BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig967

Length=712
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338945.1|  PREDICTED: enolase-like                            417   8e-142   Solanum tuberosum [potatoes]
ref|XP_009623017.1|  PREDICTED: enolase                                 415   3e-141   Nicotiana tomentosiformis
ref|XP_011094426.1|  PREDICTED: enolase                                 415   4e-141   Sesamum indicum [beniseed]
ref|XP_004249573.1|  PREDICTED: enolase-like                            413   2e-140   
emb|CDP15353.1|  unnamed protein product                                410   5e-139   Coffea canephora [robusta coffee]
ref|NP_001234080.1|  enolase                                            409   8e-139   Solanum lycopersicum
ref|XP_011101486.1|  PREDICTED: enolase-like                            409   1e-138   Sesamum indicum [beniseed]
gb|EYU35120.1|  hypothetical protein MIMGU_mgv1a006438mg                409   1e-138   Erythranthe guttata [common monkey flower]
ref|XP_006341172.1|  PREDICTED: enolase-like                            406   1e-137   Solanum tuberosum [potatoes]
gb|ACR56690.1|  enolase                                                 404   7e-137   Nicotiana tabacum [American tobacco]
ref|NP_001275058.1|  enolase-like                                       403   1e-136   Solanum tuberosum [potatoes]
ref|XP_009764205.1|  PREDICTED: enolase-like                            402   4e-136   Nicotiana sylvestris
ref|XP_009612088.1|  PREDICTED: enolase-like                            402   5e-136   Nicotiana tomentosiformis
ref|XP_012090397.1|  PREDICTED: enolase                                 397   3e-134   Jatropha curcas
gb|KJB16686.1|  hypothetical protein B456_002G243100                    392   1e-132   Gossypium raimondii
gb|KJB16680.1|  hypothetical protein B456_002G243100                    392   1e-132   Gossypium raimondii
ref|XP_012090393.1|  PREDICTED: enolase-like                            393   1e-132   Jatropha curcas
ref|XP_011657684.1|  PREDICTED: enolase isoform X2                      391   2e-132   Cucumis sativus [cucumbers]
gb|AAQ18140.1|  enolase                                                 393   2e-132   Gossypium barbadense [Egyptian cotton]
gb|ABR16178.1|  unknown                                                 390   2e-132   Picea sitchensis
ref|XP_009374527.1|  PREDICTED: enolase                                 393   2e-132   Pyrus x bretschneideri [bai li]
gb|ACN26258.1|  unknown                                                 392   3e-132   Zea mays [maize]
ref|XP_008241309.1|  PREDICTED: enolase                                 392   3e-132   Prunus mume [ume]
gb|ACG31732.1|  enolase                                                 392   4e-132   Zea mays [maize]
ref|XP_007202055.1|  hypothetical protein PRUPE_ppa005779mg             392   4e-132   Prunus persica
ref|XP_004962569.1|  PREDICTED: enolase 2-like isoform X2               392   4e-132   Setaria italica
gb|KJB16682.1|  hypothetical protein B456_002G243100                    391   4e-132   Gossypium raimondii
gb|KJB16684.1|  hypothetical protein B456_002G243100                    392   4e-132   Gossypium raimondii
ref|XP_004143301.1|  PREDICTED: enolase isoform X1                      392   4e-132   Cucumis sativus [cucumbers]
gb|KHG13187.1|  Enolase 1                                               392   5e-132   Gossypium arboreum [tree cotton]
gb|KJB16679.1|  hypothetical protein B456_002G243100                    392   6e-132   Gossypium raimondii
ref|XP_002510911.1|  enolase, putative                                  391   8e-132   Ricinus communis
ref|XP_007027607.1|  Enolase                                            391   8e-132   
gb|KJB36425.1|  hypothetical protein B456_006G158500                    389   8e-132   Gossypium raimondii
ref|XP_010094249.1|  hypothetical protein L484_001983                   390   9e-132   
gb|EMS66544.1|  Enolase 1                                               391   1e-131   Triticum urartu
gb|KJB07831.1|  hypothetical protein B456_001G046400                    390   2e-131   Gossypium raimondii
ref|XP_004962568.1|  PREDICTED: enolase 2-like isoform X1               391   2e-131   
gb|ABR17990.1|  unknown                                                 390   3e-131   Picea sitchensis
gb|KJB36423.1|  hypothetical protein B456_006G158500                    390   3e-131   Gossypium raimondii
gb|KHF99213.1|  Enolase 2                                               390   3e-131   Gossypium arboreum [tree cotton]
ref|XP_008462531.1|  PREDICTED: enolase                                 390   3e-131   Cucumis melo [Oriental melon]
gb|ABR16337.1|  unknown                                                 390   3e-131   Picea sitchensis
gb|KJB36420.1|  hypothetical protein B456_006G158500                    390   4e-131   Gossypium raimondii
gb|AEW69686.1|  enolase1                                                390   4e-131   Guzmania wittmackii x Guzmania lingulata
gb|ACN39925.1|  unknown                                                 389   4e-131   Picea sitchensis
sp|Q9LEJ0.1|ENO1_HEVBR  RecName: Full=Enolase 1; AltName: Full=2-...    389   4e-131   Hevea brasiliensis [jebe]
gb|KJB07830.1|  hypothetical protein B456_001G046400                    390   4e-131   Gossypium raimondii
ref|XP_003534043.1|  PREDICTED: enolase                                 389   6e-131   Glycine max [soybeans]
ref|XP_003548246.1|  PREDICTED: enolase-like                            389   6e-131   Glycine max [soybeans]
ref|NP_001105371.1|  enolase 2                                          389   8e-131   Zea mays [maize]
ref|XP_007152407.1|  hypothetical protein PHAVU_004G127500g             389   9e-131   Phaseolus vulgaris [French bean]
gb|ACN50180.1|  enolase                                                 388   1e-130   Annona cherimola [cherimoya]
ref|XP_010096850.1|  hypothetical protein L484_003561                   388   1e-130   Morus notabilis
sp|P42896.1|ENO_RICCO  RecName: Full=Enolase; AltName: Full=2-pho...    388   1e-130   Ricinus communis
ref|XP_004308163.1|  PREDICTED: enolase                                 388   1e-130   Fragaria vesca subsp. vesca
ref|XP_008376333.1|  PREDICTED: enolase                                 388   2e-130   Malus domestica [apple tree]
ref|XP_003557232.1|  PREDICTED: enolase 1                               388   2e-130   Brachypodium distachyon [annual false brome]
gb|EMT10090.1|  Enolase 1                                               388   2e-130   
ref|XP_009365316.1|  PREDICTED: enolase                                 388   2e-130   Pyrus x bretschneideri [bai li]
gb|KJB16681.1|  hypothetical protein B456_002G243100                    385   2e-130   Gossypium raimondii
gb|AIR93791.1|  enolase                                                 388   2e-130   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_010933076.1|  PREDICTED: enolase 2                               387   3e-130   Elaeis guineensis
ref|XP_002283632.1|  PREDICTED: enolase 1                               387   3e-130   Vitis vinifera
ref|XP_004964466.1|  PREDICTED: enolase 1-like isoform X4               387   3e-130   Setaria italica
ref|XP_004303035.1|  PREDICTED: enolase                                 387   3e-130   Fragaria vesca subsp. vesca
ref|XP_007218006.1|  hypothetical protein PRUPE_ppa005739mg             387   4e-130   Prunus persica
ref|XP_008234357.1|  PREDICTED: enolase                                 387   4e-130   Prunus mume [ume]
gb|AGH20062.1|  enolase                                                 387   4e-130   Triticum aestivum [Canadian hard winter wheat]
gb|KHN24421.1|  Enolase                                                 387   4e-130   Glycine soja [wild soybean]
ref|XP_002322420.1|  hypothetical protein POPTR_0015s14380g             387   4e-130   Populus trichocarpa [western balsam poplar]
gb|ABW21688.1|  enolase                                                 387   4e-130   Gossypium hirsutum [American cotton]
sp|Q9LEI9.1|ENO2_HEVBR  RecName: Full=Enolase 2; AltName: Full=2-...    387   5e-130   Hevea brasiliensis [jebe]
ref|XP_006481907.1|  PREDICTED: enolase-like                            387   5e-130   Citrus sinensis [apfelsine]
ref|XP_011041692.1|  PREDICTED: enolase                                 387   6e-130   Populus euphratica
ref|XP_010278245.1|  PREDICTED: enolase 1-like                          386   8e-130   Nelumbo nucifera [Indian lotus]
ref|XP_006851831.1|  PREDICTED: enolase                                 386   8e-130   Amborella trichopoda
ref|XP_004514974.1|  PREDICTED: enolase-like                            386   9e-130   Cicer arietinum [garbanzo]
ref|XP_008391739.1|  PREDICTED: enolase-like                            386   1e-129   Malus domestica [apple tree]
ref|XP_006430314.1|  hypothetical protein CICLE_v10011726mg             383   1e-129   
ref|XP_004964465.1|  PREDICTED: enolase 1-like isoform X3               387   1e-129   
ref|XP_010558960.1|  PREDICTED: bifunctional enolase 2/transcript...    386   1e-129   Tarenaya hassleriana [spider flower]
ref|XP_008386927.1|  PREDICTED: enolase                                 385   1e-129   
ref|XP_009401920.1|  PREDICTED: enolase-like                            385   1e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010050038.1|  PREDICTED: enolase-like                            385   2e-129   Eucalyptus grandis [rose gum]
emb|CBI24517.3|  unnamed protein product                                385   2e-129   Vitis vinifera
gb|KJB16683.1|  hypothetical protein B456_002G243100                    385   2e-129   Gossypium raimondii
ref|NP_001056727.1|  Os06g0136600                                       385   2e-129   
ref|XP_010907928.1|  PREDICTED: enolase-like                            385   2e-129   Elaeis guineensis
ref|XP_002528580.1|  enolase, putative                                  385   2e-129   
gb|EEC74867.1|  hypothetical protein OsI_10758                          385   3e-129   Oryza sativa Indica Group [Indian rice]
