BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1006

Length=656
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002267234.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    201   9e-59   Vitis vinifera
ref|XP_009631976.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    192   4e-56   Nicotiana tomentosiformis
ref|XP_009631975.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    192   2e-55   Nicotiana tomentosiformis
ref|XP_010087739.1|  hypothetical protein L484_008936                   190   2e-54   Morus notabilis
ref|XP_006344986.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    189   2e-54   Solanum tuberosum [potatoes]
ref|XP_012080166.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    189   3e-54   Jatropha curcas
ref|XP_004236162.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    189   3e-54   Solanum lycopersicum
ref|XP_012080164.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    189   5e-54   Jatropha curcas
ref|XP_012080165.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    189   5e-54   Jatropha curcas
ref|XP_009768776.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    188   6e-54   Nicotiana sylvestris
ref|XP_002318622.2|  hypothetical protein POPTR_0012s07530g             186   3e-53   
ref|XP_011042638.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    186   4e-53   Populus euphratica
gb|ABK93937.1|  unknown                                                 186   4e-53   Populus trichocarpa [western balsam poplar]
gb|KDO69842.1|  hypothetical protein CISIN_1g017023mg                   184   3e-52   Citrus sinensis [apfelsine]
ref|XP_006439711.1|  hypothetical protein CICLE_v10020622mg             184   3e-52   Citrus clementina [clementine]
ref|XP_006476701.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    184   3e-52   
ref|XP_006476700.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    184   4e-52   Citrus sinensis [apfelsine]
ref|XP_007010523.1|  Pre-mRNA cleavage complex II family protein ...    180   8e-52   
ref|XP_007211322.1|  hypothetical protein PRUPE_ppa007204mg             182   2e-51   Prunus persica
ref|XP_007010521.1|  Pre-mRNA cleavage complex II family protein ...    181   2e-51   Theobroma cacao [chocolate]
ref|XP_008437827.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    182   2e-51   Cucumis melo [Oriental melon]
ref|XP_007010522.1|  Pre-mRNA cleavage complex II family protein ...    180   2e-51   
ref|XP_004152451.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    181   5e-51   Cucumis sativus [cucumbers]
gb|KCW83466.1|  hypothetical protein EUGRSUZ_B00382                     178   6e-51   Eucalyptus grandis [rose gum]
ref|XP_009369394.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    180   7e-51   Pyrus x bretschneideri [bai li]
ref|XP_007010520.1|  Pre-mRNA cleavage complex II protein family ...    180   8e-51   Theobroma cacao [chocolate]
ref|XP_008239684.1|  PREDICTED: LOW QUALITY PROTEIN: polynucleoti...    178   4e-50   Prunus mume [ume]
ref|XP_010028463.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    178   4e-50   Eucalyptus grandis [rose gum]
ref|XP_002511482.1|  conserved hypothetical protein                     178   7e-50   
ref|XP_008374498.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    177   8e-50   
gb|EYU24447.1|  hypothetical protein MIMGU_mgv1a008342mg                177   1e-49   Erythranthe guttata [common monkey flower]
gb|KJB50841.1|  hypothetical protein B456_008G189500                    174   2e-48   Gossypium raimondii
ref|XP_008393083.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    172   6e-48   
gb|EYU37059.1|  hypothetical protein MIMGU_mgv1a007825mg                171   4e-47   Erythranthe guttata [common monkey flower]
ref|XP_010255658.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    169   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_003525672.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    165   4e-45   Glycine max [soybeans]
gb|KHN27453.1|  Polynucleotide 5'-hydroxyl-kinase NOL9                  165   6e-45   Glycine soja [wild soybean]
ref|XP_004301291.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    162   6e-44   Fragaria vesca subsp. vesca
ref|XP_004504479.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    160   4e-43   Cicer arietinum [garbanzo]
ref|XP_007151004.1|  hypothetical protein PHAVU_004G010600g             159   6e-43   Phaseolus vulgaris [French bean]
emb|CBI15311.3|  unnamed protein product                                151   9e-43   Vitis vinifera
ref|XP_011087186.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    158   1e-42   
ref|XP_010678646.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    158   2e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006578600.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    155   9e-42   
ref|XP_003528167.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    155   1e-41   Glycine max [soybeans]
gb|KHN16281.1|  Polynucleotide 5'-hydroxyl-kinase NOL9                  155   2e-41   Glycine soja [wild soybean]
ref|XP_003522357.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    155   2e-41   Glycine max [soybeans]
ref|XP_003637313.1|  Polyribonucleotide 5'-hydroxyl-kinase PH0197       146   5e-39   
ref|XP_010915171.1|  PREDICTED: LOW QUALITY PROTEIN: polynucleoti...    148   1e-38   
ref|XP_010540303.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    147   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_008777209.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    148   3e-38   Phoenix dactylifera
gb|KEH20553.1|  polynucleotide 5-hydroxyl-kinase NOL9-like protein      147   3e-38   Medicago truncatula
ref|NP_568243.1|  Pre-mRNA cleavage complex II protein family           145   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850805.1|  Pre-mRNA cleavage complex II protein family           145   7e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KHN19355.1|  Polynucleotide 5'-hydroxyl-kinase NOL9                  139   9e-38   Glycine soja [wild soybean]
ref|XP_010419654.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    145   1e-37   Camelina sativa [gold-of-pleasure]
gb|EPS68394.1|  hypothetical protein M569_06374                         150   2e-37   Genlisea aurea
ref|XP_006287984.1|  hypothetical protein CARUB_v10001219mg             144   2e-37   
ref|XP_010491791.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    144   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010453135.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    144   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010546094.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    143   5e-37   Tarenaya hassleriana [spider flower]
ref|XP_006287986.1|  hypothetical protein CARUB_v10001219mg             143   5e-37   
ref|XP_010936308.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    142   2e-36   Elaeis guineensis
emb|CAB96856.1|  putative protein                                       141   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408924.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    139   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006404928.1|  hypothetical protein EUTSA_v10000203mg             139   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_008808921.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    137   9e-35   Phoenix dactylifera
ref|XP_008808920.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    137   1e-34   Phoenix dactylifera
ref|XP_009122003.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    134   1e-33   Brassica rapa
emb|CDX69791.1|  BnaA10g21400D                                          134   1e-33   
ref|XP_011622893.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    134   2e-33   Amborella trichopoda
ref|XP_002871448.1|  hypothetical protein ARALYDRAFT_487931             131   2e-32   
ref|XP_009394102.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    130   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394099.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    130   4e-32   
ref|XP_009394098.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    130   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE76705.1|  unknown                                                 125   5e-30   Picea sitchensis
ref|XP_007136548.1|  hypothetical protein PHAVU_009G054100g             120   3e-28   Phaseolus vulgaris [French bean]
ref|XP_004967623.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    119   4e-28   
emb|CDX97073.1|  BnaC09g45520D                                          119   7e-28   
ref|XP_008672008.1|  PREDICTED: uncharacterized protein LOC100191...    119   8e-28   Zea mays [maize]
ref|XP_003637317.1|  Protein grc3                                       117   1e-27   
gb|EEE54540.1|  hypothetical protein OsJ_01710                          117   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564481.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    117   4e-27   
gb|KEH20552.1|  polynucleotide 5-hydroxyl-kinase NOL9-like protein      116   4e-27   Medicago truncatula
ref|XP_010230555.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    116   4e-27   
gb|ACG36367.1|  hypothetical protein                                    116   6e-27   Zea mays [maize]
gb|EMS51635.1|  hypothetical protein TRIUR3_10393                       115   2e-26   Triticum urartu
ref|XP_004968455.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    114   3e-26   Setaria italica
gb|EAY72811.1|  hypothetical protein OsI_00678                          113   8e-26   Oryza sativa Indica Group [Indian rice]
emb|CDM81640.1|  unnamed protein product                                113   1e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006645905.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    109   2e-25   
dbj|BAK02713.1|  predicted protein                                      112   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002457221.1|  hypothetical protein SORBIDRAFT_03g003540          110   6e-25   Sorghum bicolor [broomcorn]
ref|XP_001779903.1|  predicted protein                                  107   8e-24   
emb|CDP14910.1|  unnamed protein product                                106   2e-23   Coffea canephora [robusta coffee]
emb|CAN74949.1|  hypothetical protein VITISV_000264                     104   4e-23   Vitis vinifera
gb|EAZ10819.1|  hypothetical protein OsJ_00655                          102   6e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042230.1|  Os01g0184000                                       102   6e-22   
ref|XP_003572670.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    100   2e-21   Brachypodium distachyon [annual false brome]
gb|EMS68805.1|  hypothetical protein TRIUR3_10564                       100   2e-21   Triticum urartu
emb|CAN65272.1|  hypothetical protein VITISV_024535                   99.0    3e-21   Vitis vinifera
dbj|BAK07515.1|  predicted protein                                    99.4    4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT12944.1|  hypothetical protein F775_13490                       99.4    5e-21   
ref|XP_006643847.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  99.4    5e-21   Oryza brachyantha
ref|NP_001172330.1|  Os01g0354700                                     94.0    2e-19   
dbj|BAD52595.1|  hypothetical protein                                 93.6    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010546096.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  89.0    1e-17   Tarenaya hassleriana [spider flower]
gb|KFH72257.1|  hypothetical protein MVEG_02548                       89.7    1e-16   Mortierella verticillata NRRL 6337
gb|ERN04814.1|  hypothetical protein AMTR_s00146p00018170             88.6    2e-16   Amborella trichopoda
emb|CEG80066.1|  hypothetical protein RMATCC62417_14451               82.8    7e-15   Rhizopus microsporus
emb|CEG66515.1|  hypothetical protein RMATCC62417_03080               82.8    1e-14   Rhizopus microsporus
ref|XP_009549515.1|  hypothetical protein HETIRDRAFT_172844           81.6    3e-14   Heterobasidion irregulare TC 32-1
ref|XP_004345318.1|  hypothetical protein CAOG_06569                  80.5    6e-14   Capsaspora owczarzaki ATCC 30864
gb|EXX69758.1|  Grc3p                                                 80.5    7e-14   Rhizophagus irregularis DAOM 197198w
gb|ESA07900.1|  hypothetical protein GLOINDRAFT_32312                 80.5    7e-14   
ref|XP_008879304.1|  hypothetical protein H310_13533                  80.1    8e-14   Aphanomyces invadans
emb|CDS05450.1|  hypothetical protein LRAMOSA07978                    80.5    9e-14   Lichtheimia ramosa
emb|CEP19192.1|  hypothetical protein                                 80.5    9e-14   Parasitella parasitica
ref|XP_006460409.1|  hypothetical protein AGABI2DRAFT_150364          80.1    1e-13   Agaricus bisporus var. bisporus H97
dbj|GAN10671.1|  conserved hypothetical protein                       80.1    1e-13   Mucor ambiguus
ref|XP_007327110.1|  hypothetical protein AGABI1DRAFT_35289           79.7    1e-13   Agaricus bisporus var. burnettii JB137-S8
ref|XP_009948472.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  79.0    1e-13   Leptosomus discolor
ref|XP_642025.1|  NUC156 family protein                               79.7    1e-13   Dictyostelium discoideum AX4
ref|XP_007304231.1|  hypothetical protein STEHIDRAFT_147113           79.7    2e-13   Stereum hirsutum FP-91666 SS1
ref|XP_007851992.1|  hypothetical protein Moror_3014                  79.3    2e-13   
ref|XP_009842777.1|  hypothetical protein, variant                    79.0    2e-13   Aphanomyces astaci
ref|XP_001840996.2|  GRC3                                             79.0    3e-13   Coprinopsis cinerea okayama7#130
emb|CDH52186.1|  aaa family atpase grc3                               79.0    3e-13   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010141669.1|  PREDICTED: LOW QUALITY PROTEIN: polynucleoti...  77.4    3e-13   Buceros rhinoceros silvestris
gb|EPB91174.1|  hypothetical protein HMPREF1544_02054                 78.6    3e-13   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001624875.1|  predicted protein                                78.6    3e-13   Nematostella vectensis
ref|XP_009842778.1|  hypothetical protein H257_16139                  78.2    3e-13   Aphanomyces astaci
ref|XP_008501867.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  77.0    4e-13   Calypte anna
ref|XP_006399594.1|  hypothetical protein EUTSA_v10015920mg           74.7    5e-13   
ref|XP_009704551.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  77.4    5e-13   Cariama cristata
ref|XP_005514454.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  76.3    5e-13   
ref|XP_009882380.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  77.0    6e-13   Charadrius vociferus
ref|XP_003285812.1|  hypothetical protein DICPUDRAFT_149705           77.4    6e-13   Dictyostelium purpureum
ref|XP_008938506.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  77.0    7e-13   Merops nubicus
ref|XP_010003606.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  76.6    7e-13   Chaetura pelagica
ref|XP_009979797.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  76.6    7e-13   Tauraco erythrolophus
ref|XP_010123629.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  76.6    8e-13   Chlamydotis macqueenii
ref|XP_010199181.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  76.6    8e-13   Colius striatus
gb|KDE04810.1|  hypothetical protein MVLG_04774                       77.4    8e-13   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_010287893.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  76.6    9e-13   Phaethon lepturus
ref|XP_010020976.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  76.3    1e-12   Nestor notabilis
ref|XP_010164317.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  76.3    1e-12   
ref|XP_010563656.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  76.3    1e-12   Haliaeetus leucocephalus
ref|XP_009560683.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  75.9    2e-12   Cuculus canorus
ref|XP_005143747.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  75.5    2e-12   Melopsittacus undulatus
ref|XP_007388456.1|  hypothetical protein PUNSTDRAFT_93035            76.3    2e-12   Punctularia strigosozonata HHB-11173 SS5
ref|XP_009574020.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  75.5    2e-12   Fulmarus glacialis
ref|XP_010219280.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  75.5    2e-12   Tinamus guttatus
ref|XP_009971529.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  75.1    2e-12   Tyto alba [Schleiereule]
gb|KIM62259.1|  hypothetical protein SCLCIDRAFT_1215333               75.9    2e-12   Scleroderma citrinum Foug A
gb|EFA81806.1|  NUC156 family protein                                 75.9    2e-12   Heterostelium album PN500
ref|XP_009272381.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  75.1    3e-12   Aptenodytes forsteri
ref|XP_009331736.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  74.7    3e-12   Pygoscelis adeliae
ref|XP_009478204.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  74.7    3e-12   Pelecanus crispus
ref|XP_009924908.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  74.7    4e-12   Haliaeetus albicilla
ref|XP_002594381.1|  hypothetical protein BRAFLDRAFT_72211            74.7    4e-12   Branchiostoma floridae
ref|XP_009081355.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  74.3    4e-12   Acanthisitta chloris
gb|EGU11099.1|  thiol:disulfide interchange protein precursor         75.1    4e-12   Rhodotorula toruloides ATCC 204091
ref|XP_002933893.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  74.7    5e-12   Xenopus tropicalis [western clawed frog]
ref|XP_006642072.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  74.7    5e-12   
ref|XP_011596654.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  74.3    5e-12   Aquila chrysaetos canadensis
gb|KIN98490.1|  hypothetical protein M404DRAFT_1005338                74.3    6e-12   Pisolithus tinctorius Marx 270
gb|EIE75329.1|  hypothetical protein RO3G_00033                       74.3    6e-12   Rhizopus delemar RA 99-880
gb|EMT28824.1|  hypothetical protein F775_08614                       73.9    6e-12   
ref|XP_005427543.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  73.9    7e-12   Geospiza fortis
ref|XP_010079471.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  73.6    7e-12   Pterocles gutturalis
gb|EPS97830.1|  hypothetical protein FOMPIDRAFT_1166101               74.3    8e-12   Fomitopsis pinicola FP-58527 SS1
ref|XP_009933690.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  73.2    9e-12   Opisthocomus hoazin [hoatzin]
gb|ETO67392.1|  hypothetical protein F444_15689                       73.9    9e-12   Phytophthora parasitica P1976
ref|XP_005493016.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  73.9    9e-12   
ref|XP_002471073.1|  predicted protein                                73.9    9e-12   
gb|KDR71072.1|  hypothetical protein GALMADRAFT_254240                73.9    1e-11   Galerina marginata CBS 339.88
gb|KDQ14247.1|  hypothetical protein BOTBODRAFT_132759                73.9    1e-11   Botryobasidium botryosum FD-172 SS1
ref|XP_008926991.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  73.2    1e-11   
ref|XP_010308705.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  73.2    1e-11   Balearica regulorum gibbericeps
ref|XP_005493017.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  73.6    1e-11   Zonotrichia albicollis
ref|XP_001730501.1|  hypothetical protein MGL_2297                    73.2    1e-11   Malassezia globosa CBS 7966
ref|XP_004356271.1|  NUC156 family protein                            73.9    1e-11   Cavenderia fasciculata
ref|XP_002470377.1|  predicted protein                                73.9    1e-11   
ref|XP_002111887.1|  hypothetical protein TRIADDRAFT_55357            73.6    1e-11   Trichoplax adhaerens
ref|XP_008632496.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.8    1e-11   
ref|XP_005437817.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.8    1e-11   
ref|XP_005238046.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.8    2e-11   
ref|XP_007235796.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.8    2e-11   
ref|XP_007235800.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.4    2e-11   
ref|XP_009677090.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.4    2e-11   Struthio camelus australis
ref|XP_009677091.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.0    2e-11   Struthio camelus australis
ref|XP_006957049.1|  hypothetical protein WALSEDRAFT_43922            72.8    2e-11   Wallemia mellicola CBS 633.66
ref|XP_007862680.1|  hypothetical protein GLOTRDRAFT_136561           72.8    2e-11   Gloeophyllum trabeum ATCC 11539
gb|KIJ60990.1|  hypothetical protein HYDPIDRAFT_97607                 72.4    3e-11   Hydnomerulius pinastri MD-312
ref|XP_006025630.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.0    3e-11   Alligator sinensis
ref|XP_009093844.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.0    3e-11   Serinus canaria [canary]
ref|XP_002905535.1|  conserved hypothetical protein                   72.0    3e-11   Phytophthora infestans T30-4
ref|XP_005851160.1|  hypothetical protein CHLNCDRAFT_137775           72.0    3e-11   Chlorella variabilis
gb|KIM79525.1|  hypothetical protein PILCRDRAFT_74200                 72.4    4e-11   Piloderma croceum F 1598
ref|XP_006262140.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  72.0    4e-11   
ref|XP_009909630.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  71.2    4e-11   Picoides pubescens
ref|XP_696106.3|  PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9   72.0    5e-11   Danio rerio [leopard danio]
ref|XP_006820503.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  71.6    5e-11   Saccoglossus kowalevskii
gb|KII96132.1|  hypothetical protein PLICRDRAFT_35066                 72.0    5e-11   Plicaturopsis crispa FD-325 SS-3
emb|CCM03241.1|  predicted protein                                    71.6    5e-11   Fibroporia radiculosa
gb|KIK42112.1|  hypothetical protein CY34DRAFT_805324                 71.6    5e-11   Suillus luteus UH-Slu-Lm8-n1
ref|XP_010873621.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  71.6    5e-11   Esox lucius
gb|KIK94403.1|  hypothetical protein PAXRUDRAFT_142920                71.6    6e-11   Paxillus rubicundulus Ve08.2h10
ref|XP_005030216.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  70.9    6e-11   
gb|ETL32271.1|  hypothetical protein L916_15143                       71.6    6e-11   Phytophthora parasitica
ref|XP_008895264.1|  hypothetical protein PPTG_04735                  71.2    6e-11   Phytophthora parasitica INRA-310
gb|ETL85512.1|  hypothetical protein L917_14974                       71.2    6e-11   Phytophthora parasitica
gb|ETK78837.1|  hypothetical protein L915_15252                       71.2    6e-11   Phytophthora parasitica
gb|ETI38637.1|  hypothetical protein F443_15711                       71.2    6e-11   Phytophthora parasitica P1569
gb|ETP08545.1|  hypothetical protein F441_15530                       71.2    6e-11   Phytophthora parasitica CJ01A1
gb|KDQ65165.1|  hypothetical protein JAAARDRAFT_202382                71.6    6e-11   Jaapia argillacea MUCL 33604
ref|XP_003225740.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  71.2    6e-11   Anolis carolinensis [Carolina anole]
ref|XP_003212228.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  70.5    8e-11   Meleagris gallopavo [common turkey]
gb|EMS19840.1|  AAA family ATPase Grc3                                71.2    8e-11   Rhodotorula toruloides NP11
ref|XP_005528464.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  70.9    8e-11   
gb|KJA16088.1|  hypothetical protein HYPSUDRAFT_148203                71.2    9e-11   Hypholoma sublateritium FD-334 SS-4
ref|XP_009265823.1|  Polynucleotide 5'-hydroxyl-kinase GRC3           70.9    1e-10   Wallemia ichthyophaga EXF-994
ref|XP_005057712.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  70.5    1e-10   Ficedula albicollis
gb|EPZ35588.1|  hypothetical protein O9G_005108                       70.1    1e-10   Rozella allomycis CSF55
gb|ETE62219.1|  Polynucleotide 5'-hydroxyl-kinase NOL9                69.3    2e-10   Ophiophagus hannah
emb|CDQ84306.1|  unnamed protein product                              70.1    2e-10   Oncorhynchus mykiss
ref|XP_004995777.1|  hypothetical protein PTSG_03193                  70.1    2e-10   Salpingoeca rosetta
ref|XP_004024628.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  70.1    2e-10   
ref|XP_005287132.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  70.1    2e-10   
gb|KIJ08266.1|  hypothetical protein PAXINDRAFT_102638                70.1    2e-10   Paxillus involutus ATCC 200175
emb|CBN74160.1|  conserved unknown protein                            70.1    2e-10   Ectocarpus siliculosus
gb|KIM32999.1|  hypothetical protein M408DRAFT_190466                 69.7    2e-10   Serendipita vermifera MAFF 305830
ref|XP_007338857.1|  hypothetical protein AURDEDRAFT_81640            69.3    3e-10   
emb|CCA67460.1|  hypothetical protein PIIN_01290                      69.3    3e-10   Serendipita indica DSM 11827
ref|XP_003822193.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  69.3    3e-10   Pan paniscus [bonobo]
ref|XP_003274369.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  69.3    3e-10   Nomascus leucogenys [White-cheeked Gibbon]
gb|AAH94836.1|  NOL9 protein                                          68.9    3e-10   Homo sapiens [man]
ref|XP_006676334.1|  hypothetical protein BATDEDRAFT_85431            68.9    3e-10   Batrachochytrium dendrobatidis JAM81
ref|XP_514340.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase NO...  69.3    3e-10   Pan troglodytes
ref|XP_002811608.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  69.3    3e-10   Pongo abelii [orang utan]
emb|CDI95815.1|  polynucleotide 5' hydroxyl kinase NOL9               68.9    4e-10   
ref|XP_007896050.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  68.9    4e-10   Callorhinchus milii [Australian ghost shark]
sp|Q5SY16.1|NOL9_HUMAN  RecName: Full=Polynucleotide 5'-hydroxyl-...  68.9    4e-10   Homo sapiens [man]
gb|AAI10850.1|  Nucleolar protein 9                                   68.9    4e-10   Homo sapiens [man]
ref|NP_078930.3|  polynucleotide 5'-hydroxyl-kinase NOL9              68.9    4e-10   
ref|XP_008565240.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  68.9    4e-10   Galeopterus variegatus [Malayan flying lemur]
gb|AIC58598.1|  NOL9                                                  68.9    4e-10   synthetic construct
ref|XP_007268054.1|  hypothetical protein FOMMEDRAFT_110095           68.6    4e-10   Fomitiporia mediterranea MF3/22
ref|XP_006123179.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  68.6    5e-10   
ref|XP_002123550.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  68.6    5e-10   Ciona intestinalis [sea vase]
ref|XP_009538864.1|  hypothetical protein PHYSODRAFT_533258           68.6    5e-10   Phytophthora sojae
ref|XP_005544966.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  68.6    5e-10   Macaca fascicularis [crab eating macaque]
ref|XP_004947388.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  67.8    6e-10   
ref|XP_001233522.3|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  67.8    6e-10   
gb|KIK16500.1|  hypothetical protein PISMIDRAFT_113266                68.6    6e-10   Pisolithus microcarpus 441
gb|KIK10666.1|  hypothetical protein PISMIDRAFT_20191                 68.2    6e-10   Pisolithus microcarpus 441
gb|EMD31750.1|  hypothetical protein CERSUDRAFT_144572                68.6    6e-10   Gelatoporia subvermispora B
gb|KFM70080.1|  Polynucleotide 5'-hydroxyl-kinase NOL9                68.6    6e-10   Stegodyphus mimosarum
gb|KIO29173.1|  hypothetical protein M407DRAFT_21741                  68.2    7e-10   Tulasnella calospora MUT 4182
emb|CEL59375.1|  hypothetical protein RSOLAG1IB_03308                 68.2    8e-10   Rhizoctonia solani AG-1 IB
ref|XP_002955942.1|  hypothetical protein VOLCADRAFT_107002           68.2    8e-10   Volvox carteri f. nagariensis
ref|XP_002838513.1|  hypothetical protein                             67.8    8e-10   Tuber melanosporum Mel28
emb|CDO70310.1|  hypothetical protein BN946_scf184370.g11             68.2    9e-10   Trametes cinnabarina
gb|ELR58608.1|  Nucleolar protein 9                                   67.8    9e-10   Bos mutus
ref|XP_005892747.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  67.8    1e-09   
ref|XP_011904941.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  67.4    1e-09   Cercocebus atys
ref|NP_001193528.1|  polynucleotide 5'-hydroxyl-kinase NOL9           67.8    1e-09   Bos taurus [bovine]
ref|XP_005217149.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  67.4    1e-09   
ref|XP_010848250.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  67.4    1e-09   Bison bison bison
ref|XP_006048969.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  67.4    1e-09   Bubalus bubalis [domestic water buffalo]
ref|XP_011836679.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  67.0    1e-09   Mandrillus leucophaeus
gb|KIY65721.1|  hypothetical protein CYLTODRAFT_399978                67.4    1e-09   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_007312039.1|  hypothetical protein SERLADRAFT_364388           67.4    1e-09   Serpula lacrymans var. lacrymans S7.9
dbj|GAM20745.1|  hypothetical protein SAMD00019534_039200             67.0    1e-09   Acytostelium subglobosum LB1
gb|KIM42620.1|  hypothetical protein M413DRAFT_10152                  67.4    1e-09   Hebeloma cylindrosporum h7
ref|XP_005404374.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  67.0    2e-09   
ref|XP_007364489.1|  hypothetical protein DICSQDRAFT_103732           67.0    2e-09   Dichomitus squalens LYAD-421 SS1
ref|XP_005544965.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   Macaca fascicularis [crab eating macaque]
gb|EJU05971.1|  hypothetical protein DACRYDRAFT_12792                 67.0    2e-09   
ref|XP_011735834.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   
ref|XP_007978928.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   
ref|XP_005004441.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   
ref|XP_003471281.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   
ref|XP_011793698.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   
ref|XP_005103259.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   
gb|EFB21738.1|  hypothetical protein PANDA_013129                     66.6    2e-09   
ref|XP_011904945.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.2    2e-09   
ref|XP_010348688.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.2    2e-09   
ref|XP_004411109.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.2    2e-09   
ref|XP_008693194.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   
ref|XP_008998588.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   
ref|XP_006749311.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.6    2e-09   
gb|KEP55692.1|  pre-mRNA cleavage complex II protein Clp1             66.6    2e-09   
ref|XP_570592.1|  hypothetical protein                                66.6    3e-09   
ref|XP_002923909.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.2    3e-09   
gb|EHH14275.1|  hypothetical protein EGK_00168                        66.2    3e-09   
ref|NP_588473.1|  polynucleotide kinase Grc3 (predicted)              66.2    3e-09   
gb|AAH09257.2|  NOL9 protein                                          65.9    3e-09   
gb|KKA70724.1|  nol-9                                                 63.5    3e-09   
ref|XP_005994263.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.2    3e-09   
ref|XP_005263550.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.9    3e-09   
gb|AAH63639.1|  NOL9 protein                                          65.9    3e-09   
ref|XP_008532930.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.2    3e-09   
ref|XP_005994261.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.2    3e-09   
ref|XP_004863767.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.2    3e-09   
ref|XP_005690889.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.9    3e-09   
ref|XP_001492021.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  66.2    3e-09   
ref|XP_007515247.1|  predicted protein                                65.9    4e-09   
ref|XP_004906545.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.9    4e-09   
ref|XP_004768713.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.9    4e-09   
gb|KIY43811.1|  hypothetical protein FISHEDRAFT_21068                 65.9    4e-09   
gb|EHB16672.1|  Nucleolar protein 9                                   65.9    4e-09   
ref|XP_004768714.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.9    4e-09   
ref|XP_010626205.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.9    4e-09   
ref|XP_007669871.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.5    4e-09   
ref|XP_004784156.1|  PREDICTED: LOW QUALITY PROTEIN: polynucleoti...  65.9    4e-09   
ref|XP_001377300.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.9    4e-09   
ref|XP_004013805.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.9    4e-09   
ref|XP_004768712.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.9    4e-09   
ref|XP_005959688.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.5    6e-09   
emb|CCI40734.1|  unnamed protein product                              65.5    6e-09   
ref|XP_011449679.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.5    6e-09   
ref|XP_011315992.1|  GRC3 protein                                     65.5    6e-09   
ref|XP_009259063.1|  hypothetical protein FPSE_07670                  65.5    6e-09   
ref|XP_006145517.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.1    7e-09   
gb|KDQ22891.1|  hypothetical protein PLEOSDRAFT_1018497               65.1    7e-09   
ref|XP_008150076.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.1    7e-09   
gb|EKC25150.1|  Nucleolar protein 9                                   65.1    7e-09   
ref|XP_011449677.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.1    7e-09   
ref|XP_002174920.1|  AAA family ATPase Grc3                           65.1    7e-09   
ref|WP_014025740.1|  hypothetical protein                             64.7    7e-09   
ref|XP_009495719.1|  hypothetical protein H696_03576                  65.1    8e-09   
ref|XP_006934393.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  64.7    8e-09   
ref|XP_004086339.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  65.1    8e-09   
ref|XP_007078454.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  64.7    8e-09   
dbj|BAA87234.1|  Hypothetical nuclear protein                         62.4    8e-09   
ref|XP_006914455.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  64.7    9e-09   
ref|XP_011366769.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  64.7    9e-09   
ref|XP_004607280.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  64.7    1e-08   
gb|ELK28048.1|  Polynucleotide 5'-hydroxyl-kinase NOL9                64.3    1e-08   
ref|XP_001878778.1|  predicted protein                                64.7    1e-08   
ref|XP_006766889.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  64.3    1e-08   
gb|EHB12321.1|  Nucleolar protein 9                                   64.3    1e-08   
ref|XP_006794349.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  64.3    1e-08   
ref|XP_003793375.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  64.3    1e-08   
gb|EPQ12749.1|  Polynucleotide 5'-hydroxyl-kinase NOL9                63.9    1e-08   
ref|XP_006109827.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  64.3    1e-08   
ref|XP_005799036.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.9    1e-08   
ref|XP_005918906.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.9    2e-08   
gb|EPX73509.1|  AAA family ATPase Grc3                                63.9    2e-08   
ref|XP_006885979.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.9    2e-08   
ref|XP_005874427.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.9    2e-08   
ref|XP_008820679.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.9    2e-08   
ref|XP_004426133.1|  PREDICTED: pleckstrin homology domain-contai...  64.3    2e-08   
ref|XP_005620654.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.9    2e-08   
ref|XP_005448456.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.9    2e-08   
ref|XP_010955904.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.5    2e-08   
ref|WP_011018449.1|  GTPase or GTP-binding protein                    63.5    2e-08   
ref|XP_008264210.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.5    2e-08   
ref|XP_006177932.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.5    2e-08   
ref|XP_005334841.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.5    2e-08   
ref|XP_006197067.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.5    2e-08   
ref|XP_004453557.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.5    2e-08   
gb|KIR57069.1|  polynucleotide 5'-hydroxyl-kinase GRC3                63.5    2e-08   
ref|XP_002716195.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.5    2e-08   
ref|XP_005741010.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.5    3e-08   
gb|KDN44757.1|  hypothetical protein K437DRAFT_256902                 63.5    3e-08   
gb|KIL94869.1|  polynucleotide 5 -hydroxyl-kinase grc3                63.2    3e-08   
ref|XP_005454216.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.2    3e-08   
gb|KIR89232.1|  polynucleotide 5'-hydroxyl-kinase GRC3                63.2    3e-08   
ref|XP_003127589.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.2    3e-08   
ref|XP_004560400.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.2    3e-08   
ref|XP_004385227.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.2    3e-08   
ref|XP_003413240.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.2    3e-08   
emb|CBK25310.2|  unnamed protein product                              62.8    3e-08   
ref|XP_007940839.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  63.2    3e-08   
emb|CCA14231.1|  conserved hypothetical protein                       62.8    3e-08   
gb|KIR49732.1|  polynucleotide 5'-hydroxyl-kinase GRC3                62.8    4e-08   
ref|XP_010745565.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  62.8    4e-08   
gb|KIR42943.1|  polynucleotide 5'-hydroxyl-kinase GRC3                62.8    4e-08   
gb|KIR68674.1|  polynucleotide 5'-hydroxyl-kinase GRC3                62.8    4e-08   
gb|KIR27268.1|  polynucleotide 5'-hydroxyl-kinase GRC3                62.8    4e-08   
gb|KGB75033.1|  polynucleotide 5'-hydroxyl-kinase GRC3                62.8    4e-08   
gb|KIR36099.1|  polynucleotide 5'-hydroxyl-kinase GRC3                62.8    4e-08   
gb|EPY51150.1|  AAA family ATPase Grc3                                62.8    4e-08   
ref|XP_008047649.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  62.4    4e-08   
ref|XP_004596193.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  62.8    4e-08   
ref|XP_007166351.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  62.4    5e-08   
ref|XP_012049459.1|  polynucleotide 5'-hydroxyl-kinase GRC3           62.8    5e-08   
gb|KJE00047.1|  polynucleotide 5'-hydroxyl-kinase GRC3                62.4    5e-08   
gb|KIR80405.1|  polynucleotide 5'-hydroxyl-kinase GRC3                62.4    5e-08   
ref|XP_003193845.1|  hypothetical protein CGB_D7230C                  62.4    5e-08   
ref|XP_008317366.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  62.4    5e-08   
ref|XP_002290763.1|  predicted protein                                59.3    6e-08   
ref|XP_007438493.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  62.0    6e-08   
ref|XP_007453356.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  62.0    6e-08   
ref|XP_007110276.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  62.0    6e-08   
ref|XP_004317785.1|  PREDICTED: LOW QUALITY PROTEIN: polynucleoti...  62.0    6e-08   
ref|XP_004272385.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  62.0    7e-08   
gb|ELT95693.1|  hypothetical protein CAPTEDRAFT_197373                61.6    8e-08   
ref|XP_007532833.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  61.6    8e-08   
ref|XP_004705516.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  61.6    9e-08   
ref|XP_003515589.2|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  61.6    9e-08   
ref|XP_007631736.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  61.6    9e-08   
gb|ERE81898.1|  polynucleotide 5'-hydroxyl-kinase NOL9-like protein   61.6    9e-08   
ref|XP_004831100.1|  hypothetical protein BEWA_008440                 61.2    1e-07   
ref|XP_003765259.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  61.2    1e-07   
gb|KIL71123.1|  hypothetical protein M378DRAFT_201687                 61.2    2e-07   
ref|XP_006873186.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  60.8    2e-07   
ref|XP_007872111.1|  hypothetical protein PNEG_00242                  60.5    2e-07   
ref|XP_008035925.1|  hypothetical protein TRAVEDRAFT_70425            60.5    2e-07   
ref|XP_007767740.1|  hypothetical protein CONPUDRAFT_102605           60.5    2e-07   
ref|XP_003728982.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  60.5    2e-07   
ref|XP_009221501.1|  hypothetical protein GGTG_05434                  60.1    3e-07   
emb|CDJ96365.1|  Nucleolar protein 9                                  58.2    4e-07   
emb|CDJ87695.1|  NUC156 domain containing protein                     59.7    4e-07   
ref|XP_009394100.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  59.3    4e-07   
gb|KDB15670.1|  hypothetical protein UV8b_3310                        59.7    4e-07   
ref|XP_005079438.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  59.3    4e-07   
ref|XP_008283469.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  59.3    5e-07   
dbj|BAC31300.1|  unnamed protein product                              59.3    5e-07   
dbj|BAB29433.1|  unnamed protein product                              59.3    5e-07   
ref|NP_001153071.1|  polynucleotide 5'-hydroxyl-kinase NOL9 isofo...  59.3    6e-07   
ref|XP_233702.4|  PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9   59.3    6e-07   
ref|XP_006539271.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  59.3    6e-07   
dbj|BAC34472.1|  unnamed protein product                              59.3    6e-07   
ref|NP_083003.2|  polynucleotide 5'-hydroxyl-kinase NOL9 isoform 2    59.3    6e-07   
dbj|BAC32857.1|  unnamed protein product                              59.3    6e-07   
ref|XP_002413369.1|  cleavage/polyadenylation factor Ia subunit C...  59.3    6e-07   
gb|AAH24877.1|  Nol9 protein                                          58.9    6e-07   
ref|XP_011120121.1|  hypothetical protein AOL_s00054g503              59.3    6e-07   
ref|XP_006993860.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  58.9    8e-07   
gb|KDO23604.1|  hypothetical protein SPRG_10799                       58.5    8e-07   
ref|XP_011601118.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  58.5    9e-07   
gb|KIP10541.1|  hypothetical protein PHLGIDRAFT_100918                58.5    1e-06   
gb|KHJ35776.1|  putative rna processing protein                       58.5    1e-06   
ref|XP_007391582.1|  hypothetical protein PHACADRAFT_113119           58.5    1e-06   
ref|XP_008190421.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  58.5    1e-06   
ref|XP_003054396.1|  hypothetical protein NECHADRAFT_90213            58.5    1e-06   
gb|EEZ97796.1|  hypothetical protein TcasGA2_TC000158                 58.2    1e-06   
gb|KDR08998.1|  Nucleolar protein 9                                   57.8    1e-06   
ref|XP_001945272.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  57.8    2e-06   
ref|XP_008610026.1|  hypothetical protein SDRG_06047                  57.8    2e-06   
gb|EJT49006.1|  hypothetical protein A1Q1_01917                       57.8    2e-06   
gb|KIK54740.1|  hypothetical protein GYMLUDRAFT_206207                57.8    2e-06   
ref|XP_007570820.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  57.8    2e-06   
ref|XP_006692115.1|  hypothetical protein CTHT_0016120                57.4    2e-06   
gb|EKC97753.1|  hypothetical protein A1Q2_07952                       57.4    2e-06   
emb|CDJ05011.1|  polynucleotide 5' hydroxyl kinase NOL9               57.0    3e-06   
ref|XP_010404133.1|  PREDICTED: LOW QUALITY PROTEIN: polynucleoti...  56.6    3e-06   
ref|XP_008412763.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  57.0    3e-06   
ref|XP_008543687.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  57.0    3e-06   
ref|XP_005353717.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  56.6    4e-06   
ref|XP_004657456.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  56.6    4e-06   
ref|XP_011876205.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  56.2    5e-06   
ref|XP_003074518.1|  unnamed protein product                          56.2    5e-06   
ref|XP_011876206.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  56.2    6e-06   
emb|CCE30466.1|  uncharacterized protein CPUR_04314                   56.2    6e-06   
ref|XP_007820889.2|  grc3                                             56.2    6e-06   
gb|EXV06353.1|  rDNA polynucleotide kinase GRC3                       56.2    6e-06   
gb|KHN93798.1|  Pre-mRNA cleavage complex II Clp1                     55.8    7e-06   
ref|XP_007841463.1|  hypothetical protein PFICI_14691                 56.2    7e-06   
gb|KKA28975.1|  hypothetical protein TD95_000907                      55.8    8e-06   
gb|ELQ34582.1|  hypothetical protein OOU_Y34scaffold00765g128         55.8    8e-06   
ref|XP_003716660.1|  hypothetical protein MGG_03303                   55.8    8e-06   
gb|KID98232.1|  Protein grc3                                          55.8    8e-06   
gb|KFH41852.1|  Polynucleotide 5'-hydroxyl-kinase-like protein        55.5    1e-05   
ref|XP_004933452.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  55.5    1e-05   
gb|KFY73833.1|  hypothetical protein V499_06100                       55.5    1e-05   
emb|CCU99305.1|  unnamed protein product                              55.5    1e-05   
gb|KID92416.1|  Protein grc3                                          55.1    1e-05   
gb|KJK88957.1|  hypothetical protein H633G_07196                      55.1    1e-05   
ref|XP_006618252.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  55.1    1e-05   
ref|WP_029715980.1|  hypothetical protein                             54.7    1e-05   
gb|KFG87434.1|  hypothetical protein MANI_027696                      55.1    1e-05   
ref|XP_011406618.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  55.1    1e-05   
gb|KID60757.1|  Protein grc3                                          55.1    1e-05   
gb|ELR03793.1|  hypothetical protein GMDG_01322                       55.1    2e-05   
gb|KJK84266.1|  hypothetical protein H634G_00630                      54.7    2e-05   
gb|KIK07085.1|  hypothetical protein K443DRAFT_673659                 55.1    2e-05   
gb|EWZ51330.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
gb|EWZ91197.1|  polynucleotide 5'-hydroxyl-kinase GRC3                55.1    2e-05   
ref|XP_005649031.1|  hypothetical protein COCSUDRAFT_40871            54.7    2e-05   
gb|EXK48606.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
gb|EWZ91198.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
gb|EXM27923.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
gb|EWZ51329.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
emb|CCT62591.1|  probable Polynucleotide 5'-hydroxyl-kinase GRC3      54.7    2e-05   
gb|EXM11694.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
gb|EXA52444.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
gb|EXK48605.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
gb|EXA52443.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
ref|XP_008473532.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  54.7    2e-05   
gb|EXM11693.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
gb|EXM27922.1|  polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
emb|CDS17257.1|  polynucleotide 5' hydroxyl kinase NOL9               54.7    2e-05   
gb|ENH61214.1|  Polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
gb|EMT61697.1|  Polynucleotide 5'-hydroxyl-kinase GRC3                54.7    2e-05   
ref|XP_006618253.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...  54.7    2e-05   



