGFVWYT+Y SRKA EISENPHA
Sbjct  618   DDAVVAGLKEPNAMALSTAGKDGKPSSRIVLLKGVDKDGFVWYTNYGSRKAHEISENPHA  677

Query  144   SLLFYWSCLNCQV  106
             SLLFYW  LN QV
Sbjct  678   SLLFYWDGLNRQV  690



>ref|XP_010520770.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=524

 Score =   403 bits (1035),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 205/353 (58%), Positives = 247/353 (70%), Gaps = 47/353 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   +SYL  +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY PK+Y R+L I
Sbjct  64    MQNPEAVSYLMQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPKDYNRVLAI  123

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHL++FGY+ F+CYP +T K  YTGLVTQ                 
Sbjct  124   CGPGNNGGDGLVAARHLYHFGYKPFICYPKRTSKPLYTGLVTQLESLSVPFLSVDDLPED  183

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD+LI+RLVSL N   + +  PVIVSVDIPSGWHV+
Sbjct  184   LSKDFDVVLDAIFGFSFHGAPRPPFDDLIRRLVSLHNRDQTLQSHPVIVSVDIPSGWHVE  243

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GD+ G GI+P MLVSLTAPKLCAKRF GPHHFLGGRF+PPS+ +K+KL LP Y GTSMC
Sbjct  244   EGDVEGGGIKPDMLVSLTAPKLCAKRFCGPHHFLGGRFVPPSVAEKYKLQLPGYSGTSMC  303

Query  417   VRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+PP+I   A         LL   VEADP  QF+KWFD A+ AG++E N MAL+T  
Sbjct  304   VRIGKPPKIDISAMRENYISPELLEEQVEADPISQFRKWFDEAVTAGLREANAMALTTAN  363

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KD KP   +V L+G +++GFVW+T+YESRK  ++SENP A+LLFYW  LN QV
Sbjct  364   KDMKP---MVLLKGFDENGFVWFTNYESRKGSDLSENPFAALLFYWDSLNRQV  413



>ref|XP_004136264.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X1 [Cucumis sativus]
 gb|KGN60243.1| hypothetical protein Csa_3G889990 [Cucumis sativus]
Length=530

 Score =   403 bits (1035),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 202/355 (57%), Positives = 250/355 (70%), Gaps = 44/355 (12%)
 Frame = -2

Query  1038  KKMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRIL  859
             + M +   ISYL+ +EA E+D +LMG LGFSIDQLMELAGLS+AT++AEV+   EY+R+L
Sbjct  65    EAMQNLEAISYLSQREAAEVDEILMGSLGFSIDQLMELAGLSVATSVAEVFKASEYKRVL  124

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------  724
             VICGPG+NGGDGLVAARHL +FGY+  +CYP +T K  Y GLVTQ               
Sbjct  125   VICGPGNNGGDGLVAARHLFHFGYKPSICYPKKTAKPLYAGLVTQLESLAVPFLTVEDLP  184

Query  723   --------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWH  604
                                 G   PPFD+LIQRL SL   +++ ++SP IVSVDIPSGWH
Sbjct  185   LDLSKDFDIIIDAIFGFSFHGAPRPPFDDLIQRLSSLNVYKEADQRSPAIVSVDIPSGWH  244

Query  603   VDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTS  424
             V+ GDI+    +P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSIV+K+ L LP YPGT+
Sbjct  245   VEEGDISDSSFKPDMLVSLTAPKLCAKKFNGPHHFLGGRFVPPSIVNKYNLHLPPYPGTA  304

Query  423   MCVRIGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALST  271
             MCVRIG+PP++   AL         L   V+ADP  QF KWFD A+ A ++EPN M+LST
Sbjct  305   MCVRIGKPPQVDIAALRENYISPEFLEETVDADPMRQFLKWFDDAVAANLREPNAMSLST  364

Query  270   GTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              T DGKPSSR+V L+GV++DGFVWYT+YES+KA  ++ENP ASLLF+W  LN QV
Sbjct  365   ATSDGKPSSRMVLLKGVDEDGFVWYTNYESQKAHNLAENPRASLLFFWEGLNRQV  419



>ref|XP_010318945.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=486

 Score =   401 bits (1031),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 247/351 (70%), Gaps = 42/351 (12%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M ST  ISY+  QEA EID +LMGPLGF++DQLMELAGLS+A+AI EVY+  EY R+LVI
Sbjct  1     MESTDDISYVNQQEAIEIDQMLMGPLGFTVDQLMELAGLSVASAIGEVYSSSEYTRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGG+GLVAARHLH+FGY+  +CYP +  + P+ GLVTQ                 
Sbjct  61    CGPGNNGGNGLVAARHLHHFGYKPSICYPKRNTEPPFAGLVTQLESLSVPFLPVEDLPVQ  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD LI+RLVS+KN + +H K+ VI+SVD+PSGWHV 
Sbjct  121   LSSDFEIIVDAIFGFSFHGNPRPPFDSLIRRLVSIKNQQRTHEKAAVIISVDVPSGWHVV  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI GEGI P MLVSLTAPKLCAK F G HHFLGGRF+P SI+DKFKL LP YPGTSMC
Sbjct  181   EGDICGEGIEPDMLVSLTAPKLCAKMFCGLHHFLGGRFVPRSIIDKFKLKLPPYPGTSMC  240

Query  417   VRIGRPPEIYPLALLG-------MHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             VRIG  PE    A  G       + VE +P DQF KW   A  AGVKEP+YM LST  KD
Sbjct  241   VRIGNFPETNSSAQKGIFTASVNLEVEENPIDQFHKWLGDASEAGVKEPHYMVLSTAGKD  300

Query  258   GKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KPSSR+VSLEGVNKDGFVW+T+Y SRKAREISENPHASLLFYW  + CQV
Sbjct  301   AKPSSRMVSLEGVNKDGFVWHTNYRSRKAREISENPHASLLFYWGPIKCQV  351



>ref|XP_006386420.1| pyridoxamine 5'-phosphate oxidase-related family protein [Populus 
trichocarpa]
 gb|ERP64217.1| pyridoxamine 5'-phosphate oxidase-related family protein [Populus 
trichocarpa]
Length=447

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 209/353 (59%), Positives = 241/353 (68%), Gaps = 61/353 (17%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M +   ISYLT +EA E+D +LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L I
Sbjct  1     MQNPESISYLTQREAAEVDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYSRVLAI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHLH+FGY+  +CYP +T K  Y GLVTQ                 
Sbjct  61    CGPGNNGGDGLVAARHLHHFGYKPSVCYPKRTQKPLYNGLVTQLESLSVPFLSVEDLPVD  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD+LIQ+LV   N   +H+KSPV VSVDIPSGWHV+
Sbjct  121   LPEDFDILVDAMFGFSFHGSPRPPFDDLIQKLVQSCNFAQNHQKSPVTVSVDIPSGWHVE  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GD++GEG++P MLVSLTAPKLCAK+F GPHHFLGGRF+P SIVDKFKL LP YPGTSMC
Sbjct  181   EGDVSGEGVKPDMLVSLTAPKLCAKKFTGPHHFLGGRFVPSSIVDKFKLHLPPYPGTSMC  240

Query  417   VRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGT  265
             VRIG+PP+I   A         LL   V ADP DQF+KWFD AL AG++EPN MALST  
Sbjct  241   VRIGKPPQIDISALRQNYISPELLEEQVAADPIDQFRKWFDEALAAGLREPNAMALSTVG  300

Query  264   KDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KDGKP                 YT+YES+KA E+SENPHASLLFYW  LN QV
Sbjct  301   KDGKP-----------------YTNYESQKAHELSENPHASLLFYWDGLNRQV  336



>ref|XP_010061501.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68463.1| hypothetical protein EUGRSUZ_F02123 [Eucalyptus grandis]
Length=554

 Score =   403 bits (1036),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 248/345 (72%), Gaps = 44/345 (13%)
 Frame = -2

Query  1008  YLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGG  829
             YLT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY   EY+R+L ICGPG+NGG
Sbjct  99    YLTQREAAEIDEELMGPLGFSVDQLMELAGLSVATSIAEVYKASEYKRVLAICGPGNNGG  158

Query  828   DGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------------  724
             DGLVAARHL +FGY+ ++CYP +TPK  YTGLVTQ                         
Sbjct  159   DGLVAARHLFHFGYKPYICYPKRTPKPLYTGLVTQLESLRVPFLSVEDLPPDLSTEYDIL  218

Query  723   ----------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEG  574
                       G   PPFD++++RL+ ++    +++KSPVIVS+DIPSGWHV+ GDI+GEG
Sbjct  219   LDAVFGFSFHGAARPPFDDILRRLIGMRKSDQTNKKSPVIVSIDIPSGWHVEEGDISGEG  278

Query  573   IRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPE  394
             I+P MLVSLTAPKLCAK+F+GPHHFLGGRF+PP I +K+ L LP YPG SMCV IG+ P+
Sbjct  279   IKPDMLVSLTAPKLCAKQFHGPHHFLGGRFVPPPIAEKYNLRLPPYPGASMCVHIGKAPQ  338

Query  393   IYPLALLGMH---------VEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSR  241
             +   A+   +         V+ADP  QF KWF+ A+ AG++E N MALST  KDGKPSSR
Sbjct  339   VDISAMRENYISPEFHEEEVDADPIKQFCKWFEEAVAAGLREANAMALSTAGKDGKPSSR  398

Query  240   VVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             +V L+GV++DGFVWYT+YES+K  ++SENP ASLLFYW  LN QV
Sbjct  399   MVLLKGVDEDGFVWYTNYESQKGCQLSENPWASLLFYWESLNRQV  443



>ref|XP_009134036.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Brassica rapa]
Length=517

 Score =   402 bits (1032),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 202/354 (57%), Positives = 247/354 (70%), Gaps = 51/354 (14%)
 Frame = -2

Query  1035  KMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILV  856
              M  +  +SYL+ +EA EID  LMGPLGFS+DQLMELAGLS+AT++AEVY P EY R+L 
Sbjct  62    NMQDSASVSYLSQREAAEIDETLMGPLGFSVDQLMELAGLSVATSVAEVYKPSEYSRVLA  121

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------  724
             ICGPG+NGGDGLVAARHLH+FGY+  +CYP +TPK  YTGLVTQ                
Sbjct  122   ICGPGNNGGDGLVAARHLHHFGYKPSICYPKRTPKSLYTGLVTQLESLSVPFVSVDDLPE  181

Query  723   -------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHV  601
                                G   PPFD++I+RL +L+       K PVIVSVDIPSGWHV
Sbjct  182   DLSEDFDVIIDAIFGFSFHGAPRPPFDDIIRRLQTLQ-------KRPVIVSVDIPSGWHV  234

Query  600   DGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSM  421
             + GD  G GI+P MLVSLTAPKLCAK F GPHHFLGGRF+PPS+ +K+KL LP YPGTSM
Sbjct  235   EEGDHEGGGIKPDMLVSLTAPKLCAKSFSGPHHFLGGRFVPPSVAEKYKLELPSYPGTSM  294

Query  420   CVRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTG  268
             CVRIG+PP++   A         LL   VE+DP  QF+KWFD A+ AG++E N MALST 
Sbjct  295   CVRIGKPPKVDISAMRVNYVSPELLEDQVESDPVLQFRKWFDEAVAAGLRETNAMALSTT  354

Query  267   TKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KD KPSSR+V L+G +++GFVW+T+YES+K  ++SENP A+LLFYW  +N QV
Sbjct  355   NKDRKPSSRMVLLKGFDENGFVWFTNYESKKGSDLSENPFAALLFYWEDMNRQV  408



>ref|XP_002301080.2| hypothetical protein POPTR_0002s10300g [Populus trichocarpa]
 gb|EEE80353.2| hypothetical protein POPTR_0002s10300g [Populus trichocarpa]
Length=525

 Score =   401 bits (1030),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 209/354 (59%), Positives = 242/354 (68%), Gaps = 61/354 (17%)
 Frame = -2

Query  1035  KMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILV  856
             +M +   ISYLT +EA E+D +LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L 
Sbjct  78    RMQNPESISYLTQREAAEVDEILMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYSRVLA  137

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------  724
             ICGPG+NGGDGLVAARHLH+FGY+  +CYP +T K  Y GLVTQ                
Sbjct  138   ICGPGNNGGDGLVAARHLHHFGYKPSVCYPKRTQKPLYNGLVTQLESLSVPFLSVEDLPV  197

Query  723   -------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHV  601
                                G   PPFD+LIQ+LV   N   +H+KSPV VSVDIPSGWHV
Sbjct  198   DLPEDFDILVDAMFGFSFHGSPRPPFDDLIQKLVQSCNFAQNHQKSPVTVSVDIPSGWHV  257

Query  600   DGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSM  421
             + GD++GEG++P MLVSLTAPKLCAK+F GPHHFLGGRF+P SIVDKFKL LP YPGTSM
Sbjct  258   EEGDVSGEGVKPDMLVSLTAPKLCAKKFTGPHHFLGGRFVPSSIVDKFKLHLPPYPGTSM  317

Query  420   CVRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTG  268
             CVRIG+PP+I   A         LL   V ADP DQF+KWFD AL AG++EPN MALST 
Sbjct  318   CVRIGKPPQIDISALRQNYISPELLEEQVAADPIDQFRKWFDEALAAGLREPNAMALSTV  377

Query  267   TKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KDGKP                 YT+YES+KA E+SENPHASLLFYW  LN QV
Sbjct  378   GKDGKP-----------------YTNYESQKAHELSENPHASLLFYWDGLNRQV  414



>gb|ERN02919.1| hypothetical protein AMTR_s00135p00077960 [Amborella trichopoda]
Length=533

 Score =   401 bits (1030),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 206/347 (59%), Positives = 243/347 (70%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL+ ++A EID +LMGPLGFS+DQLMELAGLS+A+AIAEVY P EY  +LVICGPG+N
Sbjct  76    ISYLSQKDAAEIDEILMGPLGFSVDQLMELAGLSVASAIAEVYRPSEYSCVLVICGPGNN  135

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  136   GGDGLVAARHLYHFGYKPFICYPKRTNKPLYSGLVTQLESLSIPFLLAEDLPSNLSNDFD  195

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LIQRLV+L+   +++   PVI SVDIPSGWHV+ G+I+G
Sbjct  196   IIIDAMFGFSFHGTPRPPFDALIQRLVALQISENNYEGRPVIASVDIPSGWHVEDGNIDG  255

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAK+F GPHHFLGGRFIPPSI DK+ L LP YPGTSMCVRIG+P
Sbjct  256   TGIKPDMLVSLTAPKLCAKKFCGPHHFLGGRFIPPSIADKYILQLPPYPGTSMCVRIGKP  315

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P I   AL         L   V+ DP  QF KWF+ A+ A V EPN MALST  K GKPS
Sbjct  316   PAIDIAALRENYISPEFLEGEVKGDPVRQFAKWFEDAVAANVHEPNAMALSTANKSGKPS  375

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +  GFVWYT+Y SRK+RE+ ENP ASLLF+W  LN QV
Sbjct  376   SRMVLLKGFDDHGFVWYTNYRSRKSRELFENPQASLLFFWEPLNRQV  422



>ref|XP_006841244.2| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
[Amborella trichopoda]
Length=546

 Score =   401 bits (1030),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 206/347 (59%), Positives = 243/347 (70%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL+ ++A EID +LMGPLGFS+DQLMELAGLS+A+AIAEVY P EY  +LVICGPG+N
Sbjct  89    ISYLSQKDAAEIDEILMGPLGFSVDQLMELAGLSVASAIAEVYRPSEYSCVLVICGPGNN  148

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  149   GGDGLVAARHLYHFGYKPFICYPKRTNKPLYSGLVTQLESLSIPFLLAEDLPSNLSNDFD  208

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LIQRLV+L+   +++   PVI SVDIPSGWHV+ G+I+G
Sbjct  209   IIIDAMFGFSFHGTPRPPFDALIQRLVALQISENNYEGRPVIASVDIPSGWHVEDGNIDG  268

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAK+F GPHHFLGGRFIPPSI DK+ L LP YPGTSMCVRIG+P
Sbjct  269   TGIKPDMLVSLTAPKLCAKKFCGPHHFLGGRFIPPSIADKYILQLPPYPGTSMCVRIGKP  328

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P I   AL         L   V+ DP  QF KWF+ A+ A V EPN MALST  K GKPS
Sbjct  329   PAIDIAALRENYISPEFLEGEVKGDPVRQFAKWFEDAVAANVHEPNAMALSTANKSGKPS  388

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+G +  GFVWYT+Y SRK+RE+ ENP ASLLF+W  LN QV
Sbjct  389   SRMVLLKGFDDHGFVWYTNYRSRKSRELFENPQASLLFFWEPLNRQV  435



>ref|XP_009775274.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X3 [Nicotiana sylvestris]
Length=447

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 203/350 (58%), Positives = 244/350 (70%), Gaps = 43/350 (12%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ST  ISY++ QEA EID +LMGPLG S+DQLMELAGLS+A+AI EVY+  +Y R+LVICG
Sbjct  4     STDEISYVSQQEAIEIDEMLMGPLGSSVDQLMELAGLSVASAIGEVYSSSDYTRVLVICG  63

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHLH+FGY+  +CYP +  K  +  LVTQ                   
Sbjct  64    PGNNGGDGLVAARHLHHFGYKPSICYPKRNTKPLFAALVTQLESLSIPFLSEEQLSVQLS  123

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G    PFD LI++LVS++N + +H+K+ VI+SVD+PSGWHV+ G
Sbjct  124   SDYDIIVDAIFGFSFHGTPRLPFDSLIRKLVSVRNQQCTHQKAAVIISVDVPSGWHVEDG  183

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             D+ G+GI+P MLVSLTAPKLCAK F+G HHFLGGRF+P SI+DKFKL LP YPGTSMCVR
Sbjct  184   DVFGDGIKPDMLVSLTAPKLCAKMFFGTHHFLGGRFVPQSIIDKFKLKLPPYPGTSMCVR  243

Query  411   IGRPPE--------IYPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDG  256
             IG  P+        I+  +     VE DP  QF+KW   AL AG+KEP+YM LST  KD 
Sbjct  244   IGNLPQTNLSAQKGIFASSESLEEVEEDPIYQFQKWLSDALAAGIKEPHYMVLSTADKDA  303

Query  255   KPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KPSSR++SLEGVNKDGFVW T+Y SRKAREI ENP ASLLFYW  L  QV
Sbjct  304   KPSSRMMSLEGVNKDGFVWQTNYGSRKAREILENPQASLLFYWGPLKRQV  353



>ref|XP_009775272.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=473

 Score =   398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/350 (58%), Positives = 244/350 (70%), Gaps = 43/350 (12%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ST  ISY++ QEA EID +LMGPLG S+DQLMELAGLS+A+AI EVY+  +Y R+LVICG
Sbjct  4     STDEISYVSQQEAIEIDEMLMGPLGSSVDQLMELAGLSVASAIGEVYSSSDYTRVLVICG  63

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHLH+FGY+  +CYP +  K  +  LVTQ                   
Sbjct  64    PGNNGGDGLVAARHLHHFGYKPSICYPKRNTKPLFAALVTQLESLSIPFLSEEQLSVQLS  123

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G    PFD LI++LVS++N + +H+K+ VI+SVD+PSGWHV+ G
Sbjct  124   SDYDIIVDAIFGFSFHGTPRLPFDSLIRKLVSVRNQQCTHQKAAVIISVDVPSGWHVEDG  183

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             D+ G+GI+P MLVSLTAPKLCAK F+G HHFLGGRF+P SI+DKFKL LP YPGTSMCVR
Sbjct  184   DVFGDGIKPDMLVSLTAPKLCAKMFFGTHHFLGGRFVPQSIIDKFKLKLPPYPGTSMCVR  243

Query  411   IGRPPE--------IYPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDG  256
             IG  P+        I+  +     VE DP  QF+KW   AL AG+KEP+YM LST  KD 
Sbjct  244   IGNLPQTNLSAQKGIFASSESLEEVEEDPIYQFQKWLSDALAAGIKEPHYMVLSTADKDA  303

Query  255   KPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KPSSR++SLEGVNKDGFVW T+Y SRKAREI ENP ASLLFYW  L  QV
Sbjct  304   KPSSRMMSLEGVNKDGFVWQTNYGSRKAREILENPQASLLFYWGPLKRQV  353



>gb|EYU42518.1| hypothetical protein MIMGU_mgv1a006341mg [Erythranthe guttata]
Length=447

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 205/343 (60%), Positives = 239/343 (70%), Gaps = 35/343 (10%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M    PISYLT Q+A EID LL+GPL F+IDQLMEL GLS+A+AIAEVY P E+  +LVI
Sbjct  1     MEDEKPISYLTQQQAAEIDELLVGPLSFTIDQLMELGGLSVASAIAEVYRPNEHNLVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGG GLVAARHLH+FGY+LF+CYP +  K  +TGLVTQ                 
Sbjct  61    CGPGNNGGHGLVAARHLHHFGYKLFVCYPNRNLKPLFTGLVTQLDSLSIPFLSIESLPRE  120

Query  723   -----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDG  595
                              G   PPFD LI+ L SL+      +KS  +VSVDIPSGWHV+ 
Sbjct  121   YLNFDIIVDAIFSFSFHGNPKPPFDNLIRSLASLREHYQERKKSRFVVSVDIPSGWHVEE  180

Query  594   GDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             GDI G+GI+P MLVSLTAPKLCAK F G +HFLGGRFIPP IV K+KL LP Y GTSMCV
Sbjct  181   GDITGDGIKPDMLVSLTAPKLCAKAFLGSYHFLGGRFIPPFIVQKYKLRLPPYNGTSMCV  240

Query  414   RIGRPPEIYPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVV  235
             +IG+PP    L     +VEADPF QFKKW D A  AG+KEP  ++LST TKDGKPSSRVV
Sbjct  241   QIGKPPRTN-LKARPENVEADPFVQFKKWLDDAAAAGLKEPKAVSLSTATKDGKPSSRVV  299

Query  234   SLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              L+  ++ GFVW ++Y SRK REISENPHASLLFYW+ LN QV
Sbjct  300   LLKKFDRRGFVWCSNYGSRKGREISENPHASLLFYWNILNRQV  342



>ref|XP_009775273.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=471

 Score =   397 bits (1021),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 203/350 (58%), Positives = 244/350 (70%), Gaps = 43/350 (12%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ST  ISY++ QEA EID +LMGPLG S+DQLMELAGLS+A+AI EVY+  +Y R+LVICG
Sbjct  4     STDEISYVSQQEAIEIDEMLMGPLGSSVDQLMELAGLSVASAIGEVYSSSDYTRVLVICG  63

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHLH+FGY+  +CYP +  K  +  LVTQ                   
Sbjct  64    PGNNGGDGLVAARHLHHFGYKPSICYPKRNTKPLFAALVTQLESLSIPFLSEEQLSVQLS  123

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G    PFD LI++LVS++N + +H+K+ VI+SVD+PSGWHV+ G
Sbjct  124   SDYDIIVDAIFGFSFHGTPRLPFDSLIRKLVSVRNQQCTHQKAAVIISVDVPSGWHVEDG  183

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             D+ G+GI+P MLVSLTAPKLCAK F+G HHFLGGRF+P SI+DKFKL LP YPGTSMCVR
Sbjct  184   DVFGDGIKPDMLVSLTAPKLCAKMFFGTHHFLGGRFVPQSIIDKFKLKLPPYPGTSMCVR  243

Query  411   IGRPPE--------IYPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDG  256
             IG  P+        I+  +     VE DP  QF+KW   AL AG+KEP+YM LST  KD 
Sbjct  244   IGNLPQTNLSAQKGIFASSESLEEVEEDPIYQFQKWLSDALAAGIKEPHYMVLSTADKDA  303

Query  255   KPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             KPSSR++SLEGVNKDGFVW T+Y SRKAREI ENP ASLLFYW  L  QV
Sbjct  304   KPSSRMMSLEGVNKDGFVWQTNYGSRKAREILENPQASLLFYWGPLKRQV  353



>ref|XP_010318947.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X5 [Solanum lycopersicum]
Length=444

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 215/356 (60%), Positives = 247/356 (69%), Gaps = 47/356 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M ST  ISY+  QEA EID +LMGPLGF++DQLMELAGLS+A+AI EVY+  EY R+LVI
Sbjct  1     MESTDDISYVNQQEAIEIDQMLMGPLGFTVDQLMELAGLSVASAIGEVYSSSEYTRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGG+GLVAARHLH+FGY+  +CYP +  + P+ GLVTQ                 
Sbjct  61    CGPGNNGGNGLVAARHLHHFGYKPSICYPKRNTEPPFAGLVTQLESLSVPFLPVEDLPVQ  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD LI+RLVS+KN + +H K+ VI+SVD+PSGWHV 
Sbjct  121   LSSDFEIIVDAIFGFSFHGNPRPPFDSLIRRLVSIKNQQRTHEKAAVIISVDVPSGWHVV  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI GEGI P MLVSLTAPKLCAK F G HHFLGGRF+P SI+DKFKL LP YPGTSMC
Sbjct  181   EGDICGEGIEPDMLVSLTAPKLCAKMFCGLHHFLGGRFVPRSIIDKFKLKLPPYPGTSMC  240

Query  417   VRIGRPPEIYPLALLG-------MHVEADPFDQ-----FKKWFDHALVAGVKEPNYMALS  274
             VRIG  PE    A  G       + VE +P DQ     F KW   A  AGVKEP+YM LS
Sbjct  241   VRIGNFPETNSSAQKGIFTASVNLEVEENPIDQVELYKFHKWLGDASEAGVKEPHYMVLS  300

Query  273   TGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             T  KD KPSSR+VSLEGVNKDGFVW+T+Y SRKAREISENPHASLLFYW  + CQV
Sbjct  301   TAGKDAKPSSRMVSLEGVNKDGFVWHTNYRSRKAREISENPHASLLFYWGPIKCQV  356



>emb|CDX83173.1| BnaA03g23330D [Brassica napus]
Length=517

 Score =   399 bits (1024),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 201/354 (57%), Positives = 247/354 (70%), Gaps = 51/354 (14%)
 Frame = -2

Query  1035  KMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILV  856
              M  +  +SYL+ +EA EID  LMGPLGFS+DQLMELAGLS+AT++AEVY P EY R+L 
Sbjct  62    NMQDSASVSYLSQREAAEIDETLMGPLGFSVDQLMELAGLSVATSVAEVYKPSEYSRVLA  121

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------  724
             ICGPG+NGGDGLVAARHLH+FGY+  +CYP +T K  YTGLVTQ                
Sbjct  122   ICGPGNNGGDGLVAARHLHHFGYKPSICYPKRTSKPLYTGLVTQLESLSVPFVSVDDLPE  181

Query  723   -------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHV  601
                                G   PPFD++I+RL +L+       K PVIVSVDIPSGWHV
Sbjct  182   DLSKDFDVIIDAIFGFSFHGAPRPPFDDIIRRLQTLQ-------KRPVIVSVDIPSGWHV  234

Query  600   DGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSM  421
             + GD  G GI+P MLVSLTAPKLCAK F GPHHFLGGRF+PPS+ +K+KL LP YPGTSM
Sbjct  235   EEGDHEGGGIKPDMLVSLTAPKLCAKSFSGPHHFLGGRFVPPSVAEKYKLELPSYPGTSM  294

Query  420   CVRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTG  268
             CVRIG+PP++   A         LL   VE+DP  QF+KWFD A+ AG++E N MALST 
Sbjct  295   CVRIGKPPKVDISAMRVNYVSPELLEDQVESDPVLQFRKWFDEAVAAGLRETNAMALSTT  354

Query  267   TKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             +KD KPSSR+V L+G +++GFVW+T+YES+K  ++SENP A+LLFYW  +N QV
Sbjct  355   SKDRKPSSRMVLLKGFDENGFVWFTNYESKKGSDLSENPFAALLFYWEDMNRQV  408



>emb|CDP04610.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   396 bits (1018),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 237/347 (68%), Gaps = 44/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +SYLT +EATEID LLMGPLGF +DQLMELAGLS+ATAIAEVY   +Y R+L ICGPG+N
Sbjct  8     VSYLTRKEATEIDELLMGPLGFGVDQLMELAGLSVATAIAEVYGASKYSRVLTICGPGNN  67