ref|NP_001049556.1|  Os03g0248600                                       385   3e-129   
ref|XP_002267091.2|  PREDICTED: enolase                                 387   4e-129   Vitis vinifera
gb|KDO61018.1|  hypothetical protein CISIN_1g043137mg                   384   4e-129   Citrus sinensis [apfelsine]
ref|XP_006661656.1|  PREDICTED: enolase-like                            384   4e-129   Oryza brachyantha
ref|XP_010243562.1|  PREDICTED: enolase 1                               384   4e-129   Nelumbo nucifera [Indian lotus]
ref|XP_007038456.1|  Enolase isoform 1                                  384   5e-129   Theobroma cacao [chocolate]
ref|XP_006421751.1|  hypothetical protein CICLE_v10004965mg             384   5e-129   Citrus clementina [clementine]
ref|XP_006430313.1|  hypothetical protein CICLE_v10011726mg             384   6e-129   Citrus clementina [clementine]
gb|AGH20061.1|  enolase                                                 384   6e-129   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010277374.1|  PREDICTED: enolase-like                            384   6e-129   Nelumbo nucifera [Indian lotus]
ref|XP_003558351.1|  PREDICTED: enolase 2                               384   8e-129   Brachypodium distachyon [annual false brome]
dbj|BAJ90134.1|  predicted protein                                      384   8e-129   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003521438.1|  PREDICTED: enolase-like                            384   8e-129   Glycine max [soybeans]
ref|XP_003573806.1|  PREDICTED: enolase                                 384   9e-129   Brachypodium distachyon [annual false brome]
emb|CAB96173.1|  enolase                                                383   1e-128   Spinacia oleracea
ref|XP_008791284.1|  PREDICTED: enolase isoform X1                      383   1e-128   Phoenix dactylifera
ref|XP_008791285.1|  PREDICTED: enolase isoform X2                      383   1e-128   
ref|XP_007162849.1|  hypothetical protein PHAVU_001G186100g             383   1e-128   Phaseolus vulgaris [French bean]
ref|XP_009353019.1|  PREDICTED: enolase-like                            383   2e-128   Pyrus x bretschneideri [bai li]
ref|XP_010527847.1|  PREDICTED: bifunctional enolase 2/transcript...    383   2e-128   Tarenaya hassleriana [spider flower]
gb|AEM97875.1|  enolase                                                 382   3e-128   Corylus heterophylla
gb|AGZ15373.1|  enolase                                                 382   3e-128   Phaseolus vulgaris [French bean]
dbj|BAJ85279.1|  predicted protein                                      382   4e-128   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAL16111.1|AF428279_1  At2g36530/F1O11.16                            377   4e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778664.1|  PREDICTED: enolase-like                            382   4e-128   Phoenix dactylifera
ref|XP_006403745.1|  hypothetical protein EUTSA_v10010378mg             382   5e-128   
gb|AFB35652.1|  enolase                                                 382   5e-128   Phytolacca americana [common pokeberry]
ref|XP_009384633.1|  PREDICTED: enolase                                 381   9e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393022.1|  PREDICTED: enolase-like                            381   1e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002984551.1|  hypothetical protein SELMODRAFT_120189             381   1e-127   Selaginella moellendorffii
ref|XP_004964464.1|  PREDICTED: enolase 1-like isoform X2               384   1e-127   
gb|KDO65391.1|  hypothetical protein CISIN_1g013317mg                   380   1e-127   Citrus sinensis [apfelsine]
ref|XP_006490248.1|  PREDICTED: enolase-like                            380   1e-127   Citrus sinensis [apfelsine]
ref|XP_010050008.1|  PREDICTED: enolase 1                               380   2e-127   Eucalyptus grandis [rose gum]
ref|NP_001237329.1|  enolase                                            380   2e-127   
ref|XP_006294225.1|  hypothetical protein CARUB_v10023223mg             380   2e-127   Capsella rubella
sp|Q42971.2|ENO_ORYSJ  RecName: Full=Enolase; AltName: Full=2-pho...    380   2e-127   Oryza sativa Japonica Group [Japonica rice]
gb|AAC49173.1|  enolase                                                 380   2e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004964463.1|  PREDICTED: enolase 1-like isoform X1               383   3e-127   
gb|AFW85965.1|  enolase1                                                379   3e-127   
gb|KEH24119.1|  phosphopyruvate hydratase                               379   3e-127   Medicago truncatula
gb|ABG65935.1|  Enolase, putative, expressed                            380   4e-127   Oryza sativa Japonica Group [Japonica rice]
gb|AFW85964.1|  enolase1                                                379   4e-127   
gb|ACL53816.1|  unknown                                                 379   4e-127   Zea mays [maize]
ref|NP_001105896.1|  enolase 1                                          379   5e-127   Zea mays [maize]
ref|XP_001751337.1|  predicted protein                                  379   5e-127   
ref|XP_010515776.1|  PREDICTED: bifunctional enolase 2/transcript...    379   7e-127   Camelina sativa [gold-of-pleasure]
gb|ABB46862.2|  Enolase, putative, expressed                            380   7e-127   Oryza sativa Japonica Group [Japonica rice]
ref|NP_181192.1|  bifunctional enolase 2/transcriptional activator      379   7e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AAS66001.1|  LOS2                                                    379   8e-127   Capsella bursa-pastoris
ref|XP_011018872.1|  PREDICTED: enolase 2                               378   1e-126   Populus euphratica
ref|XP_009133088.1|  PREDICTED: bifunctional enolase 2/transcript...    378   1e-126   Brassica rapa
gb|KFK32725.1|  hypothetical protein AALP_AA6G281000                    378   1e-126   Arabis alpina [alpine rockcress]
gb|AAL06912.1|  At2g36530/F1O11.16                                      378   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381325.1|  phosphopyruvate hydratase family protein           378   1e-126   Populus trichocarpa [western balsam poplar]
ref|XP_002877895.1|  enolase                                            377   2e-126   Arabidopsis lyrata subsp. lyrata
gb|KJB16685.1|  hypothetical protein B456_002G243100                    377   2e-126   Gossypium raimondii
gb|KFK34543.1|  hypothetical protein AALP_AA5G159700                    377   2e-126   Arabis alpina [alpine rockcress]
ref|NP_001064223.1|  Os10g0167300                                       377   3e-126   
ref|XP_010683886.1|  PREDICTED: enolase                                 377   3e-126   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010504049.1|  PREDICTED: bifunctional enolase 2/transcript...    377   3e-126   Camelina sativa [gold-of-pleasure]
ref|XP_002881452.1|  hypothetical protein ARALYDRAFT_902771             377   4e-126   Arabidopsis lyrata subsp. lyrata
ref|XP_006403746.1|  hypothetical protein EUTSA_v10010379mg             377   4e-126   Eutrema salsugineum [saltwater cress]
ref|XP_007038457.1|  Enolase isoform 2                                  375   4e-126   
ref|XP_007038458.1|  Enolase isoform 3                                  376   4e-126   
ref|XP_001751336.1|  predicted protein                                  377   5e-126   
gb|AAL59917.1|  putative enolase (2-phospho-D-glycerate hydroylase)     376   5e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010050020.1|  PREDICTED: enolase-like isoform X1                 378   6e-126   Eucalyptus grandis [rose gum]
gb|ABB46861.2|  Enolase, putative, expressed                            377   7e-126   Oryza sativa Japonica Group [Japonica rice]
gb|AAM12985.1|  enolase (2-phospho-D-glycerate hydroylase)              376   8e-126   Arabidopsis thaliana [mouse-ear cress]
gb|AAN04181.1|  Putative enolase (2-phospho-D-glycerate hydroylase)     375   9e-126   Oryza sativa Japonica Group [Japonica rice]
gb|ABD92697.1|  los                                                     376   9e-126   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010505199.1|  PREDICTED: bifunctional enolase 2/transcript...    376   9e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010509461.1|  PREDICTED: bifunctional enolase 2/transcript...    376   1e-125   Camelina sativa [gold-of-pleasure]
gb|AAA21277.1|  2-phospho-D-glycerate hydrolase                         375   1e-125   Mesembryanthemum crystallinum
ref|XP_006291136.1|  hypothetical protein CARUB_v10017251mg             375   1e-125   Capsella rubella
ref|XP_010050029.1|  PREDICTED: enolase-like isoform X2                 377   1e-125   Eucalyptus grandis [rose gum]
ref|XP_010516879.1|  PREDICTED: bifunctional enolase 2/transcript...    375   1e-125   Camelina sativa [gold-of-pleasure]
gb|EEC66609.1|  hypothetical protein OsI_32842                          375   1e-125   Oryza sativa Indica Group [Indian rice]
ref|XP_009143574.1|  PREDICTED: bifunctional enolase 2/transcript...    375   2e-125   Brassica rapa
sp|Q43130.1|ENO_MESCR  RecName: Full=Enolase; AltName: Full=2-pho...    375   2e-125   Mesembryanthemum crystallinum
gb|AAQ77240.1|  enolase                                                 375   2e-125   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_002965441.1|  hypothetical protein SELMODRAFT_167539             375   2e-125   Selaginella moellendorffii
ref|XP_004494139.1|  PREDICTED: enolase-like                            375   2e-125   
gb|EEE65047.1|  hypothetical protein OsJ_20044                          375   2e-125   Oryza sativa Japonica Group [Japonica rice]
gb|KHN02262.1|  Enolase                                                 374   5e-125   Glycine soja [wild soybean]
ref|XP_009141601.1|  PREDICTED: bifunctional enolase 2/transcript...    373   9e-125   Brassica rapa
gb|KHN18726.1|  Enolase                                                 374   9e-125   Glycine soja [wild soybean]
gb|AFW85966.1|  enolase1                                                373   2e-124   