>ref|XP_002267234.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Vitis vinifera]
 emb|CBI15309.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MA+  E E PSPDI IP EWS+ A+TIAYDSVTSPPPV+L+CG KNCGKTTFSRHLL++L
Sbjct  1    MAAFSEAEAPSPDIYIPEEWSEAAETIAYDSVTSPPPVALVCGAKNCGKTTFSRHLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLDTDVGQTEFTPPGFLSLT+ID++  DLTIPCLKTPERC++FGDISS
Sbjct  61   LQRYQKVAYLDTDVGQTEFTPPGFLSLTVIDQLTPDLTIPCLKTPERCYYFGDISS  116



>ref|XP_009631976.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X2 
[Nicotiana tomentosiformis]
Length=324

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS   +E+ S +I IP EWSD ADTIAYDS TSPPPV+ +CGPKN GKTTFSR LL+VL
Sbjct  1    MASLGHDELQSANIFIPEEWSDAADTIAYDSTTSPPPVAFVCGPKNSGKTTFSRLLLNVL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLDTDVGQTEFTPPG LSLT IDKI +DL+IPCLKTPERCFFFGDISS
Sbjct  61   LQRYKKVAYLDTDVGQTEFTPPGLLSLTTIDKITSDLSIPCLKTPERCFFFGDISS  116



>ref|XP_009631975.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X1 
[Nicotiana tomentosiformis]
Length=377

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS   +E+ S +I IP EWSD ADTIAYDS TSPPPV+ +CGPKN GKTTFSR LL+VL
Sbjct  1    MASLGHDELQSANIFIPEEWSDAADTIAYDSTTSPPPVAFVCGPKNSGKTTFSRLLLNVL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLDTDVGQTEFTPPG LSLT IDKI +DL+IPCLKTPERCFFFGDISS
Sbjct  61   LQRYKKVAYLDTDVGQTEFTPPGLLSLTTIDKITSDLSIPCLKTPERCFFFGDISS  116



>ref|XP_010087739.1| hypothetical protein L484_008936 [Morus notabilis]
 gb|EXB29772.1| hypothetical protein L484_008936 [Morus notabilis]
Length=378

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MA   E E PSPDI IP EWSD AD+IAYDS TSPPP++ ICG KN GKTTFSRHLL++L
Sbjct  1    MAFIEEQENPSPDIYIPEEWSDAADSIAYDSRTSPPPIAFICGAKNSGKTTFSRHLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L RY+KVAYLDTDVGQ EFTPPGFLS T++DK+ +DLTIPCLKTPER FFFGD+SS
Sbjct  61   LNRYKKVAYLDTDVGQPEFTPPGFLSFTVVDKLTSDLTIPCLKTPERSFFFGDVSS  116



>ref|XP_006344986.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Solanum 
tuberosum]
Length=374

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS +++E  S +I IP EWSD AD++AYDS TSPPPV+ +CGPKN GKTTFSR L++VL
Sbjct  1    MASFVDDEFQSANIFIPEEWSDAADSVAYDSNTSPPPVAFVCGPKNSGKTTFSRLLVNVL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLDTDVGQTEFTPPG LSLT IDKI +DL+IPCLKTPERCFFFGDISS
Sbjct  61   LQRYKKVAYLDTDVGQTEFTPPGLLSLTTIDKITSDLSIPCLKTPERCFFFGDISS  116



>ref|XP_012080166.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X3 
[Jatropha curcas]
Length=389

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  306  GMASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHV  485
             MAS  E E PSP I IP EWS+ ADTIAYDS TSPPPV+LICG KNCGKT FSR+LL+ 
Sbjct  30   AMASISEIEDPSPSIHIPEEWSEAADTIAYDSTTSPPPVALICGAKNCGKTIFSRYLLNN  89

Query  486  LLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LL+RYRKV YLDTDVGQ EFT PGFLSLT++DK+  DLTIPCLKTPERCFFFGD+SS
Sbjct  90   LLQRYRKVGYLDTDVGQAEFTTPGFLSLTVVDKLTLDLTIPCLKTPERCFFFGDVSS  146



>ref|XP_004236162.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Solanum lycopersicum]
Length=374

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS +++E  S +I IP EWSD AD++AYDS TSPPPV+ +CGPKN GKTTFSR L++VL
Sbjct  1    MASFVDDEFQSANIFIPEEWSDAADSVAYDSNTSPPPVAFVCGPKNSGKTTFSRVLVNVL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLDTDVGQTEFTPPG LSLT IDKI +DL+IPCLKTPERCFFFGDISS
Sbjct  61   LQRYKKVAYLDTDVGQTEFTPPGLLSLTTIDKITSDLSIPCLKTPERCFFFGDISS  116



>ref|XP_012080164.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X1 
[Jatropha curcas]
 gb|KDP31174.1| hypothetical protein JCGZ_11550 [Jatropha curcas]
Length=408

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  306  GMASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHV  485
             MAS  E E PSP I IP EWS+ ADTIAYDS TSPPPV+LICG KNCGKT FSR+LL+ 
Sbjct  30   AMASISEIEDPSPSIHIPEEWSEAADTIAYDSTTSPPPVALICGAKNCGKTIFSRYLLNN  89

Query  486  LLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LL+RYRKV YLDTDVGQ EFT PGFLSLT++DK+  DLTIPCLKTPERCFFFGD+SS
Sbjct  90   LLQRYRKVGYLDTDVGQAEFTTPGFLSLTVVDKLTLDLTIPCLKTPERCFFFGDVSS  146



>ref|XP_012080165.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X2 
[Jatropha curcas]
Length=405

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  306  GMASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHV  485
             MAS  E E PSP I IP EWS+ ADTIAYDS TSPPPV+LICG KNCGKT FSR+LL+ 
Sbjct  27   AMASISEIEDPSPSIHIPEEWSEAADTIAYDSTTSPPPVALICGAKNCGKTIFSRYLLNN  86

Query  486  LLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LL+RYRKV YLDTDVGQ EFT PGFLSLT++DK+  DLTIPCLKTPERCFFFGD+SS
Sbjct  87   LLQRYRKVGYLDTDVGQAEFTTPGFLSLTVVDKLTLDLTIPCLKTPERCFFFGDVSS  143



>ref|XP_009768776.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Nicotiana 
sylvestris]
Length=377

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS   +++ S +I IP EWSD ADTIAYDS T PPPV+ +CGPKN GKTTFSR LL+VL
Sbjct  1    MASLGHDDLQSANIFIPEEWSDAADTIAYDSTTPPPPVTFVCGPKNSGKTTFSRLLLNVL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLDTDVGQTEFTPPG LSLT IDKI +DL+IPCLKTPERCFFFGDISS
Sbjct  61   LQRYKKVAYLDTDVGQTEFTPPGLLSLTTIDKITSDLSIPCLKTPERCFFFGDISS  116