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY   +CYP +TPK  Y GL TQ                       
Sbjct  68    GGDGLVAARHLHHFGYRSAVCYPKRTPKPLYGGLATQLESLSVPFLSEEDLPAELSGHFD  127

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G    PF+ LIQRLVSLK    + + S ++VS+DIPSGWHV+ GDI G
Sbjct  128   IIVDAIFGFSFKGAPRSPFESLIQRLVSLKKFDKTQKASAIVVSIDIPSGWHVEEGDITG  187

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             +GI+P MLVSLTAPKLCAK+F G HHFLGGRF+PP +VDKFKL LP Y GTSMC  I +P
Sbjct  188   DGIKPDMLVSLTAPKLCAKKFVGQHHFLGGRFVPPIVVDKFKLQLPSYSGTSMCALIEKP  247

Query  399   PEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   A          L   VE DPFDQ +KW  HA+ AGVK+PN +ALST  + GK S
Sbjct  248   PQIEIQAPRENYLSTDFLEEKVEVDPFDQLQKWIHHAVAAGVKDPNLVALSTAGRGGKLS  307

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L  V+ +GF+W+TSYE++K R++SENPHAS+LFYW  L  QV
Sbjct  308   SRMVQLLSVDNNGFLWFTSYENQKGRDLSENPHASILFYWDMLKRQV  354



>gb|AAM08545.1|AC079935_17 Putative pyridoxamine 5-phosphate oxidase [Oryza sativa Japonica 
Group]
 gb|EAY78271.1| hypothetical protein OsI_33318 [Oryza sativa Indica Group]
 gb|EAZ15889.1| hypothetical protein OsJ_31311 [Oryza sativa Japonica Group]
Length=473

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 244/347 (70%), Gaps = 45/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +++L  +EA EID  LMGPLGFS+DQLMELAGLS+A A+AEVY   E+ R+LVICGPG+N
Sbjct  17    VTHLAQREAAEIDEQLMGPLGFSVDQLMELAGLSVAAAVAEVYKLGEHTRVLVICGPGNN  76

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+  +CYP +TPK  Y+GL TQ                       
Sbjct  77    GGDGLVAARHLHHFGYKPSVCYPKRTPKPLYSGLCTQLESLTIPFVPVEDLPANLSEEFD  136

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LI RLVSL +  D+  K P IVSVDIPSGWHV+ GDING
Sbjct  137   IIIDAMFGFSFHGTPRPPFDDLINRLVSL-SAIDNSAKRPAIVSVDIPSGWHVEEGDING  195

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              G +P MLVSLTAPKLCAK+F GPHHFLGGRF+PP IV K+KL LP YPGTSMCVRIG+ 
Sbjct  196   GGFKPDMLVSLTAPKLCAKKFTGPHHFLGGRFVPPPIVSKYKLHLPPYPGTSMCVRIGKA  255

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +             LL   V  DPFDQF +WFD A+ AG++EPN MAL+T  K+GKPS
Sbjct  256   PSVDISSLRENYISPELLENQVMPDPFDQFVRWFDEAVTAGLREPNAMALTTADKEGKPS  315

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K GFVWYT+Y S+KA ++SENP+A+LLFYW+ +N QV
Sbjct  316   SRMVLLKGVDKQGFVWYTNYGSQKAHDLSENPNAALLFYWNEMNRQV  362



>emb|CDY21440.1| BnaC03g27570D [Brassica napus]
Length=513

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 201/354 (57%), Positives = 245/354 (69%), Gaps = 51/354 (14%)
 Frame = -2

Query  1035  KMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILV  856
              M  +  +SYL+ +EA EID  LMGPLGFS+DQLMELAGLS+AT++AEVY P EY R+L 
Sbjct  58    NMQDSASVSYLSQREAAEIDETLMGPLGFSVDQLMELAGLSVATSVAEVYKPCEYSRVLA  117

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------  724
             ICGPG+NGGDGLVAARHLH+FGY+  +CYP +T K  YTGLVTQ                
Sbjct  118   ICGPGNNGGDGLVAARHLHHFGYKPSICYPKRTSKSLYTGLVTQLESLSVPFVSVEDLPE  177

Query  723   -------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHV  601
                                G   PPFD +I+RL +L+       K PVIVSVDIPSGWHV
Sbjct  178   DLSVDFDVIIDAIFGFSFHGAPRPPFDAIIRRLQTLQ-------KRPVIVSVDIPSGWHV  230

Query  600   DGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSM  421
             + GD  G GI+P MLVSLTAPKLCAK F GPHHFLGGRF+PPS+ +K+KL LP YPGTSM
Sbjct  231   EDGDHEGGGIKPDMLVSLTAPKLCAKSFSGPHHFLGGRFVPPSVAEKYKLELPSYPGTSM  290

Query  420   CVRIGRPPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTG  268
             CVRIG+PP++   A         LL   VE+DP  QF+KWFD A+ AG++E N MALST 
Sbjct  291   CVRIGKPPKVDISAMRVNYVSPELLEDQVESDPVLQFRKWFDEAVAAGLRETNAMALSTT  350

Query  267   TKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              KD KPSSR+V L+G +++GFVW+T+YES+K  ++SENP A+LLFYW  +N QV
Sbjct  351   NKDRKPSSRMVLLKGFDENGFVWFTNYESKKGSDLSENPFAALLFYWEDMNRQV  404



>ref|XP_010318946.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X3 [Solanum lycopersicum]
Length=476

 Score =   395 bits (1016),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 215/356 (60%), Positives = 247/356 (69%), Gaps = 47/356 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M ST  ISY+  QEA EID +LMGPLGF++DQLMELAGLS+A+AI EVY+  EY R+LVI
Sbjct  1     MESTDDISYVNQQEAIEIDQMLMGPLGFTVDQLMELAGLSVASAIGEVYSSSEYTRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGG+GLVAARHLH+FGY+  +CYP +  + P+ GLVTQ                 
Sbjct  61    CGPGNNGGNGLVAARHLHHFGYKPSICYPKRNTEPPFAGLVTQLESLSVPFLPVEDLPVQ  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD LI+RLVS+KN + +H K+ VI+SVD+PSGWHV 
Sbjct  121   LSSDFEIIVDAIFGFSFHGNPRPPFDSLIRRLVSIKNQQRTHEKAAVIISVDVPSGWHVV  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI GEGI P MLVSLTAPKLCAK F G HHFLGGRF+P SI+DKFKL LP YPGTSMC
Sbjct  181   EGDICGEGIEPDMLVSLTAPKLCAKMFCGLHHFLGGRFVPRSIIDKFKLKLPPYPGTSMC  240

Query  417   VRIGRPPEIYPLALLG-------MHVEADPFDQ-----FKKWFDHALVAGVKEPNYMALS  274
             VRIG  PE    A  G       + VE +P DQ     F KW   A  AGVKEP+YM LS
Sbjct  241   VRIGNFPETNSSAQKGIFTASVNLEVEENPIDQVELYKFHKWLGDASEAGVKEPHYMVLS  300

Query  273   TGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             T  KD KPSSR+VSLEGVNKDGFVW+T+Y SRKAREISENPHASLLFYW  + CQV
Sbjct  301   TAGKDAKPSSRMVSLEGVNKDGFVWHTNYRSRKAREISENPHASLLFYWGPIKCQV  356



>ref|XP_010318944.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
Length=491

 Score =   395 bits (1016),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 215/356 (60%), Positives = 247/356 (69%), Gaps = 47/356 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M ST  ISY+  QEA EID +LMGPLGF++DQLMELAGLS+A+AI EVY+  EY R+LVI
Sbjct  1     MESTDDISYVNQQEAIEIDQMLMGPLGFTVDQLMELAGLSVASAIGEVYSSSEYTRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGG+GLVAARHLH+FGY+  +CYP +  + P+ GLVTQ                 
Sbjct  61    CGPGNNGGNGLVAARHLHHFGYKPSICYPKRNTEPPFAGLVTQLESLSVPFLPVEDLPVQ  120

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G   PPFD LI+RLVS+KN + +H K+ VI+SVD+PSGWHV 
Sbjct  121   LSSDFEIIVDAIFGFSFHGNPRPPFDSLIRRLVSIKNQQRTHEKAAVIISVDVPSGWHVV  180

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GDI GEGI P MLVSLTAPKLCAK F G HHFLGGRF+P SI+DKFKL LP YPGTSMC
Sbjct  181   EGDICGEGIEPDMLVSLTAPKLCAKMFCGLHHFLGGRFVPRSIIDKFKLKLPPYPGTSMC  240

Query  417   VRIGRPPEIYPLALLG-------MHVEADPFDQ-----FKKWFDHALVAGVKEPNYMALS  274
             VRIG  PE    A  G       + VE +P DQ     F KW   A  AGVKEP+YM LS
Sbjct  241   VRIGNFPETNSSAQKGIFTASVNLEVEENPIDQVELYKFHKWLGDASEAGVKEPHYMVLS  300

Query  273   TGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             T  KD KPSSR+VSLEGVNKDGFVW+T+Y SRKAREISENPHASLLFYW  + CQV
Sbjct  301   TAGKDAKPSSRMVSLEGVNKDGFVWHTNYRSRKAREISENPHASLLFYWGPIKCQV  356



>ref|NP_001064477.1| Os10g0377800 [Oryza sativa Japonica Group]
 gb|ABB47388.1| pyridoxamine 5'-phosphate oxidase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26391.1| Os10g0377800 [Oryza sativa Japonica Group]
Length=548

 Score =   397 bits (1020),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 244/347 (70%), Gaps = 45/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +++L  +EA EID  LMGPLGFS+DQLMELAGLS+A A+AEVY   E+ R+LVICGPG+N
Sbjct  92    VTHLAQREAAEIDEQLMGPLGFSVDQLMELAGLSVAAAVAEVYKLGEHTRVLVICGPGNN  151

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+  +CYP +TPK  Y+GL TQ                       
Sbjct  152   GGDGLVAARHLHHFGYKPSVCYPKRTPKPLYSGLCTQLESLTIPFVPVEDLPANLSEEFD  211

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LI RLVSL +  D+  K P IVSVDIPSGWHV+ GDING
Sbjct  212   IIIDAMFGFSFHGTPRPPFDDLINRLVSL-SAIDNSAKRPAIVSVDIPSGWHVEEGDING  270

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              G +P MLVSLTAPKLCAK+F GPHHFLGGRF+PP IV K+KL LP YPGTSMCVRIG+ 
Sbjct  271   GGFKPDMLVSLTAPKLCAKKFTGPHHFLGGRFVPPPIVSKYKLHLPPYPGTSMCVRIGKA  330

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +             LL   V  DPFDQF +WFD A+ AG++EPN MAL+T  K+GKPS
Sbjct  331   PSVDISSLRENYISPELLENQVMPDPFDQFVRWFDEAVTAGLREPNAMALTTADKEGKPS  390

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K GFVWYT+Y S+KA ++SENP+A+LLFYW+ +N QV
Sbjct  391   SRMVLLKGVDKQGFVWYTNYGSQKAHDLSENPNAALLFYWNEMNRQV  437



>ref|XP_007018152.1| Pyridoxin 5'-phosphate oxidase isoform 5 [Theobroma cacao]
 gb|EOY15377.1| Pyridoxin 5'-phosphate oxidase isoform 5 [Theobroma cacao]
Length=423

 Score =   392 bits (1007),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 231/318 (73%), Gaps = 44/318 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I+YLT +EA EID +LMGPLGFS+DQLMELAGLS+AT++AEVY P EY R+L ICGPG+N
Sbjct  11    ITYLTQREAAEIDEILMGPLGFSVDQLMELAGLSVATSMAEVYKPSEYNRVLAICGPGNN  70

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  71    GGDGLVAARHLYHFGYKPFVCYPKRTSKPLYSGLVTQLESLSIPFLSVDELPVDWSNDFD  130

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LI++LV L N +   +KSPVIVSVDIPSGWHV+ GD+NG
Sbjct  131   ILVDAMFGFSFHGAPRPPFDNLIEKLVHLNNYKQRQQKSPVIVSVDIPSGWHVEEGDVNG  190

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PPSI +K+KL LP YPGTSMCVRIG+P
Sbjct  191   EGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPSIAEKYKLHLPPYPGTSMCVRIGKP  250

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P+I   AL         L   VEADP DQF+KWFD A+ AG+KEPN MALST  KDGKPS
Sbjct  251   PQIDISALRENYMSPDFLEEQVEADPIDQFRKWFDDAVAAGLKEPNAMALSTTGKDGKPS  310

Query  246   SRVVSLEGVNKDGFVWYT  193
             SR+V L+ V+KDGFVW T
Sbjct  311   SRMVLLKSVDKDGFVWCT  328



>ref|XP_004983070.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X2 [Setaria italica]
Length=551

 Score =   393 bits (1010),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 248/347 (71%), Gaps = 46/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +++LTH++A EID  LMGPLGFS+DQLMELAGLS+A A+AEVY   E+ R+L+ICGPG+N
Sbjct  96    VTHLTHRDAAEIDEQLMGPLGFSVDQLMELAGLSVAEAVAEVYKLSEHTRVLIICGPGNN  155

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY   +CYP +TPK  Y+GLVTQ                       
Sbjct  156   GGDGLVAARHLYHFGYRPSVCYPKRTPKPLYSGLVTQLESLSIPFITAEDLPDDLSREFD  215

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRLVSL    +S ++ P IVS+D+PSGWHV+ GD++G
Sbjct  216   IIIDAMFGFSFHGTPRPPFDDLIQRLVSLAVVGNSDKR-PAIVSIDVPSGWHVEEGDVDG  274

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAK+F GPHHFLGGRFIPP I++K+ L LP YPGTSMCVRIG+ 
Sbjct  275   -GIKPDMLVSLTAPKLCAKKFTGPHHFLGGRFIPPPILNKYGLQLPPYPGTSMCVRIGKA  333

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +             LL   V  DPFDQF+KWFD A+ AG++EPN MAL+T  K+GKPS
Sbjct  334   PSVDISSLRENYISPELLESQVMPDPFDQFRKWFDEAVTAGLREPNAMALTTVNKEGKPS  393

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K GFVWYT+Y  RKA ++SENP+A+LLFYW+ +N QV
Sbjct  394   SRMVLLKGVDKQGFVWYTNYGGRKAHDLSENPNAALLFYWNEMNRQV  440



>ref|XP_004983069.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X1 [Setaria italica]
Length=552

 Score =   393 bits (1009),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 248/347 (71%), Gaps = 46/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +++LTH++A EID  LMGPLGFS+DQLMELAGLS+A A+AEVY   E+ R+L+ICGPG+N
Sbjct  96    VTHLTHRDAAEIDEQLMGPLGFSVDQLMELAGLSVAEAVAEVYKLSEHTRVLIICGPGNN  155

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY   +CYP +TPK  Y+GLVTQ                       
Sbjct  156   GGDGLVAARHLYHFGYRPSVCYPKRTPKPLYSGLVTQLESLSIPFITAEDLPDDLSREFD  215

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRLVSL    +S ++ P IVS+D+PSGWHV+ GD++G
Sbjct  216   IIIDAMFGFSFHGTPRPPFDDLIQRLVSLAVVGNSDKR-PAIVSIDVPSGWHVEEGDVDG  274

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAK+F GPHHFLGGRFIPP I++K+ L LP YPGTSMCVRIG+ 
Sbjct  275   -GIKPDMLVSLTAPKLCAKKFTGPHHFLGGRFIPPPILNKYGLQLPPYPGTSMCVRIGKA  333

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +             LL   V  DPFDQF+KWFD A+ AG++EPN MAL+T  K+GKPS
Sbjct  334   PSVDISSLRENYISPELLESQVMPDPFDQFRKWFDEAVTAGLREPNAMALTTVNKEGKPS  393

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K GFVWYT+Y  RKA ++SENP+A+LLFYW+ +N QV
Sbjct  394   SRMVLLKGVDKQGFVWYTNYGGRKAHDLSENPNAALLFYWNEMNRQV  440



>ref|NP_974918.1| pyridoxine/pyridoxamine 5'-phosphate oxidase 1 [Arabidopsis thaliana]
 gb|AED95878.1| pyridoxine/pyridoxamine 5'-phosphate oxidase 1 [Arabidopsis thaliana]
Length=466

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 198/348 (57%), Positives = 238/348 (68%), Gaps = 55/348 (16%)
 Frame = -2

Query  1017  PISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             P+SYLT +EA EID  LMGPLGFSIDQLMELAGLS+A +IAEVY P+EY R+L ICGPG+
Sbjct  72    PLSYLTQREAAEIDETLMGPLGFSIDQLMELAGLSVAASIAEVYKPEEYSRVLAICGPGN  131

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------------  724
             NGGDGLVAARHLH+FGY+ F+CYP +T K  YTGLVTQ                      
Sbjct  132   NGGDGLVAARHLHHFGYKPFICYPKRTAKPLYTGLVTQLDSLSVPFVSVEDLPDDLSKDF  191

Query  723   -------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDIN  583
                          G   PPFD+LI+RLVSL+N   + +K PVIVSVDIPSGWHV+ GD  
Sbjct  192   DVIVDAMFGFSFHGAPRPPFDDLIRRLVSLQNYEQTLQKHPVIVSVDIPSGWHVEEGDHE  251

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
               GI+P ML           RF GPHHFLGGRF+PPS+ +K+KL LP YPGTSMCVRIG+
Sbjct  252   DGGIKPDML-----------RFRGPHHFLGGRFVPPSVAEKYKLELPSYPGTSMCVRIGK  300

Query  402   PPEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             PP++   A         LL   VE DP  QF+KWFD A+ AG++E N MALST  KD KP
Sbjct  301   PPKVDISAMRVNYVSPELLEEQVETDPTVQFRKWFDEAVAAGLRETNAMALSTANKDKKP  360

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SSR+V L+G +++GFVW+T+YES+K  ++SENP A+LLFYW  LN QV
Sbjct  361   SSRMVLLKGFDENGFVWFTNYESKKGSDLSENPSAALLFYWEILNRQV  408



>ref|XP_008643596.1| PREDICTED: uncharacterized protein LOC100381809 isoform X1 [Zea 
mays]
Length=551

 Score =   391 bits (1004),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 248/347 (71%), Gaps = 46/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +++LT ++A EID  LMGPLGFS+DQLMELAGLS+A A+AEVY   E+ R+LVICGPG+N
Sbjct  96    VTHLTQRDAAEIDEQLMGPLGFSVDQLMELAGLSVAAALAEVYKLNEHARVLVICGPGNN  155

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY   +CYP +TPK  Y+GLVTQ                       
Sbjct  156   GGDGLVAARHLYHFGYRPSICYPKRTPKPLYSGLVTQLESLSIPFIPVEDLPNELPREFD  215

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LIQ LVSL + ++  ++ P IVS+DIPSGWHV+ GD++G
Sbjct  216   VIVDAMFGFSFHGTPRPPFDHLIQMLVSLSDIQNPDKR-PAIVSIDIPSGWHVEEGDVDG  274

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I++K+ L LP YPGTSMCVRIG+ 
Sbjct  275   -GIKPDMLVSLTAPKLCAKKFTGPHHFLGGRFVPPPILNKYGLQLPPYPGTSMCVRIGKA  333

Query  399   P--EIYPL-------ALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P  EI  L        LL   V +DPFDQF KWFD A+ AG++EPN MAL+T  K+GKPS
Sbjct  334   PSVEISSLRENYISPELLESQVMSDPFDQFLKWFDEAVTAGLREPNAMALTTANKEGKPS  393

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K GFVWYT+Y SRKA ++ ENP+A+LLFYW+ +N QV
Sbjct  394   SRMVLLKGVDKQGFVWYTNYGSRKAHDLCENPNAALLFYWNEMNRQV  440



>tpg|DAA46907.1| TPA: hypothetical protein ZEAMMB73_094953 [Zea mays]
Length=791

 Score =   391 bits (1004),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 248/347 (71%), Gaps = 46/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +++LT ++A EID  LMGPLGFS+DQLMELAGLS+A A+AEVY   E+ R+LVICGPG+N
Sbjct  336   VTHLTQRDAAEIDEQLMGPLGFSVDQLMELAGLSVAAALAEVYKLNEHARVLVICGPGNN  395

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY   +CYP +TPK  Y+GLVTQ                       
Sbjct  396   GGDGLVAARHLYHFGYRPSICYPKRTPKPLYSGLVTQLESLSIPFIPVEDLPNELPREFD  455

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD LIQ LVSL + ++  ++ P IVS+DIPSGWHV+ GD++G
Sbjct  456   VIVDAMFGFSFHGTPRPPFDHLIQMLVSLSDIQNPDKR-PAIVSIDIPSGWHVEEGDVDG  514

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I++K+ L LP YPGTSMCVRIG+ 
Sbjct  515   -GIKPDMLVSLTAPKLCAKKFTGPHHFLGGRFVPPPILNKYGLQLPPYPGTSMCVRIGKA  573

Query  399   P--EIYPL-------ALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P  EI  L        LL   V +DPFDQF KWFD A+ AG++EPN MAL+T  K+GKPS
Sbjct  574   PSVEISSLRENYISPELLESQVMSDPFDQFLKWFDEAVTAGLREPNAMALTTANKEGKPS  633

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K GFVWYT+Y SRKA ++ ENP+A+LLFYW+ +N QV
Sbjct  634   SRMVLLKGVDKQGFVWYTNYGSRKAHDLCENPNAALLFYWNEMNRQV  680



>dbj|BAJ96979.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   381 bits (978),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 242/347 (70%), Gaps = 45/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             +++L+ ++A +ID  LMGPLGFS+DQLMELAGLS+ATA+AEVY   E+ R+L+ICGPG+N
Sbjct  98    VTHLSQRDAADIDEQLMGPLGFSVDQLMELAGLSVATAVAEVYKLSEHTRVLIICGPGNN  157

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y GLVTQ                       
Sbjct  158   GGDGLVAARHLYHFGYKPFVCYPKRTAKPLYAGLVTQLESLAIPFVPVEDLPQDLSGQYD  217

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQ LVSL    DS ++ P IVSVDIPSGWHV+ GD++G
Sbjct  218   IVIDAMFGFSFHGAPRPPFDDLIQMLVSLSVVGDSAKRPP-IVSVDIPSGWHVEEGDVSG  276

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I  K+ L LP YPGTSMCVRIG+ 
Sbjct  277   GGIKPDMLVSLTAPKLCAKKFTGPHHFLGGRFVPPPISSKYGLELPPYPGTSMCVRIGKV  336

Query  399   PEI---------YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +             LL   V  +PFDQF+ WFD A+ AG++EPN MAL+T  K GKPS
Sbjct  337   PSVDISSLRENYISPELLENQVMPNPFDQFRSWFDEAVTAGLREPNAMALTTVNKAGKPS  396

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K GFVWYT+Y S+KA ++SEN  A+LLFYW+ +N QV
Sbjct  397   SRMVLLKGVDKQGFVWYTNYGSQKAHDLSENSSAALLFYWNEMNRQV  443



>ref|XP_006662307.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
[Oryza brachyantha]
Length=440

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 192/331 (58%), Positives = 233/331 (70%), Gaps = 45/331 (14%)
 Frame = -2

Query  966  MGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGGDGLVAARHLHYFGY  787
            MGPLGFS+DQLMELAGLS+A A+AEVY   E  R+LVICGPG+NGGDGLVAARHLH+FGY
Sbjct  1    MGPLGFSVDQLMELAGLSVAAAVAEVYKLGECTRVLVICGPGNNGGDGLVAARHLHHFGY  60

Query  786  ELFLCYPMQTPKHPYTGLVTQ-----------------------------------GPLS  712
            + ++CYP +TPK  Y+GL TQ                                   G   
Sbjct  61   KPYVCYPKRTPKPLYSGLCTQLESLAIPFVPVEDLPENLSEEFDIIIDAMFGFSFHGTPR  120

Query  711  PPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKL  532
            PPFD+LI RLVSL    +S ++ P IVSVDIPSGWHV+ GD+NG G +P MLVSLTAPKL
Sbjct  121  PPFDDLINRLVSLSVNGNSAKR-PAIVSVDIPSGWHVEEGDVNGGGFKPDMLVSLTAPKL  179

Query  531  CAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPEI---------YPLA  379
            CAK+F GPHHFLGGRF+PP I+ K+KL LP YPGTSMCVRIG+ P +             
Sbjct  180  CAKKFTGPHHFLGGRFVPPPILSKYKLHLPPYPGTSMCVRIGKAPSVDISTLRENYISPE  239

Query  378  LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVVSLEGVNKDGFVW  199
            LL   V  DPFDQF +WFD A+ AG++EPN MAL+T  K+GKPSSR+V L+GV+K GFVW
Sbjct  240  LLENQVMPDPFDQFARWFDEAVTAGLREPNAMALTTANKEGKPSSRMVLLKGVDKQGFVW  299

Query  198  YTSYESRKAREISENPHASLLFYWSCLNCQV  106
            YT+Y S+KA ++SENP+A+LLFYW+ +N QV
Sbjct  300  YTNYGSQKAHDLSENPNAALLFYWNEMNRQV  330



>emb|CDP16400.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 228/326 (70%), Gaps = 44/326 (13%)
 Frame = -2

Query  951  FSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGGDGLVAARHLHYFGYELFLC  772
            + ++ L ELAGLS+ATAIAEVY   E  R+L ICGPG+NGGDGLVAARHL++FGY+ ++C
Sbjct  59   WCVENLQELAGLSVATAIAEVYKSSERSRVLAICGPGNNGGDGLVAARHLYHFGYKPYIC  118

Query  771  YPMQTPKHPYTGLVTQ-----------------------------------GPLSPPFDE  697
            YP +T K  Y GLVTQ                                   G   PPFD+
Sbjct  119  YPKRTAKPLYNGLVTQLESLSVPFLSVEDLPMNLSDSFDILVDAMFGFSFHGTPRPPFDD  178

Query  696  LIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKLCAKRF  517
            LI+RL++L +P  +  + P IVSVDIPSGWHV+ GD++G+GI+P MLVSLTAPKLCAK+F
Sbjct  179  LIRRLLNLTSPDMNASRLPAIVSVDIPSGWHVEEGDLSGDGIKPDMLVSLTAPKLCAKKF  238

Query  516  YGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPEIYPLA---------LLGMH  364
             G HHFLGGRFIPP+I+DKF+L LP YPGTSMCVRIG+PP +   A         LL   
Sbjct  239  TGQHHFLGGRFIPPAIIDKFRLQLPAYPGTSMCVRIGKPPRVNISALRENYVSPELLEGQ  298

Query  363  VEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVVSLEGVNKDGFVWYTSYE  184
            V++DPFDQF+KWFD AL AG+KEPN M LST   D KPSSR V L+G NKDGFVWYT+Y 
Sbjct  299  VDSDPFDQFQKWFDDALAAGLKEPNAMCLSTTGSDRKPSSRFVLLKGFNKDGFVWYTNYG  358

Query  183  SRKAREISENPHASLLFYWSCLNCQV  106
            SRKA +ISENPHA+LLFYW  LN QV
Sbjct  359  SRKAHQISENPHAALLFYWDALNRQV  384



>ref|XP_003573859.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X2 [Brachypodium distachyon]
Length=554

 Score =   375 bits (962),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 243/347 (70%), Gaps = 45/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ++YL+ ++A EID  LMGPLGFS+DQLMELAGLS+A A+ EVY   E+ R+L+ICGPG+N
Sbjct  98    VTYLSQRDAAEIDKQLMGPLGFSVDQLMELAGLSVAAAVVEVYKLSEHTRVLIICGPGNN  157

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+  +CYP +T K  Y+GLVTQ                       
Sbjct  158   GGDGLVAARHLYHFGYKPSVCYPKRTAKPLYSGLVTQLEALAIPFLPVEDLPQDLSGQFD  217

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRL+ L    DS ++ P IVSVDIPSGWHV+ GDING
Sbjct  218   IVIDAMFGFSFHGTPRPPFDDLIQRLLLLSVIGDSVKRLP-IVSVDIPSGWHVEEGDING  276

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I+ K+ L LP YPGTSMCVR+G+ 
Sbjct  277   GGIKPDMLVSLTAPKLCAKKFNGPHHFLGGRFVPPPILRKYGLELPPYPGTSMCVRVGKA  336