gb|KHG20587.1|  Enolase 2                                               372   2e-124   Gossypium arboreum [tree cotton]
emb|CAB75428.1|  enolase                                                372   3e-124   Lupinus luteus
emb|CDX73592.1|  BnaC08g24110D                                          370   2e-123   
sp|Q43321.1|ENO_ALNGL  RecName: Full=Enolase; AltName: Full=2-pho...    370   2e-123   Alnus glutinosa
gb|AAQ77241.1|  enolase                                                 368   1e-122   Brassica napus [oilseed rape]
ref|XP_010426928.1|  PREDICTED: bifunctional enolase 2/transcript...    364   3e-121   Camelina sativa [gold-of-pleasure]
ref|XP_006656609.1|  PREDICTED: enolase 1-like                          347   3e-114   
emb|CDX84555.1|  BnaA03g16750D                                          338   2e-111   
emb|CDY65842.1|  BnaAnng21140D                                          338   4e-111   Brassica napus [oilseed rape]
emb|CDX79684.1|  BnaC03g20200D                                          337   7e-111   
gb|AES75861.2|  phosphopyruvate hydratase                               336   2e-110   Medicago truncatula
emb|CDY33161.1|  BnaC04g08780D                                          336   3e-110   Brassica napus [oilseed rape]
ref|XP_003619643.1|  Enolase                                            330   4e-108   
gb|ETK83693.1|  enolase                                                 318   2e-106   Phytophthora parasitica
gb|ETL37108.1|  enolase                                                 318   3e-106   Phytophthora parasitica
gb|EPS60909.1|  enolase                                                 320   7e-106   Genlisea aurea
gb|ETL90278.1|  phosphopyruvate hydratase                               319   3e-105   Phytophthora parasitica
gb|ETO99514.1|  enolase                                                 320   2e-104   Phytophthora parasitica CJ01A1
gb|ETI29888.1|  enolase                                                 321   4e-104   Phytophthora parasitica P1569
gb|ETP27738.1|  enolase                                                 321   4e-104   Phytophthora parasitica P10297
gb|KDO32627.1|  enolase 2                                               320   5e-104   Saprolegnia parasitica CBS 223.65
ref|XP_008619366.1|  enolase 2                                          320   6e-104   Saprolegnia diclina VS20
gb|ETM43595.1|  enolase                                                 320   9e-104   Phytophthora parasitica
gb|ETI47488.1|  enolase                                                 320   1e-103   Phytophthora parasitica P1569
ref|XP_008907532.1|  enolase                                            320   1e-103   Phytophthora parasitica INRA-310
gb|ETM43582.1|  enolase                                                 320   1e-103   Phytophthora parasitica
ref|XP_011133483.1|  enolase                                            315   2e-103   Gregarina niphandrodes
ref|XP_002906751.1|  enolase                                            317   1e-102   Phytophthora infestans T30-4
emb|CCI48932.1|  unnamed protein product                                317   1e-102   Albugo candida
ref|XP_002906750.1|  enolase                                            317   1e-102   Phytophthora infestans T30-4
ref|XP_005791836.1|  hypothetical protein EMIHUDRAFT_420746             317   4e-102   Emiliania huxleyi CCMP1516
ref|XP_009834734.1|  enolase                                            315   7e-102   Aphanomyces astaci
ref|XP_009515820.1|  hypothetical protein PHYSODRAFT_284295             315   1e-101   Phytophthora sojae
ref|XP_002772277.1|  Enolase, putative                                  311   1e-101   Perkinsus marinus ATCC 50983
emb|CCA14125.1|  unnamed protein product                                313   3e-101   Albugo laibachii Nc14
ref|XP_009515818.1|  phosphopyruvate hydratase                          314   4e-101   Phytophthora sojae
gb|AAN31479.1|  enolase                                                 313   4e-101   Phytophthora infestans [potato late blight]
ref|XP_001415437.1|  predicted protein                                  313   5e-101   Ostreococcus lucimarinus CCE9901
ref|XP_002771110.1|  Enolase, putative                                  311   1e-100   Perkinsus marinus ATCC 50983
ref|XP_003884000.1|  unnamed protein product                            311   5e-100   Neospora caninum Liverpool
ref|XP_002365578.1|  enolase 2                                          310   7e-100   Toxoplasma gondii ME49
ref|XP_008882278.1|  enolase 2                                          310   2e-99    
gb|AAB35826.2|  enolase                                                 299   2e-99    Echinochloa phyllopogon
sp|Q9BPL7.1|ENO2_TOXGO  RecName: Full=Enolase 2; AltName: Full=2-...    306   1e-98    Toxoplasma gondii
emb|CEF96573.1|  Enolase, N-terminal                                    307   2e-98    Ostreococcus tauri
ref|XP_002788374.1|  enolase 2, putative                                297   3e-97    Perkinsus marinus ATCC 50983
ref|XP_002507278.1|  enolase                                            304   4e-97    Micromonas commoda
gb|AAL05454.1|AF348915_1  enolase                                       298   2e-96    Nitella opaca
ref|XP_011129750.1|  enolase                                            298   2e-95    Gregarina niphandrodes
ref|XP_002785646.1|  enolase 2, putative                                298   3e-95    Perkinsus marinus ATCC 50983
ref|XP_001014643.1|  enolase family protein                             298   4e-95    Tetrahymena thermophila SB210
ref|XP_002948092.1|  hypothetical protein VOLCADRAFT_79991              298   6e-95    Volvox carteri f. nagariensis
ref|XP_008903925.1|  enolase                                            297   9e-95    Phytophthora parasitica INRA-310
gb|AAR97546.1|  enolase 1                                               295   9e-95    Apodachlya brachynema
ref|XP_011131468.1|  enolase                                            296   1e-94    Gregarina niphandrodes
gb|ETO77406.1|  enolase                                                 296   1e-94    Phytophthora parasitica P1976
dbj|BAE07165.1|  enolase 3                                              296   1e-94    Karenia brevis
ref|XP_002772948.1|  enolase 2, putative                                296   2e-94    Perkinsus marinus ATCC 50983
dbj|BAE07171.1|  enolase 3                                              295   2e-94    Karenia mikimotoi
ref|XP_003056091.1|  predicted protein                                  296   2e-94    Micromonas pusilla CCMP1545
gb|KDO32432.1|  enolase                                                 296   2e-94    Saprolegnia parasitica CBS 223.65
ref|XP_002771109.1|  enolase 2, putative                                291   2e-94    Perkinsus marinus ATCC 50983
gb|AAR97553.1|  enolase                                                 294   5e-94    Prymnesium parvum
ref|XP_004337411.1|  Enolase, Cterminal TIM barrel domain contain...    294   6e-94    Acanthamoeba castellanii str. Neff
ref|XP_009829255.1|  enolase                                            295   7e-94    Aphanomyces astaci
ref|XP_001452406.1|  hypothetical protein                               294   7e-94    Paramecium tetraurelia strain d4-2
ref|XP_001423791.1|  hypothetical protein                               294   7e-94    Paramecium tetraurelia strain d4-2
emb|CAI39008.1|  enolase, putative                                      294   1e-93    Paramecium tetraurelia
ref|XP_007515230.1|  enolase                                            296   1e-93    Bathycoccus prasinos
ref|XP_002783667.1|  enolase 2, putative                                293   1e-93    Perkinsus marinus ATCC 50983
ref|XP_008604438.1|  enolase                                            293   1e-93    Saprolegnia diclina VS20
dbj|BAE07174.1|  polyprotein                                            302   2e-93    Heterocapsa triquetra
ref|XP_005644049.1|  enolase                                            293   7e-93    Coccomyxa subellipsoidea C-169
gb|AAL05453.1|AF348914_1  enolase                                       288   1e-92    Chara corallina
emb|CDW73138.1|  enolase                                                291   1e-92    Stylonychia lemnae
gb|EJY82089.1|  Enolase                                                 291   2e-92    Oxytricha trifallax
ref|XP_011436227.1|  PREDICTED: enolase-like isoform X1                 289   2e-92    
gb|EMT25998.1|  Enolase                                                 291   2e-92    
ref|XP_011436228.1|  PREDICTED: enolase-like isoform X2                 290   3e-92    Crassostrea gigas
ref|XP_008875680.1|  enolase 2                                          290   3e-92    Aphanomyces invadans
ref|XP_011727302.1|  PREDICTED: beta-enolase                            283   8e-92    Macaca nemestrina [pigtail macaque]
ref|XP_003074214.1|  enolase (ISS)                                      303   1e-91    
ref|XP_002962502.1|  hypothetical protein SELMODRAFT_78644              289   2e-91    
ref|XP_002962785.1|  hypothetical protein SELMODRAFT_165356             289   2e-91    Selaginella moellendorffii
ref|XP_001702971.1|  enolase                                            288   3e-91    Chlamydomonas reinhardtii
ref|XP_010744629.1|  PREDICTED: enolase-like isoform X1                 288   3e-91    
gb|EAW90376.1|  enolase 3 (beta, muscle), isoform CRA_b                 283   3e-91    Homo sapiens [man]
gb|ELU17402.1|  hypothetical protein CAPTEDRAFT_159854                  287   5e-91    Capitella teleta
ref|XP_010744631.1|  PREDICTED: enolase-like isoform X2                 286   5e-91    
ref|XP_002785647.1|  enolase 2, putative                                287   6e-91    Perkinsus marinus ATCC 50983
gb|AAL05455.1|AF348916_1  enolase                                       283   9e-91    Nitellopsis obtusa
gb|ABU99606.1|  enolase                                                 284   1e-90    Phytophthora clandestina
gb|ABU99625.1|  enolase                                                 284   1e-90    Phytophthora macrochlamydospora