>ref|XP_002318622.2| hypothetical protein POPTR_0012s07530g [Populus trichocarpa]
 gb|EEE96842.2| hypothetical protein POPTR_0012s07530g [Populus trichocarpa]
Length=375

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS  E E  SP I I  EWS+ AD++AYDS TSPPP++L+CGPKNCGKTTFSR+LL++L
Sbjct  1    MASITEREEASPSIYISEEWSEAADSVAYDSTTSPPPIALVCGPKNCGKTTFSRYLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY++V YLDTDVGQ EFT PGFLSLT++DK+  DLTIPCLKTPERCFFFGD+SS
Sbjct  61   LQRYKRVGYLDTDVGQPEFTTPGFLSLTVVDKLTPDLTIPCLKTPERCFFFGDVSS  116



>ref|XP_011042638.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Populus euphratica]
 ref|XP_011042639.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Populus euphratica]
Length=375

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS  E E  SP I I  EWS+ AD++AYDS TSPPP++L+CGPKNCGKTTFSR+LL++L
Sbjct  1    MASITEREEASPSIYISEEWSEAADSVAYDSTTSPPPIALVCGPKNCGKTTFSRYLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY++V YLDTDVGQ EFT PGFLSLT++DK+  DLTIPCLKTPERCFFFGD+SS
Sbjct  61   LQRYKRVGYLDTDVGQPEFTTPGFLSLTVVDKLTPDLTIPCLKTPERCFFFGDVSS  116



>gb|ABK93937.1| unknown [Populus trichocarpa]
Length=375

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS  E E  SP I I  EWS+ AD++AYDS TSPPP++L+CGPKNCGKTTFSR+LL++L
Sbjct  1    MASITEREEASPSIYISEEWSEAADSVAYDSTTSPPPIALVCGPKNCGKTTFSRYLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY++V YLDTDVGQ EFT PGFLSLT++DK+  DLTIPCLKTPERCFFFGD+SS
Sbjct  61   LQRYKRVGYLDTDVGQPEFTTPGFLSLTVVDKLTPDLTIPCLKTPERCFFFGDVSS  116



>gb|KDO69842.1| hypothetical protein CISIN_1g017023mg [Citrus sinensis]
Length=376

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  309  MASAL-ENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHV  485
            MA+ + + E PSP I IP EWSD AD+IAYDS TSPPP++ ICG KNCGKTTFSRHL++V
Sbjct  1    MAAYMPQTENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNV  60

Query  486  LLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LL+RY+KVAYLDTDVGQ EFT PGFLSLT++D +  DLTIPCLKTP+RC+FFGD+SS
Sbjct  61   LLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSS  117



>ref|XP_006439711.1| hypothetical protein CICLE_v10020622mg [Citrus clementina]
 gb|ESR52951.1| hypothetical protein CICLE_v10020622mg [Citrus clementina]
Length=379

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  309  MASAL-ENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHV  485
            MA+ + + E PSP I IP EWSD AD+IAYDS TSPPP++ ICG KNCGKTTFSRHL++V
Sbjct  1    MAAYMPQTENPSPAIYIPQEWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNV  60

Query  486  LLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LL+RY+KVAYLDTDVGQ EFT PGFLSLT++D +  DLTIPCLKTP+RC+FFGD+SS
Sbjct  61   LLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSS  117



>ref|XP_006476701.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X2 [Citrus sinensis]
Length=365

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  309  MASAL-ENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHV  485
            MA+ + + E PSP I IP EWSD AD+IAYDS TSPPP++ ICG KNCGKTTFSRHL++V
Sbjct  1    MAAYMPQTENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNV  60

Query  486  LLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LL+RY+KVAYLDTDVGQ EFT PGFLSLT++D +  DLTIPCLKTP+RC+FFGD+SS
Sbjct  61   LLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSS  117



>ref|XP_006476700.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X1 [Citrus sinensis]
 gb|KDO69841.1| hypothetical protein CISIN_1g017023mg [Citrus sinensis]
Length=379

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  309  MASAL-ENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHV  485
            MA+ + + E PSP I IP EWSD AD+IAYDS TSPPP++ ICG KNCGKTTFSRHL++V
Sbjct  1    MAAYMPQTENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNV  60

Query  486  LLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LL+RY+KVAYLDTDVGQ EFT PGFLSLT++D +  DLTIPCLKTP+RC+FFGD+SS
Sbjct  61   LLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSS  117



>ref|XP_007010523.1| Pre-mRNA cleavage complex II family protein isoform 4 [Theobroma 
cacao]
 gb|EOY19333.1| Pre-mRNA cleavage complex II family protein isoform 4 [Theobroma 
cacao]
Length=287

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            M S LE+   + +I IP EWS+ AD+IAYDSVTSPPP++ ICG KN GKTTFSR LL++L
Sbjct  1    MDSKLESGSSTANIYIPEEWSEAADSIAYDSVTSPPPIAFICGAKNSGKTTFSRLLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLD DVGQ EFT PGFLSLT++DK+ ADL IPCLKTPERCFFFGDISS
Sbjct  61   LQRYQKVAYLDADVGQPEFTAPGFLSLTVVDKLTADLAIPCLKTPERCFFFGDISS  116



>ref|XP_007211322.1| hypothetical protein PRUPE_ppa007204mg [Prunus persica]
 gb|EMJ12521.1| hypothetical protein PRUPE_ppa007204mg [Prunus persica]
Length=378

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS  E E PSP+I IP EWS+ AD IAYDSVTSPPP++++CG KNCGK+TFSR+LL++L
Sbjct  1    MASRSEPENPSPNIYIPPEWSEAADCIAYDSVTSPPPIAIVCGAKNCGKSTFSRYLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KV YLDTDVGQ EF+PPGFLSLT++D++  DLTIP LKTPERC FFGD+SS
Sbjct  61   LQRYKKVGYLDTDVGQPEFSPPGFLSLTVVDEVTPDLTIPHLKTPERCLFFGDVSS  116



>ref|XP_007010521.1| Pre-mRNA cleavage complex II family protein isoform 2 [Theobroma 
cacao]
 gb|EOY19331.1| Pre-mRNA cleavage complex II family protein isoform 2 [Theobroma 
cacao]
Length=360

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            M S LE+   + +I IP EWS+ AD+IAYDSVTSPPP++ ICG KN GKTTFSR LL++L
Sbjct  1    MDSKLESGSSTANIYIPEEWSEAADSIAYDSVTSPPPIAFICGAKNSGKTTFSRLLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLD DVGQ EFT PGFLSLT++DK+ ADL IPCLKTPERCFFFGDISS
Sbjct  61   LQRYQKVAYLDADVGQPEFTAPGFLSLTVVDKLTADLAIPCLKTPERCFFFGDISS  116



>ref|XP_008437827.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Cucumis melo]
Length=379

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            M+S LE E  SP+I IP EWS+ A++I +DS TSPPPV LICG KNCGK+TFSRHLL+V 
Sbjct  1    MSSFLELENSSPNIFIPEEWSEAAESIVFDSPTSPPPVVLICGAKNCGKSTFSRHLLNVF  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KV YLD+DVGQ EFTPPGFLSLT++D++  DL+ PCLKTPERCFFFGDISS
Sbjct  61   LQRYKKVVYLDSDVGQPEFTPPGFLSLTVVDRLTPDLSTPCLKTPERCFFFGDISS  116



>ref|XP_007010522.1| Pre-mRNA cleavage complex II family protein isoform 3 [Theobroma 
cacao]
 gb|EOY19332.1| Pre-mRNA cleavage complex II family protein isoform 3 [Theobroma 
cacao]
Length=327

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            M S LE+   + +I IP EWS+ AD+IAYDSVTSPPP++ ICG KN GKTTFSR LL++L
Sbjct  1    MDSKLESGSSTANIYIPEEWSEAADSIAYDSVTSPPPIAFICGAKNSGKTTFSRLLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLD DVGQ EFT PGFLSLT++DK+ ADL IPCLKTPERCFFFGDISS
Sbjct  61   LQRYQKVAYLDADVGQPEFTAPGFLSLTVVDKLTADLAIPCLKTPERCFFFGDISS  116



>ref|XP_004152451.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Cucumis sativus]
 gb|KGN64273.1| hypothetical protein Csa_1G045710 [Cucumis sativus]
Length=379

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            M+S LE E  SP+I IP EWS+ A++I +DS TSPPPV LICG KNCGK+TFSRHLL+V 
Sbjct  1    MSSFLELENSSPNIFIPEEWSEAAESIVFDSPTSPPPVVLICGAKNCGKSTFSRHLLNVF  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KV YLD+DVGQ EFTPPGFLSLT++D++  DL+ PCLKTPERCFFFGDISS
Sbjct  61   LRRYKKVVYLDSDVGQPEFTPPGFLSLTVVDRLIPDLSTPCLKTPERCFFFGDISS  116



>gb|KCW83466.1| hypothetical protein EUGRSUZ_B00382 [Eucalyptus grandis]
Length=287

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +3

Query  324  ENEIPSPDIIIPNEWSDTADTIAYDS--VTSPPPVSLICGPKNCGKTTFSRHLLHVLLKR  497
            E E PSP I IP EWS+ A  IA  S    SPPPV+LICG KNCGKTTFSRHLL+VLL+R
Sbjct  3    EAEAPSPAIYIPEEWSEAAAAIARGSSAAASPPPVALICGAKNCGKTTFSRHLLNVLLRR  62

Query  498  YRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            Y++VAYLDTDVGQ EFTPPGFLSLTI+DK+  DLTIPCLKTPERCFFFGD+S+
Sbjct  63   YKRVAYLDTDVGQPEFTPPGFLSLTIVDKLTPDLTIPCLKTPERCFFFGDVSA  115



>ref|XP_009369394.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Pyrus 
x bretschneideri]
 ref|XP_009346729.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Pyrus 
x bretschneideri]
Length=378

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MA   E E PSP+I IP EWS+ AD IAYDSVT PPP++L+CG KNCGK+TFSRHLL++ 
Sbjct  1    MALPSERETPSPNIYIPPEWSEAADCIAYDSVTWPPPIALVCGAKNCGKSTFSRHLLNIF  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KV YLDTDVGQ EF+PPGF+SLT+ID++  DLTIP LKTPERC FFGD+SS
Sbjct  61   LRRYKKVGYLDTDVGQPEFSPPGFVSLTVIDEVTPDLTIPHLKTPERCLFFGDVSS  116



>ref|XP_007010520.1| Pre-mRNA cleavage complex II protein family isoform 1 [Theobroma 
cacao]
 gb|EOY19330.1| Pre-mRNA cleavage complex II protein family isoform 1 [Theobroma 
cacao]
Length=378

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            M S LE+   + +I IP EWS+ AD+IAYDSVTSPPP++ ICG KN GKTTFSR LL++L
Sbjct  1    MDSKLESGSSTANIYIPEEWSEAADSIAYDSVTSPPPIAFICGAKNSGKTTFSRLLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KVAYLD DVGQ EFT PGFLSLT++DK+ ADL IPCLKTPERCFFFGDISS
Sbjct  61   LQRYQKVAYLDADVGQPEFTAPGFLSLTVVDKLTADLAIPCLKTPERCFFFGDISS  116



>ref|XP_008239684.1| PREDICTED: LOW QUALITY PROTEIN: polynucleotide 5'-hydroxyl-kinase 
NOL9-like [Prunus mume]
Length=371

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS  E E  SP+I IP EWS+ AD IAYDSVTSPPP++++CG KNCGK+TFSR+LL++L
Sbjct  1    MASRSEPENRSPNIYIPPEWSEAADCIAYDSVTSPPPIAIVCGAKNCGKSTFSRYLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KV YLDTDVGQ EF+PPGFLSLT++D++  DLTIP LKTPERC FFGD+SS
Sbjct  61   LQRYKKVGYLDTDVGQPEFSPPGFLSLTVVDEVTPDLTIPHLKTPERCLFFGDVSS  116



>ref|XP_010028463.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Eucalyptus 
grandis]
 gb|KCW83465.1| hypothetical protein EUGRSUZ_B00382 [Eucalyptus grandis]
Length=377

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +3

Query  324  ENEIPSPDIIIPNEWSDTADTIAYDS--VTSPPPVSLICGPKNCGKTTFSRHLLHVLLKR  497
            E E PSP I IP EWS+ A  IA  S    SPPPV+LICG KNCGKTTFSRHLL+VLL+R
Sbjct  3    EAEAPSPAIYIPEEWSEAAAAIARGSSAAASPPPVALICGAKNCGKTTFSRHLLNVLLRR  62

Query  498  YRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            Y++VAYLDTDVGQ EFTPPGFLSLTI+DK+  DLTIPCLKTPERCFFFGD+S+
Sbjct  63   YKRVAYLDTDVGQPEFTPPGFLSLTIVDKLTPDLTIPCLKTPERCFFFGDVSA  115



>ref|XP_002511482.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52084.1| conserved hypothetical protein [Ricinus communis]
Length=381

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 98/118 (83%), Gaps = 2/118 (2%)
 Frame = +3

Query  309  MASAL--ENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLH  482
            MAS +    E  SP I IP EWS+ A+TIAYDS TSP PVSLICG KNCGKTTFSR+LL+
Sbjct  1    MASNILETEEASSPSIHIPQEWSEAANTIAYDSPTSPLPVSLICGAKNCGKTTFSRYLLN  60

Query  483  VLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
             LL+RYR+V YLDTDVGQ EFT PGF+SLT++DK+  DLTIPCLKTPERCFFFGD+SS
Sbjct  61   TLLQRYRRVGYLDTDVGQPEFTTPGFVSLTVVDKLTPDLTIPCLKTPERCFFFGDVSS  118



>ref|XP_008374498.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Malus 
domestica]
Length=378

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS    E PSP+I IP EWS+ AD IAYDSVT PPP++L+CG KNCGK+TFSRHLL++ 
Sbjct  1    MASPSGPETPSPNIYIPPEWSEAADCIAYDSVTWPPPIALVCGAKNCGKSTFSRHLLNIF  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY+KV YLDTDVGQ EF+PPGF+SLT+ID+   DLTIP LKTPERC FFGD+SS
Sbjct  61   LRRYKKVGYLDTDVGQPEFSPPGFVSLTVIDEATPDLTIPHLKTPERCLFFGDVSS  116



>gb|EYU24447.1| hypothetical protein MIMGU_mgv1a008342mg [Erythranthe guttata]
Length=377

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MA   E++  SPDI IP+EWS+TAD IA  SV SP  ++ +CGPKN GKTTFSRHLL+VL
Sbjct  1    MAPDSESDRSSPDIFIPDEWSNTADAIANCSVDSP--IAFVCGPKNSGKTTFSRHLLNVL  58

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+R++KVAYLDTDVGQTEFTPPG LSLTI+DKI  DLTIPCLKTPERCFFFGDISS
Sbjct  59   LQRHKKVAYLDTDVGQTEFTPPGLLSLTIVDKITPDLTIPCLKTPERCFFFGDISS  114



>gb|KJB50841.1| hypothetical protein B456_008G189500 [Gossypium raimondii]
Length=380

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS       + +I +P EWS+ A++IAYDSVTSPPP S ICG KN GKTTFSRHLL++L
Sbjct  1    MASMFGPGSSTANIYVPEEWSEAANSIAYDSVTSPPPFSFICGAKNSGKTTFSRHLLNIL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+RY KVAYLDTDVGQ EFT PGF+SLT++DKI  DL IPCLKTPERCFFFGD+SS
Sbjct  61   LQRYGKVAYLDTDVGQPEFTVPGFVSLTVVDKITPDLAIPCLKTPERCFFFGDVSS  116



>ref|XP_008393083.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Malus 
domestica]
Length=377

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  330  EIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKV  509
            E PS +I I  EWS+  D IAYDSVTSPPP++L+CG KNCGK+TFSRHLL++LL+RY+KV
Sbjct  6    ETPSANIYISPEWSEAVDCIAYDSVTSPPPIALVCGAKNCGKSTFSRHLLNILLRRYKKV  65

Query  510  AYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
             YLDTDVGQ EF+PPGFLSLT++D++  DLTIP LKTP+RC FFGD+SS
Sbjct  66   GYLDTDVGQPEFSPPGFLSLTVVDEVTPDLTIPHLKTPKRCLFFGDVSS  114



>gb|EYU37059.1| hypothetical protein MIMGU_mgv1a007825mg [Erythranthe guttata]
Length=394

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  330  EIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKV  509
            E PSP I IP EWS+  D IA  SV  P  V  +CGPKNCGKTTFSRHLL++LL+R++KV
Sbjct  19   ESPSPKIYIPEEWSNAVDAIASGSVAFP--VVFVCGPKNCGKTTFSRHLLNLLLQRHKKV  76

Query  510  AYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            AYLDTDVGQTEFTPPG LSLT+IDKI  DLT+PCLKTPERC+FFGDISS
Sbjct  77   AYLDTDVGQTEFTPPGLLSLTVIDKITPDLTLPCLKTPERCYFFGDISS  125



>ref|XP_010255658.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Nelumbo nucifera]
 ref|XP_010255662.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Nelumbo nucifera]
Length=390

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  312  ASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLL  491
             S    E PSP+I IP  WS+ A +I YDS+TSPPPV+ ICG KN GKTTFSR+LL++LL
Sbjct  10   VSPTRTETPSPNIFIPASWSEAAISIVYDSITSPPPVAFICGAKNSGKTTFSRYLLNILL  69

Query  492  KRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            +RY++VAYLDTDVGQ EFTPPG LSL +ID+   D TIPCLKTPERC FFGDISS
Sbjct  70   QRYKRVAYLDTDVGQPEFTPPGCLSLNVIDRQTPDTTIPCLKTPERCLFFGDISS  124



>ref|XP_003525672.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X1 [Glycine max]
 ref|XP_006579775.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X2 [Glycine max]
Length=372

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            PSPDI IP +WS+ A++IA+ S+   PP++LICG KNCGKTTFSR+LL+VLL +Y KVAY
Sbjct  5    PSPDIYIPEQWSEAAESIAHSSM---PPIALICGAKNCGKTTFSRYLLNVLLHKYTKVAY  61

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LDTDVGQ EFTPP FLSLTI+ K+  DLT+PCLKTPERC FFGD+SS
Sbjct  62   LDTDVGQPEFTPPAFLSLTIVHKVTPDLTVPCLKTPERCLFFGDVSS  108



>gb|KHN27453.1| Polynucleotide 5'-hydroxyl-kinase NOL9 [Glycine soja]
Length=379

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            PSPDI IP +WS+ A++IA+ S+   PP++LICG KNCGKTTFSR+LL+VLL +Y KVAY
Sbjct  5    PSPDIYIPEQWSEAAESIAHSSM---PPIALICGAKNCGKTTFSRYLLNVLLHKYTKVAY  61

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LDTDVGQ EFTPP FLSLTI+ K+  DLT+PCLKTPERC FFGD+SS
Sbjct  62   LDTDVGQPEFTPPAFLSLTIVHKVTPDLTVPCLKTPERCLFFGDVSS  108



>ref|XP_004301291.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Fragaria vesca 
subsp. vesca]
Length=375

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MAS    E PSP+I IP EWS  A+ +A+ S+TS PP+ L+CG KNCGK+TFSR+LL+ L
Sbjct  1    MASISGPENPSPNIYIPPEWSSAAEAVAHGSLTSLPPIVLVCGAKNCGKSTFSRYLLNTL  60

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L RY+KV YLDTDVGQ EF+PPGFLSLT++D++  DLTIP +KT ERC FFGD+SS
Sbjct  61   LLRYKKVGYLDTDVGQPEFSPPGFLSLTVVDEVTPDLTIPHMKTAERCLFFGDVSS  116



>ref|XP_004504479.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Cicer 
arietinum]
Length=374

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 8/119 (7%)
 Frame = +3

Query  300  ERGMASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLL  479
            ER M S+     PSPDI IP +WS  A++IA    +S P ++LICG KNCGKTTFSR+LL
Sbjct  5    ERAMGSS-----PSPDIYIPEQWSQAAESIA---SSSTPTITLICGAKNCGKTTFSRYLL  56

Query  480  HVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            +VLL ++++VAYLDTDVGQ EFTPP F+SLT++ KI  DLTIPCLKTPERC FFGD+SS
Sbjct  57   NVLLTKFKRVAYLDTDVGQPEFTPPAFVSLTVVRKITPDLTIPCLKTPERCLFFGDVSS  115



>ref|XP_007151004.1| hypothetical protein PHAVU_004G010600g [Phaseolus vulgaris]
 gb|ESW22998.1| hypothetical protein PHAVU_004G010600g [Phaseolus vulgaris]
Length=370

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            PS DI IP +WS+ A++IAY   +S PP+  ICG KNCGKTTFSR+LL++LL +Y KVAY
Sbjct  5    PSRDICIPEQWSEAAESIAY---SSTPPIVFICGAKNCGKTTFSRYLLNILLHKYAKVAY  61

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LDTDVGQ EFTPP FLSLT++ K+  DLT+PCLKTPERC FFGD+SS
Sbjct  62   LDTDVGQPEFTPPAFLSLTVVHKVTPDLTVPCLKTPERCLFFGDVSS  108



>emb|CBI15311.3| unnamed protein product [Vitis vinifera]
Length=99

 Score =   151 bits (381),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  375  TADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPP  554
            + +TIAYDSVTSPPPV+L+CG KNCGKT FSRHLL++LL+RY+KVAYLDTDVGQTEFTPP
Sbjct  4    SCETIAYDSVTSPPPVALVCGAKNCGKTAFSRHLLNILLQRYQKVAYLDTDVGQTEFTPP  63

Query  555  GFLSLTIIDKIPADLTIPCLKTPER  629
            GFLSLT+ID++  DLTIPCLKTPER
Sbjct  64   GFLSLTVIDQLTPDLTIPCLKTPER  88



>ref|XP_011087186.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Sesamum indicum]
Length=375

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MA+A E E PSP I IP EW+  A+ IA  S  +  P++ +CGPKN GKTTFSRHLL+VL
Sbjct  1    MAAASETESPSPKIFIPEEWAAAAEAIACGS--AALPITFVCGPKNSGKTTFSRHLLNVL  58

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L+R++KVAYLDTDVGQTEFTPPG LSLT+IDKI  DLTIPCLKTPERCFFFGDISS
Sbjct  59   LQRHKKVAYLDTDVGQTEFTPPGLLSLTVIDKITPDLTIPCLKTPERCFFFGDISS  114



>ref|XP_010678646.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Beta vulgaris 
subsp. vulgaris]
Length=390

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  339  SPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
             P+I I  EWSD AD I  DS TS PPV  ICG KN GKTTFSRHLL+  L RY +VAYL
Sbjct  8    QPNINISQEWSDAADAITNDSTTSLPPVVFICGAKNSGKTTFSRHLLNTFLLRYERVAYL  67

Query  519  DTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            DTDVGQ EFTPPG LSLTIID+   DLTIPCLKTP+RC+FFGD SS
Sbjct  68   DTDVGQPEFTPPGCLSLTIIDEATPDLTIPCLKTPQRCYFFGDTSS  113



>ref|XP_006578600.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X3 [Glycine max]
Length=317

 Score =   155 bits (391),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            PSPDI IP +W +  ++IA+ S+    P++LICG KNCGKTTFSR+LL++LL +Y KVAY
Sbjct  5    PSPDICIPEQWLEATESIAHSSML---PIALICGAKNCGKTTFSRYLLNILLNKYTKVAY  61

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            LDTDVGQ EFTPP FLSLTI+ K+  DLT+PCLKTPERC FFGD+S
Sbjct  62   LDTDVGQPEFTPPAFLSLTIVHKVTPDLTVPCLKTPERCLFFGDVS  107



>ref|XP_003528167.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Glycine 
max]
Length=354

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            PSPDI IP +W +  ++IA  S+   PP++LICG KNC KTTFSR+LL+VLL +Y KVAY
Sbjct  5    PSPDINIPEQWLEATESIANSSM---PPITLICGAKNCAKTTFSRYLLNVLLNKYTKVAY  61

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            LDTDVGQ EFTPP FLSLTI+ K+ +DLT+PCLKTPERC FFGD+S
Sbjct  62   LDTDVGQPEFTPPAFLSLTIVHKVTSDLTVPCLKTPERCLFFGDVS  107