Query  399   PEIYPLALLGMHVEAD---------PFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +   +L   ++  +         PF+QF +WF+ A+ AG++EPN MAL+T  K GKPS
Sbjct  337   PSVDISSLRENYISPELTENQVMPCPFNQFHRWFNEAVTAGLREPNAMALTTVNKAGKPS  396

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K GFVWYT+Y S+KA ++SEN +A+LLFYW+ +N QV
Sbjct  397   SRMVLLKGVDKHGFVWYTNYGSQKAHDLSENSNAALLFYWNEMNRQV  443



>gb|EMS63931.1| Apolipoprotein A-I-binding protein [Triticum urartu]
Length=330

 Score =   367 bits (941),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 189/331 (57%), Positives = 232/331 (70%), Gaps = 45/331 (14%)
 Frame = -2

Query  966  MGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGGDGLVAARHLHYFGY  787
            MGPLGFS+DQLMELAGLS+ATA+AEVY   E+ R+L+ICGPG+NGGDGLVAARHL++FGY
Sbjct  1    MGPLGFSVDQLMELAGLSVATAVAEVYKLSEHTRVLIICGPGNNGGDGLVAARHLYHFGY  60

Query  786  ELFLCYPMQTPKHPYTGLVTQ-----------------------------------GPLS  712
            + F+CYP +T K  Y+GLVTQ                                   G   
Sbjct  61   KPFVCYPKRTAKPLYSGLVTQLESLAIPFVPVEDLPQDLSGQYDIVIDAMFGFSFHGAPR  120

Query  711  PPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKL  532
            PPFD+LIQ LVSL    DS ++ P IVSVDIPSGWHV+ GD++G GI+P MLVSLTAPKL
Sbjct  121  PPFDDLIQMLVSLSVIGDSAKRPP-IVSVDIPSGWHVEEGDVSGGGIKPDMLVSLTAPKL  179

Query  531  CAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPEI---------YPLA  379
            CAK+F GPHHFLGGRF+PP I  K+ L LP YPGTSMCVRIG+ P +             
Sbjct  180  CAKKFTGPHHFLGGRFVPPPISSKYGLELPPYPGTSMCVRIGKVPSVDISSLRENYISPE  239

Query  378  LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVVSLEGVNKDGFVW  199
            LL   V  +PFDQF+ WFD A+ AG++EPN MAL+T  K GKPSSR+V L+GV+K GFVW
Sbjct  240  LLETQVMPNPFDQFRTWFDEAVTAGLREPNAMALTTVNKAGKPSSRMVLLKGVDKQGFVW  299

Query  198  YTSYESRKAREISENPHASLLFYWSCLNCQV  106
            YT+Y S+KA ++SEN +A+LLFYW+ +N Q+
Sbjct  300  YTNYGSQKAHDLSENSNAALLFYWNEMNRQL  330



>ref|XP_010234690.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X1 [Brachypodium distachyon]
Length=564

 Score =   375 bits (962),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 243/347 (70%), Gaps = 45/347 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ++YL+ ++A EID  LMGPLGFS+DQLMELAGLS+A A+ EVY   E+ R+L+ICGPG+N
Sbjct  98    VTYLSQRDAAEIDKQLMGPLGFSVDQLMELAGLSVAAAVVEVYKLSEHTRVLIICGPGNN  157

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+  +CYP +T K  Y+GLVTQ                       
Sbjct  158   GGDGLVAARHLYHFGYKPSVCYPKRTAKPLYSGLVTQLEALAIPFLPVEDLPQDLSGQFD  217

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LIQRL+ L    DS ++ P IVSVDIPSGWHV+ GDING
Sbjct  218   IVIDAMFGFSFHGTPRPPFDDLIQRLLLLSVIGDSVKRLP-IVSVDIPSGWHVEEGDING  276

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              GI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I+ K+ L LP YPGTSMCVR+G+ 
Sbjct  277   GGIKPDMLVSLTAPKLCAKKFNGPHHFLGGRFVPPPILRKYGLELPPYPGTSMCVRVGKA  336

Query  399   PEIYPLALLGMHVEAD---------PFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +   +L   ++  +         PF+QF +WF+ A+ AG++EPN MAL+T  K GKPS
Sbjct  337   PSVDISSLRENYISPELTENQVMPCPFNQFHRWFNEAVTAGLREPNAMALTTVNKAGKPS  396

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             SR+V L+GV+K GFVWYT+Y S+KA ++SEN +A+LLFYW+ +N QV
Sbjct  397   SRMVLLKGVDKHGFVWYTNYGSQKAHDLSENSNAALLFYWNEMNRQV  443



>ref|XP_011071780.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=439

 Score =   370 bits (950),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 195/348 (56%), Positives = 229/348 (66%), Gaps = 56/348 (16%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M     ISYLT Q+A EID LLMG LGFSIDQLMELAGLS+A+A+AEVY P EY R+LVI
Sbjct  1     MNEQESISYLTQQQAAEIDDLLMGNLGFSIDQLMELAGLSVASAVAEVYKPSEYNRVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVT------------------  727
             CGPG+NGGDGLVAARHLH+FGY+  + YP +TPK  Y GLVT                  
Sbjct  61    CGPGNNGGDGLVAARHLHHFGYKPSIWYPKRTPKPLYAGLVTQLESLSVPFISIDSLPQE  120

Query  726   ----------------QGPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDG  595
                             QG   PPFD+LI  + SL      H+KSPVIVSVDIPSGWHV+ 
Sbjct  121   FLNFDIIVDAIFGFSFQGNPRPPFDDLIMSMASLSAHYPEHQKSPVIVSVDIPSGWHVED  180

Query  594   GDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             GD +G+G RP MLVSLTAPKLCA+ F G +HFLGGRF+PPS++ K+KL LP YPGT+MCV
Sbjct  181   GDRSGDGTRPDMLVSLTAPKLCARTFSGRYHFLGGRFVPPSVMQKYKLRLPKYPGTAMCV  240

Query  414   RIGRPPEI-----YPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             +IG   +I      P   L  +VEADPF QF+KWFD A+  G+K+P+ MALST  KDGKP
Sbjct  241   QIGNSCQIKVEDPVPAKFLQKNVEADPFLQFQKWFDDAVATGLKDPDAMALSTANKDGKP  300

Query  249   SSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
              S                 +Y SRK  EI+ENPHASLLFYW+ LN QV
Sbjct  301   CS-----------------NYGSRKGHEIAENPHASLLFYWNTLNRQV  331



>gb|EMT04755.1| Apolipoprotein A-I-binding protein [Aegilops tauschii]
Length=464

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 232/331 (70%), Gaps = 45/331 (14%)
 Frame = -2

Query  966  MGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGGDGLVAARHLHYFGY  787
            MGPLGFS+DQLMELAGLS+ATA+AEVY   E+ R+L+ICGPG+NGGDGLVAARHL++FGY
Sbjct  1    MGPLGFSVDQLMELAGLSVATAVAEVYKLSEHTRVLIICGPGNNGGDGLVAARHLYHFGY  60

Query  786  ELFLCYPMQTPKHPYTGLVTQ-----------------------------------GPLS  712
            + F+CYP +T K  Y+GLVTQ                                   G   
Sbjct  61   KPFVCYPKRTAKPLYSGLVTQLESLAIPFVPVEDLPQDLSGQYDIVIDAMFGFSFHGTPR  120

Query  711  PPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKL  532
            PPFD+LIQ LVSL    DS ++ P IVSVDIPSGWHV+ GD++G GI+P MLVSLTAPKL
Sbjct  121  PPFDDLIQMLVSLSVVGDSAKRPP-IVSVDIPSGWHVEEGDVSGGGIKPDMLVSLTAPKL  179

Query  531  CAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPEI---------YPLA  379
            CAK+F GPHHFLGGRF+PP I  K+ L LP YPGTSMCVRIG+ P +             
Sbjct  180  CAKKFTGPHHFLGGRFVPPPISSKYGLELPPYPGTSMCVRIGKVPSVDISSLRENYISPE  239

Query  378  LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVVSLEGVNKDGFVW  199
            LL   V  +PFDQF+ WFD A+ AG++EPN MAL+T  K GKPSSR+V L+GV+K GFVW
Sbjct  240  LLENQVMPNPFDQFRSWFDEAVTAGLREPNAMALTTVNKAGKPSSRMVLLKGVDKQGFVW  299

Query  198  YTSYESRKAREISENPHASLLFYWSCLNCQV  106
            YT+Y S+KA ++SEN +A+LLFYW+ +N QV
Sbjct  300  YTNYGSQKAHDLSENSNAALLFYWNEMNRQV  330



>ref|XP_002964596.1| hypothetical protein SELMODRAFT_81184 [Selaginella moellendorffii]
 gb|EFJ34929.1| hypothetical protein SELMODRAFT_81184 [Selaginella moellendorffii]
Length=447

 Score =   358 bits (919),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 232/347 (67%), Gaps = 54/347 (16%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL+   A  ID  LMGPLGFS+DQLMELAGLS+A+AIAEVY+  ++ R+L++CGPG+N
Sbjct  15    ISYLSQSSAIGIDEHLMGPLGFSVDQLMELAGLSVASAIAEVYSSLDHARVLLLCGPGNN  74

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+  + YP +T K  Y GLVTQ                       
Sbjct  75    GGDGLVAARHLHHFGYKPSIVYPKRTDKPLYHGLVTQLESLSVPFLSHEDLPSELSSGYD  134

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G  +PPFD+L+Q L           ++P +VSVD+PSGWHV+ GD+NG
Sbjct  135   IVVDAMFGFSFKGKNAPPFDKLVQLLT----------RTPNVVSVDVPSGWHVEEGDVNG  184

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              G+ P MLVSLTAPKLCAK F GPHHFLGGRF+PP++V+KF L LP YPGTS CVRIGR 
Sbjct  185   LGLNPDMLVSLTAPKLCAKMFKGPHHFLGGRFVPPAVVNKFNLKLPPYPGTSQCVRIGRT  244

Query  399   PEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +   A         LL   V +DP  QFK+WF+ A+ AG+ EPN M L+T   +G+PS
Sbjct  245   PHVDVAALRENYVGSVLLENQVNSDPIQQFKEWFEDAVAAGLPEPNAMTLATADAEGRPS  304

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             +R+V L+G +  GFVWYT+Y+SRKA E++ NP+ASL+F+W  L+ QV
Sbjct  305   ARMVLLKGYDARGFVWYTNYDSRKANELNSNPNASLVFFWDRLHRQV  351



>gb|KJB59898.1| hypothetical protein B456_009G279800 [Gossypium raimondii]
Length=426

 Score =   357 bits (917),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 221/322 (69%), Gaps = 52/322 (16%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYLT +EA E+D  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICGPG+N
Sbjct  79    ISYLTQREAAEVDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYNRVLAICGPGNN  138

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL++FGY+ F+CYP +T K  Y+GLVTQ                       
Sbjct  139   GGDGLVAARHLYHFGYKPFVCYPKRTQKPLYSGLVTQLESLSIPFLSVDELPMDLSKDFD  198

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G   PPFD+LI++L++L     + RKSPVIVSVDIPSGWHV+ GD+ G
Sbjct  199   ILVDAMFGFSFHGAPRPPFDDLIKKLINLHYYEQAQRKSPVIVSVDIPSGWHVEEGDVGG  258

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
             +GI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP+I +K+KL LP YPG SMCVRIG+P
Sbjct  259   DGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPAIAEKYKLQLPQYPGMSMCVRIGKP  318

Query  399   PEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP-  250
             P+I   AL         L   VEADP DQF+KWFD A+ A +KEPN MALST  KDGKP 
Sbjct  319   PQIDISALRENYISPEFLEEQVEADPLDQFRKWFDDAMAANLKEPNAMALSTTGKDGKPH  378

Query  249   -----SSRVVSLEGVNKDGFVW  199
                  + R  +L G+ K   +W
Sbjct  379   GFEIRALRATALNGILKK--IW  398



>ref|XP_002988799.1| hypothetical protein SELMODRAFT_159735 [Selaginella moellendorffii]
 gb|EFJ10061.1| hypothetical protein SELMODRAFT_159735 [Selaginella moellendorffii]
Length=461

 Score =   356 bits (914),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 231/347 (67%), Gaps = 54/347 (16%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ISYL+   A  ID  LMGPLGFS+DQLMELAGLS+A+AIAEVY+  ++ R+L++CGPG+N
Sbjct  15    ISYLSQSSAIGIDEHLMGPLGFSVDQLMELAGLSVASAIAEVYSSLDHARVLLLCGPGNN  74

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL +FGY+  + YP +T K  Y GLVTQ                       
Sbjct  75    GGDGLVAARHLQHFGYKPSIVYPKRTDKPLYHGLVTQLESLSVPFLSHEDLPSELSSGYD  134

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         G  +PPFD+L+Q L           ++P +VSVD+PSGWHV+ GD+NG
Sbjct  135   IVVDAMFGFSFKGKNAPPFDKLVQLLT----------RTPNVVSVDVPSGWHVEEGDVNG  184

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              G+ P MLVSLTAPKLCAK F GPHHFLGGRF+PP++V+KF L LP YPGTS CVRIGR 
Sbjct  185   LGLNPDMLVSLTAPKLCAKMFKGPHHFLGGRFVPPAVVNKFNLKLPPYPGTSQCVRIGRT  244

Query  399   PEIYPLA---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPS  247
             P +   A         LL   V +DP  QFK+WF+ A+ AG+ EPN M L+T   +G+PS
Sbjct  245   PHVDVAALRENYVGSVLLENQVNSDPIQQFKEWFEDAVAAGLPEPNAMTLATADAEGRPS  304

Query  246   SRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             +R+V L+G +  GFVWYT+Y+SRKA E++ NP+ASL+F+W  L+ QV
Sbjct  305   ARMVLLKGYDARGFVWYTNYDSRKANELNSNPNASLVFFWDRLHRQV  351



>ref|XP_006433883.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
 gb|ESR47123.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
Length=386

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 211/303 (70%), Gaps = 44/303 (15%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICG
Sbjct  79    NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYDRVLAICG  138

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHL++FGY+ F+CYP +T K  YTGLVTQ                   
Sbjct  139   PGNNGGDGLVAARHLYHFGYKPFVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  198

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     +H+K PVIVSVDIPSGWHV+ G
Sbjct  199   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTHQKRPVIVSVDIPSGWHVEEG  258

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             DI  EGI+P MLVSLTAPKLCAK+F GPHHFLGGRF+PP I DK+KL LP YPGTSMCVR
Sbjct  259   DIGDEGIKPDMLVSLTAPKLCAKKFSGPHHFLGGRFVPPVIADKYKLRLPPYPGTSMCVR  318

Query  411   IGRPPEIYPLAL---------LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKD  259
             IG+ P +   AL         L   VE+DP +QF+KWFD A+ AG++EPN MALST  KD
Sbjct  319   IGKAPSVDISALRENYISPEFLEEQVESDPINQFRKWFDDAIAAGLREPNAMALSTVGKD  378

Query  258   GKP  250
             GKP
Sbjct  379   GKP  381



>ref|XP_001782628.1| predicted protein [Physcomitrella patens]
 gb|EDQ52531.1| predicted protein [Physcomitrella patens]
Length=472

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/360 (51%), Positives = 232/360 (64%), Gaps = 51/360 (14%)
 Frame = -2

Query  1032  MGSTTP-----ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYR  868
             M S+TP     ISYL+  EA+ ID LLMG LGFSIDQLMELAGLS+A+A++EVY    YR
Sbjct  1     MASSTPHNDESISYLSQAEASAIDELLMGELGFSIDQLMELAGLSVASAVSEVYEANHYR  60

Query  867   RILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ------------  724
             R+L+ICGPG+NGGDGLVAARHL +FGY+  +CYP +T K  Y GLVTQ            
Sbjct  61    RVLIICGPGNNGGDGLVAARHLCHFGYKPTICYPKRTNKPLYQGLVTQLESLKIPFVLPE  120

Query  723   -----------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPS  613
                                    G   PPFD L+++LV+    +      P IVSVDIPS
Sbjct  121   ELPSKLKDQFDLVIDAMFGFSFHGIPRPPFDSLLRKLVAPNGKKAEEVGVPPIVSVDIPS  180

Query  612   GWHVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYP  433
             GWHV+ GD  G  +RP MLVSLTAPKLCAK F G HH++GGRF+PP+IV+KF + LP YP
Sbjct  181   GWHVENGDTEGTCLRPDMLVSLTAPKLCAKMFKGAHHYVGGRFVPPAIVEKFSVRLPSYP  240

Query  432   GTSMCVRI----GRPPEIYPL-------ALLGMHVEADPFDQFKKWFDHALVAGVKEPNY  286
             G SMCVRI     +P +I  L        LL    + DPF+QFK WFD A+   V EPN 
Sbjct  241   GHSMCVRISPTESQPVDIAALRLNYVGFELLEESAKKDPFEQFKTWFDEAVSRKVSEPNA  300

Query  285   MALSTGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             M L+T +++G+PS+R+V L+ +++ GFVWYT+Y+SRKA E+  NP A L+F+W  L+  V
Sbjct  301   MTLATASENGQPSARLVLLKALDERGFVWYTNYDSRKAAELKANPKACLVFFWEPLHRSV  360



>ref|XP_009390272.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=333

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 162/220 (74%), Gaps = 9/220 (4%)
 Frame = -2

Query  738  GLVTQGPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSM  559
            G    G   PPFD+LIQRL SL       ++S  IVSVDIPSGWHV+ GDI GEG  P M
Sbjct  3    GFSFHGQPRPPFDDLIQRLASLSRVDCGRKRSSAIVSVDIPSGWHVEEGDITGEGFEPDM  62

Query  558  LVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPEIYPLA  379
            LVSLTAPKLCAK+F GPHHFLGGRF+PPSI+ K+KL LP YPGTSMCVRIG+PP +   +
Sbjct  63   LVSLTAPKLCAKKFVGPHHFLGGRFVPPSIISKYKLKLPQYPGTSMCVRIGKPPSVDIAS  122

Query  378  ---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVVSLE  226
                     LL   V + P DQF KWFD A+ AG++EPN MALST   +GKPSSR+V L+
Sbjct  123  LRENYISPELLEDQVLSHPVDQFHKWFDEAVAAGLREPNAMALSTSGHEGKPSSRIVLLK  182

Query  225  GVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
            G +K GFVW+T+Y S+KA+E+SENPHASLLFYW+ LN QV
Sbjct  183  GADKQGFVWFTNYGSQKAKELSENPHASLLFYWNPLNRQV  222



>ref|XP_005646534.1| pyridoxamine 5'-phosphate oxidase [Coccomyxa subellipsoidea C-169]
 gb|EIE21990.1| pyridoxamine 5'-phosphate oxidase [Coccomyxa subellipsoidea C-169]
Length=465

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/360 (45%), Positives = 208/360 (58%), Gaps = 65/360 (18%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I Y    +A  ID  LMGPLGFS+DQLME+AGLS+A ++A  Y    + RILV+ GPG+N
Sbjct  5     IVYRGQDQAVAIDEELMGPLGFSVDQLMEVAGLSVACSLASEYPAASHPRILVVAGPGNN  64

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL +FGY + + YP +T K  Y GLVTQ                       
Sbjct  65    GGDGLVAARHLFHFGYSVQVLYPKKTDKPLYHGLVTQLKSCNIPFLSAEDILDGPPLKER  124

Query  723   --------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDI  586
                           G   PPFD++++RL         H + P I SVD+PSGWHV+ GD 
Sbjct  125   YDVIIDAIFGFSFKGSPRPPFDKILERL-------KPHNEPPAIASVDMPSGWHVENGDE  177

Query  585   NGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI-  409
              G+G+RP MLVSLT PK  A+ F GP H+LGGRF+PP I +K+KL LP YPGTS CV++ 
Sbjct  178   IGDGLRPEMLVSLTTPKRGAQFFEGPFHYLGGRFVPPIIKEKYKLNLPPYPGTSQCVKLS  237

Query  408   -----GRPPEIYPLA-------------LLGMHVEADPFDQFKKWFDHALVAGV-KEPNY  286
                  G   E+ P +             LL   V+ DP  QF  WF  A+ A V +EPN 
Sbjct  238   GSQAAGNNGEVDPASIRLNYSLADVSGGLLESDVDPDPLKQFDSWFKDAVEAKVLEEPNQ  297

Query  285   MALSTGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
             MAL++  + G PS R+V L+G +  GF +YT+Y+SRKA E++ N HA+L  YW  L  QV
Sbjct  298   MALASADERGVPSVRMVLLKGYDARGFAFYTNYDSRKACELA-NGHAALCMYWEPLQRQV  356



>ref|XP_005847413.1| hypothetical protein CHLNCDRAFT_134278 [Chlorella variabilis]
 gb|EFN55311.1| hypothetical protein CHLNCDRAFT_134278 [Chlorella variabilis]
Length=456

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 199/356 (56%), Gaps = 70/356 (20%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I++LT ++A ++D  LMGPLGFS+DQLMELAGLS+A+A A  Y    + R+LV+ GPG+N
Sbjct  4     ITFLTQEQAQKLDEELMGPLGFSVDQLMELAGLSVASAAATEYPVSTHPRVLVVAGPGNN  63

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY + +CYP  T +  Y GLVTQ                       
Sbjct  64    GGDGLVAARHLHHFGYSVTICYPKPTDRPLYNGLVTQCRSLGIPFVSAQDLQEVPLAERC  123

Query  723   -------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDIN  583
                          G   PPFD LI+                     D+   W+V+ GD +
Sbjct  124   DVVLDAMFGFSFKGAPRPPFDALIE----------------PACGPDLGLLWNVEAGDDS  167

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIG-  406
             GEG+RP ML+SLTAPKLCA++F G HH+LGGRF+PP I DK++L LP YPG S CVRIG 
Sbjct  168   GEGLRPDMLISLTAPKLCAQQFSGGHHYLGGRFVPPQIRDKYRLQLPPYPGVSQCVRIGG  227

Query  405   --RPPEIYPLALLGMHV----------EAD-----PFDQFKKWFDHALVAGVKEPNYMAL  277
               R     P  +  M +          EAD     P ++F  WF  A   G+KEPN  AL
Sbjct  228   SARCAAAGPANVADMRMTYGTAGQSLDEADMATAGPIEEFDAWFKLAASCGLKEPNATAL  287

Query  276   STGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQ  109
             +T    G+ S R V L+G +  GFVWYT+Y+S K  ++  N  A+L F+W  L  Q
Sbjct  288   ATSDAAGRVSVRYVLLKGFDSRGFVWYTNYDSFKGHQLEANSSAALAFWWEPLQRQ  343



>gb|ABK24840.1| unknown [Picea sitchensis]
Length=333

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 152/220 (69%), Gaps = 9/220 (4%)
 Frame = -2

Query  738  GLVTQGPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSM  559
            G    G   PPFD LI+RL         +   PVIVSVDIPSGWHV+ GDI G G+RP M
Sbjct  3    GFSFHGTPRPPFDALIRRLAVPSGFTRENCGLPVIVSVDIPSGWHVEQGDIEGTGLRPDM  62

Query  558  LVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPEIYPLA  379
            LVSLTAPKLCA++    HHFLGGRF+PP +  K+ L LP YPGT+MCVRIG+P  +   +
Sbjct  63   LVSLTAPKLCARKLTASHHFLGGRFVPPELAKKYSLQLPKYPGTAMCVRIGKPLSVDVAS  122

Query  378  ---------LLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVVSLE  226
                     LL  +V+ DP  QF++WFD A+ AG++EPN MAL+T  KDG PS R+V L+
Sbjct  123  LRENYVSPELLEENVKDDPIKQFQEWFDDAVAAGLREPNAMALATADKDGHPSERMVLLK  182

Query  225  GVNKDGFVWYTSYESRKAREISENPHASLLFYWSCLNCQV  106
            G ++ GFVWYT+YESRKA EI ENP+ASLLF+W  L+ QV
Sbjct  183  GFDEHGFVWYTNYESRKAHEIHENPYASLLFFWEALHRQV  222



>ref|XP_011400606.1| Pyridoxine/pyridoxamine 5'-phosphate oxidase [Auxenochlorella 
protothecoides]
 gb|KFM27622.1| Pyridoxine/pyridoxamine 5'-phosphate oxidase [Auxenochlorella 
protothecoides]
Length=477

 Score =   253 bits (645),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 193/364 (53%), Gaps = 61/364 (17%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ++YL+  +A  ID  LMGP GFS+DQLMELAGLS+A ++A  Y    + R+LV+ GPG+N
Sbjct  1     MAYLSKADAAAIDAELMGPGGFSLDQLMELAGLSVACSLAAEYPAATHPRVLVLAGPGNN  60

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL +FGYE+ + YP  T + P+ GLVTQ                       
Sbjct  61    GGDGLVAARHLRHFGYEVAVAYPRPTQRPPFQGLVTQLRRAGARLVPVEDLGPDAHAWPA  120

Query  723   -------------GPLSPPFDELIQRLVSLKNPRDSH--------RKSPVIVSVDIPSGW  607
                          GPL PPFD L+  L +                R  P +VS+D+PSGW
Sbjct  121   DVVLDGLFGFSFRGPLRPPFDALVAALAAGAGAAARATGAGDAVLRPCPALVSIDVPSGW  180

Query  606   HVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLG-LPLYPG  430
              V+ GD  G G+RP MLVSLTAPK CA RF G HH+LGGRF+ P +  ++ L  LP +PG
Sbjct  181   DVEAGDEAGHGLRPDMLVSLTAPKRCAARFAGAHHYLGGRFLTPDLAARYGLADLPPFPG  240

Query  429   TSMCVRI---------------GRPPEIYPLALLGMHVEADPFDQFKKWFDHALV-AGVK  298
             T                     G         L      ADP   F++WF  A    GV 
Sbjct  241   TQHAPAPAPAPPTTASPHADLPGMRQSYTAGTLEESDAPADPLALFQRWFGDARAHPGVA  300

Query  297   EPNYMALSTGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLFYWSCL  118
             EPN M LST      PS+RVV L+G++  GF ++T+Y SRK  E+  NP A+L F+W  L
Sbjct  301   EPNAMVLSTLGAGSAPSARVVLLKGLDSRGFAFFTNYASRKGTELDANPAAALTFFWEPL  360

Query  117   NCQV  106
               QV
Sbjct  361   QRQV  364



>ref|XP_006345006.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic-like 
isoform X4 [Solanum tuberosum]
Length=392

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 180/321 (56%), Gaps = 61/321 (19%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVI  853
             M S   ISY++ QEA EID +LM PLGF++DQLMELAGLS+A+AI EVY+P EY  +LVI
Sbjct  1     MESKEEISYVSQQEAIEIDQMLMSPLGFTVDQLMELAGLSVASAIGEVYSPSEYTHVLVI  60

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPLSPPFDELIQRLVSL  673
             CGPG+NGGDGLVAARHLH+FGY+  +CYP +  +             PPF  L+ +L SL
Sbjct  61    CGPGNNGGDGLVAARHLHHFGYKPSICYPKRNTE-------------PPFAGLVTQLESL  107

Query  672   KNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKLCAKRFYG----PH  505
               P       PV +S D                        +    +    F+G    P 
Sbjct  108   SVPFLPVEDLPVQLSSDF----------------------EIIVDAIFGFSFHGNLRPPF  145

Query  504   HFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPEIYPLALLGMHVEA--------DP  349
               L  R +        K     +   ++ + +  P         G HVE         +P
Sbjct  146   DSLIRRMV------SIKTQQRTHEIAAVVISVDIP--------FGWHVEEGDICGEGIEP  191

Query  348   FDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAR  169
                F+KW   AL AGVKEP+YM LST  KD KPSSR+VSLEGVNKDGFVW+T+Y S+KAR
Sbjct  192   DMLFQKWLGDALEAGVKEPHYMVLSTAGKDAKPSSRMVSLEGVNKDGFVWHTNYRSQKAR  251

Query  168   EISENPHASLLFYWSCLNCQV  106
             EISENPHASLLFYW  + CQV
Sbjct  252   EISENPHASLLFYWGPIKCQV  272



>gb|KHN09005.1| NAD(P)H-hydrate epimerase [Glycine soja]
Length=342

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/296 (47%), Positives = 166/296 (56%), Gaps = 78/296 (26%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             ++YLT ++A EID  LMGPLGFS+DQLMEL  LS+AT+I+EVY P E+ R+L ICGPG+N
Sbjct  9     VTYLTQRDAAEIDETLMGPLGFSVDQLMELDVLSVATSISEVYKPCEHSRVLTICGPGNN  68