gb|KFP49252.1|  Alpha-enolase                                           278   1e-90    Cathartes aura
gb|ABU99560.1|  enolase                                                 284   1e-90    Phytophthora nicotianae [buckeye rot agent]
ref|XP_004068557.1|  PREDICTED: alpha-enolase-like                      285   1e-90    Oryzias latipes [Japanese rice fish]
gb|ABU99699.1|  enolase                                                 284   1e-90    Phytophthora nicotianae [buckeye rot agent]
gb|ABU99575.1|  enolase                                                 284   1e-90    Phytophthora nicotianae [buckeye rot agent]
ref|XP_005807362.1|  PREDICTED: alpha-enolase-like                      285   1e-90    Xiphophorus maculatus
gb|ABU99620.1|  enolase                                                 284   1e-90    
sp|O02654.1|ENO_DORPE  RecName: Full=Enolase; AltName: Full=2-pho...    285   2e-90    
gb|ABU99708.1|  enolase                                                 284   2e-90    
gb|ABU99641.1|  enolase                                                 284   2e-90    
ref|XP_007935723.1|  PREDICTED: beta-enolase isoform X1                 285   2e-90    
gb|ABU99638.1|  enolase                                                 283   2e-90    
ref|XP_006060126.1|  PREDICTED: beta-enolase isoform X1                 285   2e-90    
ref|XP_008283661.1|  PREDICTED: enolase-like                            285   2e-90    
gb|ABU99661.1|  enolase                                                 283   2e-90    
gb|ABU99634.1|  enolase                                                 283   2e-90    
gb|ABU99680.1|  enolase                                                 283   2e-90    
gb|AAR97552.1|  enolase                                                 284   2e-90    
gb|ABU99660.1|  enolase                                                 283   2e-90    
ref|XP_007625118.1|  PREDICTED: beta-enolase isoform X2                 286   2e-90    
gb|KJP86244.1|  enolase                                                 285   3e-90    
ref|XP_011404007.1|  PREDICTED: enolase-like                            285   3e-90    
ref|XP_005295339.1|  PREDICTED: beta-enolase                            281   3e-90    
ref|XP_005399679.1|  PREDICTED: beta-enolase isoform X1                 285   3e-90    
ref|XP_006060127.1|  PREDICTED: beta-enolase isoform X2                 285   3e-90    
ref|XP_005724754.1|  PREDICTED: alpha-enolase-like isoform X1           285   3e-90    
ref|XP_004548581.1|  PREDICTED: alpha-enolase-like isoform X1           285   3e-90    
ref|XP_009015226.1|  hypothetical protein HELRODRAFT_184900             285   3e-90    
ref|XP_001611923.1|  enolase  (2-phosphoglycerate dehydratase)          285   4e-90    
pdb|2XSX|A  Chain A, Crystal Structure Of Human Beta Enolase Enob       284   4e-90    
dbj|GAA51601.1|  enolase                                                284   4e-90    
gb|ABU99608.1|  enolase                                                 283   4e-90    
gb|ETW56576.1|  enolase                                                 285   5e-90    
ref|XP_001347440.1|  enolase                                            284   5e-90    
ref|XP_004604990.1|  PREDICTED: beta-enolase isoform X1                 284   5e-90    
sp|Q9UAL5.1|ENO_PLAFG  RecName: Full=Enolase; AltName: Full=2-pho...    284   5e-90    
ref|XP_008408796.1|  PREDICTED: alpha-enolase-like                      284   6e-90    
gb|ABU99643.1|  enolase                                                 282   6e-90    
ref|XP_009174927.1|  hypothetical protein T265_10327                    284   6e-90    
gb|AAH17249.1|  Enolase 3 (beta, muscle)                                284   7e-90    
ref|XP_003512064.2|  PREDICTED: alpha-enolase isoform X2                283   7e-90    
ref|XP_003883999.1|  unnamed protein product                            284   7e-90    
gb|ACQ58328.1|  Alpha-enolase                                           283   7e-90    
ref|XP_002258802.1|  enolase (2-phosphoglycerate dehydratase)           284   8e-90    
gb|ABI26619.1|  enolase                                                 283   9e-90    
ref|XP_005337413.1|  PREDICTED: beta-enolase isoform X1                 283   1e-89    
sp|Q27727.1|ENO_PLAFA  RecName: Full=Enolase; AltName: Full=2-pho...    283   1e-89    
gb|EGW01873.1|  Alpha-enolase                                           283   1e-89    
ref|XP_007631689.1|  PREDICTED: alpha-enolase isoform X3                283   1e-89    
ref|XP_003416918.2|  PREDICTED: beta-enolase isoform X1                 283   1e-89    
ref|XP_003454629.1|  PREDICTED: alpha-enolase-like isoform X1           283   1e-89    
ref|XP_006863373.1|  PREDICTED: beta-enolase isoform X1                 283   1e-89    
ref|XP_010604102.1|  PREDICTED: beta-enolase isoform X1                 283   1e-89    
ref|XP_007551882.1|  PREDICTED: alpha-enolase-like                      283   1e-89    
ref|XP_004594912.1|  PREDICTED: beta-enolase isoform X1                 283   2e-89    
emb|CAG32389.1|  hypothetical protein RCJMB04_24e12                     275   2e-89    
gb|ABU99648.1|  enolase                                                 279   2e-89    
ref|XP_004760508.1|  PREDICTED: beta-enolase isoform X1                 283   2e-89    
ref|XP_007432114.1|  PREDICTED: alpha-enolase                           280   2e-89    
ref|NP_037081.2|  beta-enolase                                          283   2e-89    
ref|XP_005256578.1|  PREDICTED: beta-enolase isoform X2                 283   2e-89    
ref|XP_005882629.1|  PREDICTED: beta-enolase isoform X3                 283   2e-89    
ref|XP_008154941.1|  PREDICTED: beta-enolase isoform X2                 283   2e-89    
ref|XP_006994179.1|  PREDICTED: beta-enolase                            283   2e-89    
ref|XP_004684783.1|  PREDICTED: beta-enolase isoform X1                 283   2e-89    
ref|XP_008154940.1|  PREDICTED: beta-enolase isoform X1                 283   2e-89    
gb|ABU99619.1|  enolase                                                 281   2e-89    
ref|XP_006783364.1|  PREDICTED: alpha-enolase-like isoform X1           283   2e-89    
ref|XP_005597080.1|  PREDICTED: beta-enolase isoform X1                 283   2e-89    
ref|XP_005067533.1|  PREDICTED: beta-enolase isoform X1                 283   2e-89    
ref|XP_006771957.1|  PREDICTED: beta-enolase isoform X3                 283   2e-89    
gb|EDL81185.1|  rCG31027, isoform CRA_b                                 276   2e-89    
ref|XP_004604991.1|  PREDICTED: beta-enolase isoform X2                 282   2e-89    
ref|XP_006863374.1|  PREDICTED: beta-enolase isoform X2                 282   2e-89    
ref|XP_008686158.1|  PREDICTED: beta-enolase                            282   2e-89    
ref|XP_006151928.1|  PREDICTED: beta-enolase isoform X1                 282   2e-89    
ref|XP_004376150.1|  PREDICTED: beta-enolase isoform 1                  283   2e-89    
ref|XP_009058096.1|  hypothetical protein LOTGIDRAFT_182683             282   2e-89    
ref|XP_004433267.1|  PREDICTED: beta-enolase isoform 1                  282   2e-89    
ref|NP_001254531.1|  beta-enolase                                       282   2e-89    
gb|ABU99673.1|  enolase                                                 280   2e-89    
ref|XP_005693511.1|  PREDICTED: beta-enolase isoform X1                 283   2e-89    
emb|CBJ32586.1|  enolase                                                283   2e-89    
ref|XP_004376151.1|  PREDICTED: beta-enolase isoform 2                  282   2e-89    
ref|XP_011235326.1|  PREDICTED: beta-enolase isoform X2                 282   2e-89    
ref|XP_004760509.1|  PREDICTED: beta-enolase isoform X2                 282   2e-89    
ref|XP_010604103.1|  PREDICTED: beta-enolase isoform X2                 282   2e-89    
ref|XP_004398638.1|  PREDICTED: beta-enolase isoform 1                  282   2e-89    
ref|XP_006737947.1|  PREDICTED: gamma-enolase-like                      275   2e-89    
ref|XP_004716191.1|  PREDICTED: beta-enolase isoform X1                 282   3e-89    
ref|XP_005220294.1|  PREDICTED: beta-enolase isoform X1                 282   3e-89    
gb|ABU99578.1|  enolase                                                 281   3e-89    
gb|ABU99651.1|  enolase                                                 280   3e-89    
gb|ABU99571.1|  enolase                                                 281   3e-89    
emb|CEG76656.1|  Putative Enolase                                       276   3e-89    
ref|XP_008568320.1|  PREDICTED: beta-enolase                            282   3e-89    
ref|XP_003791260.1|  PREDICTED: beta-enolase isoform 1                  282   3e-89    
ref|XP_004447281.1|  PREDICTED: beta-enolase isoform 3                  283   3e-89    
ref|XP_005693512.1|  PREDICTED: beta-enolase isoform X2                 282   3e-89    
ref|XP_011358026.1|  PREDICTED: beta-enolase isoform X1                 282   3e-89    
ref|XP_004638386.1|  PREDICTED: beta-enolase isoform X1                 282   3e-89    
ref|XP_003466342.1|  PREDICTED: beta-enolase isoform 1                  282   3e-89    
ref|NP_001029874.1|  beta-enolase                                       282   3e-89    
gb|ACN10247.1|  Alpha-enolase                                           282   3e-89    
dbj|BAN65021.1|  enolase (2-phosphoglycerate dehydratase)               279   3e-89    
gb|ABU99676.1|  enolase                                                 281   3e-89    
gb|ABU99689.1|  enolase                                                 281   3e-89    
ref|XP_008854145.1|  PREDICTED: beta-enolase                            282   3e-89    
ref|XP_953341.1|  enolase                                               282   3e-89    
ref|NP_001967.3|  beta-enolase isoform 1                                282   3e-89    
ref|XP_004058398.1|  PREDICTED: beta-enolase isoform 1                  282   3e-89    
ref|XP_006922310.1|  PREDICTED: beta-enolase                            282   3e-89    