>gb|KHN16281.1| Polynucleotide 5'-hydroxyl-kinase NOL9 [Glycine soja]
Length=366

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            PSPDI IP +W +  ++IA+ S+    P++LICG KNCGKTTFSR+LL++LL +Y KVAY
Sbjct  5    PSPDICIPEQWLEATESIAHSSML---PIALICGAKNCGKTTFSRYLLNILLNKYTKVAY  61

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            LDTDVGQ EFTPP FLSLTI+ K+  DLT+PCLKTPERC FFGD+S
Sbjct  62   LDTDVGQPEFTPPAFLSLTIVHKVTPDLTVPCLKTPERCLFFGDVS  107



>ref|XP_003522357.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X1 [Glycine max]
 ref|XP_006578599.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X2 [Glycine max]
Length=370

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            PSPDI IP +W +  ++IA+ S+    P++LICG KNCGKTTFSR+LL++LL +Y KVAY
Sbjct  5    PSPDICIPEQWLEATESIAHSSML---PIALICGAKNCGKTTFSRYLLNILLNKYTKVAY  61

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            LDTDVGQ EFTPP FLSLTI+ K+  DLT+PCLKTPERC FFGD+S
Sbjct  62   LDTDVGQPEFTPPAFLSLTIVHKVTPDLTVPCLKTPERCLFFGDVS  107



>ref|XP_003637313.1| Polyribonucleotide 5'-hydroxyl-kinase PH0197 [Medicago truncatula]
Length=254

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 5/106 (5%)
 Frame = +3

Query  342  PDIIIPNEWSDTADTIAYDSVTSP-PPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
            PDI IP +WS  A++I     +SP PP++L+CG  NCGK+TFSR+LL+VLL R  KVAYL
Sbjct  10   PDIYIPQKWSQAANSIT----SSPTPPITLVCGASNCGKSTFSRNLLNVLLTRCNKVAYL  65

Query  519  DTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            +TDVGQ EFTPPGF+SLTI++K+  DLTIPCLKTPER  FFGD+SS
Sbjct  66   ETDVGQPEFTPPGFVSLTIVNKVTPDLTIPCLKTPERSLFFGDVSS  111



>ref|XP_010915171.1| PREDICTED: LOW QUALITY PROTEIN: polynucleotide 5'-hydroxyl-kinase 
NOL9-like [Elaeis guineensis]
Length=389

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            P P++ IP  W++ A+ IA    +SPPPV+L+CGPKN GK+TFSRHLL++LL+RY +V Y
Sbjct  14   PHPEVFIPPWWAEAAEDIA--RASSPPPVALVCGPKNSGKSTFSRHLLNILLQRYERVGY  71

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LDTDVGQ EF+PPG LSL +ID+I  DL  PC++ PERCFFFGDISS
Sbjct  72   LDTDVGQPEFSPPGCLSLHLIDEINPDLKNPCIRPPERCFFFGDISS  118



>ref|XP_010540303.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Tarenaya 
hassleriana]
 ref|XP_010540304.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Tarenaya 
hassleriana]
Length=371

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 93/116 (80%), Gaps = 7/116 (6%)
 Frame = +3

Query  315  SALENEIPSPDIIIPNEWSDTADTIAYDSVTSP-PPVSLICGPKNCGKTTFSRHLLHVLL  491
            S  E E+P     +P+EWS+  ++IA  S+ S  PPV+L+CGPKN GK+TFSR L+ VLL
Sbjct  2    SETERELP----YVPDEWSEAVNSIANSSIMSAVPPVALVCGPKNSGKSTFSRVLVEVLL  57

Query  492  KRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDIS  653
            +RY+K+AYLDTDVGQ EFT PGF+SLT++DK  + +D++IPC+KTP+RCFFFGD+S
Sbjct  58   QRYKKIAYLDTDVGQPEFTAPGFISLTVLDKSILDSDMSIPCVKTPDRCFFFGDLS  113



>ref|XP_008777209.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Phoenix 
dactylifera]
Length=433

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +3

Query  342  PDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLD  521
            P  +IP  W +TAD IAYDS T PPPV+L+CGP N GK+TFSR LL+ LL RY++V YLD
Sbjct  15   PGWVIPQGWEETADAIAYDSSTCPPPVTLVCGPGNSGKSTFSRVLLNTLLARYKRVGYLD  74

Query  522  TDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            TDVGQ EFT PG +SL IIDK   DLTI  LKTPERC FFGD+SS
Sbjct  75   TDVGQPEFTAPGCVSLHIIDKQTPDLTILYLKTPERCLFFGDVSS  119



>gb|KEH20553.1| polynucleotide 5-hydroxyl-kinase NOL9-like protein [Medicago 
truncatula]
Length=380

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 5/106 (5%)
 Frame = +3

Query  342  PDIIIPNEWSDTADTIAYDSVTSP-PPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
            PDI IP +WS  A++I     +SP PP++L+CG  NCGK+TFSR+LL+VLL R  KVAYL
Sbjct  10   PDIYIPQKWSQAANSIT----SSPTPPITLVCGASNCGKSTFSRNLLNVLLTRCNKVAYL  65

Query  519  DTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            +TDVGQ EFTPPGF+SLTI++K+  DLTIPCLKTPER  FFGD+SS
Sbjct  66   ETDVGQPEFTPPGFVSLTIVNKVTPDLTIPCLKTPERSLFFGDVSS  111



>ref|NP_568243.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana]
 gb|AAL06528.1|AF412075_1 AT5g11010/T30N20_280 [Arabidopsis thaliana]
 gb|AED91620.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana]
Length=318

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 92/116 (79%), Gaps = 8/116 (7%)
 Frame = +3

Query  315  SALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLK  494
            S  EN++P     IP EWS+ A +++  S+   P ++L+CGPKN GK+TFSR+L+ VLL+
Sbjct  2    SEAENKLP----FIPEEWSNAASSVSCSSLQ--PVIALVCGPKNSGKSTFSRNLVEVLLQ  55

Query  495  RYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            RY++VAYLDTDVGQ EFT PGFLSLTI+DK  + +D T+PC+KTPERCFF+GD+SS
Sbjct  56   RYKRVAYLDTDVGQPEFTAPGFLSLTIVDKSILESDWTVPCVKTPERCFFYGDVSS  111



>ref|NP_850805.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana]
 ref|NP_974765.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana]
 sp|Q8VYP6.1|NOL9_ARATH RecName: Full=Polynucleotide 5'-hydroxyl-kinase NOL9; AltName: 
Full=Nucleolar protein 9 homolog [Arabidopsis thaliana]
 gb|AAL49875.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20212.1| unknown protein [Arabidopsis thaliana]
 gb|AED91621.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana]
 gb|AED91622.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana]
Length=368

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 92/116 (79%), Gaps = 8/116 (7%)
 Frame = +3

Query  315  SALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLK  494
            S  EN++P     IP EWS+ A +++  S+   P ++L+CGPKN GK+TFSR+L+ VLL+
Sbjct  2    SEAENKLP----FIPEEWSNAASSVSCSSLQ--PVIALVCGPKNSGKSTFSRNLVEVLLQ  55

Query  495  RYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            RY++VAYLDTDVGQ EFT PGFLSLTI+DK  + +D T+PC+KTPERCFF+GD+SS
Sbjct  56   RYKRVAYLDTDVGQPEFTAPGFLSLTIVDKSILESDWTVPCVKTPERCFFYGDVSS  111



>gb|KHN19355.1| Polynucleotide 5'-hydroxyl-kinase NOL9 [Glycine soja]
Length=118

 Score =   139 bits (349),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            PSPDI IP +W +  ++IA  S+   PP++LICG KNC KTTFSR+LL+VLL +Y KVAY
Sbjct  5    PSPDINIPEQWLEATESIANSSM---PPITLICGAKNCAKTTFSRYLLNVLLNKYTKVAY  61

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPER  629
            LDTDVGQ EFTPP FLSLTI+ K+  DLT+PCLKTPER
Sbjct  62   LDTDVGQPEFTPPAFLSLTIVHKVTPDLTVPCLKTPER  99



>ref|XP_010419654.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Camelina 
sativa]
Length=368

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 92/116 (79%), Gaps = 8/116 (7%)
 Frame = +3

Query  315  SALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLK  494
            S  E ++P     IP EWSD A++++  S+   P ++L+CGPKN GK+TFSR+L+ VLL+
Sbjct  2    SEAEKKLP----FIPEEWSDAANSVSRSSLQ--PVIALVCGPKNSGKSTFSRNLVEVLLQ  55

Query  495  RYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            RY++VAYLDTDVGQ EFT PGFLSLT++DK  + +D T+PC+KTPERCFF+GD+SS
Sbjct  56   RYKRVAYLDTDVGQPEFTAPGFLSLTVVDKSILESDWTVPCVKTPERCFFYGDVSS  111



>gb|EPS68394.1| hypothetical protein M569_06374 [Genlisea aurea]
Length=1141

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            M  A E E PS  I IP++WSD A+TI   SV  P  ++ ICGPKN GKT F+R+L++V 
Sbjct  1    MVEASEMETPSTKIFIPDQWSDAAETIVRSSVDCP--IAFICGPKNSGKTIFARNLVNVF  58

Query  489  LKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L R++KVAYLDTDVGQ EF PPG LSLT+IDK+  DL+ PCL+TP+RC FFGDISS
Sbjct  59   LTRHKKVAYLDTDVGQPEFNPPGLLSLTVIDKLNPDLSNPCLETPKRCLFFGDISS  114



>ref|XP_006287984.1| hypothetical protein CARUB_v10001219mg [Capsella rubella]
 ref|XP_006287985.1| hypothetical protein CARUB_v10001219mg [Capsella rubella]
 gb|EOA20882.1| hypothetical protein CARUB_v10001219mg [Capsella rubella]
 gb|EOA20883.1| hypothetical protein CARUB_v10001219mg [Capsella rubella]
Length=326

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 91/116 (78%), Gaps = 8/116 (7%)
 Frame = +3

Query  315  SALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLK  494
            S  E ++P     IP +WSD A +++  S+   P V+L+CGPKN GK+TFSR+L+ VLL+
Sbjct  2    SEAEKKLP----FIPEQWSDAATSVSCSSLQ--PVVALVCGPKNSGKSTFSRNLVEVLLQ  55

Query  495  RYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            RY++VAYLDTDVGQ EFT PGFLSLT++DK  + +D T+PC+KTPERCFF+GD+SS
Sbjct  56   RYKRVAYLDTDVGQPEFTAPGFLSLTVVDKSILESDWTVPCVKTPERCFFYGDVSS  111



>ref|XP_010491791.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Camelina sativa]
Length=368

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 91/116 (78%), Gaps = 8/116 (7%)
 Frame = +3

Query  315  SALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLK  494
            S  E ++P     IP EWSD A +++  S+   P ++L+CGPKN GK+TFSR+L+ VLL+
Sbjct  2    SEAEKKLP----FIPEEWSDAASSVSCSSLQ--PVIALVCGPKNSGKSTFSRNLVEVLLQ  55

Query  495  RYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            RY++VAYLDTDVGQ EFT PGFLSLT++DK  + +D T+PC+KTPERCFF+GD+SS
Sbjct  56   RYKRVAYLDTDVGQPEFTAPGFLSLTVVDKSILESDWTVPCVKTPERCFFYGDVSS  111



>ref|XP_010453135.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Camelina 
sativa]
Length=368

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 86/103 (83%), Gaps = 4/103 (4%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            IP EWSD A +++  S+   P ++L+CGPKN GK+TFSR+L+ VLL+RY++VAYLDTDVG
Sbjct  11   IPEEWSDAASSVSCSSLQ--PVIALVCGPKNSGKSTFSRNLVEVLLQRYKRVAYLDTDVG  68

Query  534  QTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            Q EFT PGFLSLT++DK  + +D T+PC+KTPERCFF+GD+SS
Sbjct  69   QPEFTAPGFLSLTVVDKSILESDWTVPCVKTPERCFFYGDVSS  111



>ref|XP_010546094.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010546095.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X1 [Tarenaya hassleriana]
Length=367

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 87/103 (84%), Gaps = 5/103 (5%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            +P+EWS+ A+++A   +T   PV+L+CGPKN GK+TFSR L+ VLL+RY++V YLDTDVG
Sbjct  11   VPDEWSEAANSVACSFIT---PVALVCGPKNSGKSTFSRFLVEVLLQRYKQVVYLDTDVG  67

Query  534  QTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            Q EFT PGF+SLT++DK  + +DL+IPC+KTPERCFFFGD+SS
Sbjct  68   QPEFTAPGFISLTLLDKSILDSDLSIPCVKTPERCFFFGDVSS  110



>ref|XP_006287986.1| hypothetical protein CARUB_v10001219mg [Capsella rubella]
 gb|EOA20884.1| hypothetical protein CARUB_v10001219mg [Capsella rubella]
Length=368

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 91/116 (78%), Gaps = 8/116 (7%)
 Frame = +3

Query  315  SALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLK  494
            S  E ++P     IP +WSD A +++  S+   P V+L+CGPKN GK+TFSR+L+ VLL+
Sbjct  2    SEAEKKLP----FIPEQWSDAATSVSCSSLQ--PVVALVCGPKNSGKSTFSRNLVEVLLQ  55

Query  495  RYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            RY++VAYLDTDVGQ EFT PGFLSLT++DK  + +D T+PC+KTPERCFF+GD+SS
Sbjct  56   RYKRVAYLDTDVGQPEFTAPGFLSLTVVDKSILESDWTVPCVKTPERCFFYGDVSS  111



>ref|XP_010936308.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Elaeis 
guineensis]
 ref|XP_010936380.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Elaeis 
guineensis]
 ref|XP_010936451.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Elaeis 
guineensis]
Length=407

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +3

Query  342  PDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLD  521
            P  +IP  W +TA+ IAYDS T PPP++L+CGP N GK+TFSR LL+ LL RY++V+YLD
Sbjct  15   PGWVIPQWWEETAEAIAYDSCTWPPPITLVCGPGNSGKSTFSRLLLNTLLPRYKRVSYLD  74

Query  522  TDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            TDVGQ EFT PG +SL IIDK   DLTI  LKTPERC FFGDI +
Sbjct  75   TDVGQPEFTTPGCVSLHIIDKQTPDLTILYLKTPERCLFFGDICA  119



>emb|CAB96856.1| putative protein [Arabidopsis thaliana]
Length=380

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 92/128 (72%), Gaps = 20/128 (16%)
 Frame = +3

Query  315  SALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLK  494
            S  EN++P     IP EWS+ A +++  S+   P ++L+CGPKN GK+TFSR+L+ VLL+
Sbjct  2    SEAENKLP----FIPEEWSNAASSVSCSSLQ--PVIALVCGPKNSGKSTFSRNLVEVLLQ  55

Query  495  RYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--------------IPADLTIPCLKTPERC  632
            RY++VAYLDTDVGQ EFT PGFLSLTI+DK              + +D T+PC+KTPERC
Sbjct  56   RYKRVAYLDTDVGQPEFTAPGFLSLTIVDKSILVTYVSGYIFYFVESDWTVPCVKTPERC  115

Query  633  FFFGDISS  656
            FF+GD+SS
Sbjct  116  FFYGDVSS  123



>ref|XP_009408924.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Musa 
acuminata subsp. malaccensis]
Length=385

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = +3

Query  345  DIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDT  524
            ++IIP EW + A+ I+  S  SPPPV  ICGPKN GK+TFSR+LL+VLL RY KV YLDT
Sbjct  15   EVIIPLEWEEAAEEISRAS--SPPPVVFICGPKNSGKSTFSRYLLNVLLPRYGKVGYLDT  72

Query  525  DVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            DVGQ EF+PPG LSLT++DK   DL  PC++  ERCFFFGD+SS
Sbjct  73   DVGQPEFSPPGCLSLTLVDKTIPDLMNPCIRATERCFFFGDVSS  116



>ref|XP_006404928.1| hypothetical protein EUTSA_v10000203mg [Eutrema salsugineum]
 gb|ESQ46381.1| hypothetical protein EUTSA_v10000203mg [Eutrema salsugineum]
Length=371

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = +3

Query  348  IIIPNEWSDTA-DTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDT  524
            + IP EWSD A         +S P  +L+CGPKN GK+TFSR+L+ VLL+RY+KVAYLDT
Sbjct  9    LFIPEEWSDAAASVSCSSITSSQPATALVCGPKNSGKSTFSRNLVEVLLQRYKKVAYLDT  68

Query  525  DVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            DVGQ EFT PGFLSLT++DK  + +D T+PC+KTPERCFF+GD+SS
Sbjct  69   DVGQPEFTAPGFLSLTVVDKSILDSDWTVPCVKTPERCFFYGDVSS  114



>ref|XP_008808921.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X2 [Phoenix dactylifera]
Length=389

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            P P++ IP  W++ A+ IA  S  SPPPV+L+CGPKN GK+TFSRHLL++LL+RY +V Y
Sbjct  14   PHPEVFIPPWWAEAAEAIARAS--SPPPVALVCGPKNSGKSTFSRHLLNILLQRYERVGY  71

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LDTDVGQ EF+PPG LSL ++D+I  DL  PC++ PERCFF+GDISS
Sbjct  72   LDTDVGQPEFSPPGCLSLHLVDEINPDLKNPCIRPPERCFFYGDISS  118



>ref|XP_008808920.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X1 [Phoenix dactylifera]
Length=403

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            P P++ IP  W++ A+ IA  S  SPPPV+L+CGPKN GK+TFSRHLL++LL+RY +V Y
Sbjct  14   PHPEVFIPPWWAEAAEAIARAS--SPPPVALVCGPKNSGKSTFSRHLLNILLQRYERVGY  71

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LDTDVGQ EF+PPG LSL ++D+I  DL  PC++ PERCFF+GDISS
Sbjct  72   LDTDVGQPEFSPPGCLSLHLVDEINPDLKNPCIRPPERCFFYGDISS  118



>ref|XP_009122003.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Brassica rapa]
 ref|XP_009122004.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Brassica rapa]
Length=368

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 83/105 (79%), Gaps = 4/105 (4%)
 Frame = +3

Query  348  IIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTD  527
            +IIP +WSD A +++   ++  PPV+L+CGPK+ GK+TFSR+L+ VLL+RY++VAYLD D
Sbjct  9    LIIPKDWSDAASSVS--CISLQPPVALVCGPKDSGKSTFSRNLVKVLLQRYKRVAYLDID  66

Query  528  VGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            VGQ EFT PGFLSLT++D+  +  D   PCL TPERCFF+GD SS
Sbjct  67   VGQPEFTLPGFLSLTVVDRSILDQDWAAPCLMTPERCFFYGDDSS  111



>emb|CDX69791.1| BnaA10g21400D [Brassica napus]
Length=368

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 83/105 (79%), Gaps = 4/105 (4%)
 Frame = +3

Query  348  IIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTD  527
            +IIP +WSD A +++   ++  PPV+L+CGPK+ GK+TFSR+L+ VLL+RY++VAYLD D
Sbjct  9    LIIPKDWSDAASSVS--CISLQPPVALVCGPKDSGKSTFSRNLVKVLLQRYKRVAYLDID  66

Query  528  VGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            VGQ EFT PGFLSLT++D+  +  D   PCL TPERCFF+GD SS
Sbjct  67   VGQPEFTLPGFLSLTVVDRSILDQDWAAPCLMTPERCFFYGDDSS  111



>ref|XP_011622893.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Amborella 
trichopoda]
Length=391

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 89/130 (68%), Gaps = 9/130 (7%)
 Frame = +3

Query  270  RAHALRREIIERGMASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNC  449
            RA  ++R ++          E+    IIIP  WS  A+TI+  +  + P V L+CGPKN 
Sbjct  6    RAKGIKRVLLS-------HRELGPQQIIIPPSWSQVAETISLQNGPNHPIV-LVCGPKNA  57

Query  450  GKTTFSRHLLHVLLK-RYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPE  626
            GK+TFSR+L++ LL  RY++V YLDTDVGQ E+TPPG LSL +ID    DL +PCLKTPE
Sbjct  58   GKSTFSRYLINTLLNSRYQRVGYLDTDVGQPEYTPPGCLSLHVIDTQTPDLAVPCLKTPE  117

Query  627  RCFFFGDISS  656
            RCFF+GDISS
Sbjct  118  RCFFYGDISS  127



>ref|XP_002871448.1| hypothetical protein ARALYDRAFT_487931 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47707.1| hypothetical protein ARALYDRAFT_487931 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 86/103 (83%), Gaps = 4/103 (4%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            IP EWS+ A +++  S+   P ++L+CGPKN GK+TFSR+L+ VLL+RY++VAYLDTDVG
Sbjct  11   IPEEWSNAASSVSSSSLQ--PVIALVCGPKNSGKSTFSRNLVEVLLQRYKRVAYLDTDVG  68

Query  534  QTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            Q EFT PGFLSLT++D+  + +D T+PC+KTPERCFF+GD+SS
Sbjct  69   QPEFTAPGFLSLTVVDRSILESDWTVPCVKTPERCFFYGDVSS  111



>ref|XP_009394102.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=328

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            IP  W + AD+I  DS +  PP++L+CGP N GK+TFSR LL+ LL RY++V YLDTDVG
Sbjct  18   IPEIWEEAADSITNDSSSCLPPITLVCGPGNSGKSTFSRLLLNTLLHRYKRVGYLDTDVG  77

Query  534  QTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            Q EFTPPG LSL +IDK P DLTI  LK PER FFFG +++
Sbjct  78   QPEFTPPGCLSLHVIDKQPPDLTILSLKRPERFFFFGHVTA  118



>ref|XP_009394099.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=357

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            IP  W + AD+I  DS +  PP++L+CGP N GK+TFSR LL+ LL RY++V YLDTDVG
Sbjct  18   IPEIWEEAADSITNDSSSCLPPITLVCGPGNSGKSTFSRLLLNTLLHRYKRVGYLDTDVG  77

Query  534  QTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            Q EFTPPG LSL +IDK P DLTI  LK PER FFFG +++
Sbjct  78   QPEFTPPGCLSLHVIDKQPPDLTILSLKRPERFFFFGHVTA  118



>ref|XP_009394098.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=379

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            IP  W + AD+I  DS +  PP++L+CGP N GK+TFSR LL+ LL RY++V YLDTDVG
Sbjct  18   IPEIWEEAADSITNDSSSCLPPITLVCGPGNSGKSTFSRLLLNTLLHRYKRVGYLDTDVG  77

Query  534  QTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            Q EFTPPG LSL +IDK P DLTI  LK PER FFFG +++
Sbjct  78   QPEFTPPGCLSLHVIDKQPPDLTILSLKRPERFFFFGHVTA  118



>gb|ADE76705.1| unknown [Picea sitchensis]
Length=405

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +3

Query  339  SPD-IIIPNEWSDTADTIAYDSVTSP-PPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVA  512
            +PD I+IP++W   A+ IA +    P PP+ + CG +N GK+TF+R L++ LL+RY+KV 
Sbjct  2    TPDKIVIPDDWRSAAEFIANNGDCPPIPPIVVACGAQNVGKSTFARFLVNTLLRRYKKVG  61

Query  513  YLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            YLDTDVGQ EFTPPG LSL I++K   DL+  CL+TPERC+F+GDIS
Sbjct  62   YLDTDVGQPEFTPPGCLSLHILEKPNPDLSTLCLRTPERCYFYGDIS  108



>ref|XP_007136548.1| hypothetical protein PHAVU_009G054100g [Phaseolus vulgaris]
 gb|ESW08542.1| hypothetical protein PHAVU_009G054100g [Phaseolus vulgaris]
Length=401

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 19/107 (18%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            PS  I IP +WS+ AD+                   NC +  FSR+LL++LL +Y +VAY
Sbjct  5    PSQGICIPEQWSEAADS-------------------NCLQQLFSRYLLNILLHKYAEVAY  45

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
             DTDVGQ EFTPP FLSLT++ K+  DLT+PCLKTPERC FFGD+SS
Sbjct  46   FDTDVGQPEFTPPAFLSLTVVHKVTPDLTVPCLKTPERCLFFGDVSS  92



>ref|XP_004967623.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Setaria 
italica]
Length=383

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +3

Query  387  IAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLS  566
            +AYDS T PPPV  +CGP N GK+ F R LL+ L+ RYRKV YLD DVGQ EFTPPGF+S
Sbjct  31   VAYDSCTWPPPVVAVCGPGNSGKSAFCRLLLNTLIARYRKVGYLDIDVGQPEFTPPGFVS  90

Query  567  LTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            L ++++   DLTI  L+ P+RCFFFGD+ +
Sbjct  91   LHVLEEQAKDLTILYLRNPKRCFFFGDVCA  120