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHLH+FGY+ F+CYP +TPK  Y GLVTQ                       
Sbjct  69    GGDGLVAARHLHHFGYKPFVCYPKRTPKPLYAGLVTQLEALSIPFLSVEELPSDLSNDFD  128

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDS-HRKSPVIVSVDIPSGWHVDGGDIN  583
                         G   PPFD+LIQRLVSL N  +   +K  VIVSVDIPSGWHV+ GD++
Sbjct  129   VVIDAMFGFSFHGSPRPPFDDLIQRLVSLHNNNNQIGQKRSVIVSVDIPSGWHVEEGDVD  188

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGR  403
             G GI+P ML                         PP I                 +   R
Sbjct  189   GTGIKPDML-------------------------PPQID----------------ISALR  207

Query  402   PPEIYPLALLGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKPSSRVV  235
                I P   L   VE DP +QF KWFD AL AG+KEPN MALST  KDGKP++  +
Sbjct  208   ENYISP-EFLEEQVEVDPINQFHKWFDDALAAGLKEPNAMALSTVGKDGKPTAEAM  262



>ref|XP_002509162.1| pyridoxal 5'-phosphate synthase [Micromonas sp. RCC299]
 gb|ACO70420.1| pyridoxal 5'-phosphate synthase [Micromonas sp. RCC299]
Length=288

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 154/240 (64%), Gaps = 45/240 (19%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGP-LGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             +S+++  +A EID  LMGP  GFSIDQLMELAGLS+A+A+ EVY P+ + R+LV+CGPG+
Sbjct  6     VSFVSAAQAKEIDEKLMGPEFGFSIDQLMELAGLSVASALCEVYPPRSHSRVLVLCGPGN  65

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------------  724
             NGGDGLVAARHL +FGYE+ +CYP +T +  Y GLVTQ                      
Sbjct  66    NGGDGLVAARHLFHFGYEVEVCYPKRTDRPIYNGLVTQLSTLGIPFVDAETLRGGDPLVT  125

Query  723   ---------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGD  589
                            G    PFD L++ L    NP   H   P IV+VDIPSGW VD GD
Sbjct  126   TCDVVVDALFGFSFTGAPRAPFDALLELL----NP---HNSPPPIVAVDIPSGWSVDEGD  178

Query  588   INGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              +GEG+RP +LVSLTAPKL AK F GPHHF+GGRF+PP+I ++F+L LP Y G+  C R+
Sbjct  179   ESGEGMRPELLVSLTAPKLGAKTFKGPHHFVGGRFVPPAIAEEFELVLPQYMGSDQCARV  238



>ref|XP_005841510.1| hypothetical protein GUITHDRAFT_156874 [Guillardia theta CCMP2712]
 gb|EKX54530.1| hypothetical protein GUITHDRAFT_156874 [Guillardia theta CCMP2712]
Length=233

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 146/236 (62%), Gaps = 46/236 (19%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             S   +++L   +A EID  LMGPLGFSIDQLMELAGLS+ATA +E Y  +  +RILV+CG
Sbjct  4     SLQDLAFLEASKAAEIDEKLMGPLGFSIDQLMELAGLSVATATSE-YCAQNLQRILVVCG  62

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHL++FGY+  +CYP QT K  Y GLVTQ                   
Sbjct  63    PGNNGGDGLVAARHLYHFGYKPVVCYPKQTAKPLYQGLVTQLASLDVPVLQELPSAEAIE  122

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G +  PF ++I  L  +  P         IVSVD+PSGW V+ G
Sbjct  123   RDFDVVVDAIFGFSFKGEIRAPFADIISTLKKISKP---------IVSVDVPSGWDVNEG  173

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTS  424
             +  G G+ P++L+SLTAPKLCAK F G HHFLGGRF+PP+I D+F L LP YPG S
Sbjct  174   NKGGVGLEPAVLISLTAPKLCAKHFKG-HHFLGGRFVPPAIRDEFGLKLPTYPGLS  228



>gb|ESA19734.1| hypothetical protein GLOINDRAFT_133680 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX66829.1| NADHX epimerase [Rhizophagus irregularis DAOM 197198w]
Length=237

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 143/240 (60%), Gaps = 43/240 (18%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + +LT + A  ID  L    GFS+DQLMELAGLS+A AI +VY+  +Y R+L+ CGPG+N
Sbjct  3     LKFLTQKIAQAIDEELFSSGGFSVDQLMELAGLSVAQAITKVYDNSKYSRVLICCGPGNN  62

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL +FGY+  + YP Q+ K  Y  LV Q                       
Sbjct  63    GGDGLVAARHLFHFGYKPNIFYPKQSKKELYERLVIQCQSLEIPIVTELSNSSLTNDNDL  122

Query  723   -----------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGE  577
                        G + PPFDE+IQ+L             P IVSVDIPSGW V+ G++N  
Sbjct  123   IVDALFGFSFTGEIRPPFDEVIQKL--------KVTNIPPIVSVDIPSGWDVEKGNVNNH  174

Query  576   GIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPP  397
             G++PSML+SLTAPKLCA  F G  HFLGGRFIPP + +K++L LPLYPGT   V I   P
Sbjct  175   GLKPSMLISLTAPKLCANYFNG-KHFLGGRFIPPGLKEKYELNLPLYPGTDQVVDITDLP  233



>gb|KDO81093.1| hypothetical protein CISIN_1g0369522mg, partial [Citrus sinensis]
Length=166

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 122/163 (75%), Gaps = 9/163 (6%)
 Frame = -2

Query  711  PPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKL  532
            PPFD+LI+RL+ L     + +K PVIVSVDIPSGWHV+ GDI  EGI+P MLVSLTAPKL
Sbjct  4    PPFDDLIKRLLCLHGYDQTRQKRPVIVSVDIPSGWHVEEGDIGDEGIKPDMLVSLTAPKL  63

Query  531  CAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRPPEIYPLAL--------  376
            CAK+  GPHHFLGGRF+PP I DK+KL LP YPGTSMCVRIG+ P +   AL        
Sbjct  64   CAKKSSGPHHFLGGRFVPPVIADKYKLRLPPYPGTSMCVRIGKAPSVDISALRENYISPE  123

Query  375  -LGMHVEADPFDQFKKWFDHALVAGVKEPNYMALSTGTKDGKP  250
             L   VE+DP +QF+KWFD A+ AG++EPN MALST  KDGKP
Sbjct  124  FLEEQVESDPINQFRKWFDDAIAAGLREPNAMALSTVGKDGKP  166



>ref|XP_001694250.1| hypothetical protein CHLREDRAFT_103444 [Chlamydomonas reinhardtii]
 gb|EDP02683.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=466

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 186/369 (50%), Gaps = 85/369 (23%)
 Frame = -2

Query  1002  THQEATEIDHLLMGP-LGFSIDQLMELAGLSIATAIAEVYNPK---EYRRILVICGPGSN  835
             + ++A  +D  LMGP LGFS+DQLMELAGLS+A A+   Y P+    +RR+LV+CGPG+N
Sbjct  1     SQKDAIAVDEHLMGPDLGFSVDQLMELAGLSVAAAVQAEYPPEGAPRWRRVLVLCGPGNN  60

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----PLSP-------------  709
             GGDGLVAARHL++FGY++ +CYP  T K  Y GLV Q      PL P             
Sbjct  61    GGDGLVAARHLYHFGYDVRVCYPKPTDKPLYNGLVKQVTTLGIPLVPWAELEAAAAAGPG  120

Query  708   -------------------------------PFDELIQRLVSLKNPRDSHRKSPVIVSVD  622
                                            PFD +I+ L+    P       P IVSVD
Sbjct  121   GGGGGGGGLASQADLVIDALFGFSFSGAPRAPFDAIIKALLPAAGP-------PPIVSVD  173

Query  621   IPSGWHVDGGDIN---GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKL  451
             IPSGW V+ GD     G+ I+P+MLVSLTAPK+CA RF G HH+LGGRF+PP + ++F L
Sbjct  174   IPSGWDVERGDEAAGPGQAIQPAMLVSLTAPKMCAARFKGEHHYLGGRFVPPPLAERFHL  233

Query  450   -GLPLYPGTSMCVRIG--------RPPEIYPLALLGMHVEA-----DPFDQFKKWFDHAL  313
              GLP YPG +M VR+G                  +   +EA     DP   F +WF  A+
Sbjct  234   TGLPRYPGAAMTVRLGGAAAESAAAESAAAEAKRVRWRLEADFAGRDPMALFDEWFKAAV  293

Query  312   VAGVKEPNYMALSTGTKDGKPSSRVVSLEGVNKDGFVWYTSYESRKAREISENPHASLLF  133
                V+E    A                        FV+YT+Y SRK  +++    A+   
Sbjct  294   AGKVREHRAAAGRREGGREGGREEREC--------FVFYTNYSSRKGSDLAATGKAAFAI  345

Query  132   YWSCLNCQV  106
             Y+  L  Q+
Sbjct  346   YYEKLQRQI  354



>ref|XP_006433882.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
 gb|ESR47122.1| hypothetical protein CICLE_v10000790mg [Citrus clementina]
Length=270

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 129/193 (67%), Gaps = 35/193 (18%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICG  847
             ++  +S+LT +EA EID  LMGPLGFS+DQLMELAGLS+AT+IAEVY P EY R+L ICG
Sbjct  6     NSDSVSHLTQREAAEIDETLMGPLGFSVDQLMELAGLSVATSIAEVYKPSEYDRVLAICG  65

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHL++FGY+ F+CYP +T K  YTGLVTQ                   
Sbjct  66    PGNNGGDGLVAARHLYHFGYKPFVCYPKRTQKPLYTGLVTQLESLSIPFLSVEDLPLDFS  125

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             G   PPFD+LI+RL+ L     +H+K PVIVSVDIPSGWHV+ G
Sbjct  126   KDFDIIVDAMFGFSFHGTPRPPFDDLIKRLLCLHGYDQTHQKRPVIVSVDIPSGWHVEEG  185

Query  591   DINGEGIRPSMLV  553
             DI  EGI+P MLV
Sbjct  186   DIGDEGIKPDMLV  198



>emb|CBN77089.1| pyridoxamine 5-phosphate oxidase, putative [Ectocarpus siliculosus]
Length=256

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 138/236 (58%), Gaps = 44/236 (19%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             IS LT +++  +D  LM   GFSIDQLMELAGLS+A AIA+VY P    R+L++CGPG+N
Sbjct  13    ISLLTAEDSAALDADLMSTPGFSIDQLMELAGLSVACAIAKVYPPPS--RVLIVCGPGNN  70

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------------  724
             GGDGLVAARHL  FGY     YP  T +  +T LV Q                       
Sbjct  71    GGDGLVAARHLWQFGYRPTCLYPKPTARQLFTNLVEQCKQLDIEFLPSWEAAGDLGSYDV  130

Query  723   -----------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGE  577
                        G   PPFD +++ L        S   +  +VSVD+PSGW VD GD  G 
Sbjct  131   VLDAMFGFGFKGDPRPPFDTILKDL--------SKSGATPVVSVDVPSGWSVDEGDSKGG  182

Query  576   GIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             G++P ML+SLTAPKL A+ F GPHHFLGGRF+PP I  K+ L LP YPG+  CVR+
Sbjct  183   GLKPEMLISLTAPKLSARFFEGPHHFLGGRFVPPGIASKYSLELPAYPGSEQCVRL  238



>ref|XP_011293548.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X2 [Musca domestica]
Length=229

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 137/230 (60%), Gaps = 28/230 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  QEA  +D  L     FS+DQLMELAGLS + AIA+ Y   +Y R+LV CGPG+N
Sbjct  1     MKYLNQQEAINVDQDLFNDYKFSVDQLMELAGLSCSHAIAKCYAAPQYARVLVCCGPGNN  60

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGP---------------LSPPFD  700
             GGDGLV ARHL   GY+  + YP  TP   Y  L  Q                 +S  +D
Sbjct  61    GGDGLVCARHLSLMGYKPRIYYPKPTPNPLYENLTHQCKSMNIEFVDATPDLENISQQYD  120

Query  699   ELIQRL--VSLKNP-RDS---------HRKSPVIVSVDIPSGWHVDGGDINGEGIRPSML  556
              ++  L   S K P R++         + K P I S+DIPSGWHV+ G  N     PS+L
Sbjct  121   LIVDALFGFSFKPPVRETFVSIINVLQNTKLP-IASIDIPSGWHVENGKNNECDFEPSLL  179

Query  555   VSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIG  406
             +SLTAPKLCAK + GPHH+LGGRF+PP++ +K++L LP YPGT  CV++ 
Sbjct  180   ISLTAPKLCAKFYKGPHHYLGGRFVPPALREKYQLDLPEYPGTETCVKLS  229



>ref|XP_005185985.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Musca domestica]
Length=257

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 137/230 (60%), Gaps = 28/230 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  QEA  +D  L     FS+DQLMELAGLS + AIA+ Y   +Y R+LV CGPG+N
Sbjct  29    MKYLNQQEAINVDQDLFNDYKFSVDQLMELAGLSCSHAIAKCYAAPQYARVLVCCGPGNN  88

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGP---------------LSPPFD  700
             GGDGLV ARHL   GY+  + YP  TP   Y  L  Q                 +S  +D
Sbjct  89    GGDGLVCARHLSLMGYKPRIYYPKPTPNPLYENLTHQCKSMNIEFVDATPDLENISQQYD  148

Query  699   ELIQRL--VSLKNP-RDS---------HRKSPVIVSVDIPSGWHVDGGDINGEGIRPSML  556
              ++  L   S K P R++         + K P I S+DIPSGWHV+ G  N     PS+L
Sbjct  149   LIVDALFGFSFKPPVRETFVSIINVLQNTKLP-IASIDIPSGWHVENGKNNECDFEPSLL  207

Query  555   VSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIG  406
             +SLTAPKLCAK + GPHH+LGGRF+PP++ +K++L LP YPGT  CV++ 
Sbjct  208   ISLTAPKLCAKFYKGPHHYLGGRFVPPALREKYQLDLPEYPGTETCVKLS  257



>ref|XP_002055771.1| GJ19543 [Drosophila virilis]
 gb|EDW65972.1| GJ19543 [Drosophila virilis]
Length=246

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 136/231 (59%), Gaps = 26/231 (11%)
 Frame = -2

Query  1023  TTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGP  844
             ++ + YL   EA  +D  L     FS+DQLMELAGLS A A+A+ +  K++ R+LV CGP
Sbjct  16    SSMLKYLNQSEAINVDLELFNEYKFSVDQLMELAGLSCAHAVAKCFPAKDFARVLVCCGP  75

Query  843   GSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGL-----------VTQGP----LSP  709
             G+NGGDGLV ARHL   GY   + YP  TPK  Y  L           +T+ P     + 
Sbjct  76    GNNGGDGLVCARHLALMGYTPAIYYPKPTPKPLYENLAHQCQRMEICSITECPRVEEAAD  135

Query  708   PFDELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPS  562
              +D ++  L   S K P  +   S V         I SVDIPSGW V+ G +N   + P+
Sbjct  136   SYDLIVDALFGFSFKPPVRADFVSVVELLQQTKLPIASVDIPSGWDVEQGKLNDCDLEPT  195

Query  561   MLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             +L+SLTAPKLCAK F G HHFLGGRF+PP++  K++L LP YPG  +C+ +
Sbjct  196   LLISLTAPKLCAKHFKGKHHFLGGRFVPPALQRKYELNLPAYPGNELCLEL  246



>sp|B4M2R8.2|NNRE_DROVI RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Drosophila virilis]
Length=229

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 134/228 (59%), Gaps = 26/228 (11%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL   EA  +D  L     FS+DQLMELAGLS A A+A+ +  K++ R+LV CGPG+N
Sbjct  2     LKYLNQSEAINVDLELFNEYKFSVDQLMELAGLSCAHAVAKCFPAKDFARVLVCCGPGNN  61

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGL-----------VTQGP----LSPPFD  700
             GGDGLV ARHL   GY   + YP  TPK  Y  L           +T+ P     +  +D
Sbjct  62    GGDGLVCARHLALMGYTPAIYYPKPTPKPLYENLAHQCQRMEICSITECPRVEEAADSYD  121

Query  699   ELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              ++  L   S K P  +   S V         I SVDIPSGW V+ G +N   + P++L+
Sbjct  122   LIVDALFGFSFKPPVRADFVSVVELLQQTKLPIASVDIPSGWDVEQGKLNDCDLEPTLLI  181

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SLTAPKLCAK F G HHFLGGRF+PP++  K++L LP YPG  +C+ +
Sbjct  182   SLTAPKLCAKHFKGKHHFLGGRFVPPALQRKYELNLPAYPGNELCLEL  229



>ref|XP_008891775.1| YjeF family domain-containing protein [Phytophthora parasitica 
INRA-310]
 gb|ETI50030.1| YjeF family domain-containing protein [Phytophthora parasitica 
P1569]
 gb|ETK89938.1| YjeF family domain-containing protein [Phytophthora parasitica]
 gb|ETL43336.1| YjeF family domain-containing protein [Phytophthora parasitica]
 gb|ETL96528.1| YjeF family domain-containing protein [Phytophthora parasitica]
 gb|ETM49684.1| YjeF family domain-containing protein [Phytophthora parasitica]
 gb|ETN22529.1| YjeF family domain-containing protein [Phytophthora parasitica 
INRA-310]
 gb|ETO78795.1| YjeF family domain-containing protein [Phytophthora parasitica 
P1976]
 gb|ETP19819.1| YjeF family domain-containing protein [Phytophthora parasitica 
CJ01A1]
 gb|ETP47776.1| YjeF family domain-containing protein [Phytophthora parasitica 
P10297]
Length=247

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 109/249 (44%), Positives = 140/249 (56%), Gaps = 55/249 (22%)
 Frame = -2

Query  1008  YLTHQEATEIDHLLMGPL-GFSIDQLMELAGLSIATAIAEVY--NPKE------YRRILV  856
             YL  +EA   D  LM    GFSIDQLMELAGLS+ATA+ + Y  N K       ++R+LV
Sbjct  7     YLGQREAQHFDEQLMSSTHGFSIDQLMELAGLSVATAVGKQYPTNTKSTAATGGFKRVLV  66

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------  724
             + GPG+NGGD LVAARHL +FGY   + YP ++ K  + GLVTQ                
Sbjct  67    VAGPGNNGGDALVAARHLVHFGYSPSILYPKRSAKPLFQGLVTQCEQLKIPFIEQIQNAS  126

Query  723   -------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHV  601
                                G + PPFD ++  L   + P         IVS+DIPSGWHV
Sbjct  127   DVDAAYDLILDGIFGFSFSGGIRPPFDHVVGTLQKCQTP---------IVSIDIPSGWHV  177

Query  600   DGGDINGEGIRPSMLVSLTAPKLCAKRFYGPH--HFLGGRFIPPSIVDKFKLGLPLYPGT  427
             + G+ +G G+ P MLVSLTAPKLCAK F GP   H++GGRF+  S+ ++F L LP YPG 
Sbjct  178   EKGNESGVGLEPQMLVSLTAPKLCAKLFTGPDKVHYVGGRFVSKSLAEEFNLELPEYPGV  237

Query  426   SMCVRIGRP  400
               CV++  P
Sbjct  238   EQCVKVPIP  246



>ref|NP_001232952.1| uncharacterized protein LOC100165916 [Acyrthosiphon pisum]
 dbj|BAH72352.1| ACYPI006830 [Acyrthosiphon pisum]
Length=248

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 136/225 (60%), Gaps = 24/225 (11%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  +EA  ID  L     FS+DQLMELAGLS ATAI + + PK ++R+LV+CGPG+N
Sbjct  25    VKYLKQEEAINIDQELFNVYKFSVDQLMELAGLSCATAIQKCFPPKSHQRVLVLCGPGNN  84

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPLS--PPFDELIQRLVSLKNPR  661
             GGDGLV ARH++ FGY   + YP++T K  Y+ LV Q   S  P  D L   + +     
Sbjct  85    GGDGLVCARHMNLFGYLTEVYYPVRTDKLLYSNLVHQCETSGVPVSDSLADNISTYDLIV  144

Query  660   DS----HRKSPV-----------------IVSVDIPSGWHVDGGDINGEGIRPSMLVSLT  544
             D+      K PV                 I S+D+PSGW ++G   + +GI P +L+SLT
Sbjct  145   DALFGFSFKPPVRAKFLPVMNALKTVDKPICSIDVPSGWSIEGVP-DSDGINPELLISLT  203

Query  543   APKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             APK CAK F G +H+LGGRF+P  + +K++L LP YPG   CV++
Sbjct  204   APKECAKSFKGKYHYLGGRFVPKELEEKYQLELPAYPGAECCVKL  248



>ref|XP_008049215.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Tarsius syrichta]
Length=290

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 143/239 (60%), Gaps = 32/239 (13%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----  865
             M STT + YL+ QEA  +D  L     FS+DQLMELAGLS ATAIA+ Y PK   R    
Sbjct  52    MASTT-VKYLSQQEAQAVDEELFNEYRFSVDQLMELAGLSCATAIAKAYPPKSMSRSPPA  110

Query  864   ILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLS  712
             +LVICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ         G + 
Sbjct  111   VLVICGPGNNGGDGLVCARHLQLFGYEPTIYYPKRPSKPLFTALVTQCQKMDIPFLGEMP  170

Query  711   PP---FDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDI  586
             P     DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G+ 
Sbjct  171   PEPTMIDELYELVVDAIFGFSFKGDVREPFRSILGVLKGLTVPIASIDIPSGWDVEKGNS  230

Query  585   NGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              G GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  289



>ref|XP_003886180.1| hypothetical protein NCLIV_065800 [Neospora caninum Liverpool]
 emb|CBZ56154.1| hypothetical protein NCLIV_065800 [Neospora caninum Liverpool]
Length=230

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 140/238 (59%), Gaps = 52/238 (22%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEV--YNPKEYR--RILVICG  847
             ++YLT  +A  +D  LMGP      +LMELAGLS+A A+AE    +P   R  R+LV+ G
Sbjct  8     LTYLTQSQAQALDEDLMGP------ELMELAGLSVAQAVAEAIPLSPAVTRLARVLVVAG  61

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------  724
             PG+NGGDGLVAARHL  FGY++ + YP  T K  + GL+ Q                   
Sbjct  62    PGNNGGDGLVAARHLKLFGYQVHVWYPRPTAKPLFEGLMKQLKNHRVPVTFEAPPGLADF  121

Query  723   -------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDIN  583
                          G L PPFDE++QRL +   P         I+SVDIPSGW V+ G++ 
Sbjct  122   HLIVDSIFGFSFKGALRPPFDEVLQRLKASNIP---------ILSVDIPSGWDVEKGNVR  172

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             GEG+ P  L+SLTAPKLCAK F G  HF+GGRF+P S+V+K++L LP YPG    VRI
Sbjct  173   GEGLEPQYLISLTAPKLCAKHF-GKVHFVGGRFVPESMVEKYQLVLPDYPGIQGVVRI  229



>gb|EWM28046.1| pyridoxamine 5-phosphate oxidase, putative [Nannochloropsis gaditana]
Length=501

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 135/237 (57%), Gaps = 45/237 (19%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAE-VYNPKEYRRILVICGPGS  838
             I+ LT +EA  ID  LMG  GFS+DQLMELAGLS+A+AI + +  P     IL++CGPG+
Sbjct  115   ITLLTQKEAQAIDEELMGTPGFSVDQLMELAGLSVASAIHDFLAQPTRSASILILCGPGN  174

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------------  724
             NGGDGLVAARHL++FGY   + YP +  +  +T LV Q                      
Sbjct  175   NGGDGLVAARHLYHFGYRPVVVYPKRPARPLFTNLVKQCEDLGIHVGVDMPEDIEAKFDC  234

Query  723   -----------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGE  577
                        GPL  PF E++Q L  L  P         IVSVDIPSGW V+ GD+ G 
Sbjct  235   VVDALFGFGTAGPLRAPFGEMMQVLSKLTTP---------IVSVDIPSGWDVEAGDVYGT  285

Query  576   GIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKL-GLPLYPGTSMCVRI  409
             G  P  LVSLTAPK CA  F G  H+LGGRF+PP +  ++ L  LP YPGT  CV I
Sbjct  286   GFTPDALVSLTAPKKCAALFRG-RHYLGGRFVPPGLQHQYGLDALPAYPGTCQCVEI  341



>ref|XP_004518861.1| PREDICTED: NAD(P)H-hydrate epimerase-like isoform X1 [Ceratitis 
capitata]
 ref|XP_004518862.1| PREDICTED: NAD(P)H-hydrate epimerase-like isoform X2 [Ceratitis 
capitata]
Length=269

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 131/228 (57%), Gaps = 26/228 (11%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + +LT  EA  +D  L     FS+DQLMELAGLS A AIA+ Y  + ++R+L+ CGPG+N
Sbjct  42    MKFLTQNEAINVDMELFNEYKFSVDQLMELAGLSCAHAIAKCYPVERFKRVLICCGPGNN  101

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPLS---------------PPFD  700
             GGDGLV  RHL    YE  + YP QT K  Y  L  Q  LS                 +D
Sbjct  102   GGDGLVCGRHLSLMQYEPKIYYPKQTSKELYQNLTHQCKLSGIQFLSTNPTLEATNDCYD  161

Query  699   ELIQRLV--SLKNP-RDS--------HRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              +I  L   S K P R++         + +  I S+DIPSGW V+ G I+     P ML+
Sbjct  162   LIIDALFGFSFKPPIRETFVPIIEVLQKTTTPIASIDIPSGWDVEKGKIDETYFEPEMLI  221

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SLTAPKLCA  F G +H+LGGRF+P ++ +K++L LP YP   MC++I
Sbjct  222   SLTAPKLCASSFKGKYHYLGGRFVPKALQEKYQLNLPEYPNCDMCLKI  269



>ref|XP_002011712.1| GI11178 [Drosophila mojavensis]
 sp|B4L8C7.1|NNRE_DROMO RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Drosophila mojavensis]
 gb|EDW05702.1| GI11178 [Drosophila mojavensis]
Length=229

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/229 (45%), Positives = 129/229 (56%), Gaps = 28/229 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL   EA  +D  L     FS+DQLMELAGLS A AIA+ +    + R+LV CGPG+N
Sbjct  2     LKYLNQSEAINVDLELFNEYKFSVDQLMELAGLSCAHAIAKCFPADRFGRVLVCCGPGNN  61

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGP---------------LSPPFD  700
             GGDGLV ARHL   GY   L YP  TPK  Y  L  Q                  +  +D
Sbjct  62    GGDGLVCARHLALMGYLPVLYYPKPTPKPLYENLAHQCKRMEIESISECPSVALAAECYD  121

Query  699   ELIQRLV--SLKNPRDS----------HRKSPVIVSVDIPSGWHVDGGDINGEGIRPSML  556
              ++  L   S K P  +            K P I SVDIPSGW V+ G +N   + P++L
Sbjct  122   LIVDALFGFSFKPPVRADFVPVVELLQQTKLP-IASVDIPSGWDVEAGKLNECDMEPTLL  180

Query  555   VSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             +SLTAPKLCAK F G HHFLGGRF+PP++  K++L LP YPG  MC+ +
Sbjct  181   ISLTAPKLCAKHFKGKHHFLGGRFVPPALQRKYELNLPTYPGNEMCLEL  229



>dbj|GAM17859.1| hypothetical protein SAMD00019534_010340, partial [Acytostelium 
subglobosum LB1]
Length=249

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 137/246 (56%), Gaps = 46/246 (19%)
 Frame = -2

Query  1020  TPISYLTHQEATEIDHLLMGP-LGFSIDQLMELAGLSIATAIAEVYN--PKEYRRILVIC  850
               + Y+   E+  +D LLMG   GFS+DQLMELAGLS+A ++ + Y    +  +R+L IC
Sbjct  9     NALKYMGQSESIRMDQLLMGQQYGFSVDQLMELAGLSVAASVQKCYGSLARSPKRVLAIC  68

Query  849   GPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ------------------  724
             GPG+NGGDGLVA+RHL +FGY + + YP +T K  Y  LV Q                  
Sbjct  69    GPGNNGGDGLVASRHLVHFGYAVDVLYPKRTDKDLYKNLVLQCQHVGISFLDNMPAESEL  128