ref|XP_004716192.1|  PREDICTED: beta-enolase isoform X2                 282   3e-89    
ref|XP_005619976.1|  PREDICTED: beta-enolase isoform X2                 282   3e-89    
ref|NP_001075554.1|  beta-enolase                                       282   3e-89    
gb|ABU99569.1|  enolase                                                 281   3e-89    
ref|XP_005337414.1|  PREDICTED: beta-enolase isoform X2                 282   3e-89    
gb|ABU99732.1|  enolase                                                 280   4e-89    
ref|XP_010594837.1|  PREDICTED: beta-enolase isoform X2                 282   4e-89    
gb|ABU99729.1|  enolase                                                 280   4e-89    
gb|ABU99597.1|  enolase                                                 280   4e-89    
emb|CAA36216.1|  muscle-specific enolase                                282   4e-89    
ref|XP_004222043.1|  enolase                                            282   4e-89    
ref|XP_011358029.1|  PREDICTED: beta-enolase isoform X2                 282   4e-89    
ref|XP_003996194.1|  PREDICTED: beta-enolase                            282   4e-89    
ref|XP_004684784.1|  PREDICTED: beta-enolase isoform X2                 281   4e-89    
gb|ABU99572.1|  enolase                                                 280   4e-89    
ref|XP_003963162.1|  PREDICTED: alpha-enolase                           281   4e-89    
ref|XP_011235325.1|  PREDICTED: beta-enolase isoform X1                 283   4e-89    
ref|XP_004666960.1|  PREDICTED: beta-enolase isoform X1                 281   4e-89    
ref|XP_006771956.1|  PREDICTED: beta-enolase isoform X2                 283   4e-89    
ref|XP_005882628.1|  PREDICTED: beta-enolase isoform X2                 283   4e-89    
gb|ABU99730.1|  enolase                                                 280   4e-89    
gb|ABU99656.1|  enolase                                                 280   4e-89    
ref|XP_004660313.1|  PREDICTED: beta-enolase-like isoform X1            281   4e-89    
ref|XP_007521410.1|  PREDICTED: beta-enolase isoform X1                 281   4e-89    
ref|XP_006903348.1|  PREDICTED: beta-enolase isoform X1                 283   4e-89    
gb|ABU99632.1|  enolase                                                 280   5e-89    
ref|XP_010739239.1|  PREDICTED: alpha-enolase isoform X1                281   5e-89    
gb|ABU99604.1|  enolase                                                 280   5e-89    
gb|ABU99639.1|  enolase                                                 280   5e-89    
ref|XP_004901365.1|  PREDICTED: beta-enolase isoform X5                 281   5e-89    
ref|XP_007483315.1|  PREDICTED: beta-enolase isoform X2                 282   5e-89    
ref|XP_008123931.1|  PREDICTED: beta-enolase                            281   5e-89    
ref|NP_001037992.1|  beta-enolase                                       281   5e-89    
gb|ABU99731.1|  enolase                                                 280   5e-89    
gb|ABU99645.1|  enolase                                                 280   5e-89    
ref|XP_005669210.1|  PREDICTED: beta-enolase isoform X1                 281   5e-89    
ref|XP_011850096.1|  PREDICTED: beta-enolase isoform X1                 281   5e-89    
gb|ABU99709.1|  enolase                                                 280   6e-89    
ref|XP_002736959.2|  PREDICTED: alpha-enolase-like                      278   6e-89    
ref|XP_008064118.1|  PREDICTED: beta-enolase isoform X1                 281   6e-89    
ref|XP_003973285.1|  PREDICTED: alpha-enolase-like                      281   6e-89    
gb|ABU99614.1|  enolase                                                 280   6e-89    
ref|XP_005669211.1|  PREDICTED: beta-enolase isoform X2                 281   6e-89    
gb|EDL12600.1|  enolase 3, beta muscle, isoform CRA_a                   281   6e-89    
gb|ADU85973.1|  enolase                                                 281   6e-89    
gb|ABU99650.1|  enolase                                                 280   6e-89    
gb|ABU99617.1|  enolase                                                 280   6e-89    
gb|ABU99557.1|  enolase                                                 280   6e-89    
ref|XP_536606.3|  PREDICTED: beta-enolase isoformX1                     283   6e-89    
gb|ABU99600.1|  enolase                                                 280   6e-89    
ref|XP_001632906.1|  predicted protein                                  281   6e-89    
ref|XP_006262962.1|  PREDICTED: beta-enolase                            281   7e-89    
ref|XP_008317958.1|  PREDICTED: alpha-enolase-like                      281   7e-89    
gb|ABU99613.1|  enolase                                                 280   7e-89    
gb|ABU99707.1|  enolase                                                 280   7e-89    
gb|EDM01935.1|  enolase 2, gamma, isoform CRA_b                         277   7e-89    
gb|ABU99579.1|  enolase                                                 280   7e-89    
gb|ABU99704.1|  enolase                                                 280   7e-89    
gb|ABU99679.1|  enolase                                                 280   7e-89    
ref|NP_001187631.1|  enolase                                            281   8e-89    
gb|ABU99647.1|  enolase                                                 280   8e-89    
ref|NP_031959.1|  beta-enolase                                          281   8e-89    
ref|XP_004804268.1|  PREDICTED: beta-enolase isoform X1                 282   8e-89    
gb|ABU99723.1|  enolase                                                 280   8e-89    
ref|XP_003931416.1|  PREDICTED: beta-enolase isoform X1                 281   8e-89    
gb|ABU99694.1|  enolase                                                 280   8e-89    
gb|ABU99615.1|  enolase                                                 280   8e-89    
ref|XP_001366144.2|  PREDICTED: beta-enolase isoform X1                 282   8e-89    
gb|ABU99583.1|  enolase                                                 279   8e-89    
ref|XP_011850097.1|  PREDICTED: beta-enolase isoform X2                 281   9e-89    
ref|XP_004857366.1|  PREDICTED: beta-enolase isoform X2                 281   9e-89    
gb|ABU99659.1|  enolase                                                 280   9e-89    
gb|ABU99681.1|  enolase                                                 280   9e-89    
gb|ABU99664.1|  enolase                                                 280   9e-89    
ref|XP_009692141.1|  enolase                                            281   9e-89    
gb|ABU99624.1|  enolase                                                 279   9e-89    
ref|XP_003778767.1|  PREDICTED: beta-enolase                            281   9e-89    
ref|XP_007625117.1|  PREDICTED: beta-enolase isoform X1                 282   9e-89    
gb|ABU99682.1|  enolase                                                 279   9e-89    
gb|ABU99654.1|  enolase                                                 280   9e-89    
gb|ABU99568.1|  enolase                                                 280   9e-89    
gb|ABU99678.1|  enolase                                                 280   9e-89    
gb|ABU99628.1|  enolase                                                 279   9e-89    
gb|ABU99713.1|  enolase                                                 279   1e-88    
gb|ABU99567.1|  enolase                                                 280   1e-88    
gb|ABU99611.1|  enolase                                                 279   1e-88    
gb|ABU99710.1|  enolase                                                 279   1e-88    
ref|XP_005582674.1|  PREDICTED: beta-enolase isoform X1                 281   1e-88    
gb|ABU99564.1|  enolase                                                 279   1e-88    
ref|XP_008008172.1|  PREDICTED: beta-enolase isoform X1                 281   1e-88    
ref|XP_003791262.1|  PREDICTED: beta-enolase isoform 3                  282   1e-88    
gb|ABU99703.1|  enolase                                                 279   1e-88    
gb|ABU99702.1|  enolase                                                 279   1e-88    
gb|ABU99550.1|  enolase                                                 279   1e-88    
gb|ABU99695.1|  enolase                                                 279   1e-88    
gb|ABU99555.1|  enolase                                                 279   1e-88    
gb|ABU99558.1|  enolase                                                 279   1e-88    
gb|ABU99603.1|  enolase                                                 279   1e-88    
gb|ABU99674.1|  enolase                                                 279   1e-88    
ref|XP_011475654.1|  PREDICTED: alpha-enolase                           280   1e-88    
gb|ABU99561.1|  enolase                                                 279   1e-88    
ref|XP_006743197.1|  PREDICTED: beta-enolase isoform X1                 280   1e-88    
emb|CDI97979.1|  enolase                                                280   1e-88    
gb|ABU99690.1|  enolase                                                 279   1e-88    
ref|XP_004447280.1|  PREDICTED: beta-enolase isoform 2                  281   1e-88    
ref|XP_006029663.1|  PREDICTED: LOW QUALITY PROTEIN: beta-enolase       280   1e-88    
gb|ABU99652.1|  enolase                                                 279   1e-88    
gb|ABU99612.1|  enolase                                                 279   1e-88    
gb|ABU99675.1|  enolase                                                 279   1e-88    
gb|ABU99553.1|  enolase                                                 279   1e-88    
ref|XP_764336.1|  enolase                                               281   1e-88    
gb|ABU99636.1|  enolase                                                 279   1e-88    
ref|XP_004692962.1|  PREDICTED: gamma-enolase isoform X1                280   1e-88    
gb|ABU99565.1|  enolase                                                 279   1e-88    
gb|ABU99691.1|  enolase                                                 279   1e-88    