>emb|CDX97073.1| BnaC09g45520D [Brassica napus]
Length=380

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 69/82 (84%), Gaps = 2/82 (2%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IP  590
            PV+L+CGPK+ GK+TFSR+L+ VLL+RY++VAYLD DVGQ EFT PGFLSLT++D+  + 
Sbjct  42   PVALVCGPKDSGKSTFSRNLVKVLLQRYKRVAYLDIDVGQPEFTLPGFLSLTVVDRSILD  101

Query  591  ADLTIPCLKTPERCFFFGDISS  656
             D + PCL TPERCFF+GD SS
Sbjct  102  QDWSAPCLMTPERCFFYGDDSS  123



>ref|XP_008672008.1| PREDICTED: uncharacterized protein LOC100191258 isoform X1 [Zea 
mays]
 tpg|DAA53123.1| TPA: hypothetical protein ZEAMMB73_493026 [Zea mays]
Length=390

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 3/107 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            P  + ++P +W     T+   S    PPV ++CGPKN GK+TFSR LL+ LL R+ KVAY
Sbjct  22   PRTEAVVPPDWDSAVSTV---SSHPSPPVVVVCGPKNSGKSTFSRVLLNALLPRHGKVAY  78

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LDTDVGQ EF PPG LS  ++D+  ADL  P L+  ERC+FFGDISS
Sbjct  79   LDTDVGQPEFGPPGCLSFNVLDEAIADLMNPSLREAERCYFFGDISS  125



>ref|XP_003637317.1| Protein grc3 [Medicago truncatula]
Length=294

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 5/108 (5%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLK-RYRKVA  512
            P PDI IP EWS  A++I     +S PPV L+CGP + GK+TF+R+LL++LL  R +KVA
Sbjct  5    PPPDIFIPEEWSQAANSIV---SSSTPPVVLVCGPGSVGKSTFARYLLNLLLTTRCKKVA  61

Query  513  YLDTDVGQTEFTPPGFLSLTII-DKIPADLTIPCLKTPERCFFFGDIS  653
            YLDTDVGQTEFTP G +SLT++ D  P DL    LK  +R  FFGDIS
Sbjct  62   YLDTDVGQTEFTPLGLISLTVVYDITPGDLKTKYLKPSKRSLFFGDIS  109



>gb|EEE54540.1| hypothetical protein OsJ_01710 [Oryza sativa Japonica Group]
Length=382

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +3

Query  393  YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            YDS T PPPV  +CGP N GK+ FSR LL+ L+ RY+KVAYLDTDVGQ EFTPPGF+S+ 
Sbjct  27   YDSCTWPPPVVAVCGPGNSGKSAFSRLLLNTLVGRYKKVAYLDTDVGQPEFTPPGFVSIH  86

Query  573  IIDKIPADLTIPCLKTPERCFFFGDISS  656
            ++++   D  +  L+TP+RCFFFGD S+
Sbjct  87   VLEEQAEDFKMLYLRTPKRCFFFGDCSA  114



>ref|XP_003564481.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X1 
[Brachypodium distachyon]
Length=436

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +3

Query  348  IIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTD  527
            +I+P +W   A   A+ S     PV L+CGP NCGK+TFSR LL+ LL R+ +V YLDTD
Sbjct  52   VIVPPDW---ASANAFISSELSTPVVLVCGPTNCGKSTFSRLLLNSLLPRHGRVGYLDTD  108

Query  528  VGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            VGQ EF+PPG LSL ++D+  ADL  P L+  ERCFFFGD SS
Sbjct  109  VGQPEFSPPGCLSLHVVDEAIADLQNPVLRQAERCFFFGDTSS  151



>gb|KEH20552.1| polynucleotide 5-hydroxyl-kinase NOL9-like protein [Medicago 
truncatula]
Length=370

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLK-RYRKVA  512
            P PDI IP EWS  A++I     +S PPV L+CGP + GK+TF+R+LL++LL  R +KVA
Sbjct  5    PPPDIFIPEEWSQAANSIV---SSSTPPVVLVCGPGSVGKSTFARYLLNLLLTTRCKKVA  61

Query  513  YLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            YLDTDVGQTEFTP G +SLT++  I  DL    LK  +R  FFGDIS
Sbjct  62   YLDTDVGQTEFTPLGLISLTVVYDITPDLKTKYLKPSKRSLFFGDIS  108



>ref|XP_010230555.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X2 
[Brachypodium distachyon]
Length=363

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = +3

Query  348  IIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTD  527
            +I+P +W+     I+ +  T   PV L+CGP NCGK+TFSR LL+ LL R+ +V YLDTD
Sbjct  52   VIVPPDWASANAFISSELST---PVVLVCGPTNCGKSTFSRLLLNSLLPRHGRVGYLDTD  108

Query  528  VGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            VGQ EF+PPG LSL ++D+  ADL  P L+  ERCFFFGD SS
Sbjct  109  VGQPEFSPPGCLSLHVVDEAIADLQNPVLRQAERCFFFGDTSS  151



>gb|ACG36367.1| hypothetical protein [Zea mays]
Length=390

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 3/107 (3%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            P  + ++P +W     T+   S    PPV ++CGPKN GK+TFSR LL+ LL R+ KVAY
Sbjct  22   PRTEAVVPPDWDSAVSTV---SSHPTPPVVVVCGPKNSGKSTFSRVLLNALLPRHGKVAY  78

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            LDTDVGQ EF PPG LS  ++D+   DL  P L+  ERC+FFGDISS
Sbjct  79   LDTDVGQPEFGPPGCLSFHVLDEAIVDLMNPSLREAERCYFFGDISS  125



>gb|EMS51635.1| hypothetical protein TRIUR3_10393 [Triticum urartu]
Length=385

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +3

Query  339  SPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
            +P++++P +W+   D I+ D  +   PV L+CGP N GK+TF+R LL+ LL  Y +V YL
Sbjct  49   APEVVVPEDWAMATDVISSDLSS---PVVLVCGPSNSGKSTFTRLLLNKLLPSYGRVGYL  105

Query  519  DTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            DTDVGQ EF+PPG LSL I+D+   D+  P L+  ERC F+GDISS
Sbjct  106  DTDVGQPEFSPPGCLSLHIVDEAITDMQNPVLREAERCCFYGDISS  151



>ref|XP_004968455.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Setaria 
italica]
Length=390

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = +3

Query  345  DIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDT  524
            + ++P +W+     ++ D     PPV ++CGPKN GK+TFSR LL+ LL RY KV YLDT
Sbjct  23   EAVVPPDWASAVTLVSSDPT---PPVVVVCGPKNSGKSTFSRILLNALLPRYGKVGYLDT  79

Query  525  DVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            DVGQ EF PPG LS  ++++  ADL  P L+  ERC FFGDISS
Sbjct  80   DVGQPEFAPPGCLSFHVVEEAIADLLNPTLREAERCCFFGDISS  123



>gb|EAY72811.1| hypothetical protein OsI_00678 [Oryza sativa Indica Group]
Length=379

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +3

Query  345  DIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDT  524
            ++++P +W+    T A  S    PPV ++CGPKN GK+TFSR LL+ LL RY +V YLDT
Sbjct  11   EVVVPPDWAAATATAAAASSEPAPPVVVVCGPKNAGKSTFSRLLLNSLLPRYGRVGYLDT  70

Query  525  DVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            DVGQ EF+PPG LS  ++D+   DL  P L+  ERC FFGDISS
Sbjct  71   DVGQPEFSPPGCLSFHVVDEALTDLLNPTLRECERCCFFGDISS  114



>emb|CDM81640.1| unnamed protein product [Triticum aestivum]
Length=438

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +3

Query  339  SPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
            +P++++P +W+     I+ D  +   PV L+CGP N GK+TF+R LL+ LL  Y ++ YL
Sbjct  49   APEVVVPEDWALATKVISSDLSS---PVVLVCGPSNSGKSTFTRLLLNKLLPSYGRIGYL  105

Query  519  DTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            DTDVGQ EF+PPG LSL I+D+  AD+  P L+  ERC F+GDISS
Sbjct  106  DTDVGQPEFSPPGCLSLHIVDEAIADMRNPVLREAERCCFYGDISS  151



>ref|XP_006645905.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like, partial 
[Oryza brachyantha]
Length=203

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  363  EWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTE  542
            EW + AD +AYDS T PPPV  +CGP N GK+ FSR LL+ L+ RY+KVAYLDTDVGQ E
Sbjct  25   EWEEVADAVAYDSCTWPPPVVAVCGPGNSGKSAFSRLLLNTLVGRYKKVAYLDTDVGQPE  84

Query  543  FTPPGFLSLTIIDKIPAD  596
            FTPPGF+SL ++++   D
Sbjct  85   FTPPGFVSLHVLEEQAED  102



>dbj|BAK02713.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 73/106 (69%), Gaps = 3/106 (3%)
 Frame = +3

Query  339  SPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
             P++++P +W+   D I+ D  +   PV L+CGP N GK+TF+R LL+ LL  Y +V YL
Sbjct  49   GPEVVVPEDWALATDAISSDLSS---PVVLVCGPSNSGKSTFTRLLLNKLLPSYGRVGYL  105

Query  519  DTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            DTDVGQ EF+PPG LSL I+D+   D+  P L+  +RC F+GDISS
Sbjct  106  DTDVGQPEFSPPGCLSLHIVDEAITDMRNPVLREADRCCFYGDISS  151



>ref|XP_002457221.1| hypothetical protein SORBIDRAFT_03g003540 [Sorghum bicolor]
 gb|EES02341.1| hypothetical protein SORBIDRAFT_03g003540 [Sorghum bicolor]
Length=388

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = +3

Query  345  DIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDT  524
            ++++P++W+    T++ D     PPV ++CGPKN GK+TFSR LL+ LL R+ KV YLDT
Sbjct  23   EVVVPSDWACVVTTVSSDPT---PPVVVVCGPKNSGKSTFSRVLLNALLPRHGKVGYLDT  79

Query  525  DVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            D+GQ EF  PG LS  ++D+   DL  P L+  ERC+FFGD SS
Sbjct  80   DMGQPEFGLPGCLSFNVVDEPITDLLNPTLREAERCYFFGDTSS  123



>ref|XP_001779903.1| predicted protein [Physcomitrella patens]
 gb|EDQ55318.1| predicted protein [Physcomitrella patens]
Length=387

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            IP +W D  +TI   ++ S  P+  ICG KN GK+TF+R L++ LL RY++VAYLDTDVG
Sbjct  39   IPRDWKDAVETI---TLGSNFPIVAICGAKNVGKSTFARFLVNSLLNRYKEVAYLDTDVG  95

Query  534  QTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            Q EFT PG +SL I+D     +    L+TPERCFF+GD+S
Sbjct  96   QPEFTAPGCISLHILD---TPVVAMHLRTPERCFFYGDVS  132



>emb|CDP14910.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 6/67 (9%)
 Frame = +3

Query  474  LLHVLLK------RYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCF  635
            +L+V+L+      RY+KVAYLDTDVGQTEFTPPG LSLT+IDK+  DLTIPCLKTPERCF
Sbjct  126  ILYVILRFSVLNCRYKKVAYLDTDVGQTEFTPPGLLSLTVIDKVTPDLTIPCLKTPERCF  185

Query  636  FFGDISS  656
            FFGDISS
Sbjct  186  FFGDISS  192



>emb|CAN74949.1| hypothetical protein VITISV_000264 [Vitis vinifera]
Length=286

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  309  MASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVL  488
            MA+  E E PSPDI IP EWS+ A+TIAYDSVTSPPPV+L+CG KNCGKTTFSRHLL++L
Sbjct  1    MAAFSEAEAPSPDIYIPEEWSEAAETIAYDSVTSPPPVALVCGAKNCGKTTFSRHLLNIL  60

Query  489  LKR  497
            L+R
Sbjct  61   LQR  63



>gb|EAZ10819.1| hypothetical protein OsJ_00655 [Oryza sativa Japonica Group]
Length=379

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  420  VSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADL  599
            V ++CGPKN GK+TFSR LL+ LL RY +V YLDTDVGQ EF+PPG LS  ++D+   DL
Sbjct  36   VVVVCGPKNAGKSTFSRLLLNSLLPRYGRVGYLDTDVGQPEFSPPGCLSFHVVDEALTDL  95

Query  600  TIPCLKTPERCFFFGDISS  656
              P L+  ERC FFGDISS
Sbjct  96   LNPTLRECERCCFFGDISS  114



>ref|NP_001042230.1| Os01g0184000 [Oryza sativa Japonica Group]
 dbj|BAD67793.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04144.1| Os01g0184000 [Oryza sativa Japonica Group]
 dbj|BAG92331.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=379

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  420  VSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADL  599
            V ++CGPKN GK+TFSR LL+ LL RY +V YLDTDVGQ EF+PPG LS  ++D+   DL
Sbjct  36   VVVVCGPKNAGKSTFSRLLLNSLLPRYGRVGYLDTDVGQPEFSPPGCLSFHVVDEALTDL  95

Query  600  TIPCLKTPERCFFFGDISS  656
              P L+  ERC FFGDISS
Sbjct  96   LNPTLRECERCCFFGDISS  114



>ref|XP_003572670.2| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Brachypodium 
distachyon]
Length=382

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  393  YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            YDS T PPPV ++CGP NCGK+ FSR LL+ LL+RY+ VAYLDTDVGQ EFTPPGF+SL 
Sbjct  32   YDSCTWPPPVVVVCGPGNCGKSAFSRLLLNTLLERYQTVAYLDTDVGQPEFTPPGFVSLH  91

Query  573  IIDKIPADLTIPCLKTPERCFFFGDISS  656
            +I++   D T+  L++P+RCFFFGD+ +
Sbjct  92   VIEEPAKDFTMLYLRSPKRCFFFGDVCA  119



>gb|EMS68805.1| hypothetical protein TRIUR3_10564 [Triticum urartu]
Length=376

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  393  YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            YDS T PPPV ++CGP N GK+ FSR LL+ LL RY++VAYLDTDVGQ EFTPPGF+SL 
Sbjct  26   YDSCTWPPPVVVVCGPGNSGKSAFSRLLLNTLLARYKRVAYLDTDVGQPEFTPPGFVSLH  85

Query  573  IIDKIPADLTIPCLKTPERCFFFGDISS  656
            ++++   DLT+  L+ P+RCFFFGD+++
Sbjct  86   VLEEQAKDLTMLYLRAPKRCFFFGDVAA  113



>emb|CAN65272.1| hypothetical protein VITISV_024535 [Vitis vinifera]
Length=261

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  324  ENEIPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKR  497
            E E PSPDI IP EWS+ A+TIAYDSVTSPP V+L+CG KNCGKTTFSRHLL++LL+R
Sbjct  182  EVEAPSPDIYIPEEWSEGAETIAYDSVTSPPSVALVCGAKNCGKTTFSRHLLNILLQR  239



>dbj|BAK07515.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  393  YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            YDS T PPPV ++CGP N GK+ FSR LL+ L+ RY++VAYLDTDVGQ EFTPPGF+SL 
Sbjct  32   YDSSTWPPPVVVVCGPGNSGKSAFSRLLLNTLIARYKRVAYLDTDVGQPEFTPPGFVSLH  91

Query  573  IIDKIPADLTIPCLKTPERCFFFGDISS  656
            ++++   DLT+  L+ P+RCFFFGD+++
Sbjct  92   VLEEQAKDLTMIYLRAPKRCFFFGDVAA  119



>gb|EMT12944.1| hypothetical protein F775_13490 [Aegilops tauschii]
Length=376

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  393  YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            YDS T PPPV ++CGP N GK+ F+R LL+ LL RY++VAYLDTDVGQ EFTPPGF+SL 
Sbjct  26   YDSCTWPPPVVVVCGPGNSGKSAFARLLLNTLLARYKRVAYLDTDVGQPEFTPPGFVSLH  85

Query  573  IIDKIPADLTIPCLKTPERCFFFGDISS  656
            ++++   DLT+  L+ P+RCFFFGD+++
Sbjct  86   VLEEQAKDLTMLYLRAPKRCFFFGDVAA  113



>ref|XP_006643847.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Oryza 
brachyantha]
Length=375

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +3

Query  345  DIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDT  524
            + ++P +W+    T++         V ++CGPKN GK+TFSR LL+ LL RY +V YLDT
Sbjct  11   EAVVPPDWASATATVSSVPSPP---VVVVCGPKNAGKSTFSRLLLNSLLPRYGRVGYLDT  67

Query  525  DVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            DVGQ EF+PPG LS  ++ +   DL  P L+  ERC FFGDISS
Sbjct  68   DVGQPEFSPPGCLSFNVVGEAFEDLLNPTLRESERCCFFGDISS  111



>ref|NP_001172330.1| Os01g0354700 [Oryza sativa Japonica Group]
 dbj|BAH91060.1| Os01g0354700 [Oryza sativa Japonica Group]
Length=235

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  393  YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            YDS T PPPV  +CGP N GK+ FSR LL+ L+ RY+KVAYLDTDVGQ EFTPPGF+S+ 
Sbjct  27   YDSCTWPPPVVAVCGPGNSGKSAFSRLLLNTLVGRYKKVAYLDTDVGQPEFTPPGFVSIH  86

Query  573  IIDKIPAD  596
            ++++   D
Sbjct  87   VLEEQAED  94



>dbj|BAD52595.1| hypothetical protein [Oryza sativa Japonica Group]
Length=374

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  393  YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            YDS T PPPV  +CGP N GK+ FSR LL+ L+ RY+KVAYLDTDVGQ EFTPPGF+S+ 
Sbjct  27   YDSCTWPPPVVAVCGPGNSGKSAFSRLLLNTLVGRYKKVAYLDTDVGQPEFTPPGFVSIH  86

Query  573  IIDKIPADLTIP  608
            ++++   D   P
Sbjct  87   VLEEQAEDTDNP  98



>ref|XP_010546096.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform 
X2 [Tarenaya hassleriana]
Length=327

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 2/55 (4%)
 Frame = +3

Query  498  YRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDISS  656
            Y++V YLDTDVGQ EFT PGF+SLT++DK  + +DL+IPC+KTPERCFFFGD+SS
Sbjct  16   YKQVVYLDTDVGQPEFTAPGFISLTLLDKSILDSDLSIPCVKTPERCFFFGDVSS  70



>gb|KFH72257.1| hypothetical protein MVEG_02548 [Mortierella verticillata NRRL 
6337]
Length=1177

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 10/134 (7%)
 Frame = +3

Query  270  RAHALRREIIERGMASALENEIPSPDIIIPNEWSDTADTIAYDSV------TSPPPVSLI  431
            + H +R E    G    LE       + IPN W D   T+   +V         PPV+++
Sbjct  654  KQHQVRLENSVPGFHPILEPTDSIAALKIPNTWQDAIQTLVDSTVDENGARVKRPPVAVV  713

Query  432  CGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIID--KIPADLTI  605
            CG K  GK+TFSR +L+ +L RYRKVA+L+ D+GQ+EFTP G ++L +I+   + A  T 
Sbjct  714  CGGKKMGKSTFSRLILNRMLNRYRKVAFLECDIGQSEFTPVGMVALHVIETPALGAPFTH  773

Query  606  PCLKTPERCFFFGD  647
            P  + P R F+ G+
Sbjct  774  P--RQPYRAFYVGN  785



>gb|ERN04814.1| hypothetical protein AMTR_s00146p00018170 [Amborella trichopoda]
Length=769

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  495  RYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            RY++V YLDTDVGQ E+TPPG LSL +ID    DL +PCLKTPERCFF+GDISS
Sbjct  425  RYQRVGYLDTDVGQPEYTPPGCLSLHVIDTQTPDLAVPCLKTPERCFFYGDISS  478



>emb|CEG80066.1| hypothetical protein RMATCC62417_14451 [Rhizopus microsporus]
Length=458

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = +3

Query  414  PPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--I  587
            P VS++CG KN GK++FS++L++ LL RY+KVAY++TDVGQTEFTP G LSL  I+   +
Sbjct  41   PMVSVVCGGKNLGKSSFSKYLVNRLLTRYKKVAYIETDVGQTEFTPTGLLSLHYIEHPVL  100

Query  588  PADLTIPCLKTPERCFFFGDIS  653
                T    + P R FFFG  S
Sbjct  101  GPSYTHQQFE-PARSFFFGGNS  121



>emb|CEG66515.1| hypothetical protein RMATCC62417_03080 [Rhizopus microsporus]
Length=773

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 3/79 (4%)
 Frame = +3

Query  414  PPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--I  587
            P VS++CG KN GK++FS++L++ LL RY+KVAY++TDVGQTEFTP G LSL  I+   +
Sbjct  356  PMVSVVCGGKNLGKSSFSKYLVNRLLTRYKKVAYIETDVGQTEFTPTGLLSLHYIEHPVL  415

Query  588  PADLTIPCLKTPERCFFFG  644
                T    + P R FFFG
Sbjct  416  GPSYTHQQFE-PARSFFFG  433



>ref|XP_009549515.1| hypothetical protein HETIRDRAFT_172844 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW79268.1| hypothetical protein HETIRDRAFT_172844 [Heterobasidion irregulare 
TC 32-1]
Length=781

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +3

Query  414  PPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--I  587
            PPV+LI GPKN GK+TF+R LL+    RYRKVAYL+ D+GQ+EFTP G ++LTII+K   
Sbjct  363  PPVTLIRGPKNSGKSTFARTLLNRSTMRYRKVAYLECDLGQSEFTPGGMVALTIIEKPVF  422

Query  588  PADLTIPCLKTPERCFFFGDIS  653
                T P L  P +  + G  S
Sbjct  423  GPPFTHPTL--PHQAHYIGSTS  442



>ref|XP_004345318.1| hypothetical protein CAOG_06569 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE96214.1| hypothetical protein CAOG_006569 [Capsaspora owczarzaki ATCC 
30864]
Length=692

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +3

Query  297  IERGMASALENEIPSPDIIIPNEWSDTADTIAYDSVTSP-PPVSLICGPKNCGKTTFSRH  473
            IE      L++ IP     +P  WS  AD +     + P PPV L CG K+ GK+T  R 
Sbjct  256  IESAFGLRLDHRIPL--FSVPPSWSQLADGLVAHRYSRPDPPVILACGGKDVGKSTLCRF  313

Query  474  LLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            L++VLL  Y  VAY++TD GQ EFTP GF++L I+ +     +   L+ P+  F  G+ S
Sbjct  314  LVNVLLDHYPAVAYIETDPGQCEFTPSGFVALNIVTEPCFGPSFTHLQQPDLAFCIGESS  373

Query  654  S  656
            +
Sbjct  374  A  374



>gb|EXX69758.1| Grc3p [Rhizophagus irregularis DAOM 197198w]
Length=764

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVT-SPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDV  530
            IP+ W ++ + +  D +  + PP+S+I G KN GK+TFSR+L++ +L    KVAY+++DV
Sbjct  331  IPHSWENSTNQLVTDILDFTLPPISIISGHKNVGKSTFSRYLVNSMLNICPKVAYIESDV  390

Query  531  GQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            GQ+EFTP G +SL I+D          ++ P R +F G  S
Sbjct  391  GQSEFTPCGLVSLNILDSPIFGPPFTHIQQPYRSYFIGHNS  431



>gb|ESA07900.1| hypothetical protein GLOINDRAFT_32312 [Rhizophagus irregularis 
DAOM 181602]
Length=718

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVT-SPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDV  530
            IP+ W ++ + +  D +  + PP+S+I G KN GK+TFSR+L++ +L    KVAY+++DV
Sbjct  285  IPHSWENSTNQLVTDILDFTLPPISIISGHKNVGKSTFSRYLVNSMLNICPKVAYIESDV  344

Query  531  GQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            GQ+EFTP G +SL I+D          ++ P R +F G  S
Sbjct  345  GQSEFTPCGLVSLNILDSPIFGPPFTHIQQPYRSYFIGHNS  385



>ref|XP_008879304.1| hypothetical protein H310_13533 [Aphanomyces invadans]
 gb|ETV92007.1| hypothetical protein H310_13533 [Aphanomyces invadans]
Length=622

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            P  +I+IP  WS  A +I  +   S     L+CG K  GK+TFSR+L++ LL  Y  VAY
Sbjct  226  PVREILIPPTWSTVASSILENLAASSNRKVLVCGAKGVGKSTFSRYLVNQLLNVYSIVAY  285

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFG  644
            LDTDVGQ E   PG LSL  I           L+   R +FFG
Sbjct  286  LDTDVGQPELAAPGVLSLHYITTPLLGPGYTHLQPAYRSYFFG  328