Query  723   -----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDG  595
                              G +  PFD +I+ L  L      + +S  I SVDIPSGW V+ 
Sbjct  129   TSRYGLVIDSIFGYSFKGDIRAPFDSIIKTLTGL------NSQSLPIASVDIPSGWDVEQ  182

Query  594   GDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             G++N     PS+L+SL APK CA+ F G  H+LGGRF+P S +D+F+L LP YPG   CV
Sbjct  183   GNVNNT-FTPSLLISLAAPKKCAESFKGT-HYLGGRFLPQSFLDEFQLNLPQYPGAEQCV  240

Query  414   RIGRPP  397
              I   P
Sbjct  241   DISLQP  246



>sp|B3NW64.2|NNRE_DROER RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Drosophila erecta]
Length=230

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 136/228 (60%), Gaps = 26/228 (11%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  +EA ++D  L     FS+DQLMELAGLS A A+A+ +  +++ RILV CGPG+N
Sbjct  3     LKYLNQKEAIDVDQELFTEYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCCGPGNN  62

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPL---------------SPPFD  700
             GGDGLVAARHL   GY   + YP  T K  +  L  Q  +               +  +D
Sbjct  63    GGDGLVAARHLSLMGYTPTIYYPKPTAKPLFENLSHQCQMMGICGVKECPSVESAAANYD  122

Query  699   ELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              ++  L   S K P  +   + V         I SVDIPSGW V+ G +    + P++L+
Sbjct  123   LILDALFGFSFKPPVRADFVAVVELMQQTKLPIASVDIPSGWDVEKGKLTECDVEPALLI  182

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SLTAPKLCA++F G HH+LGGRF+PP++  K++L LP+YPG  +CV++
Sbjct  183   SLTAPKLCARQFRGEHHYLGGRFVPPALQRKYELNLPVYPGNELCVKL  230



>ref|XP_011550997.1| PREDICTED: NAD(P)H-hydrate epimerase [Plutella xylostella]
Length=272

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 132/228 (58%), Gaps = 28/228 (12%)
 Frame = -2

Query  1008  YLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGG  829
             YL   EA  +D  L     FS+DQLMELAGLS+ATA+A+ Y P  Y   L++CGPG+NGG
Sbjct  44    YLNQVEAAALDQELFTEYKFSVDQLMELAGLSVATAVAQAYPPTSYSSALIVCGPGNNGG  103

Query  828   DGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------GPLSPPFDEL  694
             DGLVAARH+  FGY++ + YP +TPK  Y  L+ Q                 L   +  L
Sbjct  104   DGLVAARHMALFGYKVAVHYPKRTPKPLYENLLEQCCKFGIHIVDKLLEPNELKNEYQVL  163

Query  693   IQRL--VSLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSMLVSL  547
             +  L   S K P     K  +         + SVDIPSGWHV+ G  +   ++P++L+SL
Sbjct  164   VDALFGFSFKPPVREELKPALDALIDGGLPVCSVDIPSGWHVEDGPSSDHSLKPALLISL  223

Query  546   TAPKLCAKRFY--GPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             +APKLCAK  Y  G  H+LGGRF+PP+IV K+ L LP YP     V++
Sbjct  224   SAPKLCAKDEYLKGAKHYLGGRFLPPAIVKKYNLTLPEYPAQDQVVQL  271



>ref|XP_008568728.1| PREDICTED: NAD(P)H-hydrate epimerase [Galeopterus variegatus]
Length=288

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 140/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLS  712
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ            P  
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKSLFTALVTQCQKMDIPFLGEMPTE  172

Query  711   PPF-DELIQRLV----------SLKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDING  580
             P   DEL + +V           ++ P  S     +  +  I S+DIPSGW V+ G  N 
Sbjct  173   PTMIDELYELVVDAIFGFSFKGDVREPFHSILSVLNGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK+ A +F G +H+LGGRF+PP++  K++L LP YPGT    R+
Sbjct  231   GGIQPDLLISLTAPKMSATQFTGRYHYLGGRFVPPALEKKYQLNLPSYPGTECVYRL  287



>ref|XP_970501.2| PREDICTED: NAD(P)H-hydrate epimerase isoform X2 [Tribolium castaneum]
Length=232

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 132/228 (58%), Gaps = 28/228 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEY--RRILVICGPG  841
             + YL  QEA  ID  L     FS+DQLMELAG S A+AIA+VY  ++Y  + ILV CGPG
Sbjct  2     VRYLGQQEAINIDKDLFNQYKFSVDQLMELAGFSCASAIAKVYPVEKYGQKPILVCCGPG  61

Query  840   SNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPLS--------PPFDELIQR  685
             +NGGDGLV ARHL  FGY+L + YP +T K  Y  LV Q   S        P  DE+   
Sbjct  62    NNGGDGLVCARHLSLFGYKLKVFYPQRTDKQLYHNLVHQAVSSDVVMINREPTLDEVNNE  121

Query  684   L---------VSLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSM  559
                        S K P     K+ +         I S+D+PSGW+V+ G  +  GI P +
Sbjct  122   FGLIVDALFGFSFKPPVRPDFKNIMEVLKCVSVPIASIDVPSGWNVEKGMPSEGGISPEL  181

Query  558   LVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             L+SLTAPK CA+ F G +H+LGGRF+PP +  K+KL LP Y GT  CV
Sbjct  182   LISLTAPKQCAQFFLGKYHYLGGRFVPPKLEQKYKLSLPKYHGTECCV  229



>ref|XP_011364683.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X2 [Pteropus vampyrus]
Length=288

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 142/237 (60%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +TGLVTQ         G + P 
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPE  172

Query  705   ---FDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  + 
Sbjct  173   PMLVDELYELVVDAIFGFSFKGDVREPFRSILSILSGLTVPIASIDIPSGWDVEKG--SA  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +LVSLTAPK CA +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   AGIQPDLLVSLTAPKRCAAQFAGRYHYLGGRFVPPALEKKYQLNLPQYPDTECVYRL  287



>ref|XP_001977270.1| GG18945 [Drosophila erecta]
 gb|EDV46197.1| GG18945 [Drosophila erecta]
Length=275

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 137/233 (59%), Gaps = 26/233 (11%)
 Frame = -2

Query  1029  GSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVIC  850
             G    + YL  +EA ++D  L     FS+DQLMELAGLS A A+A+ +  +++ RILV C
Sbjct  43    GKRMDLKYLNQKEAIDVDQELFTEYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCC  102

Query  849   GPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPL---------------  715
             GPG+NGGDGLVAARHL   GY   + YP  T K  +  L  Q  +               
Sbjct  103   GPGNNGGDGLVAARHLSLMGYTPTIYYPKPTAKPLFENLSHQCQMMGICGVKECPSVESA  162

Query  714   SPPFDELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIR  568
             +  +D ++  L   S K P  +   + V         I SVDIPSGW V+ G +    + 
Sbjct  163   AANYDLILDALFGFSFKPPVRADFVAVVELMQQTKLPIASVDIPSGWDVEKGKLTECDVE  222

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P++L+SLTAPKLCA++F G HH+LGGRF+PP++  K++L LP+YPG  +CV++
Sbjct  223   PALLISLTAPKLCARQFRGEHHYLGGRFVPPALQRKYELNLPVYPGNELCVKL  275



>ref|XP_011191093.1| PREDICTED: NAD(P)H-hydrate epimerase [Bactrocera cucurbitae]
Length=267

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 136/229 (59%), Gaps = 28/229 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + +LT  EA +ID  L     FS+DQLMELAGLS A AIA+ Y  + ++R+LV CGPG+N
Sbjct  40    MKFLTQTEAIKIDEELFNEYKFSVDQLMELAGLSCAHAIAKCYPTECFKRVLVCCGPGNN  99

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGP---------------LSPPFD  700
             GGDGLV ARHL    YE  + YP +T K  Y  L  Q                  +  FD
Sbjct  100   GGDGLVCARHLSLMKYEPTIYYPKKTAKPLYENLSHQCKSNGIPFLHSDPTLESTNDDFD  159

Query  699   ELIQRL--VSLKNP-RDS---------HRKSPVIVSVDIPSGWHVDGGDINGEGIRPSML  556
              +I  L   S K P R++         + K+P I S+DIPSGW V+ G I  E   P +L
Sbjct  160   LIIDALFGFSFKPPVRETFIPITEILQNTKTP-IASIDIPSGWDVEKGKIREEDFEPDLL  218

Query  555   VSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             +SLTAPKLCAK F G +H+LGGRF+PP++ +K++L LP Y   ++C+++
Sbjct  219   ISLTAPKLCAKLFKGKYHYLGGRFVPPTLQEKYQLNLPAYIDCNLCLKL  267



>ref|XP_008195014.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Tribolium castaneum]
Length=251

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 132/228 (58%), Gaps = 28/228 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEY--RRILVICGPG  841
             + YL  QEA  ID  L     FS+DQLMELAG S A+AIA+VY  ++Y  + ILV CGPG
Sbjct  21    VRYLGQQEAINIDKDLFNQYKFSVDQLMELAGFSCASAIAKVYPVEKYGQKPILVCCGPG  80

Query  840   SNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPLS--------PPFDELIQR  685
             +NGGDGLV ARHL  FGY+L + YP +T K  Y  LV Q   S        P  DE+   
Sbjct  81    NNGGDGLVCARHLSLFGYKLKVFYPQRTDKQLYHNLVHQAVSSDVVMINREPTLDEVNNE  140

Query  684   L---------VSLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSM  559
                        S K P     K+ +         I S+D+PSGW+V+ G  +  GI P +
Sbjct  141   FGLIVDALFGFSFKPPVRPDFKNIMEVLKCVSVPIASIDVPSGWNVEKGMPSEGGISPEL  200

Query  558   LVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             L+SLTAPK CA+ F G +H+LGGRF+PP +  K+KL LP Y GT  CV
Sbjct  201   LISLTAPKQCAQFFLGKYHYLGGRFVPPKLEQKYKLSLPKYHGTECCV  248



>dbj|GAA95330.1| hypothetical protein E5Q_01987 [Mixia osmundae IAM 14324]
Length=254

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/265 (42%), Positives = 148/265 (56%), Gaps = 22/265 (8%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLG--FSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPG  841
              + ++ + A +ID  LM P G  FSIDQLMELAGL+ ATA+ + Y P  + ++L+  GPG
Sbjct  2     TTLISQETAQDIDQWLMDPSGGAFSIDQLMELAGLACATALQKTYQPCTHPKVLICAGPG  61

Query  840   SNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPLSPPFDELIQRLVSLKNPR  661
             + GGDGLVAARHL +FGY+  L YP QT K    G    G   PPFD +I  L     P 
Sbjct  62    NQGGDGLVAARHLWHFGYQPTLFYPKQTDKDLLFGFSFHGEPRPPFDAVINALNETTKP-  120

Query  660   DSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFI  481
                     I+SVDIPS W V+ G+++G    P  L+SLTAPKL +K F G  H+LGGRF+
Sbjct  121   --------ILSVDIPSAWDVEKGNVSGT-FTPDSLISLTAPKLGSKSFKGT-HWLGGRFV  170

Query  480   PPSIVDKFKLGLPLYPGTSMCVRIGRPPEIY----PLALLGMHVEADPFDQFKKWFDHAL  313
             PP I  +FKL LP YPG+     +      Y    P A  GMH    P+   +K F    
Sbjct  171   PPHIAQRFKLDLPDYPGSEQVRVLKETARTYDQGWPTA-YGMH---SPWISTQKGFASRS  226

Query  312   VAGVKEPNYM-ALSTGTKDGKPSSR  241
                +++ + + + S    DGK  +R
Sbjct  227   TTSLEDMHRLDSESNSESDGKSDAR  251



>ref|XP_001967143.1| GF19489 [Drosophila ananassae]
 sp|B3N0Q8.1|NNRE_DROAN RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Drosophila ananassae]
 gb|EDV34787.1| GF19489 [Drosophila ananassae]
Length=229

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 130/228 (57%), Gaps = 26/228 (11%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL+  EA  +D  L     FS+DQLMELAGLS A AI++ +   +Y R+L+ CGPG+N
Sbjct  2     VKYLSQSEAINVDQELFNDYKFSVDQLMELAGLSCAHAISKCFPTDKYGRVLICCGPGNN  61

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPL---------------SPPFD  700
             GGDGLV ARHL   GY   + YP  T K  Y  L  Q  L               +  FD
Sbjct  62    GGDGLVCARHLALMGYTPTIYYPKPTAKPLYENLSHQCKLMEICRVEDCPAINEAASNFD  121

Query  699   ELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              ++  L   S K P  +   + V         I SVDIPSGW V+ G +N   + P +L+
Sbjct  122   LIVDALFGFSFKPPVRAEFVAIVELMQQTTLPIASVDIPSGWDVEKGKVNDSDLEPDLLI  181

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SLTAPK+CA+ F G +H+LGGRF+PP++  K+ L LP YPG  +C+++
Sbjct  182   SLTAPKICARNFKGRYHYLGGRFVPPALQRKYDLNLPTYPGNELCLKL  229



>gb|KIY46724.1| YjeF N-terminal domain-like protein [Fistulina hepatica ATCC 
64428]
Length=235

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 136/242 (56%), Gaps = 47/242 (19%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLG-FSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             + YLT + A +ID  LM   G FS+DQLMELAGL+ A  +A VY+  +Y R+LV CGPG+
Sbjct  3     LRYLTARIAQQIDEELMSTAGAFSLDQLMELAGLACAQTLAAVYHKDKYPRVLVCCGPGN  62

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------------  724
              GGDGLVAARHL  FGY+  +  P    K  Y  L  Q                      
Sbjct  63    QGGDGLVAARHLGMFGYKPTVFVPKPGSKDIYKRLQIQCDNMRIRTVDGAAFDNALSSSD  122

Query  723   ------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDING  580
                         GP+ PPFD +I +L     P         IVSVDIPSGW V+ G+++G
Sbjct  123   VILDAIFGFSFKGPMRPPFDSVISKLTKSGLP---------IVSVDIPSGWDVEQGNVDG  173

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIGRP  400
              G+ P +LVSLTAPK  A+ F+G  HFLGGRF+P +I +KF+L LPLYPG    V +  P
Sbjct  174   TGLNPDVLVSLTAPKEGARLFHG-RHFLGGRFVPTTIAEKFELNLPLYPGVEQIVEL--P  230

Query  399   PE  394
             P+
Sbjct  231   PQ  232



>ref|XP_003415203.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Loxodonta africana]
Length=288

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 140/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDQELFNEYKFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLS  712
             +ICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ            PL 
Sbjct  113   IICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPLE  172

Query  711   P-PFDELIQRLVS----------LKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
             P   DEL + +V           ++ P  S  K     +  I S+DIPSGW V+ G  N 
Sbjct  173   PLMIDELYELVVDAIFGFSFKGDVREPFQSILKVLSGITVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             EG++P ML+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   EGLQPDMLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  287



>dbj|GAA33511.2| YjeF N-terminal domain-containing protein GK25285 [Clonorchis 
sinensis]
Length=244

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/250 (42%), Positives = 131/250 (52%), Gaps = 52/250 (21%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYR----RILVICG  847
             ISYL   +A ++D+ L     +S+DQLMELAGLS ATAIA+ Y   E R     +LV CG
Sbjct  2     ISYLNQADAQQLDNELFTEYAYSVDQLMELAGLSCATAIAKAYPRDELRITNGALLVCCG  61

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG------------------  721
             PG+NGGDGLV ARHL  FGY   +CYP    K  Y  LV Q                   
Sbjct  62    PGNNGGDGLVCARHLKMFGYNPTICYPRTPTKQLYKNLVRQCEKMNIDFFQAPTPEMASQ  121

Query  720   -------------------PLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHV-  601
                                P+S  F  L+  +   K P         +VS+D+PSGW+V 
Sbjct  122   WGSSYNLIVDALFGFGFKPPVSAEFKTLLDYMCQAKIP---------VVSIDVPSGWNVE  172

Query  600   -DGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTS  424
              D G +    + P  L+SLTAPKLCA+ F G  HFLGGRF+P SI  K++L LP YPGT 
Sbjct  173   ADVGGVEEGSLNPDCLISLTAPKLCARAFRGRFHFLGGRFVPDSIAVKYRLQLPAYPGTD  232

Query  423   MCVRIGRPPE  394
              CV++  P +
Sbjct  233   QCVQLPLPSD  242



>ref|XP_002041832.1| GM11335 [Drosophila sechellia]
 sp|B4IDM2.1|NNRE_DROSE RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Drosophila sechellia]
 gb|EDW45680.1| GM11335 [Drosophila sechellia]
Length=230

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 136/228 (60%), Gaps = 26/228 (11%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  +EA  +D  L     FS+DQLMELAGLS A A+A+ +  +++ RILV CGPG+N
Sbjct  3     LKYLNQKEAIAVDQELFNEYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCCGPGNN  62

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGL-----------VTQGP----LSPPFD  700
             GGDGLVAARHL   GY   + YP  T K  +  L           V + P     +  +D
Sbjct  63    GGDGLVAARHLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDICDVKECPSVESAARDYD  122

Query  699   ELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              ++  L   S K P  +   + V         I SVDIPSGW V+ G +    + P++L+
Sbjct  123   LILDALFGFSFKPPVRADFVAVVELMQQTKLPIASVDIPSGWDVEKGKLTECDVEPALLI  182

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SLTAPKLCA++F G HH+LGGRF+PP++  K++L LP+YPG  +CV++
Sbjct  183   SLTAPKLCARQFRGEHHYLGGRFVPPALQRKYELNLPVYPGNELCVKL  230



>gb|ACJ13219.1| FI07335p [Drosophila melanogaster]
Length=275

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 137/233 (59%), Gaps = 26/233 (11%)
 Frame = -2

Query  1029  GSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVIC  850
             G    + YL  +EA  +D  L     FS+DQLMELAGLS A A+A+ +  +++ RILV C
Sbjct  43    GKRMDLKYLNQKEAIAVDQELFNDYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCC  102

Query  849   GPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGL-----------VTQGP----L  715
             GPG+NGGDGLVAARHL   GY   + YP  T K  +  L           V + P     
Sbjct  103   GPGNNGGDGLVAARHLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDICDVKECPSVESA  162

Query  714   SPPFDELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIR  568
             +  +D ++  L   S K P  +   + V         I SVDIPSGW V+ G +    + 
Sbjct  163   ARDYDLILDALFGFSFKPPVRADFVAVVELMQQTKLPIASVDIPSGWDVEKGKLTECDVE  222

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P++L+SLTAPKLCA++F G HH+LGGRF+PP++  K++L LP+YPG  +CV++
Sbjct  223   PALLISLTAPKLCARQFRGEHHYLGGRFVPPALQRKYELNLPVYPGNELCVKL  275



>ref|NP_572604.2| CG2974 [Drosophila melanogaster]
 sp|Q9W2Y3.2|NNRE_DROME RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Drosophila melanogaster]
 gb|AAF46554.2| CG2974 [Drosophila melanogaster]
Length=230

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 136/228 (60%), Gaps = 26/228 (11%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  +EA  +D  L     FS+DQLMELAGLS A A+A+ +  +++ RILV CGPG+N
Sbjct  3     LKYLNQKEAIAVDQELFNDYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCCGPGNN  62

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGL-----------VTQGP----LSPPFD  700
             GGDGLVAARHL   GY   + YP  T K  +  L           V + P     +  +D
Sbjct  63    GGDGLVAARHLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDICDVKECPSVESAARDYD  122

Query  699   ELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              ++  L   S K P  +   + V         I SVDIPSGW V+ G +    + P++L+
Sbjct  123   LILDALFGFSFKPPVRADFVAVVELMQQTKLPIASVDIPSGWDVEKGKLTECDVEPALLI  182

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SLTAPKLCA++F G HH+LGGRF+PP++  K++L LP+YPG  +CV++
Sbjct  183   SLTAPKLCARQFRGEHHYLGGRFVPPALQRKYELNLPVYPGNELCVKL  230



>ref|XP_011202325.1| PREDICTED: NAD(P)H-hydrate epimerase [Bactrocera dorsalis]
 ref|XP_011202326.1| PREDICTED: NAD(P)H-hydrate epimerase [Bactrocera dorsalis]
Length=228

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 132/229 (58%), Gaps = 28/229 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + +LT  EA +ID  L     FS+DQLMELAGLS A AIA+ Y    ++R+LV CGPG+N
Sbjct  1     MKFLTQTEAVKIDEELFNEYKFSVDQLMELAGLSCAHAIAKCYPADCFKRVLVCCGPGNN  60

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG---------------PLSPPFD  700
             GGDGLV ARHL +  YE  + YP  T K  Y  L  Q                  +  +D
Sbjct  61    GGDGLVCARHLSFMKYEPTIYYPKPTAKPLYENLSHQCKSNGISFLRSSPTLESTNECYD  120

Query  699   ELIQRLV--SLKNP-RDS---------HRKSPVIVSVDIPSGWHVDGGDINGEGIRPSML  556
              ++  L   S K P R++         + K P I S+DIPSGW V+ G I      P ML
Sbjct  121   LIVDALFGFSFKPPVRETFVPITEILLNTKIP-IASIDIPSGWDVEKGKIRENDFEPDML  179

Query  555   VSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             +SLTAPKLCAK F G +H+LGGRF+PP++ +KF+L LP Y    MC+++
Sbjct  180   ISLTAPKLCAKMFKGKYHYLGGRFVPPALQEKFQLNLPEYHDCDMCLKL  228



>ref|XP_002605536.1| hypothetical protein BRAFLDRAFT_104103 [Branchiostoma floridae]
 sp|C3YDS7.1|NNRE_BRAFL RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Branchiostoma floridae]
 gb|EEN61546.1| hypothetical protein BRAFLDRAFT_104103 [Branchiostoma floridae]
Length=273

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 136/240 (57%), Gaps = 49/240 (20%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVY---NPKEYRRILVICGP  844
             ISY++ +EA +ID  L     +S+DQLMELAG S A A+A+ Y   + K+   +LV CGP
Sbjct  44    ISYVSQEEAQQIDQELFNEYAYSVDQLMELAGHSCAVALAKSYPLTSLKKDATVLVCCGP  103

Query  843   GSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ--------------------  724
             G+NGGDGLV ARHL  FGY   + YP +T K  Y  L  Q                    
Sbjct  104   GNNGGDGLVCARHLKMFGYNPSVFYPKRTDKPLYKNLTIQCEQLDIPFLSHLPKPQLLSD  163

Query  723   ---------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGD  589
                            G + PPF ++++ L  +  P         I S+D+PSGW V+GG 
Sbjct  164   GFSYIVDALFGFSFKGEVRPPFGDVLKTLKEVTVP---------ICSIDVPSGWDVEGG-  213

Query  588   INGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              N +G++P  L+SLTAPK CA++F G +H+LGGRF+PP I+ K++L LP YPGT  C+R+
Sbjct  214   -NPDGLQPEFLISLTAPKKCAEKFAGRYHYLGGRFVPPGIIQKYELNLPTYPGTEPCIRL  272



>gb|KEI41176.1| hypothetical protein L969DRAFT_92409 [Mixia osmundae IAM 14324]
Length=253

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 150/264 (57%), Gaps = 21/264 (8%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLG--FSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPG  841
              + ++ + A +ID  LM P G  FSIDQLMELAGL+ ATA+ + Y P  + ++L+  GPG
Sbjct  2     TTLISQETAQDIDQWLMDPSGGAFSIDQLMELAGLACATALQKTYQPCTHPKVLICAGPG  61

Query  840   SNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPLSPPFDELIQRLVSLKNPR  661
             + GGDGLVAARHL +FGY+  L YP QT K    G    G   PPFD +I  L     P 
Sbjct  62    NQGGDGLVAARHLWHFGYQPTLFYPKQTDKDLLFGFSFHGEPRPPFDAVINALNETTKP-  120

Query  660   DSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFI  481
                     I+SVDIPS W V+ G+++G    P  L+SLTAPKL +K F G  H+LGGRF+
Sbjct  121   --------ILSVDIPSAWDVEKGNVSGT-FTPDSLISLTAPKLGSKSFKGT-HWLGGRFV  170

Query  480   PPSIVDKFKLGLPLYPGTSMCV--RIGRP-PEIYPLALLGMHVEADPFDQFKKWFDHALV  310
             PP I  +FKL LP YPG+   V     R   + +P A  GMH    P+   +K F     
Sbjct  171   PPHIAQRFKLDLPDYPGSHQRVLKETARTYDQGWPTA-YGMH---SPWISTQKGFASRST  226

Query  309   AGVKEPNYM-ALSTGTKDGKPSSR  241
               +++ + + + S    DGK  +R
Sbjct  227   TSLEDMHRLDSESNSESDGKSDAR  250



>sp|B4PXF5.2|NNRE_DROYA RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Drosophila yakuba]
Length=230

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 133/228 (58%), Gaps = 26/228 (11%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  +EA ++D  L     FS+DQLMELAGLS A A+A+ +  +++ RILV CGPG+N
Sbjct  3     LKYLNQKEAIDVDQELFTEYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCCGPGNN  62

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPL---------------SPPFD  700
             GGDGLVAARHL   GY   + YP  T K  +  L  Q  +               +  +D
Sbjct  63    GGDGLVAARHLSLMGYTPTIYYPKPTAKPLFENLSHQCQMMDICGVKECPSVATAASDYD  122

Query  699   ELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              ++  L   S K P  +   + V         I SVDIPSGW V+ G +    + P++L+
Sbjct  123   LILDALFGFSFKPPVRADFVAVVELLQQTKLPIASVDIPSGWDVEKGKLTECDVEPALLI  182

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SLTAPKLCA+ F G HH+LGGRF+PP++  K+ L LP YPG  +CV++
Sbjct  183   SLTAPKLCARHFRGEHHYLGGRFVPPALQRKYGLNLPTYPGNELCVKL  230



>gb|KIK92572.1| hypothetical protein PAXRUDRAFT_792304 [Paxillus rubicundulus 
Ve08.2h10]
Length=236

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 139/241 (58%), Gaps = 49/241 (20%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLG-FSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             I +LT + A +ID  LMG +G FSIDQLMELAGL+ A A+A+VY+ ++YR++LV CGPG+
Sbjct  3     IRHLTAKLAQQIDEELMGSVGAFSIDQLMELAGLACAQALAKVYSKEKYRKVLVCCGPGN  62

Query  837   NGGDGLVAARHLHYFGYE--LFL---------------CYPMQTPKHPYT----------  739
              GGDGLVAARHL  FGYE  +++               C  M+    P+           
Sbjct  63    QGGDGLVAARHLDMFGYEPTIYMPKPGFKDIYKRLQKQCENMKIESLPHDVSMDALRSTL  122

Query  738   -----------GLVTQGPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                        G   +GP+  PFDE++  L S + P         IVSVDIPSGW V+ G
Sbjct  123   SSFDVILDAIFGFSFEGPVRAPFDEVLPLLSSSRKP---------IVSVDIPSGWGVEKG  173

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
             +  G GI P +LVSLTAPK   + F G  HFLGGRF+P ++ +KF+L LP YPG    V 
Sbjct  174   NEEGTGIVPDVLVSLTAPKEGVRSFKG-RHFLGGRFVPKAMEEKFQLNLPEYPGFDQIVE  232

Query  411   I  409
             +
Sbjct  233   L  233



>gb|AAM11267.1| RH19667p [Drosophila melanogaster]
Length=275

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 137/233 (59%), Gaps = 26/233 (11%)
 Frame = -2

Query  1029  GSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVIC  850
             G    + YL  +EA  +D  L     FS+DQLMELAGLS A A+A+ +  +++ RILV C
Sbjct  43    GKRMDLKYLNQKEAIAVDQELFNDYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCC  102

Query  849   GPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGL-----------VTQGP----L  715
             GPG+NGGDGLVAARHL   GY   + YP  T K  +  L           V + P     
Sbjct  103   GPGNNGGDGLVAARHLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDICDVKECPSVESA  162

Query  714   SPPFDELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIR  568
             +  +D ++  L   S K P  +   + V         I SVDIPSGW V+ G +    + 
Sbjct  163   ARDYDLILDALFGFSFKPPVRADFVAVVELMQQTKLPIASVDIPSGWDVEKGKLTECDVE  222