>ref|XP_006338945.1| PREDICTED: enolase-like [Solanum tuberosum]
Length=444

 Score =   417 bits (1071),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 200/211 (95%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKSVKARQIFDSRGNPTVEVDV+LSN  W RAAVPSGASTGIYEALE+RDGGS+YLG
Sbjct  1    MATIKSVKARQIFDSRGNPTVEVDVHLSNGVWERAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPTDQTG+DN MV QLDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTDQTGLDNYMVHQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVKNIPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  211



>ref|XP_009623017.1| PREDICTED: enolase [Nicotiana tomentosiformis]
Length=444

 Score =   415 bits (1067),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/211 (95%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKS+KARQIFDSRGNPTVEVDV+LSN  WARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKSLKARQIFDSRGNPTVEVDVHLSNGVWARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSII P+LVGKDPTDQTGIDN MV QLDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIAPSLVGKDPTDQTGIDNFMVHQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVKNIPLY+HIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKNIPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  211



>ref|XP_011094426.1| PREDICTED: enolase [Sesamum indicum]
Length=444

 Score =   415 bits (1066),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 202/211 (96%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKSVKARQIFDSRGNPTVEVDV+LSN  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKSVKARQIFDSRGNPTVEVDVHLSNGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPTDQTGIDN MVQQLDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV NIPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_004249573.1| PREDICTED: enolase-like [Solanum lycopersicum]
Length=444

 Score =   413 bits (1062),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/211 (94%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKS+KARQIFDSRGNPTVEVDV LSN  W RAAVPSGASTGIYEALE+RDGGS+YLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVYLSNGLWERAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPTDQTG+DN MV QLDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTDQTGLDNYMVHQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  211