>emb|CDS05450.1| hypothetical protein LRAMOSA07978 [Absidia idahoensis var. thermophila]
Length=834

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = +3

Query  336  PSPDII---IPNEWSDTADTIAYDSVTSPPP-VSLICGPKNCGKTTFSRHLLHVLLKRYR  503
            P+P I    IP+ WS+ A+    D      P VS++CG K+ GK+TF+R+L++ LL  ++
Sbjct  387  PTPGIKSLDIPSTWSENANVAIQDEKERGSPLVSIVCGAKDSGKSTFNRYLVNRLLNSHK  446

Query  504  KVAYLDTDVGQTEFTPPGFLSLTIID  581
            +VAYL+TDVGQTEF+P G ++L ++D
Sbjct  447  RVAYLETDVGQTEFSPAGIIALHVLD  472



>emb|CEP19192.1| hypothetical protein [Parasitella parasitica]
Length=784

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 10/114 (9%)
 Frame = +3

Query  336  PSP---DIIIPNEWSDTADTIAYDSVTSP---PPVSLICGPKNCGKTTFSRHLLHVLLKR  497
            P+P    + I   W  T  ++A D  T     P V+++CG K+ GK+++SR+L++ LL +
Sbjct  338  PTPGVKSLKIEPSWH-THTSMAIDKATQQAVRPLVAVVCGGKDMGKSSYSRYLINRLLAK  396

Query  498  YRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDIS  653
            Y +VAYL+TDVGQ+EFTP G LSL  ID   +    T   L+ PER FFFG  S
Sbjct  397  YSRVAYLETDVGQSEFTPSGLLSLHYIDSPVLGPSYTHQRLE-PERSFFFGSAS  449



>ref|XP_006460409.1| hypothetical protein AGABI2DRAFT_150364 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV48546.1| hypothetical protein AGABI2DRAFT_150364 [Agaricus bisporus var. 
bisporus H97]
Length=779

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = +3

Query  354  IPNEWSDTADTIAYD-SVTSPP----PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
            +P  WS+T  T +   + T PP    P  L+ GPK CGK+TF+R LL+ LL  + +VAYL
Sbjct  333  MPPTWSETISTFSTPPTFTLPPSRAGPTYLVKGPKKCGKSTFARTLLNTLLSHHSRVAYL  392

Query  519  DTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFG  644
            + D+GQ+EFTPPG ++L ++ K         L  P R  F G
Sbjct  393  ECDIGQSEFTPPGMVALNVVSKPLFGPAYTHLTFPVRSHFIG  434



>dbj|GAN10671.1| conserved hypothetical protein [Mucor ambiguus]
Length=796

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 50/114 (44%), Positives = 71/114 (62%), Gaps = 10/114 (9%)
 Frame = +3

Query  336  PSPDII---IPNEWSDTADTIAYDSVT---SPPPVSLICGPKNCGKTTFSRHLLHVLLKR  497
            P+P +    I + W   A T+A D  T   + P VS++CG K+ GK+++SR+L++ LL +
Sbjct  350  PTPGVKSLRIESSWHTRA-TMAIDKATLQATSPLVSVVCGAKDMGKSSYSRYLINRLLAK  408

Query  498  YRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDIS  653
            Y +VAYL+TDVGQ+EFTP G LSL  I    +    T   L+ PER F+FG  S
Sbjct  409  YNRVAYLETDVGQSEFTPSGLLSLHYISNPILGPPYTHQQLE-PERSFYFGSTS  461



>ref|XP_007327110.1| hypothetical protein AGABI1DRAFT_35289 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM82143.1| hypothetical protein AGABI1DRAFT_35289 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=784

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 5/102 (5%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPP-----PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
            +P  WS+T  T +    ++ P     P  L+ GPK CGK+TF+R LL+ LL  Y +VAYL
Sbjct  338  MPPTWSETISTFSTPPTSTLPSSRAGPTYLVKGPKKCGKSTFARTLLNTLLSHYSRVAYL  397

Query  519  DTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFG  644
            + D+GQ+EFTPPG ++L ++           L  P R  F G
Sbjct  398  ECDIGQSEFTPPGIVALNVVSNPLFGPAYTHLTFPVRSHFIG  439



>ref|XP_009948472.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Leptosomus 
discolor]
Length=416

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  53   PVVLVCGPKNSGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSSVTEPILG  112

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G IS
Sbjct  113  PPFTHQQTPRKMVYYGQIS  131



>ref|XP_642025.1| NUC156 family protein [Dictyostelium discoideum AX4]
 sp|Q54Z27.1|NOL9_DICDI RecName: Full=Polynucleotide 5'-hydroxyl-kinase nol9; AltName: 
Full=Nucleolar protein 9 homolog [Dictyostelium discoideum]
 gb|EAL68145.1| NUC156 family protein [Dictyostelium discoideum AX4]
Length=683

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = +3

Query  354  IPNEWSDTADT-IAYDSVTSPPPVSLI-CGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTD  527
            IPNEW +  +T   Y+   +   +S++ CG +N GK+TF+R L++ LLK+Y  + +++TD
Sbjct  248  IPNEWLNLINTQFLYNDHCNNNGLSILTCGERNVGKSTFNRILINKLLKKYTHIIFIETD  307

Query  528  VGQTEFTPPGFLSLTIIDKIPADLTIP----CLKTPERCFFFGDIS  653
             GQTEFTP G +S+ II+   + L  P    C   P + +FFGD S
Sbjct  308  TGQTEFTPSGIMSIDIIN---SPLLGPPFTHCKNNPLKSYFFGDTS  350



>ref|XP_007304231.1| hypothetical protein STEHIDRAFT_147113 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM86540.1| hypothetical protein STEHIDRAFT_147113 [Stereum hirsutum FP-91666 
SS1]
Length=826

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 5/81 (6%)
 Frame = +3

Query  354  IPNEW----SDTADTIAYDSVT-SPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
            +P+ W    S +A T+  DSV+ + P  SL+ GPKN GK+TF+R LL+  L RY++VA+L
Sbjct  357  LPHTWESAMSSSAPTLRSDSVSLAVPTTSLVKGPKNSGKSTFARTLLNRFLTRYQRVAFL  416

Query  519  DTDVGQTEFTPPGFLSLTIID  581
            + D+GQ+EFTP G ++L I+D
Sbjct  417  ECDIGQSEFTPAGMVALNIVD  437



>ref|XP_007851992.1| hypothetical protein Moror_3014 [Moniliophthora roreri MCA 2997]
 gb|ESK88675.1| hypothetical protein Moror_3014 [Moniliophthora roreri MCA 2997]
Length=694

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 63/106 (59%), Gaps = 5/106 (5%)
 Frame = +3

Query  351  IIPNEWSDTADTIAY---DSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLD  521
            I+P  W+    + +    +S  + P V L+ GPK  GK+TF+R L + LL+R+  VAYL+
Sbjct  286  ILPMSWNLALPSFSMSDKESAGNKPGVYLVKGPKKSGKSTFARTLTNSLLQRFPYVAYLE  345

Query  522  TDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDIS  653
            TD+GQ+EFTPPG +SLT++ K       T P L  P    F G ++
Sbjct  346  TDLGQSEFTPPGIVSLTVLSKPVFGPPWTHPTLSHPGYAHFVGSLT  391



>ref|XP_009842777.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV67785.1| hypothetical protein, variant [Aphanomyces astaci]
Length=615

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            P  +I+IP  WS  A +I     TS     L+CG K  GK+TFSR++++ LL  Y  VAY
Sbjct  221  PVREILIPPTWSKVAASILDSMATSANRKMLVCGAKGVGKSTFSRYVVNRLLNVYPMVAY  280

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFG  644
            LDTDVGQ E   PG LSL  I           L+   R +FFG
Sbjct  281  LDTDVGQPELAAPGVLSLHYITSPLLGPGYTHLEPAYRSYFFG  323



>ref|XP_001840996.2| GRC3 [Coprinopsis cinerea okayama7#130]
 gb|EAU80730.2| GRC3 [Coprinopsis cinerea okayama7#130]
Length=866

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = +3

Query  348  IIIPNEWSDTADTIAYDSVTSP----PPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
             ++P  WSD  D    +S  S      PV ++ GP+N GK+T +R LL+ LL  Y KVA+
Sbjct  374  FVLPASWSDALDKALKNSHQSASSGDAPVYVVKGPRNTGKSTLARTLLNRLLGIYEKVAF  433

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFG  644
            LD D+GQTEFTPPG +SL+++           L  P    F G
Sbjct  434  LDCDLGQTEFTPPGMVSLSVVGNEVFGPPFTHLSVPYAAHFVG  476



>emb|CDH52186.1| aaa family atpase grc3 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=890

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = +3

Query  336  PSPDII---IPNEWSDTADTIAYDSVTSPPP-VSLICGPKNCGKTTFSRHLLHVLLKRYR  503
            P+P I    IP+ WS  A+    D      P VS++CG K+ GK+TF+R+L++ LL  ++
Sbjct  447  PTPGIRALDIPSTWSGNANVAIQDEKERGSPIVSIVCGTKDSGKSTFNRYLVNRLLNSHK  506

Query  504  KVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLK---TPERCFFFG  644
            +VAYL+TDVGQTEFTP G ++L +++     L  PC        R  +FG
Sbjct  507  RVAYLETDVGQTEFTPAGIIALHVLES--PILGPPCTHQNIASRRSHYFG  554



>ref|XP_010141669.1| PREDICTED: LOW QUALITY PROTEIN: polynucleotide 5'-hydroxyl-kinase 
NOL9-like, partial [Buceros rhinoceros silvestris]
Length=392

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 14/86 (16%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+       D
Sbjct  53   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLS-------D  105

Query  597  LTIPCL-------KTPERCFFFGDIS  653
            +T P L       +TP +  ++G  S
Sbjct  106  VTEPILAPPFTHQQTPRKMVYYGQTS  131



>gb|EPB91174.1| hypothetical protein HMPREF1544_02054 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=801

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 68/107 (64%), Gaps = 7/107 (7%)
 Frame = +3

Query  348  IIIPNEWSDTADTIAYDSVT---SPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
            + I + W  T  ++A D  T   + P VS++CG K+ GK+++SR+L++ LL +Y +VAYL
Sbjct  362  LAIESSWQ-TRTSMAIDKATQQATNPLVSVVCGAKDMGKSSYSRYLINRLLAKYNRVAYL  420

Query  519  DTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDIS  653
            +TDVGQ+EFTP G LSL  I    +    T   L+ PER F+FG  S
Sbjct  421  ETDVGQSEFTPSGLLSLHYISNPILGPPYTHQQLE-PERSFYFGSTS  466



>ref|XP_001624875.1| predicted protein [Nematostella vectensis]
 gb|EDO32775.1| predicted protein [Nematostella vectensis]
Length=886

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +3

Query  357  PNEWSDTADTIAY--DSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDV  530
            P +WSD    I    +  T   P  LICG K  GK+T +R +++ LL  + +V YL+ DV
Sbjct  47   PKQWSDLLHAIHQIKEGPTGRCPSLLICGGKGVGKSTLARFMVNGLLNSFPEVCYLECDV  106

Query  531  GQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            GQTEFTPP  LS+T +            + PER +FFGDIS
Sbjct  107  GQTEFTPPAILSITRVTSPLLGSPFTHQQWPERAYFFGDIS  147



>ref|XP_009842778.1| hypothetical protein H257_16139 [Aphanomyces astaci]
 gb|ETV67784.1| hypothetical protein H257_16139 [Aphanomyces astaci]
Length=621

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  PSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            P  +I+IP  WS  A +I     TS     L+CG K  GK+TFSR++++ LL  Y  VAY
Sbjct  221  PVREILIPPTWSKVAASILDSMATSANRKMLVCGAKGVGKSTFSRYVVNRLLNVYPMVAY  280

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFG  644
            LDTDVGQ E   PG LSL  I           L+   R +FFG
Sbjct  281  LDTDVGQPELAAPGVLSLHYITSPLLGPGYTHLEPAYRSYFFG  323



>ref|XP_008501867.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Calypte anna]
Length=404

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 14/86 (16%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+       D
Sbjct  12   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLS-------D  64

Query  597  LTIPCL-------KTPERCFFFGDIS  653
            +T P L       +TP +  ++G  S
Sbjct  65   VTEPILGPPFTHQQTPRKMVYYGQTS  90



>ref|XP_006399594.1| hypothetical protein EUTSA_v10015920mg, partial [Eutrema salsugineum]
 gb|ESQ41047.1| hypothetical protein EUTSA_v10015920mg, partial [Eutrema salsugineum]
Length=213

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 23/89 (26%)
 Frame = +3

Query  363  EWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTE  542
            EWSD A +++  S+   P V+L+CGPK+ GK+TFSR+L+                  Q E
Sbjct  1    EWSDAASSVSCSSLQ--PVVALVCGPKHSGKSTFSRNLV------------------QPE  40

Query  543  FTPPGFLSLTIIDKIPADLTIPCLKTPER  629
            FT PGFLSLT++DK    + +PC+KTPER
Sbjct  41   FTAPGFLSLTVVDK---SILVPCVKTPER  66



>ref|XP_009704551.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Cariama 
cristata]
Length=445

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  53   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNITEPVLG  112

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  113  PPFTHQQTPRKMVYYGQTS  131



>ref|XP_005514454.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Columba livia]
Length=356

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  13   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  72

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  +FG  S
Sbjct  73   PPFTHQQTPLKMVYFGQTS  91



>ref|XP_009882380.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Charadrius 
vociferus]
Length=455

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  63   PVVLVCGPKNTGKSTFNRYLVNLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNITEPVLG  122

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  123  PPFTHQQTPRKMVYYGQTS  141



>ref|XP_003285812.1| hypothetical protein DICPUDRAFT_149705 [Dictyostelium purpureum]
 gb|EGC37708.1| hypothetical protein DICPUDRAFT_149705 [Dictyostelium purpureum]
Length=648

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 8/105 (8%)
 Frame = +3

Query  354  IPNEWSDTADT-IAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDV  530
            IPN+W    +    Y +        L CG +N GK+TF+R L++ LLK+Y  + Y+DTD 
Sbjct  210  IPNQWLQLINNQFIYSNEFDSNLSILTCGERNVGKSTFNRILINKLLKKYSNIVYIDTDT  269

Query  531  GQTEFTPPGFLSLTIIDKIPADLTIP----CLKTPERCFFFGDIS  653
            GQ+EFTP G LS+ II+   + L  P    C   P + +FFGD S
Sbjct  270  GQSEFTPCGLLSIDIIN---SPLLGPPFTHCKLNPLKTYFFGDTS  311



>ref|XP_008938506.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Merops nubicus]
Length=482

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  90   PVMLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNITEPVLG  149

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  150  PPFTHQQTPRKMVYYGQTS  168



>ref|XP_010003606.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Chaetura pelagica]
Length=449

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  57   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  116

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  117  PPFTHQQTPRKMVYYGQTS  135



>ref|XP_009979797.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Tauraco 
erythrolophus]
Length=445

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  53   PVVLVCGPKNTGKSTFNRYLINLLLNRLPLVEYMECDIGQTEFTPPGCVSLSTITEPILG  112

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  113  PPFTHQQTPRKMVYYGQTS  131



>ref|XP_010123629.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Chlamydotis 
macqueenii]
Length=427

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 14/86 (16%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+       D
Sbjct  35   PVVLVCGPKNTGKSTFNRYLINLLLNRLPLVEYMECDIGQTEFTPPGCVSLS-------D  87

Query  597  LTIPCL-------KTPERCFFFGDIS  653
            +T P L       +TP +  ++G  S
Sbjct  88   ITEPILGPPFTHQQTPRKMVYYGQTS  113



>ref|XP_010199181.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Colius 
striatus]
Length=444

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  56   PVVLVCGPKNTGKSTFNRYLINLLLNRLPAVEYMECDIGQTEFTPPGCVSLSNITEPILG  115

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  116  PPFTHQQTPRKMVYYGQTS  134



>gb|KDE04810.1| hypothetical protein MVLG_04774 [Microbotryum violaceum p1A1 
Lamole]
Length=860

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = +3

Query  426  LICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTI  605
            L+ GPK  GK+TFS+ +LH LL R+  VAYLDTD+GQ EF PPGF+SL +I       + 
Sbjct  457  LVEGPKRVGKSTFSKLVLHQLLSRFMAVAYLDTDLGQPEFMPPGFVSLNVITSPQLGPSF  516

Query  606  PCLKTPERCFFFGDIS  653
              L  P   +F G  S
Sbjct  517  THLSVPMASYFIGQTS  532



>ref|XP_010287893.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Phaethon 
lepturus]
Length=445

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  53   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  112

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  113  PPFTHQQTPHKMVYYGQTS  131



>ref|XP_010020976.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Nestor 
notabilis]
Length=445

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  53   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  112

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  113  PPFTHQQTPRKMVYYGQTS  131



>ref|XP_010164317.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Caprimulgus 
carolinensis]
Length=445

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  53   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  112

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  113  PPFTHQQTPHKMVYYGQTS  131



>ref|XP_010563656.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Haliaeetus 
leucocephalus]
Length=496

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  104  PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  163

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  164  PPFTHQQTPRKMVYYGQTS  182



>ref|XP_009560683.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Cuculus canorus]
Length=496

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  104  PVILVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  163

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  164  PPFTHQQTPRKMVYYGQTS  182



>ref|XP_005143747.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Melopsittacus 
undulatus]
Length=447

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  59   PVVLVCGPKNTGKSTFNRYLINLLLNRLPAVEYMECDIGQTEFTPPGCVSLSSVTEPILG  118

Query  597  LTIPCLKTPERCFFFGDIS  653
                   TP +  ++G  S
Sbjct  119  PPFTHQHTPRKMVYYGQTS  137



>ref|XP_007388456.1| hypothetical protein PUNSTDRAFT_93035 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN04313.1| hypothetical protein PUNSTDRAFT_93035 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=689

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV LI GPK  GK+ FSR LL+ LL  YR+ A+L+ D+GQ+EFTPPG +SL II++    
Sbjct  258  PVYLIRGPKKVGKSNFSRTLLNTLLGHYRRAAFLECDLGQSEFTPPGMVSLAIIEQPVFG  317

Query  597  LTIPCLKTPERCFFFG  644
                 L  P R  + G
Sbjct  318  PAFTHLTVPFRAHYIG  333



>ref|XP_009574020.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Fulmarus 
glacialis]
Length=472

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            P+ L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  80   PMVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNITEPILG  139

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  140  PPFTHQQTPRKMVYYGQTS  158



>ref|XP_010219280.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Tinamus guttatus]
Length=452

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV ++CGPKN GK+TF+R+L+++LL     V YL+ D+GQTEFTPPG +SLT + +    
Sbjct  60   PVIMVCGPKNVGKSTFNRYLINLLLNHLPSVEYLECDIGQTEFTPPGCVSLTNVTEPFLG  119

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  120  PPFTHQRTPRKMVYYGQTS  138



>ref|XP_009971529.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Tyto 
alba]
Length=445

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   + Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  53   PVVLVCGPKNTGKSTFNRYLINLLLNRVPLIEYMECDIGQTEFTPPGCVSLSNITEPILG  112

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  113  PPFTHQQTPRKMVYYGQTS  131



>gb|KIM62259.1| hypothetical protein SCLCIDRAFT_1215333 [Scleroderma citrinum 
Foug A]
Length=669

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +3

Query  396  DSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTI  575
            D+  +P P+ ++ GPK  GK+TF+R L++ LL RYR+VA+L+ DVGQ+EFTP G ++L I
Sbjct  232  DTDLAPVPICIVKGPKKSGKSTFARTLVNRLLNRYRRVAFLECDVGQSEFTPGGLVALNI  291

Query  576  IDK--IPADLTIPCLKTPERCFFFG  644
            ++K       T P L  P R  F G
Sbjct  292  VEKYIFGPPFTHPTL--PYRAHFVG  314



>gb|EFA81806.1| NUC156 family protein [Polysphondylium pallidum PN500]
Length=653

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 61/110 (55%), Gaps = 17/110 (15%)
 Frame = +3

Query  348  IIIPNEWSD-TADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDT  524
            +IIPN W    AD +    V    P+ + CG K+ GK+TF+R +++ LL +YR V YLD+
Sbjct  246  LIIPNHWDQFIADKLL--DVKQQSPIIMTCGNKDIGKSTFNRTVVNRLLSKYRYVLYLDS  303

Query  525  DVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPE-------RCFFFGDIS  653
            DVGQ+EF P   ++L ++ +       P L  P        R +F+GD S
Sbjct  304  DVGQSEFAPNALITLNMLSE-------PLLGPPHSHQMKPIRSYFYGDTS  346



>ref|XP_009272381.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Aptenodytes 
forsteri]
Length=498

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  106  PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNITEPILG  165

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  166  PPFTHQQMPRKMVYYGQTS  184



>ref|XP_009331736.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Pygoscelis 
adeliae]
Length=412

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  20   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNITEPILG  79

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  80   PPFTHQQMPRKMVYYGQTS  98



>ref|XP_009478204.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Pelecanus 
crispus]
Length=469

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  77   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  136

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  137  PPFTHQQTPCKMVYYGQTS  155



>ref|XP_009924908.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Haliaeetus 
albicilla]
Length=457

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  65   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  124

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  125  PPFTHQQMPRKMVYYGQTS  143



>ref|XP_002594381.1| hypothetical protein BRAFLDRAFT_72211 [Branchiostoma floridae]
 gb|EEN50392.1| hypothetical protein BRAFLDRAFT_72211 [Branchiostoma floridae]
Length=541

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CG KN GK+T +R L++++L    +V +L+ D+GQTEFTP GF+SLT ++     
Sbjct  193  PVILLCGGKNAGKSTLARFLINLILSSCGEVYHLECDIGQTEFTPSGFVSLTHVNTPTVG  252

Query  597  LTIPCLKTPERCFFFGDIS  653
                  KTP+RC ++G +S
Sbjct  253  PPFTHQKTPDRCCYYGHLS  271



>ref|XP_009081355.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Acanthisitta 
chloris]
Length=435

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V YL+ D+GQTEFTPPG +SL+ + +    
Sbjct  43   PVVLVCGPKNTGKSTFNRYLINLLLNRLPVVEYLECDIGQTEFTPPGCVSLSSVTEPVLG  102

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  103  PPFTHQQMPHKTVYYGQTS  121



>gb|EGU11099.1| thiol:disulfide interchange protein precursor [Rhodotorula glutinis 
ATCC 204091]
Length=905

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
            TS   V+++ GPK  GK+TF++ L++ LL+RY KVAYLDTD+GQ EFTPPGF+SL+++++
Sbjct  481  TSDRLVAVVEGPKRVGKSTFAKMLVNQLLERYEKVAYLDTDLGQPEFTPPGFVSLSVVNE  540

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L  P    + G  S
Sbjct  541  PILAPAFTHLSQPLSSHYLGSTS  563



>ref|XP_002933893.2| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Xenopus (Silurana) 
tropicalis]
Length=639

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (51%), Gaps = 2/114 (2%)
 Frame = +3

Query  318  ALENEIPSPDIIIPNEWSDTADTIAYDSVTSPP--PVSLICGPKNCGKTTFSRHLLHVLL  491
             +EN  P     +  EW     T+    +      P+ L+CG KN GK+TF R+L++ LL
Sbjct  215  GVENRDPENGFKMSEEWHSEVQTLVNACLEEDNGCPIILVCGSKNVGKSTFIRYLMNQLL  274

Query  492  KRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
                 V YLD D+GQTEFTPPG +SL  I +          +  ++  +FG+ S
Sbjct  275  NHISSVGYLDCDLGQTEFTPPGCISLLSITEPVLGPPFTHQQEAQKMVYFGETS  328



>ref|XP_006642072.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Lepisosteus 
oculatus]
Length=638

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            P+ L+CG KN GK+TF+RHL++ LL     V YL+ DVGQTEFTPPG LSL  + +    
Sbjct  193  PIILVCGSKNVGKSTFNRHLINTLLNHTVSVDYLECDVGQTEFTPPGCLSLLSVTEPLLG  252

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P R  FFG+ S
Sbjct  253  PPFTHQRLPSRMVFFGESS  271



>ref|XP_011596654.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Aquila chrysaetos 
canadensis]
Length=496

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  104  PVVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  163

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  164  PPFTHQQMPRKMVYYGQTS  182



>gb|KIN98490.1| hypothetical protein M404DRAFT_1005338 [Pisolithus tinctorius 
Marx 270]
 gb|KIO02970.1| hypothetical protein M404DRAFT_1001586 [Pisolithus tinctorius 
Marx 270]
Length=535