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P++L+SLT+PKLCA++F G HH+LGGRF+PP++  K++L LP+YPG  +CV++
Sbjct  223   PALLISLTSPKLCARQFRGEHHYLGGRFVPPALQRKYELNLPVYPGNELCVKL  275



>gb|KFD56549.1| hypothetical protein M513_02653 [Trichuris suis]
 gb|KFD71079.1| hypothetical protein M514_02653 [Trichuris suis]
Length=261

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 127/234 (54%), Gaps = 43/234 (18%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPK-EYRRILVICGPGS  838
             + YL  QEA EID  L     FS+DQLMELAGLS ATAIA+ Y P     ++LVICGPG+
Sbjct  32    VKYLNQQEAMEIDQELFNKYRFSVDQLMELAGLSCATAIAKAYAPPFGNNKVLVICGPGN  91

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG---------------------  721
             NGGDGLV ARHL  FGYE  + YP          L TQ                      
Sbjct  92    NGGDGLVCARHLKLFGYEPTILYPKSPNSQLMNNLCTQVDMMMIDRRQSLDQLDINSFSL  151

Query  720   ------------PLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGE  577
                         PL  PF  +++ L     P+D+ R    I+S+DIPSGW V+GG +  +
Sbjct  152   IVDAIFGFSFRPPLREPFASIVKAL-----PKDNQRP---IISIDIPSGWDVNGGPLETD  203

Query  576   GIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
              + P  LVSLTAPKL A+ F G +HFLGGRF+P  +  K+ + LP YP T  CV
Sbjct  204   SLHPDCLVSLTAPKLAARHFKGRYHFLGGRFVPEQLAAKYDINLPKYP-TYECV  256



>ref|XP_004388533.1| PREDICTED: LOW QUALITY PROTEIN: NAD(P)H-hydrate epimerase [Trichechus 
manatus latirostris]
Length=305

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++  + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  70    ASAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  129

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLS  712
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ            PL 
Sbjct  130   VICGPGNNGGDGLVCARHLKLFGYQPTVYYPKRPNKPLFTALVTQCQKMDIPFLGEMPLE  189

Query  711   PPF-DELIQRLVS----------LKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
             P   DEL + +V           ++ P  S  K     +  I SVDIPSGW V+ G  N 
Sbjct  190   PMMIDELYELVVDAIFGFSFKGDVREPFRSILKVLSGITVPIASVDIPSGWDVEKG--NS  247

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             EG++P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  248   EGLQPDLLISLTAPKKSASQFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  304



>gb|KIY96224.1| hypothetical protein MNEG_11737, partial [Monoraphidium neglectum]
Length=311

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 153/310 (49%), Gaps = 81/310 (26%)
 Frame = -2

Query  870  RRILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------  724
            RR+ V+ GPG+NGGDGLVAARHL  FGYE  +CYP  T K  Y GLVTQ           
Sbjct  3    RRVAVLAGPGNNGGDGLVAARHLWQFGYEPTICYPKPTDKPLYNGLVTQCKSLGIPFVSA  62

Query  723  ------GPLSPPFDELIQRLVSL------KNPRDSHRKS-------PVIVSVDIPSGWHV  601
                   PL   FD ++  L         + P D+  +S       P IVSVDIPSGWHV
Sbjct  63   DDLTGGAPLQERFDVIVDALFGFSFKGQPRTPFDALLESLKPSARPPPIVSVDIPSGWHV  122

Query  600  DGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSM  421
            + GD +G GIRP +LVSLTAPKL AK F G  H+LGGRF+PP+  DK+ L LP YPGT+ 
Sbjct  123  EEGDPSGVGIRPDVLVSLTAPKLAAKSFQG-THYLGGRFVPPATRDKYGLVLPAYPGTAQ  181

Query  420  CVRIG---------------------------------------------RPPEIYPLAL  376
             VRI                                              +P ++     
Sbjct  182  SVRISPPHAARVDIWDAPAPAAAAAAAGAPAGGGAASGTAEGAAAAGQLPKPADMRITYQ  241

Query  375  LGMHVEAD----PFDQFKKWFDHALV-AGVKEPNYMALSTGTKDGKPSSRVVSLEGVNKD  211
             G   E D    PF QF  WF  A     ++EPN +A+++ T  G  S R+V L+  ++ 
Sbjct  242  AGTLSEDDVNGDPFAQFDAWFKEAAADPEIQEPNAIAVASSTPGGAVSVRMVLLKQYDER  301

Query  210  GFVWYTSYES  181
            GF ++T+Y S
Sbjct  302  GFCFFTNYNS  311



>ref|XP_006861660.1| PREDICTED: NAD(P)H-hydrate epimerase [Chrysochloris asiatica]
Length=288

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++  + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLS  712
             +ICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ            PL 
Sbjct  113   IICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPLE  172

Query  711   P-PFDELIQRLVS----------LKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
             P   DEL + +V           ++ P  S  K     +  I S+DIPSGW V+ G  N 
Sbjct  173   PMQIDELYELVVDAIFGFSFKGDVREPFRSILKVLSGITVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             EG++P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   EGLQPDLLISLTAPKKSAAQFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  287



>gb|KHJ48649.1| YjeF-like protein [Trichuris suis]
Length=261

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 127/234 (54%), Gaps = 43/234 (18%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPK-EYRRILVICGPGS  838
             + YL  QEA EID  L     FS+DQLMELAGLS ATAIA+ Y P     ++LVICGPG+
Sbjct  32    VKYLNQQEAMEIDQELFNKYRFSVDQLMELAGLSCATAIAKAYAPPFGNNKVLVICGPGN  91

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG---------------------  721
             NGGDGLV ARHL  FGYE  + YP          L TQ                      
Sbjct  92    NGGDGLVCARHLKLFGYEPTILYPKSPNSQLMNNLCTQVDMMMIDRRQSLDQLDINSFSL  151

Query  720   ------------PLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGE  577
                         PL  PF  +++ L     P+D+ R    I+S+DIPSGW V+GG +  +
Sbjct  152   IVDAIFGFSFRPPLREPFASIVKAL-----PKDNQRP---IISIDIPSGWDVNGGPLETD  203

Query  576   GIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
              + P  LVSLTAPKL A+ F G +HFLGGRF+P  +  K+ + LP YP T  CV
Sbjct  204   SLHPDCLVSLTAPKLAARHFKGRYHFLGGRFVPEQLAAKYDVNLPKYP-TYECV  256



>ref|XP_007946623.1| PREDICTED: NAD(P)H-hydrate epimerase [Orycteropus afer afer]
Length=288

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 140/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y      R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPTTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGY+  + YP ++ K  +T LVTQ   +  PF       
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRSNKPLFTALVTQCQKMDIPFLDEMPLE  172

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S  K     +  + S+DIPSGW V+ G  N 
Sbjct  173   AMLIDELYELVVDAIFGFSFKGEVREPFRSILKVLSGITVPVASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             EG++P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   EGLQPDLLISLTAPKQSATQFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  287



>ref|XP_008049216.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X2 [Tarsius syrichta]
Length=252

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 127/212 (60%), Gaps = 16/212 (8%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----  865
             M STT + YL+ QEA  +D  L     FS+DQLMELAGLS ATAIA+ Y PK   R    
Sbjct  52    MASTT-VKYLSQQEAQAVDEELFNEYRFSVDQLMELAGLSCATAIAKAYPPKSMSRSPPA  110

Query  864   ILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPLSPPFDELIQR  685
             +LVICGPG+NGGDGLV ARHL  F   +   Y +        G   +G +  PF  ++  
Sbjct  111   VLVICGPGNNGGDGLVCARHLQLFPTMIDELYELVV--DAIFGFSFKGDVREPFRSILGV  168

Query  684   LVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPH  505
             L  L  P         I S+DIPSGW V+ G+  G GI+P +L+SLTAPK  A +F G +
Sbjct  169   LKGLTVP---------IASIDIPSGWDVEKGNSGGGGIQPDLLISLTAPKKSATQFTGRY  219

Query  504   HFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  220   HYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  251



>ref|XP_002101798.1| GE15417 [Drosophila yakuba]
 gb|EDX02906.1| GE15417 [Drosophila yakuba]
Length=278

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 133/228 (58%), Gaps = 26/228 (11%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  +EA ++D  L     FS+DQLMELAGLS A A+A+ +  +++ RILV CGPG+N
Sbjct  51    LKYLNQKEAIDVDQELFTEYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCCGPGNN  110

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPL---------------SPPFD  700
             GGDGLVAARHL   GY   + YP  T K  +  L  Q  +               +  +D
Sbjct  111   GGDGLVAARHLSLMGYTPTIYYPKPTAKPLFENLSHQCQMMDICGVKECPSVATAASDYD  170

Query  699   ELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              ++  L   S K P  +   + V         I SVDIPSGW V+ G +    + P++L+
Sbjct  171   LILDALFGFSFKPPVRADFVAVVELLQQTKLPIASVDIPSGWDVEKGKLTECDVEPALLI  230

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SLTAPKLCA+ F G HH+LGGRF+PP++  K+ L LP YPG  +CV++
Sbjct  231   SLTAPKLCARHFRGEHHYLGGRFVPPALQRKYGLNLPTYPGNELCVKL  278



>ref|XP_004821745.1| PREDICTED: NAD(P)H-hydrate epimerase [Mustela putorius furo]
Length=295

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 140/239 (59%), Gaps = 33/239 (14%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----  865
             + S   ++YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y PK   R    
Sbjct  58    LASARTVAYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPKSMSRSPPA  117

Query  864   ILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-----  703
             +LVICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ   +  PF     
Sbjct  118   VLVICGPGNNGGDGLVCARHLKLFGYQPTVYYPKRPNKPLFTALVTQCQKMEIPFLGEMP  177

Query  702   ------DELIQRLVS----------LKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDI  586
                   DEL + +V           ++ P  S     H  +  I S+DIPSGW V+ G  
Sbjct  178   SEPMLIDELYELVVDAIFGFSFKGDVREPFRSILSVLHGLTVPIASIDIPSGWDVEKG--  235

Query  585   NGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             N  GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  236   NSGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  294



>ref|XP_005739811.1| PREDICTED: NAD(P)H-hydrate epimerase-like [Pundamilia nyererei]
Length=279

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 133/228 (58%), Gaps = 28/228 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I YL  +EA  ID  L    GFS+DQLMELAGLS ATA+  V   K    +LVICGPG+N
Sbjct  54    IKYLGQEEAQHIDEELFSEYGFSVDQLMELAGLSCATAVTRVSLLKNEPSLLVICGPGNN  113

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLSPPFDELIQ  688
             GGDGLV ARHL  FGYE  + YP +  K  + GL TQ            P +   DE   
Sbjct  114   GGDGLVCARHLKLFGYEPTILYPKRPNKPLFQGLTTQCQKMEIPFLTEMPEAKAIDEAYN  173

Query  687   RLV----------SLKNP----RDSHRKSPV-IVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              ++          +++ P     D+ +KS V I S+DIPSGW V+ G  +  G++P ML+
Sbjct  174   LVIDAIFGFSFKGAVREPFGSILDTLKKSTVPIASIDIPSGWDVEQGSTD--GLQPDMLI  231

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SLTAPK  A  F G +HFLGGRF+PP +  K++L LP YPGT   +++
Sbjct  232   SLTAPKKSASLFKGRYHFLGGRFVPPGLEKKYQLNLPQYPGTDCVLQL  279



>ref|XP_003327886.2| YjeF [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 sp|E3KGP2.2|NNRE_PUCGT RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP83467.2| YjeF [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
Length=240

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 132/242 (55%), Gaps = 44/242 (18%)
 Frame = -2

Query  1032  MGSTTPISYLTHQEATEIDHLLMGP-LGFSIDQLMELAGLSIATAIAEVYNPKEYRRILV  856
             M   + ++YLT +EA EID  LMGP  G+++ QLMELAGL+ A A+ +VY P+ Y R+LV
Sbjct  1     MKEDSTMTYLTQKEAQEIDAELMGPKYGYTLAQLMELAGLACAQALHKVYGPERYPRVLV  60

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPL-------------  715
              CGPG+ GGDGLVAARHL +FG++  L YP QT K  Y  L+ Q                
Sbjct  61    CCGPGNQGGDGLVAARHLWHFGHKPTLYYPKQTDKEHYKSLLRQCETLGIPVIGANFSEA  120

Query  714   --------------------SPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDG  595
                                   PFDE I+     + P         IVSVDIPSGW V+ 
Sbjct  121   VGETDVILDAIFGFSFHSEPRAPFDEPIRSFQQTQTP---------IVSVDIPSGWDVET  171

Query  594   GDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             G+ N     P++LVSLTAPK   K F G  HFLGGRFIPP IV  + L LP YP +   V
Sbjct  172   GNPNHVYFTPNVLVSLTAPKRGVKSFPG-RHFLGGRFIPPGIVKSYNLKLPCYPSSDQVV  230

Query  414   RI  409
              I
Sbjct  231   EI  232



>ref|XP_009021779.1| hypothetical protein HELRODRAFT_192690 [Helobdella robusta]
 gb|ESO00005.1| hypothetical protein HELRODRAFT_192690 [Helobdella robusta]
Length=794

 Score =   186 bits (471),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 131/235 (56%), Gaps = 46/235 (20%)
 Frame = -2

Query  1008  YLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGG  829
             Y + +EA +ID  L     +S+DQLMELAG S A + A+ Y  K+   +LV+CGPG+NGG
Sbjct  562   YTSQKEAQDIDQELFTEYEYSVDQLMELAGQSCAVSFAKSYKDKKESDVLVVCGPGNNGG  621

Query  828   DGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-------------------------  724
             DGLV ARHL  FGY   + YP +T +  Y  L TQ                         
Sbjct  622   DGLVCARHLKLFGYNPAIFYPKRTDRPLYHNLTTQCNKMEIPFLEKLPNSTEMSKHYSVI  681

Query  723   ----------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEG  574
                       GP    F ++I  L+S K P         I+SVD+PSGW+++ G  N +G
Sbjct  682   VDALFGFSFTGPPRGHFADIISSLISSKLP---------ILSVDVPSGWNIESG--NPDG  730

Query  573   IRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             I+P +LVSLTAPKLCAK F G  HFLGGRF+PP + +K++L LP YPG  + V I
Sbjct  731   IQPDVLVSLTAPKLCAKHFKGRKHFLGGRFVPPQLANKYQLNLPEYPGIELVVDI  785



>ref|XP_004619376.1| PREDICTED: NAD(P)H-hydrate epimerase [Sorex araneus]
Length=289

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 141/241 (59%), Gaps = 34/241 (14%)
 Frame = -2

Query  1038  KKMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR--  865
             ++M S   + YL+  EA  +D  L     FS+DQLMELAGLS ATAIA+ Y PK   R  
Sbjct  51    RRMASAA-VKYLSQAEAQAVDEELFSEYQFSVDQLMELAGLSCATAIAKAYPPKAMARSS  109

Query  864   --ILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF---  703
               +LVICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +  LVTQ   ++ PF   
Sbjct  110   PTVLVICGPGNNGGDGLVCARHLRLFGYQPAIYYPKRPSKPLFASLVTQCQKMNIPFLEE  169

Query  702   --------DELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGG  592
                     DEL   +V      S K + R+  R         +  I S+DIPSGW V+ G
Sbjct  170   MPAEPTLIDELYDLVVDAIFGFSFKGDVREPFRSILNVLDGLTVPIASIDIPSGWDVEKG  229

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
               N  GI+P +L+SLTAPK  A++F G +H+LGGRF+PP++  K++L LP YP T    R
Sbjct  230   --NSAGIQPDLLISLTAPKQSARQFTGRYHYLGGRFVPPALEKKYQLNLPAYPDTECVFR  287

Query  411   I  409
             +
Sbjct  288   L  288



>gb|EAW52943.1| apolipoprotein A-I binding protein, isoform CRA_c [Homo sapiens]
Length=237

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  2     ASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  61

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  62    VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAE  121

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  122   PMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NA  179

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  180   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  236



>ref|XP_004436279.1| PREDICTED: NAD(P)H-hydrate epimerase [Ceratotherium simum simum]
Length=288

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 140/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P 
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPE  172

Query  705   ---FDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  173   PMLIDELYELVVDAIFGFSFKGDVREPFRSILSVLNGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P ML+SLTAPK  A  F G +H+LGGRF+PP++  K++L LP YP T   +R+
Sbjct  231   GGIQPDMLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVLRL  287



>ref|XP_006744324.1| PREDICTED: NAD(P)H-hydrate epimerase, partial [Leptonychotes 
weddellii]
Length=248

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 138/233 (59%), Gaps = 33/233 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +LVICG
Sbjct  17    VKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPAVLVICG  76

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP---F  703
             PG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P     
Sbjct  77    PGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPEPMLI  136

Query  702   DELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDINGEGIR  568
             DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N EGI+
Sbjct  137   DELYELVVDAIFGFSFKGDVREPFRGILGVLNGLTVPIASIDIPSGWDVEKG--NSEGIQ  194

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  195   PDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEQKYQLNLPPYPDTECVYRL  247



>ref|XP_007333047.1| hypothetical protein AGABI1DRAFT_108868 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM76324.1| hypothetical protein AGABI1DRAFT_108868 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=244

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 133/243 (55%), Gaps = 51/243 (21%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLG-FSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             + YLT + A +ID  LM   G FSIDQLMELAGL+ A  +A VYN ++Y R+LV CGPG+
Sbjct  3     MRYLTARLAQQIDEELMNASGAFSIDQLMELAGLACAQTLATVYNREKYPRVLVCCGPGN  62

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG---------------------  721
              GGDGLVAARHL  FGY   +  P    K  Y  L TQ                      
Sbjct  63    QGGDGLVAARHLGLFGYTPTVYMPKPGSKDIYKRLETQCRNMSIPILSPSPPADLSPLKQ  122

Query  720   -------------------PLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                                P+ PPFD+++  L   K P         IVSVDIPSGW+V+
Sbjct  123   SLSQTDVILDAIFGFSFQPPIRPPFDDVLPLLTQSKLP---------IVSVDIPSGWNVE  173

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GD  G G++P +LVSLTAPKL  K F G  HFLGGRF+P ++ +K +L LPLYPG S  
Sbjct  174   KGDEYGAGLQPDVLVSLTAPKLGVKEFKG-RHFLGGRFVPKAMEEKLELNLPLYPGFSQI  232

Query  417   VRI  409
             V +
Sbjct  233   VEL  235



>ref|XP_005495381.1| PREDICTED: NAD(P)H-hydrate epimerase [Zonotrichia albicollis]
Length=254

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 139/238 (58%), Gaps = 33/238 (14%)
 Frame = -2

Query  1029  GSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----I  862
             G++  +S+   +EA  ID  L     FS+DQLMELAGLS ATAIA+ Y P  +      +
Sbjct  18    GTSGAVSHPRQEEAQAIDQELFTEYKFSVDQLMELAGLSCATAIAKAYPPSSFTTSQPAV  77

Query  861   LVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----PLSPPF--  703
             LV+CGPG+NGGDGLV ARHL  FGY+  + YP ++ K  + GL TQ      P  P F  
Sbjct  78    LVVCGPGNNGGDGLVCARHLKMFGYQPTVYYPKRSSKPLFEGLTTQCNKMDIPFLPEFPA  137

Query  702   -----DELIQRLV----------SLKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDIN  583
                  DEL   +V          +++ P  S      R +  I S+DIPSGW V+ G   
Sbjct  138   EAEFIDELYGLVVDAIFGFSFTGAVREPFGSILSTLERVTVPIASIDIPSGWDVEKG--K  195

Query  582   GEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              +G++P ML+SLTAPK  A  F G +HFLGGRF+PP++ +K+ L LP YPGT   +++
Sbjct  196   ADGLQPDMLISLTAPKKAAMHFTGRYHFLGGRFVPPALQEKYSLNLPEYPGTDCVLQL  253



>ref|XP_001991181.1| GH12525 [Drosophila grimshawi]
 sp|B4JJQ3.1|NNRE_DROGR RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Drosophila grimshawi]
 gb|EDV99805.1| GH12525 [Drosophila grimshawi]
Length=233

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 127/229 (55%), Gaps = 28/229 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  +EA  +D  L     FS+DQLMELAGLS A AI + +    + R+LV CGPG+N
Sbjct  2     VKYLNQKEAINVDLELFNEYKFSVDQLMELAGLSCAHAITKCFPADRFGRVLVCCGPGNN  61

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPL---------------SPPFD  700
             GGDGLV ARHL   GY   + YP  T K  +  L  Q                  +  +D
Sbjct  62    GGDGLVCARHLALMGYTPAIYYPKPTAKPLFENLSHQCQRMEICRIDECPTVETSANSYD  121

Query  699   ELIQRLV--SLKNPRD----------SHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSML  556
              ++  L   S K P               K P I SVDIPSGW V+ G +N   + P++L
Sbjct  122   LIVDALFGFSFKPPVRVDFVPVVELLQQTKLP-IASVDIPSGWDVENGKLNDCDLEPTLL  180

Query  555   VSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             +SLTAPKLCAK F G HHFLGGRF+PP++  K++L LP YPG  +C+ +
Sbjct  181   ISLTAPKLCAKHFKGKHHFLGGRFVPPALQRKYELNLPEYPGNELCLEL  229



>gb|EHJ67260.1| apolipoprotein a binding protein [Danaus plexippus]
Length=266

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/232 (43%), Positives = 133/232 (57%), Gaps = 30/232 (13%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             I+YL+ + A  +D  L     FS+DQLMELAGLS+ATA+A+VY    Y+  LV+CGPG+N
Sbjct  35    INYLSQENAAALDQDLFTEYKFSVDQLMELAGLSVATAVAKVYPSSTYKSALVVCGPGNN  94

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGP---------------LSPPFD  700
             GGDGLVAARH+  FGY++ + YP +TPK  Y  L+ Q                 +   + 
Sbjct  95    GGDGLVAARHMTLFGYKVAIYYPKRTPKPLYENLLLQCEKFGVTVLQSLPPKEDVKKEYK  154

Query  699   ELIQRL--VSLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              L+  L   S K P     K  +         + SVDIPSGW V+ G  +   ++P++L+
Sbjct  155   VLVDALFGFSFKPPVREALKPALDVLIDSGLPVCSVDIPSGWDVEKGPQSENSLQPNLLI  214

Query  552   SLTAPKLCAK----RFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             SL+APKLCAK          H+LGGRF+PP I+DK+ L LP YPG    V I
Sbjct  215   SLSAPKLCAKPEILSKLNCKHYLGGRFLPPGIIDKYNLTLPPYPGQDQVVEI  266



>ref|XP_001116635.2| PREDICTED: apolipoprotein A-I-binding protein-like isoform 1 
[Macaca mulatta]
Length=307

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 134/246 (54%), Gaps = 51/246 (21%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  72    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  131

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------  724
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ               
Sbjct  132   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  191

Query  723   ---------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGW  607
                                  G +  PF  ++  L  L  P         I S+DIPSGW
Sbjct  192   PTMIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVP---------IASIDIPSGW  242

Query  606   HVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGT  427
              V+ G  N  GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T
Sbjct  243   DVEKG--NSGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDT  300

Query  426   SMCVRI  409
             +   R+
Sbjct  301   ACVYRL  306



>ref|XP_010952189.1| PREDICTED: NAD(P)H-hydrate epimerase [Camelus bactrianus]
 ref|XP_010997754.1| PREDICTED: NAD(P)H-hydrate epimerase [Camelus dromedarius]
Length=288

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             +++ + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASSAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P 
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPE  172

Query  705   ---FDELIQRLVS----------LKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S     H  +  I S+DIPSGW V+ G  N 
Sbjct  173   PMLIDELYELVVDAIFGFSFKGDVREPFHSILSVLHGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_004027026.1| PREDICTED: NAD(P)H-hydrate epimerase [Gorilla gorilla gorilla]
Length=288

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAE  172

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  173   PMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NA  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_005541489.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X2 [Macaca fascicularis]
 ref|XP_011934111.1| PREDICTED: NAD(P)H-hydrate epimerase [Cercocebus atys]
 ref|XP_011768153.1| PREDICTED: NAD(P)H-hydrate epimerase [Macaca nemestrina]
Length=307

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  72    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  131

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  132   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  191

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  192   PTMIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NS  249

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T+   R+
Sbjct  250   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTACVYRL  306



>ref|XP_003259513.1| PREDICTED: NAD(P)H-hydrate epimerase [Nomascus leucogenys]
Length=288

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  172

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  173   PMMIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_007974930.1| PREDICTED: NAD(P)H-hydrate epimerase [Chlorocebus sabaeus]
Length=307

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 134/246 (54%), Gaps = 51/246 (21%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  72    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  131

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------  724
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ               
Sbjct  132   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  191

Query  723   ---------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGW  607
                                  G +  PF  ++  L  L  P         I S+DIPSGW
Sbjct  192   PTMIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVP---------IASIDIPSGW  242

Query  606   HVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGT  427
              V+ G  N  GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T
Sbjct  243   DVEKG--NSGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDT  300

Query  426   SMCVRI  409
             +   R+
Sbjct  301   ACVYRL  306



>sp|E3XA68.1|NNRE_ANODA RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Anopheles darlingi]
Length=228

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 129/229 (56%), Gaps = 27/229 (12%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSN  835
             + YL  QEA  ID  L     FS+DQLMELAGLS A  IA+ Y P E  +IL+ CGPG+N
Sbjct  1     MKYLNQQEAISIDEELFNEYKFSVDQLMELAGLSCAHVIADAYAP-ESNKILICCGPGNN  59

Query  834   GGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG---------------PLSPPFD  700
             GGDGLVAARHL    Y  ++ YP +T K  +  L  Q                 +   F 
Sbjct  60    GGDGLVAARHLALMNYNPYVYYPKRTEKELFRNLQHQAESMGITVTTDCPDGASVEQEFG  119

Query  699   ELIQRLV--SLKNP-RDS--------HRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLV  553
              ++  L   S K P RDS         R    IVS+DIPSGW+V+ G  N   I+P+ L+
Sbjct  120   LIVDALFGFSFKPPVRDSFLPIMNVLQRSKLPIVSIDIPSGWNVEEGPQNESDIQPACLI  179

Query  552   SLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIG  406
             SLTAPKLCAKR     H+LGGRF+P  + +K+ L LP Y G+++ V++ 
Sbjct  180   SLTAPKLCAKRLLNAQHYLGGRFVPKRLEEKYSLELPSYLGSNLFVKLN  228



>ref|XP_006155254.1| PREDICTED: NAD(P)H-hydrate epimerase [Tupaia chinensis]
Length=237

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 137/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             +++ + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  2     ASSVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  61

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLS  712
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ            P  
Sbjct  62    VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  121

Query  711   PPFDELIQRLV-------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
             P   E +  LV       S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  122   PLMIEELYELVVDAIFGFSFKGDVREPFRSILSVLSGLTVPIASIDIPSGWDVEKG--NS  179

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  180   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  236



>ref|XP_003742116.1| PREDICTED: NAD(P)H-hydrate epimerase-like [Metaseiulus occidentalis]
Length=246

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 138/241 (57%), Gaps = 49/241 (20%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVY---NPKEYRRILVICGP  844
             I+YLT ++AT ID  L G  GF+IDQLMELAGL++ATAIA+ Y   +     ++L+  GP
Sbjct  17    ITYLTQEQATNIDVELFGDYGFTIDQLMELAGLAVATAIAKAYPPPSKAPPPKVLICSGP  76

Query  843   GSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-------------------  721
             G+NGGDGLVAARHL +FGY+  + YP QT K  +  L  Q                    
Sbjct  77    GNNGGDGLVAARHLKWFGYDPCIFYPKQTAKPIFAALRRQCEEMEISFMSFLPDANLVDN  136

Query  720   ----------------PLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGD  589
                             P+ P F E++Q++   K P         IVSVD+PSGW V+ G 
Sbjct  137   NFTLAVDALFGFGFKPPVRPEFVEVLQKMCRFKTP---------IVSVDVPSGWDVETGP  187

Query  588   INGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              + + I+P M+VSLTAPK   + F+G  H+LGGR+IP S+  KF L LP YPGT + V++
Sbjct  188   -HQDSIKPDMVVSLTAPKKGMQNFHG-KHYLGGRYIPDSLAAKFNLKLPRYPGTELVVQL  245

Query  408   G  406
             G
Sbjct  246   G  246



>ref|XP_011783825.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Colobus angolensis 
palliatus]
 ref|XP_011783826.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Colobus angolensis 
palliatus]
Length=304