>emb|CDP15353.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   410 bits (1053),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI SVKARQIFDSRGNPTVEVDV++SN  WARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIVSVKARQIFDSRGNPTVEVDVHVSNGVWARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPTDQTGIDN MVQQLDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVKN+PLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKNLPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|NP_001234080.1| enolase [Solanum lycopersicum]
 sp|P26300.1|ENO_SOLLC RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Solanum 
lycopersicum]
 emb|CAA41115.1| enolase [Solanum lycopersicum]
Length=444

 Score =   409 bits (1051),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 207/211 (98%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKS+KARQIFDSRGNPTVEVDV++SN  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVHISNGVFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPTDQTG+DN MV QLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTDQTGLDNFMVHQLDGTQNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV+N+PLY+HIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVRNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            ++FKEAMKMGCEVYHHLKAVIKKKYGQDATN
Sbjct  181  ANFKEAMKMGCEVYHHLKAVIKKKYGQDATN  211



>ref|XP_011101486.1| PREDICTED: enolase-like [Sesamum indicum]
Length=444

 Score =   409 bits (1051),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 198/211 (94%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKSVKARQIFDSRGNPTVEVDV+L+N  WARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKSVKARQIFDSRGNPTVEVDVHLTNGIWARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPALVGK+PTDQTGIDN MVQQLDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNTIIGPALVGKNPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA+ NIPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAALLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>gb|EYU35120.1| hypothetical protein MIMGU_mgv1a006438mg [Erythranthe guttata]
Length=444

 Score =   409 bits (1050),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 205/211 (97%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKSVKARQIFDSRGNPTVEVD++LSN  WARAAVPSGASTG+YEALE+RDGGS+YLG
Sbjct  1    MATIKSVKARQIFDSRGNPTVEVDIHLSNGLWARAAVPSGASTGVYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPTDQTGIDN MVQQLDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGAAV +IPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LALCKAGAAVLDIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_006341172.1| PREDICTED: enolase-like [Solanum tuberosum]
Length=444

 Score =   406 bits (1043),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 207/211 (98%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKS+KARQIFDSRGNPTVEVDV++SN  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVHVSNGVFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPTDQTG+DN MV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTDQTGLDNFMVHELDGTQNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV+N+PLY+HIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVRNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            ++FKEAMKMGCEVYHHLK+VIKKKYGQDATN
Sbjct  181  ANFKEAMKMGCEVYHHLKSVIKKKYGQDATN  211



>gb|ACR56690.1| enolase [Nicotiana tabacum]
Length=444

 Score =   404 bits (1038),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 203/211 (96%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKS+KARQIFDSRGNPTVEVDV LSN  +ARAAVPSGASTGIYEALE+RDGGS+YLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVTLSNGVFARAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKD TDQTG+DN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDATDQTGLDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA +N+PLY+HIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAAARNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  211



>ref|NP_001275058.1| enolase-like [Solanum tuberosum]
 gb|ABB87127.1| enolase-like [Solanum tuberosum]
Length=443

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 207/211 (98%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKS+KARQIFDSRGNPTVEVDV++SN  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVHVSNGVFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPTDQTG+DN MV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTDQTGLDNFMVHELDGTQNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV+N+PLY+HIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVRNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            ++FKEAMKMGCEVYHHLK+VIKKKYGQDATN
Sbjct  181  ANFKEAMKMGCEVYHHLKSVIKKKYGQDATN  211



>ref|XP_009764205.1| PREDICTED: enolase-like [Nicotiana sylvestris]
Length=444

 Score =   402 bits (1033),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEVDV LSN  +ARAAVPSGASTGIYEALE+RDGGS+YLG
Sbjct  1    MATIKIVKARQIFDSRGNPTVEVDVTLSNGVFARAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKD TDQTG+DN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDATDQTGLDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA +N+PLY+HIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAAARNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  211



>ref|XP_009612088.1| PREDICTED: enolase-like [Nicotiana tomentosiformis]
Length=444

 Score =   402 bits (1033),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 202/211 (96%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEVDV LSN  +ARAAVPSGASTGIYEALE+RDGGS+YLG
Sbjct  1    MATIKIVKARQIFDSRGNPTVEVDVTLSNGVFARAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKD TDQTG+DN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDATDQTGLDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA +N+PLY+HIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAAARNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  211



>ref|XP_012090397.1| PREDICTED: enolase [Jatropha curcas]
 gb|KDP22386.1| hypothetical protein JCGZ_26217 [Jatropha curcas]
Length=445

 Score =   397 bits (1021),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKVVKARQIFDSRGNPTVEVDVKLSDGTVARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VKNIPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGATVKNIPLYQHIANLAGNKSLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>gb|KJB16686.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=386

 Score =   392 bits (1006),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>gb|KJB16680.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=419

 Score =   392 bits (1008),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>ref|XP_012090393.1| PREDICTED: enolase-like [Jatropha curcas]
 gb|KDP22388.1| hypothetical protein JCGZ_26219 [Jatropha curcas]
Length=445

 Score =   393 bits (1010),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEVDV L++   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKVVKARQIFDSRGNPTVEVDVKLTDGKVARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT +DN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTQLDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVKEIPLYQHIANLAGNKSLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_011657684.1| PREDICTED: enolase isoform X2 [Cucumis sativus]
Length=398

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVD+ LS+   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDIVLSDGSLARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPALVGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVENVNAIIGPALVGKDPTEQAQIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGA+VK IPLYQHIANLAGN +LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LALCKAGASVKKIPLYQHIANLAGNSQLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|AAQ18140.1| enolase [Gossypium barbadense]
Length=445

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>gb|ABR16178.1| unknown [Picea sitchensis]
Length=380

 Score =   390 bits (1003),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK+VKAR IFDSRGNPTVEVD++LS+ + +RAAVPSGASTG+YEALE+RDGG DY+G
Sbjct  1    MATIKAVKARSIFDSRGNPTVEVDIHLSDGYLSRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDP DQTGIDN MVQ+LDGTQN+WGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVENVNKIIGPALIGKDPVDQTGIDNFMVQELDGTQNQWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIAN+AGNK LV+PVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKIPLYQHIANIAGNKTLVIPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF+EAM+MG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFREAMQMGSEVYHHLKAVIKKKYGQDATN  211



>ref|XP_009374527.1| PREDICTED: enolase [Pyrus x bretschneideri]
Length=445

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKLVKARQIFDSRGNPTVEVDVTLSDGTYARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>gb|ACN26258.1| unknown [Zea mays]
 tpg|DAA46777.1| TPA: putative enolase family protein isoform 1 [Zea mays]
 tpg|DAA46778.1| TPA: putative enolase family protein isoform 2 [Zea mays]
Length=446

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVFCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAVNNVNS+IGPAL+GKDPT QT IDN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVNNVNSVIGPALIGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA++K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASIKRIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>ref|XP_008241309.1| PREDICTED: enolase [Prunus mume]
Length=444

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI++VKARQIFDSRGNPTVEVD+ LS+   ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIQTVKARQIFDSRGNPTVEVDIVLSDGTLARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVAKAGASVKKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>gb|ACG31732.1| enolase [Zea mays]
Length=446

 Score =   392 bits (1007),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVFCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAVNNVNS+IGPAL+GKDPT QT IDN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVNNVNSVIGPALIGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA++K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASIKRIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>ref|XP_007202055.1| hypothetical protein PRUPE_ppa005779mg [Prunus persica]
 gb|EMJ03254.1| hypothetical protein PRUPE_ppa005779mg [Prunus persica]
Length=444

 Score =   392 bits (1007),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI++VKARQIFDSRGNPTVEVD+ LS+   ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIQTVKARQIFDSRGNPTVEVDIVLSDGTLARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVAKAGASVKKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_004962569.1| PREDICTED: enolase 2-like isoform X2 [Setaria italica]
Length=445

 Score =   392 bits (1007),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPT QT IDN MVQQLDGT+NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA++K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGASIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  ASFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>gb|KJB16682.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=429

 Score =   391 bits (1005),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>gb|KJB16684.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=444

 Score =   392 bits (1007),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>ref|XP_004143301.1| PREDICTED: enolase isoform X1 [Cucumis sativus]
 gb|KGN48232.1| hypothetical protein Csa_6G450370 [Cucumis sativus]
Length=444

 Score =   392 bits (1007),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVD+ LS+   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDIVLSDGSLARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPALVGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVENVNAIIGPALVGKDPTEQAQIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGA+VK IPLYQHIANLAGN +LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LALCKAGASVKKIPLYQHIANLAGNSQLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|KHG13187.1| Enolase 1 [Gossypium arboreum]
 gb|KJB16678.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=445