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIID  581
            P+ ++ GPK  GK+TFSR LL+ LL RYR+VA+L+ DVGQ+EFTP G ++LTII+
Sbjct  247  PLCVVKGPKKSGKSTFSRTLLNRLLNRYRRVAFLECDVGQSEFTPGGMVALTIIE  301



>gb|EIE75329.1| hypothetical protein RO3G_00033 [Rhizopus delemar RA 99-880]
Length=511

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +3

Query  420  VSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADL  599
            VS++CG K+ GK++FS++LL+ LL +Y++VAY++TD+GQ+EFTP G LSL  I       
Sbjct  151  VSVVCGGKDLGKSSFSKYLLNRLLTKYKQVAYIETDLGQSEFTPSGLLSLHYIQHPVMGP  210

Query  600  TIPCLK-TPERCFFFGDIS  653
            +    +  P R FF G  S
Sbjct  211  SYAHQQLEPARSFFLGATS  229



>gb|EMT28824.1| hypothetical protein F775_08614 [Aegilops tauschii]
Length=493

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +3

Query  432  CGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPC  611
            C  +NC     S +      K Y ++ YLDTDVGQ EF+PPG LSL I D+  AD+  P 
Sbjct  150  CTQRNCHMWKQSENHKTTPPKSYGRIGYLDTDVGQPEFSPPGCLSLHIADEAIADMWNPV  209

Query  612  LKTPERCFFFGDISS  656
            L+  ERC F+GDISS
Sbjct  210  LREAERCCFYGDISS  224



>ref|XP_005427543.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Geospiza fortis]
Length=453

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  64   PVVLVCGPKNTGKSTFNRYLINLLLNRLPVVEYMECDIGQTEFTPPGCVSLSSVTEPVLG  123

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  124  PPFTHQQMPSKMVYYGQTS  142



>ref|XP_010079471.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Pterocles 
gutturalis]
Length=445

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  53   PVILVCGPKNTGKSTFNRYLINLLLNRLPLVEYMECDIGQTEFTPPGCVSLSNVTEPILG  112

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  113  PPFTHQQTPCKMVYYGQTS  131



>gb|EPS97830.1| hypothetical protein FOMPIDRAFT_1166101 [Fomitopsis pinicola 
FP-58527 SS1]
Length=794

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 73/136 (54%), Gaps = 25/136 (18%)
 Frame = +3

Query  273  AHALRREIIERGMASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPP------VSLIC  434
            AH LR E  E            SP I+ P+ W DT        +  P        V L+ 
Sbjct  327  AHLLRTETSE-----------TSPFIMSPS-WKDTV-AFVMKGLAEPQNARHSRHVYLVK  373

Query  435  GPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKI---PADLTI  605
            GP+N GK+TF+R LL+ LL RYR+VA+L+ D+GQ+EFTP G ++LT++DK    PA  T 
Sbjct  374  GPRNAGKSTFARVLLNTLLTRYRRVAFLECDLGQSEFTPAGMVALTVVDKPLFGPA-FTH  432

Query  606  PCLKTPERCFFFGDIS  653
            PC+  P    F G  S
Sbjct  433  PCM--PYAAHFVGAAS  446



>ref|XP_009933690.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Opisthocomus 
hoazin]
Length=405

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            P+ L+CGPKN GK+TFSR+L+++LL     V Y++ D+GQ EFTPPG +SL+ + +    
Sbjct  20   PLILVCGPKNTGKSTFSRYLINLLLNHLPSVEYMECDIGQAEFTPPGCVSLSTVTEPILG  79

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  80   PPFTHQQTPRKMVYYGQTS  98



>gb|ETO67392.1| hypothetical protein F444_15689 [Phytophthora parasitica P1976]
Length=632

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  366  WSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEF  545
            W  T D +    V   P   ++CG K  GK+TF RHL++ LL ++  VA+LDTD+GQ+E 
Sbjct  230  WQATVDRLEKSLVDENPQKIVVCGGKGVGKSTFCRHLVNRLLSKFGTVAFLDTDLGQSEL  289

Query  546  TPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGD  647
            TP G ++L  +           +K P R FF G+
Sbjct  290  TPSGLVALHALSTPLLGPGFAHMKHPVRSFFCGN  323



>ref|XP_005493016.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X1 
[Zonotrichia albicollis]
Length=649

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  260  PVVLVCGPKNTGKSTFNRYLINLLLNRLPVVEYMECDIGQTEFTPPGCVSLSSVTEPVLG  319

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  320  PPFTHQQMPSKMVYYGQTS  338



>ref|XP_002471073.1| predicted protein [Postia placenta Mad-698-R]
 gb|EED83730.1| predicted protein [Postia placenta Mad-698-R]
Length=729

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 5/84 (6%)
 Frame = +3

Query  348  IIIPNEW-SDTADTIAYDSVTSPPP----VSLICGPKNCGKTTFSRHLLHVLLKRYRKVA  512
            +++P+ W ++T+  +  D  TS       V L+ GPKN GK+T +R LL+ LL +YR+VA
Sbjct  326  LLVPHSWEAETSSILTRDVSTSGYASARLVCLVKGPKNAGKSTLARTLLNRLLTKYRRVA  385

Query  513  YLDTDVGQTEFTPPGFLSLTIIDK  584
            +L+ D+GQ+EFTP G  +L I+DK
Sbjct  386  FLECDLGQSEFTPGGMAALNILDK  409



>gb|KDR71072.1| hypothetical protein GALMADRAFT_254240 [Galerina marginata CBS 
339.88]
Length=806

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 58/99 (59%), Gaps = 4/99 (4%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            IP+ W+ T D I   S +      ++ GPKN GK+T +R L + LL+ Y++VA+L+ D+G
Sbjct  340  IPSSWTSTLDRILSKSDSMSCGTYIVKGPKNAGKSTLARTLTNRLLESYQRVAFLECDIG  399

Query  534  QTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFG  644
            Q+EFTP G +SL +I K  +    T P L  P    F G
Sbjct  400  QSEFTPGGMVSLNVISKPILGPPFTHPTL--PNHAHFVG  436



>gb|KDQ14247.1| hypothetical protein BOTBODRAFT_132759 [Botryobasidium botryosum 
FD-172 SS1]
Length=640

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 5/80 (6%)
 Frame = +3

Query  345  DIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDT  524
            D++IP E  D  +  + D     P V+L+ GPK  GK+TF+R LL  L  RY+KVA+L+ 
Sbjct  218  DLLIPEESQDMDEDTSLD-----PLVALVKGPKKSGKSTFARTLLSRLTTRYQKVAFLEC  272

Query  525  DVGQTEFTPPGFLSLTIIDK  584
            D+GQ+EFTP G +SL +I +
Sbjct  273  DMGQSEFTPGGMVSLHVISR  292



>ref|XP_008926991.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Manacus vitellinus]
Length=411

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQ EFTPPG +SL+ + +    
Sbjct  20   PVVLVCGPKNTGKSTFNRYLINLLLNRLPAVEYMECDIGQPEFTPPGCVSLSSVTEPVLG  79

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  80   PPFTHQQTPRKMVYYGQTS  98



>ref|XP_010308705.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Balearica 
regulorum gibbericeps]
Length=445

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            P+ L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  53   PLVLVCGPKNTGKSTFNRYLINLLLNRLPSVEYMECDIGQTEFTPPGCVSLSNVTEPILG  112

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  113  PPFTHQQMPRKMVYYGQTS  131



>ref|XP_005493017.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X2 
[Zonotrichia albicollis]
Length=624

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  235  PVVLVCGPKNTGKSTFNRYLINLLLNRLPVVEYMECDIGQTEFTPPGCVSLSSVTEPVLG  294

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  295  PPFTHQQMPSKMVYYGQTS  313



>ref|XP_001730501.1| hypothetical protein MGL_2297 [Malassezia globosa CBS 7966]
 gb|EDP43287.1| hypothetical protein MGL_2297 [Malassezia globosa CBS 7966]
Length=539

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 60/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  348  IIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKR--YRKVAYLD  521
            + +PNEW DT D +A    +  P +  + G KN GK+T +R LLH  L R  +R VAY++
Sbjct  66   LCMPNEWLDTLDELA-SLPSRVPGIVAVRGLKNSGKSTCARMLLHAFLTRGEHRFVAYME  124

Query  522  TDVGQTEFTPPGFLSLTIID-KIPADLTIP---CLKTPERCFFFGDIS  653
             DVGQ EF PPG L L + D +    L  P     + P R  F GDI+
Sbjct  125  LDVGQPEFGPPGMLCLHVFDSQREHGLFAPGWCTARMPVRAHFLGDIT  172



>ref|XP_004356271.1| NUC156 family protein [Dictyostelium fasciculatum]
 gb|EGG17787.1| NUC156 family protein [Dictyostelium fasciculatum]
Length=810

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +3

Query  408  SPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKI  587
            SP P+ L CG K  GK+TF+R L++ +L +Y  + Y+D D GQ EFTP G +SL I++  
Sbjct  308  SPLPIILTCGSKGVGKSTFNRILVNRMLSKYNNIIYIDGDAGQCEFTPGGLVSLHIVNGP  367

Query  588  PADLTIPCLKTPERCFFFGDIS  653
                +   L+   R +FFG++S
Sbjct  368  LLGPSFTHLQKAVRTYFFGEVS  389



>ref|XP_002470377.1| predicted protein [Postia placenta Mad-698-R]
 gb|EED84402.1| predicted protein [Postia placenta Mad-698-R]
Length=1061

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +3

Query  348  IIIPNEWSDTADTIAYDSVT-----SPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVA  512
            ++IP+ W     ++    V+     S   V L+ GPKN GK+T +R LL+ LL +YR+VA
Sbjct  370  LLIPHSWEAATSSLLTRDVSTSGYASARLVCLVKGPKNAGKSTLARTLLNRLLTKYRRVA  429

Query  513  YLDTDVGQTEFTPPGFLSLTIIDK  584
            +L+ D+GQ+EFTP G  +L I+DK
Sbjct  430  FLECDLGQSEFTPGGMAALNILDK  453



>ref|XP_002111887.1| hypothetical protein TRIADDRAFT_55357 [Trichoplax adhaerens]
 gb|EDV25854.1| hypothetical protein TRIADDRAFT_55357 [Trichoplax adhaerens]
Length=710

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  426  LICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTI  605
            LICG K+ GK+TF R+LL+ LL  + +VA++++D+GQTEFTP GF++L I+ K       
Sbjct  238  LICGGKDVGKSTFCRYLLNSLLTCFNQVAFMESDIGQTEFTPSGFVALNIVTKPVLGPPF  297

Query  606  PCLKTPERCFFFGDISS  656
              L+ P   +F G+ S+
Sbjct  298  THLRQPSLSYFIGEASA  314



>ref|XP_008632496.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Corvus brachyrhynchos]
Length=412

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            P+ L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ I +    
Sbjct  20   PLVLVCGPKNTGKSTFNRYLINLLLNRLPVVEYMECDIGQTEFTPPGCVSLSSITEPVLG  79

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  80   PPFTHQQMPRKMVYYGQTS  98



>ref|XP_005437817.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Falco cherrug]
Length=424

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            PV L+CGPKN GK+TF+R+L+++LL R   + Y++ D+GQTEFTPPG +SL+
Sbjct  32   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSIEYMECDIGQTEFTPPGCVSLS  83



>ref|XP_005238046.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Falco peregrinus]
Length=482

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            PV L+CGPKN GK+TF+R+L+++LL R   + Y++ D+GQTEFTPPG +SL+
Sbjct  90   PVVLVCGPKNTGKSTFNRYLINLLLNRLPSIEYMECDIGQTEFTPPGCVSLS  141



>ref|XP_007235796.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X1 
[Astyanax mexicanus]
 ref|XP_007235797.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X2 
[Astyanax mexicanus]
 ref|XP_007235798.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X3 
[Astyanax mexicanus]
 ref|XP_007235799.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X4 
[Astyanax mexicanus]
Length=463

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            P+ L+CG KN GK+TF+RHL++ LL     V YL+ D+GQTEFTPPG LSL+ + +    
Sbjct  346  PIILVCGAKNSGKSTFNRHLINSLLNHTASVEYLECDLGQTEFTPPGCLSLSTVTEPLLG  405

Query  597  LTIPCLKTPERCFFFGD  647
                  + P+   F+G 
Sbjct  406  PPFTHQREPDHMVFYGQ  422



>ref|XP_007235800.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X5 
[Astyanax mexicanus]
Length=462

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            P+ L+CG KN GK+TF+RHL++ LL     V YL+ D+GQTEFTPPG LSL+ + +    
Sbjct  345  PIILVCGAKNSGKSTFNRHLINSLLNHTASVEYLECDLGQTEFTPPGCLSLSTVTEPLLG  404

Query  597  LTIPCLKTPERCFFFGD  647
                  + P+   F+G 
Sbjct  405  PPFTHQREPDHMVFYGQ  421



>ref|XP_009677090.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X1 
[Struthio camelus australis]
Length=412

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV ++CGPKN GK+TF+R+L+++LL     V YL+ D+GQTEFTPPG +SLT + +    
Sbjct  20   PVIMVCGPKNVGKSTFNRYLINLLLNHLPSVEYLECDIGQTEFTPPGCVSLTNVTEPFLG  79

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  80   PPFTHQRMPRKMVYYGQPS  98



>ref|XP_009677091.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X2 
[Struthio camelus australis]
Length=409

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV ++CGPKN GK+TF+R+L+++LL     V YL+ D+GQTEFTPPG +SLT + +    
Sbjct  20   PVIMVCGPKNVGKSTFNRYLINLLLNHLPSVEYLECDIGQTEFTPPGCVSLTNVTEPFLG  79

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  80   PPFTHQRMPRKMVYYGQPS  98



>ref|XP_006957049.1| hypothetical protein WALSEDRAFT_43922 [Wallemia sebi CBS 633.66]
 gb|EIM23010.1| hypothetical protein WALSEDRAFT_43922 [Wallemia sebi CBS 633.66]
Length=645

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 65/118 (55%), Gaps = 1/118 (1%)
 Frame = +3

Query  303  RGMASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPP-VSLICGPKNCGKTTFSRHLL  479
            +G+   LE+       ++P  W+  A+    +S  S  P ++++ G KN GK+ FSR L 
Sbjct  236  KGLYPILESTSNVYAYLLPPSWTSAANIARENSFRSAEPYIAIVKGWKNTGKSAFSRLLS  295

Query  480  HVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            + L   ++KVAYL+ D+GQ+EF P G +SL ++D+          + P +  F GD+S
Sbjct  296  NTLKNSHKKVAYLECDIGQSEFMPSGCVSLHLLDEYLLGPAFTHPRIPAKAHFIGDVS  353



>ref|XP_007862680.1| hypothetical protein GLOTRDRAFT_136561 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ59788.1| hypothetical protein GLOTRDRAFT_136561 [Gloeophyllum trabeum 
ATCC 11539]
Length=773

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTS--PPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTD  527
            +P+ W      +   +      PPV L+ GPKN GK+TF+R LL+ L+ +Y +VA+L+ D
Sbjct  340  VPDSWDAALSAVLSHAKAGDMKPPVCLVKGPKNAGKSTFARTLLNRLVTKYARVAFLECD  399

Query  528  VGQTEFTPPGFLSLTIID  581
            +GQ+EFTP G ++L ++D
Sbjct  400  LGQSEFTPGGMVALNVLD  417



>gb|KIJ60990.1| hypothetical protein HYDPIDRAFT_97607 [Hydnomerulius pinastri 
MD-312]
Length=692

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 6/104 (6%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVT--SPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTD  527
            +P+ W     +I    V+  +  P+ L+ GPK  GK+TF+R L++ LL RYR+VA+L+ D
Sbjct  244  LPHSWETALSSIDGTQVSDIATAPICLVRGPKKTGKSTFARTLVNRLLDRYRRVAFLECD  303

Query  528  VGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDIS  653
            +GQ+EFTP G ++L +++        T P L  P R  + G  S
Sbjct  304  LGQSEFTPGGMVALNVVENYVFGPPFTHPSL--PYRAHYIGSTS  345



>ref|XP_006025630.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Alligator 
sinensis]
Length=480

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPK  GK+TF+R+L+++LL     V YL+ D+GQTEFTPPG +SL  I      
Sbjct  90   PVILVCGPKCVGKSTFNRYLINLLLNHLPCVEYLECDLGQTEFTPPGCVSLMNISDPFLG  149

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++GD+S
Sbjct  150  PPFTHQRTPRKMVYYGDVS  168



>ref|XP_009093844.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Serinus canaria]
Length=479

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPKN GK+TF+R+L+++LL R   V Y++ D+GQ EFTPPG +SL+ I +    
Sbjct  90   PVVLVCGPKNTGKSTFNRYLINLLLNRLPVVEYMECDIGQAEFTPPGCISLSSITEPILG  149

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  150  PPFTHQQMPGKMVYYGQTS  168



>ref|XP_002905535.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY68376.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=617

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  366  WSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEF  545
            W  T D +    V   P   ++CG K  GK+TF R+L++ LL ++  VA+LDTD+GQ+E 
Sbjct  230  WQATVDRLQASLVAQNPQKIVVCGGKGVGKSTFCRYLVNTLLSKFDTVAFLDTDLGQSEL  289

Query  546  TPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGD  647
            TP G ++L  +           +K P R FF G+
Sbjct  290  TPSGLVALHALTTPLLGPGFAHMKHPIRSFFCGN  323



>ref|XP_005851160.1| hypothetical protein CHLNCDRAFT_137775 [Chlorella variabilis]
 gb|EFN59058.1| hypothetical protein CHLNCDRAFT_137775 [Chlorella variabilis]
Length=635

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 5/105 (5%)
 Frame = +3

Query  354  IPNEWSDTA----DTIAYDSVTSP-PPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYL  518
            +P  W   A    D++A  +     PP+ ++CG K  GK+TF+R L++ LL ++  VAYL
Sbjct  189  LPPLWQQAAGEVEDSMAQQAQQGGGPPLIVVCGAKKVGKSTFARFLVNSLLGKHACVAYL  248

Query  519  DTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            DTD GQ EFT PG +SL+++ +          + P   FF GD S
Sbjct  249  DTDCGQPEFTAPGLVSLSLVRQPVLGPPHMHQRRPVAAFFAGDTS  293



>gb|KIM79525.1| hypothetical protein PILCRDRAFT_74200 [Piloderma croceum F 1598]
Length=785

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  420  VSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
            V L+ GPK  GK+TF+R L++ LL RYRKVAYL+ DVGQ+EFTP G ++L II++
Sbjct  377  VCLVKGPKKTGKSTFARTLVNRLLARYRKVAYLECDVGQSEFTPCGMVALNIIEQ  431



>ref|XP_006262140.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Alligator 
mississippiensis]
Length=566

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPK  GK+TF+R+L+++LL     V YL+ D+GQTEFTPPG +SL  I      
Sbjct  176  PVILVCGPKCVGKSTFNRYLINLLLNHLPCVEYLECDLGQTEFTPPGCVSLMNISDPFLG  235

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++GD+S
Sbjct  236  PPFTHQRTPRKMVYYGDVS  254



>ref|XP_009909630.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Picoides pubescens]
Length=445

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            P+ L+CGPKN GK+TF+R+L+++LL     V YL+ D+GQTEFTPPG +SL+ + +    
Sbjct  58   PLILVCGPKNTGKSTFNRYLINLLLNSLPSVEYLECDIGQTEFTPPGCVSLSHVTEPLLG  117

Query  597  LTIPCLKTPERCFFFG  644
                  + P R  ++G
Sbjct  118  PPFTHQQAPRRMVYYG  133



>ref|XP_696106.3| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Danio rerio]
 ref|XP_005162271.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Danio rerio]
Length=713

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            P+ L+CG K+ GK+TF+RHL++ LL     V YL+ D+GQTEFTPPG LSL  + +    
Sbjct  337  PIILVCGGKSSGKSTFNRHLINSLLNHTASVEYLECDLGQTEFTPPGCLSLCTVTEPLLG  396

Query  597  LTIPCLKTPERCFFFG  644
                 L+ PE   ++G
Sbjct  397  PPFTHLRDPEHMVYYG  412



>ref|XP_006820503.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Saccoglossus 
kowalevskii]
Length=543

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = +3

Query  342  PDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLD  521
            P   + +E  D   T+   +VT P  V L+CG KN GK+T+ R+L++  L +   + YL+
Sbjct  344  PLFYLQSELKDITRTLLKSTVTRP--VVLVCGGKNVGKSTYCRYLINSFLNKENSIDYLE  401

Query  522  TDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
             DVGQTEFTP   +SLT + +         L+ P    FFGD+S
Sbjct  402  CDVGQTEFTPSSIISLTEVKEPLLGPPFTHLREPTIMSFFGDLS  445



>gb|KII96132.1| hypothetical protein PLICRDRAFT_35066 [Plicaturopsis crispa FD-325 
SS-3]
Length=814

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 4/80 (5%)
 Frame = +3

Query  420  VSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK--IPA  593
            V L+ G K  GK+TF+R L++ LL+RY +VA+L+TDVGQ+EFTP G ++LTI+D+     
Sbjct  388  VCLVKGAKRTGKSTFARTLVNKLLERYSRVAFLETDVGQSEFTPGGMVALTIVDRPIFGP  447

Query  594  DLTIPCLKTPERCFFFGDIS  653
              T P L  P R  + G  S
Sbjct  448  PYTHPSL--PYRAHYIGAAS  465



>emb|CCM03241.1| predicted protein [Fibroporia radiculosa]
Length=798

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 58/93 (62%), Gaps = 17/93 (18%)
 Frame = +3

Query  339  SPDIIIPNEWSDTADTIAYDSVTSPPP-----------VSLICGPKNCGKTTFSRHLLHV  485
            SP +I+P+ W       A+D+V S  P           V L+ GP+N GK+TF+R L++ 
Sbjct  353  SPLLILPS-WR-----TAFDAVLSNIPENSLEFDYSRRVYLVKGPRNSGKSTFARTLINK  406

Query  486  LLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
            L  RYR+VA+L+ D GQ+EFTP G ++L IIDK
Sbjct  407  LTHRYRRVAFLECDPGQSEFTPGGLIALNIIDK  439



>gb|KIK42112.1| hypothetical protein CY34DRAFT_805324 [Suillus luteus UH-Slu-Lm8-n1]
Length=742

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 61/111 (55%), Gaps = 17/111 (15%)
 Frame = +3

Query  351  IIPNEWSDTADTIAYDSVTSPPP--------VSLICGPKNCGKTTFSRHLLHVLLKRYRK  506
            ++P  WS     +A  +  +PP         V ++ GPK  GK+TF+R LL+ LL R+++
Sbjct  304  VLPESWS-----VALSAAETPPSSEDPIPLSVYVVKGPKKSGKSTFARTLLNRLLARFQR  358

Query  507  VAYLDTDVGQTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFGDIS  653
            VAYL+ DVGQ+EFTP G ++L +I         T P L  P R  + G  S
Sbjct  359  VAYLECDVGQSEFTPGGLVALNVIHNPVFGPPFTHPSL--PYRAHYVGATS  407



>ref|XP_010873621.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Esox lucius]
 ref|XP_010873622.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Esox lucius]
 ref|XP_010873623.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Esox lucius]
 ref|XP_010873624.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Esox lucius]
Length=718

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV ++CG KN GK+TF+RHL++ LL     V YLD D+GQTEFTP G LSL  + +    
Sbjct  339  PVIIVCGAKNVGKSTFNRHLINTLLNHTACVDYLDCDLGQTEFTPSGCLSLCTVREPLLG  398

Query  597  LTIPCLKTPERCFFFGDIS  653
                   TPE   F+G  S
Sbjct  399  PPFTHQWTPEHMIFYGQTS  417



>gb|KIK94403.1| hypothetical protein PAXRUDRAFT_142920 [Paxillus rubicundulus 
Ve08.2h10]
Length=691

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 6/99 (6%)
 Frame = +3

Query  360  NEWSDTADTIA--YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            + W     +IA   DS +  PP+ L+ GPK  GK+T +R L++ LL+RY +VA+L+ D+G
Sbjct  246  HSWETALASIAGTQDSDSGTPPICLVKGPKKSGKSTLARTLVNRLLERYSRVAFLECDLG  305

Query  534  QTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFG  644
            Q+EFTP G ++L+I++        T P L  P R  + G
Sbjct  306  QSEFTPGGMVALSIVESYIFGPPFTHPSL--PYRAHYIG  342



>ref|XP_005030216.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Anas platyrhynchos]
Length=412