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  69    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  128

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  129   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  188

Query  702   ----DELIQRLV----------SLKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  189   PTMIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NS  246

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T+   R+
Sbjct  247   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTACVYRL  303



>gb|KIY71990.1| YjeF N-terminal domain-like protein [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=241

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 130/241 (54%), Gaps = 49/241 (20%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLG-FSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             + YLT + A +ID  LM   G FSIDQLMELAGL+ A A+A VYN  ++ R+LV CGPG+
Sbjct  3     MRYLTAKLAQQIDEELMSSAGAFSIDQLMELAGLACAQALATVYNKDKHPRVLVCCGPGN  62

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ----------------------  724
              GGDGLVAARHL  FGYE  +  P    K  Y  L TQ                      
Sbjct  63    QGGDGLVAARHLSLFGYEPTIYMPKPGSKDIYKRLTTQSDNMKIETIPPSADVEPLKKAL  122

Query  723   ----------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGG  592
                             GP+  PFD  ++ +   + P         IVSVDIPSGW V+GG
Sbjct  123   ASSDVILDAIFGFSFKGPVRAPFDSALKLITESRLP---------IVSVDIPSGWDVEGG  173

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVR  412
              +  EG+ P +L+SLTAPK   + F G  HFLGGRF+P ++ D+F+L +P YPG    V 
Sbjct  174   KVLDEGLDPDVLISLTAPKEGVRAFQG-RHFLGGRFVPKTLEDRFQLNIPAYPGFDQIVE  232

Query  411   I  409
             +
Sbjct  233   L  233



>ref|XP_010354715.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Rhinopithecus 
roxellana]
Length=307

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  72    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  131

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  132   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  191

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  192   PTMIDELYELVVDAIFGFSFKGDVREPFHSILSILKGLTVPIASIDIPSGWDVEKG--NS  249

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T+   R+
Sbjct  250   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTACVYRL  306



>emb|CDS07645.1| hypothetical protein LRAMOSA01594 [Absidia idahoensis var. thermophila]
Length=235

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 126/232 (54%), Gaps = 42/232 (18%)
 Frame = -2

Query  1005  LTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGGD  826
             L+ + A  ID  LM   GFS+DQLMELAGLS+A A+   Y+  ++  +LV  GPG+NGGD
Sbjct  6     LSQKVAQAIDEELMSSGGFSVDQLMELAGLSVAQAVQRTYDRTQFPNVLVCVGPGNNGGD  65

Query  825   GLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ--------------------------  724
             GLVAARHL++FGY+  L YP Q  K  Y  L+ Q                          
Sbjct  66    GLVAARHLYHFGYKPSLYYPKQPNKDLYQRLLVQCNQLGLSVHDTFADKTVEEADVLVDA  125

Query  723   -------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRP  565
                    G +  PF E+++   + K P         IVSVDIPSGW V+ G  N    +P
Sbjct  126   VFGFSFKGDVRDPFKEVVKTFETTKKP---------IVSVDIPSGWDVEQGPSNNVKFQP  176

Query  564   SMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              +LVSLTAPK+CA  F G  HFLGGRF+PP+I  K+   +P + G+   V +
Sbjct  177   DVLVSLTAPKICANHFKGKRHFLGGRFVPPAIAKKYDFEVPPFHGSDQVVEL  228



>ref|XP_513889.1| PREDICTED: NAD(P)H-hydrate epimerase [Pan troglodytes]
Length=288

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAE  172

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  173   PMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NA  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>emb|CAC86580.1| apoA-I binding protein [Homo sapiens]
 gb|AAI00932.1| Apolipoprotein A-I binding protein [Homo sapiens]
 gb|AAI00934.1| Apolipoprotein A-I binding protein [Homo sapiens]
 gb|AAI00935.1| Apolipoprotein A-I binding protein [Homo sapiens]
Length=288

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAE  172

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  173   PMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NA  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|NP_658985.2| NAD(P)H-hydrate epimerase precursor [Homo sapiens]
 sp|Q8NCW5.2|NNRE_HUMAN RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=Apolipoprotein 
A-I-binding protein; Short=AI-BP; AltName: Full=NAD(P)HX 
epimerase; AltName: Full=YjeF N-terminal domain-containing 
protein 1; Short=YjeF_N1; Flags: Precursor [Homo sapiens]
Length=288

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAE  172

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  173   PMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NA  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_003821095.1| PREDICTED: NAD(P)H-hydrate epimerase [Pan paniscus]
Length=307

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  72    ASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  131

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  132   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAE  191

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  192   PMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NA  249

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  250   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  306



>ref|XP_007457946.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Lipotes vexillifer]
 ref|XP_007457947.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X2 [Lipotes vexillifer]
Length=288

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 140/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             +++ + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASSAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P 
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPE  172

Query  705   ---FDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  173   PTLIDELYELVVDAIFGFSFKGDVREPFRSILSVLNGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSASQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>dbj|BAG60492.1| unnamed protein product [Homo sapiens]
Length=307

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  72    ASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  131

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  132   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAE  191

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  192   PMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NA  249

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  250   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  306



>ref|XP_004284599.1| PREDICTED: NAD(P)H-hydrate epimerase isoform 1 [Orcinus orca]
 ref|XP_004284600.1| PREDICTED: NAD(P)H-hydrate epimerase isoform 2 [Orcinus orca]
Length=288

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 140/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             +++ + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASSAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P 
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPE  172

Query  705   ---FDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  173   PTLIDELYELVVDAIFGFSFKGDVREPFRSILSVLNGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSASQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_006895814.1| PREDICTED: NAD(P)H-hydrate epimerase [Elephantulus edwardii]
Length=288

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 136/233 (58%), Gaps = 33/233 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y      R    +LVICG
Sbjct  57    VKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPSTSMSRSPPTVLVICG  116

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLSPPF-  703
             PG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ            PL P   
Sbjct  117   PGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLSEMPLEPMLI  176

Query  702   DELIQRLVS----------LKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDINGEGIR  568
             DEL + +V           ++ P  S  K     +  I SVDIPSGW V+ G  N EG++
Sbjct  177   DELYELVVDAIFGFSFKGDVREPFQSILKVLKGVTVPIASVDIPSGWDVEKG--NSEGLQ  234

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  235   PDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_002413577.1| apolipoprotein A-I-binding protein, putative [Ixodes scapularis]
 sp|B7QDG3.1|NNRE_IXOSC RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Ixodes scapularis]
 gb|EEC16885.1| apolipoprotein A-I-binding protein, putative [Ixodes scapularis]
Length=275

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 139/246 (57%), Gaps = 52/246 (21%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVY----NPKEYRRILVICG  847
             ++Y++ +EA +ID  L     +S+DQLMELAGLS+ATA+A+ Y     PK    +LV CG
Sbjct  41    LNYVSQEEAIKIDQELFSEYAYSVDQLMELAGLSVATAVAKSYPRGPMPKG-GTVLVCCG  99

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG------------------  721
             PG+NGGDGLV ARHL  FGYE  + YP Q+ K  +  L  Q                   
Sbjct  100   PGNNGGDGLVCARHLKLFGYEPSVFYPKQSNKPLFQNLTKQCQEMEVPFLSFLPDSQLVS  159

Query  720   -----------------PLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD-G  595
                              P+ P F++++ +L  +K P         +VS+DIPSGW V+ G
Sbjct  160   DSYNLVVDALFGFSFKPPVRPEFNDVMDKLKKVKIP---------VVSIDIPSGWDVETG  210

Query  594   GDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             GD   + ++P  LVSLTAPK C++ F G  H+LGGRF+PP++  K++L LP YPGT  C+
Sbjct  211   GD--ADSLQPECLVSLTAPKRCSRNFKGRFHWLGGRFVPPALAAKYELNLPPYPGTDCCL  268

Query  414   RIGRPP  397
              +  PP
Sbjct  269   LLTPPP  274



>ref|XP_004311921.1| PREDICTED: NAD(P)H-hydrate epimerase isoform 1 [Tursiops truncatus]
 ref|XP_004311922.1| PREDICTED: NAD(P)H-hydrate epimerase isoform 2 [Tursiops truncatus]
Length=288

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 140/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             +++ + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASSAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P 
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPE  172

Query  705   ---FDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  173   PTLIDELYELVVDAIFGFSFKGDVREPFRSILSVLNGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSASQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_002296768.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 sp|B8LCD8.1|NNRE_THAPS RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Thalassiosira pseudonana]
 gb|EED86969.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=250

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 138/250 (55%), Gaps = 45/250 (18%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVY----------NPK  877
             S     YL  Q+A  +D  LM   GFS++QLMELAGLS+A A+ EV           +  
Sbjct  2     SNIQTGYLNAQDAAALDVELMSTPGFSLEQLMELAGLSVAEAVYEVAFGGDGEKASNDGG  61

Query  876   EYRRILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----PL-  715
               +R+L++CGPG+NGGDGLVAARHL +FG E  + YP Q+ K  +  LV Q      P+ 
Sbjct  62    RKKRVLLVCGPGNNGGDGLVAARHLAHFGLESTIVYPKQSSKQHFVNLVKQCEDMGIPIL  121

Query  714   -------------SPPFDELIQRLVSLK----NPRDSH-----------RKSPVIVSVDI  619
                             +D ++  +         PR+ +           ++  V++SVD+
Sbjct  122   QEIPSTNDSSKVEETKYDVIVDAIFGFSFHGTAPREPYATAISQMVQLQKEQSVLLSVDV  181

Query  618   PSGWHVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPL  439
             PSGW VDGGD+ G    P +L+SLTAPKL AK+F G  HF+GGRF+PPSI +K+ +  P 
Sbjct  182   PSGWDVDGGDLTGTNFHPDVLISLTAPKLSAKKFEG-RHFVGGRFLPPSIAEKYGIQKPP  240

Query  438   YPGTSMCVRI  409
             YPG S  + +
Sbjct  241   YPGVSQVMEL  250



>gb|EAW52941.1| apolipoprotein A-I binding protein, isoform CRA_a, partial [Homo 
sapiens]
Length=302

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  67    ASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  126

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  127   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAE  186

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  187   PMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NA  244

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  245   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  301



>ref|XP_002164619.2| PREDICTED: NAD(P)H-hydrate epimerase-like [Hydra vulgaris]
Length=269

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 136/241 (56%), Gaps = 54/241 (22%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVY------NPKEYRRILVI  853
             + +L   EA  ID  L+    ++++QLMELAGLS+A+A+A+ +      NP   +++L+ 
Sbjct  36    MKFLNQVEAQNIDVELINDYKYTLEQLMELAGLSVASAVAKSFPLDSLSNPN--KKVLIC  93

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-----------------  724
             CGPG+NGGDGLVAARHL  FGY   + YP +  K  +  LV Q                 
Sbjct  94    CGPGNNGGDGLVAARHLKLFGYSPEIFYPKRPKKELFNNLVIQCKRQFITFIEELPDAGY  153

Query  723   ------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                               G + PPFD +I+ L ++  P         + SVDIPSGW+V+
Sbjct  154   INENYNFIIDAIFGFSFRGDVRPPFDSMIEMLKTVSIP---------LASVDIPSGWNVE  204

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              G  N +GI+P +L+SLTAPKLCA RF G HH+LGGRF+P ++ +K+ L LP +PGT   
Sbjct  205   NG--NPDGIKPEVLISLTAPKLCAARFKGEHHYLGGRFVPKALENKYHLDLPFFPGTDCV  262

Query  417   V  415
             V
Sbjct  263   V  263



>ref|XP_007110412.1| PREDICTED: NAD(P)H-hydrate epimerase [Physeter catodon]
Length=288

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 140/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             +++ + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASSAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ   +  PF       
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLDEMPPE  172

Query  702   ----DELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  173   PMLIDELYELVVDAIFGFSFKGDVREPFRSILSVLSGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_003937893.1| PREDICTED: NAD(P)H-hydrate epimerase [Saimiri boliviensis boliviensis]
Length=288

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ   +  PF       
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  172

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  173   PTVIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NP  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   AGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_004480658.1| PREDICTED: NAD(P)H-hydrate epimerase isoform 2 [Dasypus novemcinctus]
Length=305

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++  +  L+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y PK   R    IL
Sbjct  70    ASAAVKLLSQEEAQAVDEELFNQYQFSVDQLMELAGLSCATAIAKAYPPKSMSRSLPTIL  129

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  ++ LVTQ   +  PF       
Sbjct  130   VICGPGNNGGDGLVCARHLKLFGYQPAIYYPKRPNKPLFSALVTQCQKMDIPFLDEMPPE  189

Query  702   ----DELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL   +V      S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  190   PMLIDELYDLVVDAIFGFSFKGDVREPFRNILSVLSGLTVPIASIDIPSGWDVEKG--NS  247

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             +GI+P +L+SLTAPK CA  F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  248   DGIQPDLLISLTAPKKCATHFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  304



>ref|XP_004693907.1| PREDICTED: NAD(P)H-hydrate epimerase [Condylura cristata]
Length=288

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P 
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPSIYYPKRPNKPLFTALVTQCQKMDITFLGEMPPE  172

Query  705   ---FDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL   +V      S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  173   PMLIDELYDLVVDAIFGFSFKGDVREPFRSILSVLSGLTVPIASIDIPSGWDVEKG--NP  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPAYPDTECVYRL  287



>ref|XP_002760154.1| PREDICTED: NAD(P)H-hydrate epimerase [Callithrix jacchus]
Length=307

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  72    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  131

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ   +  PF       
Sbjct  132   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  191

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  192   PMVIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NP  249

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  250   AGIQPDLLISLTAPKTSAAQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  306



>ref|XP_003061593.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54223.1| predicted protein [Micromonas pusilla CCMP1545]
Length=224

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 137/218 (63%), Gaps = 36/218 (17%)
 Frame = -2

Query  954  GFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGGDGLVAARHLHYFGYELFL  775
            GFSIDQLMELAGLS+A+AI E Y P+ + R+LVI GPG+NGGDGLVAARHL +FGY++ +
Sbjct  6    GFSIDQLMELAGLSVASAIRETYPPETHPRVLVIAGPGNNGGDGLVAARHLTHFGYDVSV  65

Query  774  CYPMQTP-KHPYTGLVTQ----------------GPLSPP------FDELIQRLVSL---  673
            CYP ++P K  Y GLVTQ                G  +PP       D  +  +      
Sbjct  66   CYPKRSPGKALYEGLVTQCETLGVTFVSADALVGGGAAPPPPLRETHDVAVDAMFGFSFA  125

Query  672  ---KNPRDS-----HRKS--PVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKLCAK  523
               + P D+     H+++  P IV+VDIPSGW VD GD+ G+G+RP  LVSLTAPK+ A 
Sbjct  126  GAPRAPFDALLALLHQRASPPPIVAVDIPSGWDVDDGDVFGDGMRPETLVSLTAPKIGAT  185

Query  522  RFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             F G HHFLGGRF+PP + ++F L  P Y G   CVRI
Sbjct  186  AFAGAHHFLGGRFVPPRMKEEFGLRAPEYEGAKQCVRI  223



>ref|XP_003373968.1| meiotically up-regulated protein 182 protein [Trichinella spiralis]
 gb|EFV53840.1| meiotically up-regulated protein 182 protein [Trichinella spiralis]
Length=287

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 124/228 (54%), Gaps = 42/228 (18%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNP-KEYRRILVICGPGS  838
             + YLT QEA  ID  L     FS+DQLMELAGLS A +I + Y P + +  +L++CGPG+
Sbjct  56    VKYLTQQEAINIDTELFDEYQFSVDQLMELAGLSCANSILKAYPPGQSFNNVLIVCGPGN  115

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG---------------------  721
             NGGDGLV ARHL  F Y+  + YP          L+TQ                      
Sbjct  116   NGGDGLVCARHLKMFNYQPHVVYPANPRSILMKRLLTQVKGFRIPISDSLEGINMNTFHL  175

Query  720   ------------PLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGE  577
                         P   P+  ++Q+L            S  +VS+DIPSGWHV+ G I+G+
Sbjct  176   IVDAIFGFSFKPPAKEPYKTILQQLAKFN--------SIPVVSIDIPSGWHVEQGPIDGD  227

Query  576   GIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYP  433
              ++P  L+SLTAPK CA +F G  HFLGGRF+P S+ DK++L LP YP
Sbjct  228   ALQPKCLISLTAPKKCAIKFRGDFHFLGGRFVPESVADKYQLNLPAYP  275



>gb|ELU17607.1| hypothetical protein CAPTEDRAFT_226012 [Capitella teleta]
Length=365

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 124/229 (54%), Gaps = 51/229 (22%)
 Frame = -2

Query  993  EATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICGPGSNGGD  826
            EA  ID  L     FS+DQLMELAGLS A AI++VY  +   R    ILV CGPG+NGGD
Sbjct  76   EAQNIDQELFSEFAFSVDQLMELAGLSCAVAISKVYPKESLTREKGAILVACGPGNNGGD  135

Query  825  GLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-------------------------  721
            GLV ARHL  FGY   L YP +  K  +  L TQ                          
Sbjct  136  GLVCARHLKLFGYRPTLFYPKKPNKELFQNLTTQCEKMDIPFLSYLPSDAQLIHDSYNLI  195

Query  720  -----------PLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEG  574
                       P  P F  +I ++     P         ++S+D+PSGW V+ G  N EG
Sbjct  196  IDALFGFSFKPPARPEFATIISKIQESGLP---------VISIDVPSGWEVEKG--NPEG  244

Query  573  IRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGT  427
            I+P ML+SLTAPKLCAK+F+G HH+LGGRF+PP +  K++L LP YPG+
Sbjct  245  IQPEMLISLTAPKLCAKQFFGKHHYLGGRFVPPDLAKKYELSLPPYPGS  293



>ref|XP_003475685.2| PREDICTED: NAD(P)H-hydrate epimerase [Cavia porcellus]
Length=303

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 138/240 (58%), Gaps = 33/240 (14%)
 Frame = -2

Query  1035  KMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR---  865
             K+ + T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y      +   
Sbjct  65    KVMAGTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPAASLSKSPP  124

Query  864   -ILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------  721
              +LVICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ            
Sbjct  125   AVLVICGPGNNGGDGLVCARHLKLFGYQPSIYYPKRPNKPLFTALVTQCQKMDIPFLGEM  184

Query  720   PLSPPF-DELIQRLVS----------LKNPRDS-----HRKSPVIVSVDIPSGWHVDGGD  589
             P  PP  DEL + +V           ++ P  S     H  +  I S+DIPSGW V+ G 
Sbjct  185   PSEPPMIDELYELVVDAIFGFSFKGDVREPFRSILSVLHELTVPIASIDIPSGWDVEKG-  243

Query  588   INGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              +  GI+P ML+SLTAPK  A +F G +H+LGGRF+PP++  K+ L LP YP T    R+
Sbjct  244   -SSGGIQPDMLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYHLNLPPYPDTECVYRL  302



>dbj|BAM18021.1| apolipoprotein a binding protein [Papilio xuthus]
Length=264

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 134/237 (57%), Gaps = 28/237 (12%)
 Frame = -2

Query  1035  KMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILV  856
             K+ +   + YL+ ++A  +D  L     FS+DQLMELAGLS+A AIA+ + P  +   L+
Sbjct  27    KLINVCNMHYLSQKDAAALDQDLFNEYKFSVDQLMELAGLSVAAAIAKTFPPSTHNSALI  86

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------G  721
             ICGPG+NGGDGLVAARH+  FGY + + YP +TPK  Y  L+ Q                
Sbjct  87    ICGPGNNGGDGLVAARHMTLFGYNVSVHYPKRTPKPLYENLLHQCEQFGVHIVEKLPQPN  146

Query  720   PLSPPFDELIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEG  574
              L   +  L+  L   S K P     K  +         + SVDIPSGW V+ G I+ + 
Sbjct  147   ELRNDYKVLVDALFGFSFKPPVREELKPALDALIEGGLPVCSVDIPSGWDVEKGPISEKS  206

Query  573   IRPSMLVSLTAPKLCAKRFY--GPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             ++P++L+SL+APK CAKR +     HFLGGRF+PP I+ K+ L LP YP     V I
Sbjct  207   LKPALLISLSAPKQCAKREFIDTAKHFLGGRFLPPGIITKYNLKLPEYPNQDQIVEI  263



>ref|XP_008515064.1| PREDICTED: NAD(P)H-hydrate epimerase, partial [Equus przewalskii]
Length=243

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 137/236 (58%), Gaps = 33/236 (14%)
 Frame = -2

Query  1023  TTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILV  856
             T  +++L+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +LV
Sbjct  9     TQAVAFLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLV  68

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG------------PLS  712
             +CGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ             P S
Sbjct  69    VCGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPES  128

Query  711   PPFDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDINGE  577
                DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N  
Sbjct  129   MLIDELYELVVDAIFGFSFKGDVREPFRSILSVLNGLTVPIASIDIPSGWDVEKG--NSG  186

Query  576   GIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             GI+P +L+SLTAPK  A  F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  187   GIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  242



>ref|XP_006232671.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Rattus norvegicus]
 sp|B0BNM1.1|NNRE_RAT RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=Apolipoprotein 
A-I-binding protein; Short=AI-BP; AltName: Full=NAD(P)HX 
epimerase; Flags: Precursor [Rattus norvegicus]
 gb|EDM00740.1| rCG62645, isoform CRA_b [Rattus norvegicus]
 gb|AAI58877.1| Apoa1bp protein [Rattus norvegicus]
Length=282

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++  + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    +    +L
Sbjct  47    ASAAVKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVL  106

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +TGLVTQ         G + P 
Sbjct  107   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPE  166

Query  705   ---FDELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  167   PMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKG--NP  224

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  225   SGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPAYPDTECVYRL  281



>ref|XP_002715421.2| PREDICTED: NAD(P)H-hydrate epimerase [Oryctolagus cuniculus]
Length=303

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  68    ASTSVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPAVL  127

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ   +  PF       
Sbjct  128   VICGPGNNGGDGLVCARHLKLFGYQPAIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  187

Query  702   ----DELIQRLV------SLKNP-RDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V      S K   R+  R         +  I S+DIPSGW V+ G  + 
Sbjct  188   PMMIDELYELVVDAIFGFSFKGEVREPFRSILSVLSGLTVPIASIDIPSGWDVEKG--SS  245

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  246   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  302



>ref|XP_001500364.1| PREDICTED: NAD(P)H-hydrate epimerase [Equus caballus]
Length=288

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTGVKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG------------PL  715
             V+CGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ             P 
Sbjct  113   VVCGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPE  172

Query  714   SPPFDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
             S   DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  173   SMLIDELYELVVDAIFGFSFKGDVREPFRSILSVLNGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A  F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|NP_001072132.1| NAD(P)H-hydrate epimerase precursor [Sus scrofa]
 sp|Q0PIT9.1|NNRE_PIG RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=Apolipoprotein 
A-I-binding protein; Short=AI-BP; AltName: Full=NAD(P)HX 
epimerase; Flags: Precursor [Sus scrofa]
 gb|ABH01264.1| apoliprotein A-I binding protein [Sus scrofa]
Length=288

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             +++ + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+VY P    R    +L
Sbjct  53    ASSAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKVYPPTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGY   + YP +  K  +T LVTQ   +  PF       
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYHPTIYYPKRPNKPLFTALVTQCQKMDIPFLDEMPSE  172

Query  702   ----DELIQRLV------SLKNP-RDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V      S K   R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  173   PTLIDELYELVVDAIFGFSFKGEVREPFRSILSVLNGLTVPIASIDIPSGWDVERG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSAAQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_007171916.1| PREDICTED: NAD(P)H-hydrate epimerase [Balaenoptera acutorostrata 
scammoni]
Length=288

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             +++ + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASSAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P 
Sbjct  113   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPE  172

Query  705   ---FDELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N 
Sbjct  173   PLLIDELYELVVDAIFGFSFKGDVREPFRSILSVLNGLTVPIASIDIPSGWDVEKG--NS  230

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A  F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  231   GGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>ref|XP_009861136.1| PREDICTED: NAD(P)H-hydrate epimerase-like [Ciona intestinalis]
Length=287

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/240 (41%), Positives = 131/240 (55%), Gaps = 47/240 (20%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYR-RILVICGPGS  838
             + +L  QEA  ID  L     FS+DQLME+AGLS A  +A  Y       ++L+ICGPG+
Sbjct  57    LKFLNQQEAINIDQELFNEYKFSVDQLMEIAGLSCAHVVANAYPLSSGSGKVLIICGPGN  116

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGP--------------------  718
             NGGDGLV ARHL  FGYE  + YP +  K  +  L TQ                      
Sbjct  117   NGGDGLVCARHLSLFGYEPHILYPKRPKKPLFEALTTQCEKMGLHFLTEMPSAKDITLNY  176

Query  717   -----------------LSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGD  589
                              +  PFD++I  LV+L    D+H     I SVDIPSGW V+G D
Sbjct  177   RCVVDAIFGFSFNSKSGIRAPFDDIIATLVTL----DNHP----ICSVDIPSGWDVEG-D  227

Query  588   INGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             +    ++P  L+SLTAPKLCAK+F G  H++GGRF+P ++ +K++L LP YPGT   +R+
Sbjct  228   VKENSLKPDCLISLTAPKLCAKQFKGTFHYIGGRFVPKALAEKYQLNLPNYPGTDSILRL  287



>sp|B4NEH6.2|NNRE_DROWI RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=NAD(P)HX 
epimerase [Drosophila willistoni]
Length=238

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 133/236 (56%), Gaps = 34/236 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVY--------NPKEYRRIL  859
             + YL   EA ++D +L     FS+DQLMELAGLS A A+A+ +        +     R+L
Sbjct  2     LKYLNQAEAIKVDQILFNEYKFSVDQLMELAGLSCAHAVAKCFPSPCQGNDDKAGKLRVL  61

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPL--------SPPF  703
             V CGPG+NGGDGLV ARHL   GYE  + YP  T K  Y  L  Q  L         P  
Sbjct  62    VCCGPGNNGGDGLVCARHLALMGYEPTIYYPKPTAKPLYENLHHQCELMEISTISQCPSV  121

Query  702   DE-------LIQRLV--SLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGE  577
             +E       ++  L   S K P  S   S +         I S+DIPSGW V+ G +N  
Sbjct  122   EEAAHSYHLIVDALFGFSFKPPVRSDFLSVMELMQQTKIPIASIDIPSGWDVEKGKLNDC  181

Query  576   GIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              + P +L+SLTAPKLCAK F G +H+LGGRF+PP++  +++L LP YPGT +CV++
Sbjct  182   ELEPKLLISLTAPKLCAKHFKGQYHYLGGRFVPPALQRQYELNLPNYPGTELCVKL  237



>ref|XP_005943617.1| PREDICTED: NAD(P)H-hydrate epimerase-like [Haplochromis burtoni]
Length=283

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 133/232 (57%), Gaps = 32/232 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYN----PKEYRRILVICG  847
             I YL  +EA  ID  L    GFS+DQLMELAGLS ATA+   Y      K    +LVICG
Sbjct  54    IKYLGQEEAQHIDEELFSEYGFSVDQLMELAGLSCATAVTRAYPLTSLVKARPSLLVICG  113

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLSPPFD  700
             PG+NGGDGLV ARHL  FGYE  + YP +  K  + GL TQ            P +   D
Sbjct  114   PGNNGGDGLVCARHLKLFGYEPTILYPKRPNKPLFQGLTTQCQKMEIPFLTEMPEAKAID  173

Query  699   ELIQRLV----------SLKNP----RDSHRKSPV-IVSVDIPSGWHVDGGDINGEGIRP  565
             E    ++          +++ P     D+ +KS V I S+DIPSGW V+ G  +G  ++P
Sbjct  174   EAYNLVIDAIFGFSFKGAVREPFGSILDTLKKSTVPIASIDIPSGWDVEQGSTDG--LQP  231

Query  564   SMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              ML+SLTAPK  A  F G +HFLGGRF+PP +  K++L LP YPGT   +++
Sbjct  232   DMLISLTAPKKSASLFKGRYHFLGGRFVPPGLEKKYQLNLPQYPGTDCVLQL  283



>ref|XP_006794459.1| PREDICTED: NAD(P)H-hydrate epimerase-like [Neolamprologus brichardi]
Length=283