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV ++CGPK+ GK+TF+R+L+++LL     V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  20   PVIMVCGPKSIGKSTFNRYLINLLLNHLPSVEYMECDIGQTEFTPPGCVSLSSVTEPFLG  79

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  80   PPFTHQQTPRKMVYYGQTS  98



>gb|ETL32271.1| hypothetical protein L916_15143 [Phytophthora parasitica]
Length=632

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  366  WSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEF  545
            W  T D +    V   P   ++CG K  GK+TF R+L++ LL ++  VA+LDTD+GQ+E 
Sbjct  230  WQATVDRLEKSLVDENPQKIVVCGGKGVGKSTFCRYLVNRLLSKFGTVAFLDTDLGQSEL  289

Query  546  TPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGD  647
            TP G ++L  +           +K P R FF G+
Sbjct  290  TPSGLVALHALSTPLLGPGFAHMKHPVRSFFCGN  323



>ref|XP_008895264.1| hypothetical protein PPTG_04735 [Phytophthora parasitica INRA-310]
 gb|ETN19411.1| hypothetical protein PPTG_04735 [Phytophthora parasitica INRA-310]
Length=632

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  366  WSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEF  545
            W  T D +    V   P   ++CG K  GK+TF R+L++ LL ++  VA+LDTD+GQ+E 
Sbjct  230  WQATVDRLEKSLVDENPQKIVVCGGKGVGKSTFCRYLVNRLLSKFGTVAFLDTDLGQSEL  289

Query  546  TPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGD  647
            TP G ++L  +           +K P R FF G+
Sbjct  290  TPSGLVALHALSTPLLGPGFAHMKHPVRSFFCGN  323



>gb|ETL85512.1| hypothetical protein L917_14974 [Phytophthora parasitica]
 gb|ETP36839.1| hypothetical protein F442_15288 [Phytophthora parasitica P10297]
Length=632

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  366  WSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEF  545
            W  T D +    V   P   ++CG K  GK+TF R+L++ LL ++  VA+LDTD+GQ+E 
Sbjct  230  WQATVDRLEKSLVDENPQKIVVCGGKGVGKSTFCRYLVNRLLSKFGTVAFLDTDLGQSEL  289

Query  546  TPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGD  647
            TP G ++L  +           +K P R FF G+
Sbjct  290  TPSGLVALHALSTPLLGPGFAHMKHPVRSFFCGN  323



>gb|ETK78837.1| hypothetical protein L915_15252 [Phytophthora parasitica]
Length=632

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  366  WSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEF  545
            W  T D +    V   P   ++CG K  GK+TF R+L++ LL ++  VA+LDTD+GQ+E 
Sbjct  230  WQATVDRLEKSLVDENPQKIVVCGGKGVGKSTFCRYLVNRLLSKFGTVAFLDTDLGQSEL  289

Query  546  TPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGD  647
            TP G ++L  +           +K P R FF G+
Sbjct  290  TPSGLVALHALSTPLLGPGFAHMKHPVRSFFCGN  323



>gb|ETI38637.1| hypothetical protein F443_15711 [Phytophthora parasitica P1569]
 gb|ETM38666.1| hypothetical protein L914_15108 [Phytophthora parasitica]
Length=632

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  366  WSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEF  545
            W  T D +    V   P   ++CG K  GK+TF R+L++ LL ++  VA+LDTD+GQ+E 
Sbjct  230  WQATVDRLEKSLVDENPQKIVVCGGKGVGKSTFCRYLVNRLLSKFGTVAFLDTDLGQSEL  289

Query  546  TPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGD  647
            TP G ++L  +           +K P R FF G+
Sbjct  290  TPSGLVALHALSTPLLGPGFAHMKHPVRSFFCGN  323



>gb|ETP08545.1| hypothetical protein F441_15530 [Phytophthora parasitica CJ01A1]
Length=632

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +3

Query  366  WSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEF  545
            W  T D +    V   P   ++CG K  GK+TF R+L++ LL ++  VA+LDTD+GQ+E 
Sbjct  230  WQATVDRLEKSLVDENPQKIVVCGGKGVGKSTFCRYLVNRLLSKFGTVAFLDTDLGQSEL  289

Query  546  TPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGD  647
            TP G ++L  +           +K P R FF G+
Sbjct  290  TPSGLVALHALSTPLLGPGFAHMKHPVRSFFCGN  323



>gb|KDQ65165.1| hypothetical protein JAAARDRAFT_202382 [Jaapia argillacea MUCL 
33604]
Length=829

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  414  PPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
            P V L+ GPKN GK+ F+R LL+ LL +Y++VAYL+ D+GQ+EFTP G +SL +I +
Sbjct  402  PVVCLVKGPKNSGKSGFARLLLNQLLSKYKRVAYLECDIGQSEFTPGGMVSLNVISE  458



>ref|XP_003225740.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Anolis carolinensis]
Length=642

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPK+ GK+TF+R+L+++LL R   VA+L+ D+GQ EFTPPG +SL  + +    
Sbjct  256  PVILVCGPKSVGKSTFNRYLINLLLNRLPCVAFLECDLGQPEFTPPGCISLLNVTEPLLG  315

Query  597  LTIPCLKTPERCFFFGDIS  653
                  ++P R  +FG+ S
Sbjct  316  PPFTHQRSPGRMVYFGETS  334



>ref|XP_003212228.2| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9, partial [Meleagris 
gallopavo]
Length=423

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV ++CGPK+ GK+TF+R+L+++LL     V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  31   PVIMVCGPKSIGKSTFNRYLINLLLNHLPSVEYMECDIGQTEFTPPGCVSLSNVTEPFLG  90

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP +  ++G  S
Sbjct  91   PPFTHQRTPRKMVYYGQTS  109



>gb|EMS19840.1| AAA family ATPase Grc3 [Rhodosporidium toruloides NP11]
 emb|CDR35497.1| RHTO0S01e00672g1_1 [Rhodosporidium toruloides]
Length=794

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTII  578
            TS   V+++ GPK  GK+TF++ L++ LL+RY KVAYLDTD+GQ EFTPPGF+SL ++
Sbjct  370  TSDRLVAIVEGPKRVGKSTFAKMLVNQLLERYEKVAYLDTDLGQPEFTPPGFVSLNVL  427



>ref|XP_005528464.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Pseudopodoces 
humilis]
Length=622

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPK+ GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL+ + +    
Sbjct  235  PVVLVCGPKSTGKSTFNRYLINLLLNRLPVVEYMECDIGQTEFTPPGCVSLSSVMEPILG  294

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  295  PPFTHQQMPRKMVYYGQTS  313



>gb|KJA16088.1| hypothetical protein HYPSUDRAFT_148203 [Hypholoma sublateritium 
FD-334 SS-4]
Length=772

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            +P  WS   + +    V +     +I GP+N GK+TF+R L++ LL  YR VAYL+ D+G
Sbjct  322  LPPSWSKALNDVTVSDVLAG--THIIKGPRNSGKSTFARTLMNHLLGSYRHVAYLECDIG  379

Query  534  QTEFTPPGFLSLTII  578
            Q+EFTP G +SL II
Sbjct  380  QSEFTPGGMVSLNII  394



>ref|XP_009265823.1| Polynucleotide 5'-hydroxyl-kinase GRC3 [Wallemia ichthyophaga 
EXF-994]
 gb|EOR04806.1| Polynucleotide 5'-hydroxyl-kinase GRC3 [Wallemia ichthyophaga 
EXF-994]
Length=717

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 66/122 (54%), Gaps = 3/122 (2%)
 Frame = +3

Query  297  IERGMASALENEIPSPDIIIPNEWSDTADTIAYDSVTSPPP-VSLICGPKNCGKTTFSRH  473
            +  GM   LE+   +   + P  W+  A  IA ++  SP P ++++ G +N GK+ FSR+
Sbjct  262  VVEGMYPILESTPNTYAFLTPPSWTSAATQIARNAFHSPQPYIAIVKGGRNTGKSAFSRY  321

Query  474  LLHVLLKR--YRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGD  647
            L + L     +  VAYL+ DVGQ+EF P G +SL +ID+          + P +  F G+
Sbjct  322  LCNALRGEATHANVAYLECDVGQSEFMPSGCVSLHLIDEFLLGPPFTHPRIPSKAHFVGE  381

Query  648  IS  653
            +S
Sbjct  382  LS  383



>ref|XP_005057712.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Ficedula albicollis]
Length=485

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPK+ GK+TF+R+L+++LL R   V Y++ D+GQTEFTPPG +SL  + +    
Sbjct  93   PVVLVCGPKSIGKSTFNRYLINLLLNRLPVVEYMECDIGQTEFTPPGCVSLCSVTEPILG  152

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  ++G  S
Sbjct  153  PPFTHQQMPRKMVYYGQTS  171



>gb|EPZ35588.1| hypothetical protein O9G_005108 [Rozella allomycis CSF55]
Length=528

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 61/129 (47%), Gaps = 15/129 (12%)
 Frame = +3

Query  228  RLASEQTKILILSLRAHALR------REIIERGMASALE----NEIPSPDIIIPNEWSDT  377
            +L      +L+  L  HA+       R I  +     LE     E P P + I   W   
Sbjct  87   KLDCNNCVLLLDKLDFHAIHHKYPEYRYIFGKSEKETLEIYPSEESPLPTLQITESW---  143

Query  378  ADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPG  557
                A+  + +      +CG KN GK+TFSR LL+  L  Y KV Y+D DVGQ EFTPPG
Sbjct  144  --IRAFQDLNNSVHSVFVCGSKNVGKSTFSRCLLNGFLSNYDKVIYVDFDVGQPEFTPPG  201

Query  558  FLSLTIIDK  584
             +S  +I K
Sbjct  202  LVSARVISK  210



>gb|ETE62219.1| Polynucleotide 5'-hydroxyl-kinase NOL9 [Ophiophagus hannah]
Length=366

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPK+ GK+TF+R+L+++LL R   + YL+ D+GQ EF PPG +SL  + +    
Sbjct  112  PVILVCGPKSIGKSTFNRYLMNLLLNRLPCLEYLECDLGQPEFNPPGCISLVDVREPLLG  171

Query  597  LTIPCLKTPERCFFFGDIS  653
                  + P +  F+GDIS
Sbjct  172  PPFSHQRPPRKMAFYGDIS  190



>emb|CDQ84306.1| unnamed protein product [Oncorhynchus mykiss]
Length=720

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CG KN GK+TF+RHL++ LL     V YL+ D+GQTEFTP G LSL+ + +    
Sbjct  341  PVILVCGAKNVGKSTFNRHLINTLLNHTASVEYLECDLGQTEFTPSGCLSLSTVREPLLG  400

Query  597  LTIPCLKTPERCFFFGDIS  653
                    PE   F+G  S
Sbjct  401  PPFTHQWAPEHMIFYGQSS  419



>ref|XP_004995777.1| hypothetical protein PTSG_03193 [Salpingoeca rosetta]
 gb|EGD82541.1| hypothetical protein PTSG_03193 [Salpingoeca rosetta]
Length=666

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 60/107 (56%), Gaps = 1/107 (1%)
 Frame = +3

Query  333  IPSPDIIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVA  512
            + S   II ++    AD +      +PP V L+CG K  GK+T  R+L++ LL R+ +VA
Sbjct  274  VASHGTIIDDKLRSFADQLLATRGRNPPSV-LLCGAKGAGKSTTLRYLVNRLLSRFPRVA  332

Query  513  YLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
             LD D+GQ E TPP  +SL +I +         +KTP   F+ GD+S
Sbjct  333  LLDGDIGQAECTPPATISLVMITEPLFSSPFTHIKTPAVSFYLGDVS  379



>ref|XP_004024628.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Gorilla gorilla 
gorilla]
Length=683

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  234  QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  280

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  281  ----PVILVCGSQDVGKSTFNRYLINQLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  336

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  337  PVLGAPFTHLRTPQKMVYYGKPS  359



>ref|XP_005287132.2| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Chrysemys 
picta bellii]
Length=611

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 55/86 (64%), Gaps = 14/86 (16%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPK+ GK+TF+R+L+++LL     V YL+ D+GQTEFTPPG +SL        +
Sbjct  221  PVILVCGPKSIGKSTFNRYLINLLLNHLPCVEYLECDLGQTEFTPPGCVSLI-------N  273

Query  597  LTIPCL-------KTPERCFFFGDIS  653
            ++ PCL       + P +  ++G+ S
Sbjct  274  VSEPCLGPPFTHQRMPRKMVYYGETS  299



>gb|KIJ08266.1| hypothetical protein PAXINDRAFT_102638 [Paxillus involutus ATCC 
200175]
Length=643

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 59/99 (60%), Gaps = 6/99 (6%)
 Frame = +3

Query  360  NEWSDTADTIA--YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVG  533
            + W     +IA   DS     P+ L+ GPK  GK+TF+R L++ LL+RY +VA+L+ D+G
Sbjct  353  HSWETALASIAGTQDSDIGTSPICLVKGPKKSGKSTFARTLVNRLLERYCRVAFLECDLG  412

Query  534  QTEFTPPGFLSLTIIDK--IPADLTIPCLKTPERCFFFG  644
            Q+EFTP G +SL+I++        T P L  P R  + G
Sbjct  413  QSEFTPGGMVSLSIVESYIFGPPFTHPSL--PYRAHYIG  449



>emb|CBN74160.1| conserved unknown protein [Ectocarpus siliculosus]
Length=832

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 61/111 (55%), Gaps = 12/111 (11%)
 Frame = +3

Query  348  IIIPNEWSDTADTIAYDSVTSPPPVS--------LICGPKNCGKTTFSRHLLHVLLKRYR  503
            + +P +W++  D +    + SPP  +        L+CG K  GK+T  R L + +L R+R
Sbjct  332  LTLPQDWANAIDAV----LASPPRPAGGGSNDSVLVCGAKGVGKSTLCRFLANRMLGRHR  387

Query  504  KVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDISS  656
            +VAY+D D+GQ EFTPPG +SL +++          L+ P   +F G  +S
Sbjct  388  EVAYMDCDLGQPEFTPPGQVSLHLLNTPVVGPPHANLRHPHLAYFIGTTTS  438



>gb|KIM32999.1| hypothetical protein M408DRAFT_190466 [Serendipita vermifera 
MAFF 305830]
Length=616

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  423  SLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTII  578
            +L+ GPK  GK+TF R L++ LL R+R VAYLD D GQTEFTPPG +SL II
Sbjct  220  ALVKGPKGSGKSTFVRMLVNRLLLRHRHVAYLDCDPGQTEFTPPGMVSLHII  271



>ref|XP_007338857.1| hypothetical protein AURDEDRAFT_81640 [Auricularia delicata TFB-10046 
SS5]
 gb|EJD53281.1| hypothetical protein AURDEDRAFT_81640 [Auricularia delicata TFB-10046 
SS5]
Length=575

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 57/107 (53%), Gaps = 7/107 (7%)
 Frame = +3

Query  354  IPNEWSDTADTIA-------YDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVA  512
            +P  W    D +         D+  + P V ++ G K  GK+T +R  L+ L+ RYR+VA
Sbjct  170  LPPSWQTALDAVEAPPAKGRQDNGLAKPLVIMVKGAKRSGKSTLARTALNRLVMRYRRVA  229

Query  513  YLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            +L+ DVGQ+EFTP G ++L I+D+     +   L TP    F G  S
Sbjct  230  FLECDVGQSEFTPAGIVALNIVDRPQFGPSFTHLSTPLVAHFTGSTS  276



>emb|CCA67460.1| hypothetical protein PIIN_01290 [Piriformospora indica DSM 11827]
Length=681

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +3

Query  357  PNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQ  536
            P  W  + D IA+    SP    LI GPK  GK+  SR L++ LL R+++VAYLD DVGQ
Sbjct  268  PYSWKASLD-IAHTYPESP--RILIQGPKGSGKSMLSRMLVNRLLSRFKQVAYLDCDVGQ  324

Query  537  TEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFGDIS  653
            TEFTP G +SL ++ +          + P R  F G  S
Sbjct  325  TEFTPEGMVSLHLLTQPVFGPPFSHPRDPLRAHFVGSTS  363



>ref|XP_003822193.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Pan paniscus]
Length=702

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  253  QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  299

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  300  ----PVILVCGSQDVGKSTFNRYLINQLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  355

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  356  PVLGPPFTHLRTPQKMVYYGQPS  378



>ref|XP_003274369.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Nomascus leucogenys]
Length=704

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  255  QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  301

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  302  ----PVILVCGSQDVGKSTFNRYLINQLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  357

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  358  PVLGPPFTHLRTPQKMVYYGKPS  380



>gb|AAH94836.1| NOL9 protein, partial [Homo sapiens]
Length=525

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  76   QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  122

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  123  ----PVILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  178

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  179  PVLGPPFTHLRTPQKMVYYGKPS  201



>ref|XP_006676334.1| hypothetical protein BATDEDRAFT_85431 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF84106.1| hypothetical protein BATDEDRAFT_85431 [Batrachochytrium dendrobatidis 
JAM81]
Length=569

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 2/108 (2%)
 Frame = +3

Query  324  ENEIPSPD-IIIPNEWSDTADTIAYDSVTSPPPVSLICGPKNCGKTTFSRHLLHVLLKRY  500
            E+ + S D +IIP+ W+ TA ++  +S T    +  + GPKN GK+TF+R+L++  L+R+
Sbjct  151  ESTLKSVDALIIPDTWALTASSLLVNSFTHNSNICAV-GPKNSGKSTFTRYLINRFLERH  209

Query  501  RKVAYLDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCLKTPERCFFFG  644
             +VAY+D D GQ   TP G +SL +I+           +   R FF G
Sbjct  210  PEVAYMDCDPGQPGCTPNGMVSLHVINSPLLGPAFTTQRDSYRSFFIG  257



>ref|XP_514340.2| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X1 
[Pan troglodytes]
Length=702

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  253  QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  299

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  300  ----PVILVCGSQDVGKSTFNRYLINQLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  355

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  356  PVLGPPFTHLRTPQKMVYYGKPS  378



>ref|XP_002811608.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Pongo abelii]
Length=702

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  253  QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  299

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  300  ----PVILVCGSQDVGKSTFNRYLINQLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  355

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  356  PVLGPPFTHLRTPQKMVYYGKPS  378



>emb|CDI95815.1| polynucleotide 5' hydroxyl kinase NOL9 [Hymenolepis microstoma]
 emb|CDI95812.1| polynucleotide 5' hydroxyl kinase NOL9 [Hymenolepis microstoma]
 emb|CDS34744.1| polynucleotide 5' hydroxyl kinase NOL9 [Hymenolepis microstoma]
 emb|CDS34741.1| polynucleotide 5' hydroxyl kinase NOL9 [Hymenolepis microstoma]
Length=642

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 27/127 (21%)
 Frame = +3

Query  354  IPNEWSDTADTIAYDSVT------SPPPVS-----------------LICGPKNCGKTTF  464
            IPN+ S T +T +++S +       PP +                  ++CGP N GK++ 
Sbjct  165  IPNKVSITGETYSFESASVGEGYVEPPELFDLFQSLSNVQETRGSKIIVCGPSNSGKSSL  224

Query  465  SRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKI----PADLTIPCLKTPERC  632
             R L++  L  +  VA+LD D GQTEFTPPG LSLTII       P    +  L  P+R 
Sbjct  225  LRRLVNHFLCNHEAVAFLDCDPGQTEFTPPGMLSLTIIKNFILGPPFTHPLNGLFKPKRQ  284

Query  633  FFFGDIS  653
             FFG  S
Sbjct  285  CFFGGTS  291



>ref|XP_007896050.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Callorhinchus 
milii]
 ref|XP_007896051.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Callorhinchus 
milii]
 ref|XP_007896052.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Callorhinchus 
milii]
Length=751

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 62/108 (57%), Gaps = 6/108 (6%)
 Frame = +3

Query  342  PDIIIPNEWSDTADTIAYDSVTSPP--PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAY  515
            P +I+  EWS+T   +    +      P+ L+CG KN GK+TFSR+L++  L     V +
Sbjct  330  PGLILSEEWSNTIQELLKTCLEDDDGCPIILVCGNKNVGKSTFSRYLMNSFLNHVPCVEF  389

Query  516  LDTDVGQTEFTPPGFLSLTIIDKIPADLTIPCL--KTPERCFFFGDIS  653
            L+ D+GQTEF+PPG ++L  +      L+ P +    P +  ++GD+S
Sbjct  390  LECDLGQTEFSPPGCVALHSVTG--PLLSPPYMHQSEPRKMVYYGDVS  435



>sp|Q5SY16.1|NOL9_HUMAN RecName: Full=Polynucleotide 5'-hydroxyl-kinase NOL9; AltName: 
Full=Nucleolar protein 9 [Homo sapiens]
Length=702

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  253  QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  299

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  300  ----PVILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  355

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  356  PVLGPPFTHLRTPQKMVYYGKPS  378



>gb|AAI10850.1| Nucleolar protein 9 [Homo sapiens]
 gb|AAI05096.1| Nucleolar protein 9 [Homo sapiens]
 gb|AAI12279.1| Nucleolar protein 9 [Homo sapiens]
 dbj|BAF82342.1| unnamed protein product [Homo sapiens]
 gb|ADR83383.1| nucleolar protein 9 [synthetic construct]
 gb|AIC57101.1| NOL9, partial [synthetic construct]
Length=702

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  253  QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  299

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  300  ----PVILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  355

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  356  PVLGPPFTHLRTPQKMVYYGKPS  378



>ref|NP_078930.3| polynucleotide 5'-hydroxyl-kinase NOL9 [Homo sapiens]
 gb|EAW71550.1| nucleolar protein 9 [Homo sapiens]
Length=702

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  253  QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  299

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  300  ----PVILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  355

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  356  PVLGPPFTHLRTPQKMVYYGKPS  378



>ref|XP_008565240.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Galeopterus 
variegatus]
Length=631

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGP++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +    
Sbjct  234  PVILVCGPQDIGKSTFNRYLINQLLNSISCVDYLECDLGQTEFTPPGCISLFNITEPILG  293

Query  597  LTIPCLKTPERCFFFGDIS  653
                  +TP++  ++G +S
Sbjct  294  PPFTHQRTPQKMVYYGKLS  312



>gb|AIC58598.1| NOL9, partial [synthetic construct]
Length=702

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 23/143 (16%)
 Frame = +3

Query  243  QTKILILSLRAHALRREIIERGMA------SALENEIPSPDIIIPNEWSDTADTIAYDSV  404
            Q K   L+LR+  +RRE   +G+       SALE  +        N   +  D       
Sbjct  253  QIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELV--------NVSCEEVDGC-----  299

Query  405  TSPPPVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDK  584
                PV L+CG ++ GK+TF+R+L++ LL     V YL+ D+GQTEFTPPG +SL  I +
Sbjct  300  ----PVILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQTEFTPPGCISLLNITE  355

Query  585  IPADLTIPCLKTPERCFFFGDIS  653
                     L+TP++  ++G  S
Sbjct  356  PVLGPPFTHLRTPQKMVYYGKPS  378



>ref|XP_007268054.1| hypothetical protein FOMMEDRAFT_110095 [Fomitiporia mediterranea 
MF3/22]
 gb|EJD00777.1| hypothetical protein FOMMEDRAFT_110095 [Fomitiporia mediterranea 
MF3/22]
Length=599

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +3

Query  396  DSVTSPPPVS-LICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLT  572
            + V S  PV+ L+ G K  GK+T +R L + LL RYR+VA+L+ DVGQTEFTPPG +SL 
Sbjct  146  EDVQSLDPVTVLVRGRKRTGKSTLARTLGNRLLNRYRRVAFLECDVGQTEFTPPGLVSLH  205

Query  573  IID  581
            +ID
Sbjct  206  VID  208



>ref|XP_006123179.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Pelodiscus 
sinensis]
Length=598

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 14/86 (16%)
 Frame = +3

Query  417  PVSLICGPKNCGKTTFSRHLLHVLLKRYRKVAYLDTDVGQTEFTPPGFLSLTIIDKIPAD  596
            PV L+CGPK+ GK+TF+R+L+++LL     V YL+ D+GQTEFTPPG +S         +
Sbjct  208  PVILVCGPKSTGKSTFNRYLINLLLNHLPCVEYLECDLGQTEFTPPGCVSFI-------N  260

Query  597  LTIPCL-------KTPERCFFFGDIS  653
            ++ PCL       + P +  ++G+ S
Sbjct  261  VSEPCLGPPFTHQRMPRKMVYYGEAS  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1035462857458