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 133/232 (57%), Gaps = 32/232 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYN----PKEYRRILVICG  847
             I YL  +EA  ID  L    GFS+DQLMELAGLS ATA+   Y      K    +LVICG
Sbjct  54    IKYLGQEEAQHIDEELFSEYGFSVDQLMELAGLSCATAVTRAYPLTSLVKARPSLLVICG  113

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLSPPFD  700
             PG+NGGDGLV ARHL  FGYE  + YP +  K  + GL TQ            P +   D
Sbjct  114   PGNNGGDGLVCARHLKLFGYEPTILYPKRPNKPLFQGLTTQCQKMEIPFLTEMPEAKAID  173

Query  699   ELIQRLV----------SLKNP----RDSHRKSPV-IVSVDIPSGWHVDGGDINGEGIRP  565
             E    ++          +++ P     D+ +KS V I S+DIPSGW V+ G  +G  ++P
Sbjct  174   EAYNLVIDAIFGFSFKGAVREPFGSILDTLKKSTVPIASIDIPSGWDVEQGSTDG--LQP  231

Query  564   SMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              ML+SLTAPK  A  F G +HFLGGRF+PP +  K++L LP YPGT   +++
Sbjct  232   DMLISLTAPKKSASLFKGRYHFLGGRFVPPGLEKKYQLNLPQYPGTDCVLQL  283



>ref|XP_006174648.1| PREDICTED: NAD(P)H-hydrate epimerase [Camelus ferus]
Length=330

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 139/237 (59%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             +++ + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  95    ASSAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  154

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP  706
             VICGPG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P 
Sbjct  155   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPE  214

Query  705   ---FDELIQRLVS----------LKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S     H  +  I S+DIPSGW V+ G  N 
Sbjct  215   PMLIDELYELVVDAIFGFSFKGDVREPFHSILSVLHGLTVPIASIDIPSGWDVEKG--NS  272

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  273   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  329



>ref|XP_003892881.1| PREDICTED: NAD(P)H-hydrate epimerase [Papio anubis]
Length=307

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 139/235 (59%), Gaps = 34/235 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  72    ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  131

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF       
Sbjct  132   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  191

Query  702   ----DELIQRLV----------SLKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  192   PTMIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG--NS  249

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
              GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T+ C+
Sbjct  250   GGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTA-CI  303



>ref|XP_002810067.1| PREDICTED: NAD(P)H-hydrate epimerase [Pongo abelii]
Length=302

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 138/239 (58%), Gaps = 34/239 (14%)
 Frame = -2

Query  1038  KKMGSTTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR--  865
             K M  T P  +L+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R  
Sbjct  63    KVMADTGPRVFLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSP  122

Query  864   --ILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF---  703
               +LVICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ   +  PF   
Sbjct  123   PTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGE  182

Query  702   --------DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGG  592
                     DEL + +V           ++ P  S        +  I S+DIPSGW V+ G
Sbjct  183   MPSEPMMIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKG  242

Query  591   DINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
               N  GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T  CV
Sbjct  243   --NSGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTE-CV  298



>ref|XP_011848179.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X1 [Mandrillus leucophaeus]
Length=368

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 134/246 (54%), Gaps = 51/246 (21%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  133   ASTAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVL  192

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------------  724
             VICGPG+NGGDGLV ARHL  FGYE  + YP +  K  +T LVTQ               
Sbjct  193   VICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSE  252

Query  723   ---------------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGW  607
                                  G +  PF  ++  L  L  P         I S+DIPSGW
Sbjct  253   PTMIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVP---------IASIDIPSGW  303

Query  606   HVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGT  427
              V+ G  N  GI+P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T
Sbjct  304   DVEKG--NSGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDT  361

Query  426   SMCVRI  409
             +   R+
Sbjct  362   ACVYRL  367



>ref|XP_010593142.1| PREDICTED: NAD(P)H-hydrate epimerase isoform X2 [Loxodonta africana]
Length=250

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 126/210 (60%), Gaps = 17/210 (8%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++T + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L
Sbjct  53    ASTAVKYLSQEEAQAVDQELFNEYKFSVDQLMELAGLSCATAIAKAYPPTSLSRSPPTVL  112

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGPLSPPFDELIQRLV  679
             +ICGPG+NGGDGLV ARHL  F   +   Y +        G   +G +  PF  +++ L 
Sbjct  113   IICGPGNNGGDGLVCARHLKLFPLMIDELYELVV--DAIFGFSFKGDVREPFQSILKVLS  170

Query  678   SLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHF  499
              +  P         I S+DIPSGW V+ G  N EG++P ML+SLTAPK  A +F G +H+
Sbjct  171   GITVP---------IASIDIPSGWDVEKG--NSEGLQPDMLISLTAPKKSATQFTGRYHY  219

Query  498   LGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             LGGRF+PP++  K++L LP YP T    R+
Sbjct  220   LGGRFVPPALEKKYQLNLPSYPDTECVYRL  249



>ref|XP_003969245.1| PREDICTED: NAD(P)H-hydrate epimerase [Takifugu rubripes]
 ref|XP_011607642.1| PREDICTED: NAD(P)H-hydrate epimerase [Takifugu rubripes]
Length=276

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 134/235 (57%), Gaps = 32/235 (14%)
 Frame = -2

Query  1023  TTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYN----PKEYRRILV  856
             T PI YL  +EA  ID  L    GFS+DQLMELAGLS ATA+   Y      K    +LV
Sbjct  44    TQPIKYLGQEEAQHIDEELFSEYGFSVDQLMELAGLSCATAVTRAYPLTSLVKASPSVLV  103

Query  855   ICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----------PLSP  709
             ICGPG+NGGDGLV ARHL  FGYE F+ YP +  K  + GL TQ            P + 
Sbjct  104   ICGPGNNGGDGLVCARHLKLFGYEPFIFYPKRPNKPLFQGLATQCEKMEIPFLSDMPEAS  163

Query  708   PFDELIQRLV----------SLKNP----RDSHRKSPV-IVSVDIPSGWHVDGGDINGEG  574
               DE    +V          +++ P     D  + + V + S+DIPSGW V+ G  + +G
Sbjct  164   LIDEAYNLVVDAIFGFSFKGAVREPFGSILDVLKNTTVPLASIDIPSGWDVEQG--SADG  221

Query  573   IRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             ++P  L+SLTAPK  A  F G +HFLGGRF+PPS+  K++L LP YP T   +++
Sbjct  222   LQPDTLISLTAPKKSASLFRGRYHFLGGRFVPPSLERKYQLNLPKYPDTDCVLKL  276



>ref|XP_005532346.1| PREDICTED: NAD(P)H-hydrate epimerase [Pseudopodoces humilis]
Length=290

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 135/235 (57%), Gaps = 33/235 (14%)
 Frame = -2

Query  1020  TPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVI  853
             T + +L  +EA  ID  L     FS+DQLMELAGLS ATAIA+ Y P  +      +LV+
Sbjct  57    TGLRFLGQEEAQAIDQELFTEYKFSVDQLMELAGLSCATAIAKAYPPSSFTTSQPAVLVV  116

Query  852   CGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----PLSPPF-----  703
             CGPG+NGGDGLV ARHL  FGY+  + YP +  K  + GL TQ      P  P F     
Sbjct  117   CGPGNNGGDGLVCARHLKMFGYQPTVYYPKRPSKSLFEGLTTQCEKMDIPFLPEFPAEAA  176

Query  702   --DELIQRLV----------SLKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDINGEG  574
               DEL   +V          +++ P  S      R +  I S+DIPSGW V+ G    +G
Sbjct  177   FIDELYGLVVDAIFGFSFKGAVREPFGSILSTLERVTVPIASIDIPSGWDVEKG--KADG  234

Query  573   IRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             ++P ML+SLTAPK  A  F G +HFLGGRF+PP + +K+ L LP YPGT   +++
Sbjct  235   LQPDMLISLTAPKKAAMHFTGRYHFLGGRFVPPMLQEKYALNLPAYPGTDCILQL  289



>ref|XP_006456548.1| hypothetical protein AGABI2DRAFT_181137 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV42863.1| hypothetical protein AGABI2DRAFT_181137 [Agaricus bisporus var. 
bisporus H97]
Length=244

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 133/243 (55%), Gaps = 51/243 (21%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLG-FSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGS  838
             + YLT + A +ID  LM   G FSIDQLMELAGL+ A  +A VYN ++Y R+LV CGPG+
Sbjct  3     MRYLTARLAQQIDEELMNASGAFSIDQLMELAGLACAQTLATVYNREKYPRVLVCCGPGN  62

Query  837   NGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG---------------------  721
              GGDGLVAARHL  FGY+  +  P    K  Y  L TQ                      
Sbjct  63    QGGDGLVAARHLGLFGYKPTVYMPKPGSKDIYKRLETQCRNMSIPILSPSPPTDLSPLKQ  122

Query  720   -------------------PLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVD  598
                                P+  PFD+++  L   K P         IVSVDIPSGW+V+
Sbjct  123   SLSQSDVILDAIFGFSFQPPIRAPFDDVLPLLTQSKLP---------IVSVDIPSGWNVE  173

Query  597   GGDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMC  418
              GD  G G++P +LVSLTAPKL  K F G  HFLGGRF+P ++ +K +L LPLYPG S  
Sbjct  174   KGDEYGVGLQPDVLVSLTAPKLGVKAFKG-RHFLGGRFVPKAMEEKLELNLPLYPGFSQI  232

Query  417   VRI  409
             V +
Sbjct  233   VEL  235



>emb|CCD75736.1| n-terminal yjef related [Schistosoma mansoni]
Length=242

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 133/235 (57%), Gaps = 32/235 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             +SYL+  EA ++D+ L     FS+DQLMELAGLS A AI + Y   +  +    +LV CG
Sbjct  3     VSYLSQVEAQQVDNELFTEYAFSVDQLMELAGLSCAVAINKAYPLNKLTKSNGSVLVFCG  62

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGP----------------L  715
             PG+NGGDGLV ARHL  FGY+  + YP    K  Y  LV Q                  L
Sbjct  63    PGNNGGDGLVCARHLKMFGYKPSIHYPRNPTKQLYKNLVIQCEKMDIPFLPDLTNETFNL  122

Query  714   SPPFDELIQRLVSL--KNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGEG-I  571
             S  +D  I  L     K P     KS +         ++S+D+PSGW+V+ G ++ E  +
Sbjct  123   SQSYDLFIDALFGFGFKPPVRLEFKSILQIMSTSQIPVISIDVPSGWNVEIGPLDNENNL  182

Query  570   RPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIG  406
             +P  L+SLTAPKLCA+ F G +HFLGGRF+P +++ K+ L LP YPG  +CV + 
Sbjct  183   KPDCLISLTAPKLCARFFQGRYHFLGGRFVPDALMKKYNLKLPTYPGHELCVLLN  237



>ref|XP_009097515.1| PREDICTED: NAD(P)H-hydrate epimerase [Serinus canaria]
Length=232

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 134/233 (58%), Gaps = 33/233 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             +S+    EA  ID  L     FS+DQLMELAGLS ATAIA+ Y P  +      +LV+CG
Sbjct  1     MSHPRQAEAQAIDQELFTEYKFSVDQLMELAGLSCATAIAKAYPPSSFTTSQPAVLVVCG  60

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----PLSPPF-------  703
             PG+NGGDGLV ARHL  FGY+  + YP  + K  + GL TQ      P  P F       
Sbjct  61    PGNNGGDGLVCARHLKMFGYQPTVYYPKPSSKPLFEGLTTQCKKMDIPFLPEFPTEAEFI  120

Query  702   DELIQRLV----------SLKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDINGEGIR  568
             DEL   +V          +++ P  S      R +  I S+DIPSGW V+ G    +G++
Sbjct  121   DELYGLVVDAIFGFSFTGAVREPFGSILSTLERVTVPIASIDIPSGWDVEKG--KADGLQ  178

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P ML+SLTAPK  A  F G +HFLGGRF+PP++ +K+ L LP YPGT   +++
Sbjct  179   PDMLISLTAPKKAAMHFTGRYHFLGGRFVPPALQEKYALNLPAYPGTDCVLQL  231



>ref|NP_001232543.1| putative apolipoprotein A-I binding protein precursor [Taeniopygia 
guttata]
 gb|ACH45046.1| putative apolipoprotein A-I binding protein [Taeniopygia guttata]
Length=299

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 136/233 (58%), Gaps = 33/233 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             + +L  +EA  ID  L    GFS++QLMELAGLS ATAIA+ Y P  +      +LV+CG
Sbjct  68    LRFLGQEEAQAIDQELFTEYGFSVEQLMELAGLSCATAIAKAYPPSSFTTSQPAVLVVCG  127

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-----PLSPPF-------  703
             PG+NGGDGLV ARHL  FGY+  + YP +  K  + GL TQ      P  P F       
Sbjct  128   PGNNGGDGLVCARHLKMFGYQPTVYYPKRPNKPLFEGLTTQCKKMDIPFLPEFPAEAEFI  187

Query  702   DELIQRLV----------SLKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDINGEGIR  568
             DEL   +V          +++ P  S      R +  I S+DIPSGW V+ G    +G++
Sbjct  188   DELYGLVVDAIFGFSFTGAVREPFGSILSTLERVTVPIASIDIPSGWDVEKG--KADGLQ  245

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P ML+SLTAPK  A  F G +HFLGGRF+PP++ +K+ L LP YPGT   +++
Sbjct  246   PDMLISLTAPKKAAMHFTGRYHFLGGRFVPPALQEKYALNLPAYPGTDCVLQL  298



>gb|AAW27603.1| SJCHGC06839 protein [Schistosoma japonicum]
Length=244

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 135/235 (57%), Gaps = 33/235 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             +SYL+  EA ++D+ L     FS+DQLMELAGLS ATAI++ Y   +  +    ILV CG
Sbjct  3     VSYLSQVEAQQVDNELFTEYAFSVDQLMELAGLSCATAISKAYPLNKLTKANGSILVFCG  62

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQGP-----------------  718
             PG+NGGDGLV ARHL  FGY+  + YP    K  Y  L+ Q                   
Sbjct  63    PGNNGGDGLVCARHLKMFGYKPTIHYPRNPTKQLYKNLIIQCEKMDIPFVTHLMINESPN  122

Query  717   LSPPFDELIQRL--VSLKNPRDSHRKSPV---------IVSVDIPSGWHVDGGDINGE-G  574
             L   +D  I  L     K P  +  KS +         +VS+D+PSGW+V+ G ++ E  
Sbjct  123   LLQSYDLYIDALFGFGFKPPVSAEFKSILQIMSTSQIPVVSIDVPSGWNVETGPLDDENN  182

Query  573   IRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             ++P  L+SLTAPKLCA+ F G +HFLGGRF+P +++ K+ L LP+YP   +CV +
Sbjct  183   LQPDCLISLTAPKLCARFFKGQYHFLGGRFVPDALMRKYNLKLPIYPNHELCVLL  237



>gb|EHA99546.1| Apolipoprotein A-I-binding protein [Heterocephalus glaber]
Length=237

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 136/233 (58%), Gaps = 33/233 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    +    +LV+CG
Sbjct  6     VKYLSQEEAQALDLELFNEYQFSVDQLMELAGLSCATAIAKAYPPTALSKSPPAVLVVCG  65

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-----------  703
             PG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ   +  PF           
Sbjct  66    PGNNGGDGLVCARHLKLFGYQPTVYYPKRPNKPLFTALVTQCQKMDIPFLGEMPSEPMMI  125

Query  702   DELIQRLV----------SLKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDINGEGIR  568
             DEL + +V           ++ P  S     +  +  I S+DIPSGW V+ G  N  GI+
Sbjct  126   DELYELVVDAIFGFSFKGDVREPFRSILSILNELTVPIASIDIPSGWDVEKG--NSGGIQ  183

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P ML+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  184   PDMLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  236



>ref|XP_007535603.1| PREDICTED: NAD(P)H-hydrate epimerase [Erinaceus europaeus]
Length=289

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 136/233 (58%), Gaps = 33/233 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +L++CG
Sbjct  58    VKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPASMSRSPPAVLIVCG  117

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-----------  703
             PG+NGGDGLV ARHL  FGY+  + YP +  K  ++ LVTQ   +  PF           
Sbjct  118   PGNNGGDGLVCARHLKLFGYQPTVYYPKRPSKPLFSALVTQCQKMDIPFLGEMPSEPSLI  177

Query  702   DELIQRLVS----------LKNPRDS-----HRKSPVIVSVDIPSGWHVDGGDINGEGIR  568
             DEL + +V           ++ P  +     H  +  I S+DIPSGW V+ G  N  GI+
Sbjct  178   DELYELVVDAIFGFSFKGDVREPFRNILSVLHGVTVPIASIDIPSGWDVEKG--NSGGIQ  235

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P ML+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  236   PDMLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPAYPDTECVYRL  288



>gb|KGB39934.1| NAD(P)H-hydrate epimerase [Schistosoma haematobium]
Length=243

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/236 (42%), Positives = 133/236 (56%), Gaps = 34/236 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             +SYL+  EA ++D+ L     FS+DQLMELAGLS A AI + Y   +  +    +LV CG
Sbjct  3     VSYLSQVEAQQVDNELFTEYAFSVDQLMELAGLSCAVAINKAYPLNKLTKSNGSVLVFCG  62

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG-PLSPPF-DELIQRLVSL  673
             PG+NGGDGLV ARHL  FGY+  + Y     K  Y  LV Q   +  PF  +L    V+L
Sbjct  63    PGNNGGDGLVCARHLKMFGYKPSIHYSRNPTKQLYKNLVIQCEKMDIPFLSDLTNETVNL  122

Query  672   KNPRD--------------------------SHRKSPVIVSVDIPSGWHVDGGDINGE-G  574
                 D                          S  + PVI S+D+PSGW+V+ G ++ E  
Sbjct  123   SQSYDLFIDALFGFGFKPPVSLEFKSILQIMSTSQIPVI-SIDVPSGWNVETGPLDSENN  181

Query  573   IRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRIG  406
             ++P  L+SLTAPKLCA+ F G +HFLGGRF+P +++ K+KL LP YP   +CV + 
Sbjct  182   LKPDCLISLTAPKLCAQFFQGQYHFLGGRFVPDALMKKYKLKLPTYPSHELCVLLN  237



>sp|E2QRY6.1|NNRE_CANFA RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=Apolipoprotein 
A-I-binding protein; Short=AI-BP; AltName: Full=NAD(P)HX 
epimerase; Flags: Precursor [Canis lupus familiaris]
Length=288

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 137/233 (59%), Gaps = 33/233 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    R    +LVICG
Sbjct  57    VKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPAVLVICG  116

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP---F  703
             PG+NGGDGLV ARHL  FGY+  + YP +  K  +T LVTQ         G + P     
Sbjct  117   PGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPPEPMLI  176

Query  702   DELIQRLV------SLK-NPRDSHRK--------SPVIVSVDIPSGWHVDGGDINGEGIR  568
             DEL + +V      S K + R+  R         +  I S+DIPSGW V+ G  N  GI+
Sbjct  177   DELYELVVDAIFGFSFKGDVREPFRTILSVLDGLTVPIASIDIPSGWDVEKG--NSGGIQ  234

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P +L+SLTAPK  A +F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  235   PDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRL  287



>gb|ETN67052.1| apolipoprotein a binding protein [Anopheles darlingi]
Length=263

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 136/243 (56%), Gaps = 32/243 (13%)
 Frame = -2

Query  1038  KKMGST----TPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEY  871
             K++ ST    + + YL  QEA  ID  L     FS+DQLMELAGLS A  IA+ Y P+  
Sbjct  21    KRLHSTGSRASRMKYLNQQEAISIDEELFNEYKFSVDQLMELAGLSCAHVIADAYAPESL  80

Query  870   R--RILVICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQG--------  721
             +  +IL+ CGPG+NGGDGLVAARHL    Y  ++ YP +T K  +  L  Q         
Sbjct  81    KSNKILICCGPGNNGGDGLVAARHLALMNYNPYVYYPKRTEKELFRNLQHQAESMGITVT  140

Query  720   -------PLSPPFDELIQRLV--SLKNP-RDS--------HRKSPVIVSVDIPSGWHVDG  595
                     +   F  ++  L   S K P RDS         R    IVS+DIPSGW+V+ 
Sbjct  141   TDCPDGASVEQEFGLIVDALFGFSFKPPVRDSFLPIMNVLQRSKLPIVSIDIPSGWNVEE  200

Query  594   GDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             G  N   I+P+ L+SLTAPKLCAKR     H+LGGRF+P  + +K+ L LP Y G+++ V
Sbjct  201   GPQNECDIQPACLISLTAPKLCAKRLLNAQHYLGGRFVPKRLEEKYSLELPSYLGSNLFV  260

Query  414   RIG  406
             ++ 
Sbjct  261   KLN  263



>emb|CDH59648.1| n-terminal domain-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH55432.1| n-terminal domain-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=235

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 124/232 (53%), Gaps = 42/232 (18%)
 Frame = -2

Query  1005  LTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRRILVICGPGSNGGD  826
             L+ + A  ID  LM   GFS+DQLMELAGLS+A A+   Y+  ++  +LV  GPG+NGGD
Sbjct  6     LSQKVAQAIDEELMSSGGFSVDQLMELAGLSVAQAVQRTYDRTQFPNVLVCVGPGNNGGD  65

Query  825   GLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ--------------------------  724
             GLVAARHL++FGY+  L YP Q  K  Y  L+ Q                          
Sbjct  66    GLVAARHLYHFGYKPSLYYPKQPNKDLYQRLLVQCNQLGLSVHESFADKTVEEADVLVDA  125

Query  723   -------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDINGEGIRP  565
                    G +  PF E+++   +   P         IVSVDIPSGW V+ G  N    +P
Sbjct  126   VFGFSFKGDVRDPFKEVVKTFETTNKP---------IVSVDIPSGWDVEQGPSNNVKFQP  176

Query  564   SMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              +LVSLTAPK+CA  F G  HFLGGRF+PP+I  K+   +P + G    V +
Sbjct  177   DVLVSLTAPKICANHFKGKRHFLGGRFVPPAIAKKYDFEVPPFHGADQVVEL  228



>ref|XP_002177085.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51548.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=236

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 137/242 (57%), Gaps = 49/242 (20%)
 Frame = -2

Query  1005  LTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYN---PKEYRRI----LVICG  847
             L  + A  +D  LM   GF+++QLMELAGLS+A A+  V     P + R+I    L++CG
Sbjct  1     LDAKSAASLDEELMATPGFTLEQLMELAGLSVAEAVYTVAQQKWPLDQRQIQPHVLLVCG  60

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHP-YTGLVTQ---------GPLS-----  712
             PG+NGGDGLVAARHL  FGYE  + YP Q+ K P Y  LVTQ         G LS     
Sbjct  61    PGNNGGDGLVAARHLVMFGYECTVIYPKQSSKQPHYENLVTQCRDVGVKIQGELSEEFLQ  120

Query  711   ---------------------PPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDG  595
                                   PFD ++ ++   +   D+     +IVSVD+PSGW VD 
Sbjct  121   SQTPLVIVDAIFGFSFHGEPRAPFDTILAQMKRAQKDNDT-----IIVSVDVPSGWDVDE  175

Query  594   GDINGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCV  415
             GD++G G+ P +LVSLTAPK  A+ F G  HF+GGRF+PP++ +K+ + +P YPG    +
Sbjct  176   GDVSGVGLVPDVLVSLTAPKKSARSFQG-RHFVGGRFLPPALANKYGVNMPPYPGVQQVM  234

Query  414   RI  409
              +
Sbjct  235   EV  236



>gb|ERE87402.1| apolipoprotein A-I-binding protein [Cricetulus griseus]
Length=282

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 138/237 (58%), Gaps = 33/237 (14%)
 Frame = -2

Query  1026  STTPISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----IL  859
             ++  + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    +    +L
Sbjct  47    ASAAVKYLSQEEARAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVL  106

Query  858   VICGPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ-GPLSPPF-------  703
             VICGPG+NGGDGLV ARHL  FGY+  + YP ++ K  +TGLVTQ   +  PF       
Sbjct  107   VICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRSNKPLFTGLVTQCQKMDIPFLNEMPPE  166

Query  702   ----DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDING  580
                 DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N 
Sbjct  167   PMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKG--NP  224

Query  579   EGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GI+P +L+SLTAPK  A  F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  225   GGIQPDLLISLTAPKKSAAHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  281



>ref|NP_659146.1| NAD(P)H-hydrate epimerase precursor [Mus musculus]
 sp|Q8K4Z3.1|NNRE_MOUSE RecName: Full=NAD(P)H-hydrate epimerase; AltName: Full=Apolipoprotein 
A-I-binding protein; Short=AI-BP; AltName: Full=NAD(P)HX 
epimerase; Flags: Precursor [Mus musculus]
 emb|CAC86966.1| apoA-I binding protein [Mus musculus]
 gb|AAH58362.1| Apolipoprotein A-I binding protein [Mus musculus]
 gb|AAT70236.1| apolipoprotein A-I binding protein [Mus musculus]
 dbj|BAE35424.1| unnamed protein product [Mus musculus]
Length=282

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 135/233 (58%), Gaps = 33/233 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    +    +LVICG
Sbjct  51    VKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICG  110

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP---F  703
             PG+NGGDGLV ARHL  FGY+  + YP +  K  +TGLVTQ         G + P     
Sbjct  111   PGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMV  170

Query  702   DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDINGEGIR  568
             DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N  GI+
Sbjct  171   DELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKG--NPSGIQ  228

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P +L+SLTAPK  A  F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  229   PDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  281



>gb|EDL15317.1| apolipoprotein A-I binding protein [Mus musculus]
Length=282

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 135/233 (58%), Gaps = 33/233 (14%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGPLGFSIDQLMELAGLSIATAIAEVYNPKEYRR----ILVICG  847
             + YL+ +EA  +D  L     FS+DQLMELAGLS ATAIA+ Y P    +    +LVICG
Sbjct  51    VKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICG  110

Query  846   PGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ---------GPLSPP---F  703
             PG+NGGDGLV ARHL  FGY+  + YP +  K  +TGLVTQ         G + P     
Sbjct  111   PGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMV  170

Query  702   DELIQRLV----------SLKNPRDSHRK-----SPVIVSVDIPSGWHVDGGDINGEGIR  568
             DEL + +V           ++ P  S        +  I S+DIPSGW V+ G  N  GI+
Sbjct  171   DELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKG--NPSGIQ  228

Query  567   PSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
             P +L+SLTAPK  A  F G +H+LGGRF+PP++  K++L LP YP T    R+
Sbjct  229   PDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL  281



>gb|KFH10801.1| putative apolipoprotein A-I binding protein [Toxoplasma gondii 
MAS]
Length=343

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 138/239 (58%), Gaps = 47/239 (20%)
 Frame = -2

Query  1014  ISYLTHQEATEIDHLLMGP-LGFSIDQLMELAGLSIATAIAEV--YNPKEYR--RILVIC  850
             ++YLT  +A  +D  LMG  +G+S+DQLMELAGLS+A A+AE    +P   R  R+LV+ 
Sbjct  114   LTYLTQSQAQALDEDLMGSEVGYSVDQLMELAGLSVAQAVAEAIPLSPAVTRLLRVLVVA  173

Query  849   GPGSNGGDGLVAARHLHYFGYELFLCYPMQTPKHPYTGLVTQ------------------  724
             GPG+NGGDGLVAARHL  FGY++ +  P    K  +  L+ Q                  
Sbjct  174   GPGNNGGDGLVAARHLKLFGYQVHVWCPRPPAKALFENLMKQLRNHRVPVTVEAPPDLRD  233

Query  723   --------------GPLSPPFDELIQRLVSLKNPRDSHRKSPVIVSVDIPSGWHVDGGDI  586
                           G + PPFD ++  L +   P         ++SVDIPSGW V+ G++
Sbjct  234   FHLIVDSIFGFSFKGFVRPPFDAVLHALKTSNIP---------VLSVDIPSGWDVEKGNV  284

Query  585   NGEGIRPSMLVSLTAPKLCAKRFYGPHHFLGGRFIPPSIVDKFKLGLPLYPGTSMCVRI  409
              GEG+ P  L+SLTAPKLCAK F    HF+GGRF+P S+V+K++L LP YPG    VRI
Sbjct  285   TGEGLEPQYLISLTAPKLCAKHFKK-VHFVGGRFVPESMVEKYQLVLPEYPGIQGVVRI  342



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2665783826636