 Score =   392 bits (1006),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>gb|KJB16679.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=442

 Score =   392 bits (1006),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>ref|XP_002510911.1| enolase, putative [Ricinus communis]
 gb|EEF51513.1| enolase, putative [Ricinus communis]
Length=445

 Score =   391 bits (1005),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 191/211 (91%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIK VKARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MTTIKVVKARQIFDSRGNPTVEVDVILSDGTLARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT IDN MVQ+LDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTQIDNFMVQELDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_007027607.1| Enolase [Theobroma cacao]
 gb|EOY08109.1| Enolase [Theobroma cacao]
Length=445

 Score =   391 bits (1005),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI S+KARQIFDSRGNPTVEVDV  SN    RAAVPSGASTG+YEALE+RDGG DYLGKG
Sbjct  4    TIVSIKARQIFDSRGNPTVEVDVETSNGKKVRAAVPSGASTGVYEALELRDGGLDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VKNIPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP+GASS
Sbjct  124  VCKAGAEVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKAVIKKKYGQDATN  212



>gb|KJB36425.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
Length=386

 Score =   389 bits (999),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI S+KARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSIKARQIFDSRGNPTVEVDVETSNGKKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTQQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA V NIPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGAEVLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>ref|XP_010094249.1| hypothetical protein L484_001983 [Morus notabilis]
 gb|EXB55478.1| hypothetical protein L484_001983 [Morus notabilis]
Length=419

 Score =   390 bits (1002),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEVDV LS+  ++RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKLVKARQIFDSRGNPTVEVDVVLSDGSFSRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVGNVNTIIGPALVGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGAAV  IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAICKAGAAVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>gb|EMS66544.1| Enolase 1 [Triticum urartu]
Length=449

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  75   SMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYL  254
            +  TI+SVKARQIFDSRGNPTVEVD+ LS+  +AR AVPSGASTGIYEALE+RDGGSDYL
Sbjct  4    ATTTIQSVKARQIFDSRGNPTVEVDIGLSDGSFARGAVPSGASTGIYEALELRDGGSDYL  63

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV KAVNNVN+IIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAV
Sbjct  64   GKGVLKAVNNVNAIIGPALIGKDPTEQTDIDNFMVQQLDGTSNEWGWCKQKLGANAILAV  123

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            SLAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP G
Sbjct  124  SLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTG  183

Query  615  ASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            ASSFKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  184  ASSFKEAMKMGVEVYHHLKSIIKKKYGQDATN  215



>gb|KJB07831.1| hypothetical protein B456_001G046400 [Gossypium raimondii]
Length=445

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK +KARQIFDSRGNPTVEVDV+LS+   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDVSLSDGAVARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPTEQAKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA +K IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMLKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_004962568.1| PREDICTED: enolase 2-like isoform X1 [Setaria italica]
Length=476

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPT QT IDN MVQQLDGT+NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA++K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGASIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  ASFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>gb|ABR17990.1| unknown [Picea sitchensis]
Length=445

 Score =   390 bits (1001),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK+VKAR IFDSRGNPTVEVD++LS+ + +RAAVPSGASTG+YEALE+RDGG DY+G
Sbjct  1    MATIKAVKARSIFDSRGNPTVEVDIHLSDGYLSRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDP DQTGIDN MVQ+LDGTQN+WGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNKIIGPALIGKDPVDQTGIDNFMVQELDGTQNQWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIAN+AGNK LV+PVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKIPLYQHIANIAGNKTLVMPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF+EAM+MG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFREAMQMGSEVYHHLKAVIKKKYGQDATN  211



>gb|KJB36423.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
Length=439

 Score =   390 bits (1001),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI S+KARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSIKARQIFDSRGNPTVEVDVETSNGKKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTQQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA V NIPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGAEVLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>gb|KHF99213.1| Enolase 2 [Gossypium arboreum]
Length=446

 Score =   390 bits (1001),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI S+KARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIVSIKARQIFDSRGNPTVEVDVETSNGRKARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTQQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA V NIPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGAEVLNIPLYRHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>ref|XP_008462531.1| PREDICTED: enolase [Cucumis melo]
Length=444

 Score =   390 bits (1001),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVD+ LS+   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDIVLSDGTLARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPALVGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVENVNAIIGPALVGKDPTEQAQIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYQHIANLAGN +LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNSQLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>gb|ABR16337.1| unknown [Picea sitchensis]
Length=445

 Score =   390 bits (1001),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK+VKAR IFDSRGNPTVEVD++LS+ + +RAAVPSGASTG+YEALE+RDGG DY+G
Sbjct  1    MATIKAVKARSIFDSRGNPTVEVDIHLSDGYLSRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDP DQTGIDN MVQ+LDGTQN+WGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNKIIGPALIGKDPVDQTGIDNFMVQELDGTQNQWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIAN+AGNK LV+PVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKIPLYQHIANIAGNKTLVMPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF+EAM+MG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFREAMQMGSEVYHHLKAVIKKKYGQDATN  211



>gb|KJB36420.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
 gb|KJB36421.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
 gb|KJB36424.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
Length=446

 Score =   390 bits (1001),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI S+KARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSIKARQIFDSRGNPTVEVDVETSNGKKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTQQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA V NIPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGAEVLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>gb|AEW69686.1| enolase1 [Guzmania wittmackii x Guzmania lingulata]
Length=445

 Score =   390 bits (1001),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK ++ARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKCIQARQIFDSRGNPTVEVDVCLSDGAKARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVGNVNTIIGPALIGKDPTEQTQIDNFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIANLAGNK +VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKNIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>gb|ACN39925.1| unknown [Picea sitchensis]
Length=445

 Score =   389 bits (1000),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK+VKAR IFDSRGNPTVEVD++LS+ + +RAAVPSGASTG+YEALE+RDGG DY+G
Sbjct  1    MATIKAVKARSIFDSRGNPTVEVDIHLSDGYLSRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDP DQTGIDN MVQ+LDGTQN+WGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNKIIGPALIGKDPVDQTGIDNFMVQELDGTQNQWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIAN+AGNK LV+PVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKIPLYQHIANIAGNKTLVMPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF+EAM+MG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFREAMQMGSEVYHHLKAVIKKKYGQDATN  211



>sp|Q9LEJ0.1|ENO1_HEVBR RecName: Full=Enolase 1; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 1; AltName: Full=2-phosphoglycerate dehydratase 
1; AltName: Allergen=Hev b 9 [Hevea brasiliensis]
 emb|CAC00532.1| enolase, isoform 1 [Hevea brasiliensis]
Length=445

 Score =   389 bits (1000),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SV+ARQIFDSRGNPTVE DV LS+ + ARAAVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV NVN IIGPALVGKDPTDQ GIDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAHVKGIPLYEHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  184  FKEAMKMGAEVYHHLKSVIKKKYGQDATN  212



>gb|KJB07830.1| hypothetical protein B456_001G046400 [Gossypium raimondii]
Length=466

 Score =   390 bits (1002),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK +KARQIFDSRGNPTVEVDV+LS+   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDVSLSDGAVARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPTEQAKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA +K IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMLKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_003534043.1| PREDICTED: enolase [Glycine max]
 gb|KHN27853.1| Enolase [Glycine soja]
Length=445

 Score =   389 bits (999),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK+VKARQIFDSRGNPTVEVDV LS+  + RAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIKAVKARQIFDSRGNPTVEVDVILSDGSFHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSII PAL+GKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLY+HIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_003548246.1| PREDICTED: enolase-like [Glycine max]
Length=445

 Score =   389 bits (999),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK+VKARQIFDSRGNPTVEVDV LS+  + RAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIKAVKARQIFDSRGNPTVEVDVILSDGTFHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSII PAL+GKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLY+HIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|NP_001105371.1| enolase 2 [Zea mays]
 sp|P42895.1|ENO2_MAIZE RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 2; AltName: Full=2-phosphoglycerate dehydratase 
2 [Zea mays]
 gb|AAD04187.1| enolase [Zea mays]
 gb|AAQ17040.2| pollen 2-phosphoglycerate dehydrogenase 2 precursor [Cynodon 
dactylon]
Length=446

 Score =   389 bits (998),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGS YLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVFCSDGTFARAAVPSGASTGVYEALELRDGGSYYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAVNNVNS+IGPAL+GKDPT QT IDN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVNNVNSVIGPALIGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA++K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASIKRIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>ref|XP_007152407.1| hypothetical protein PHAVU_004G127500g [Phaseolus vulgaris]
 gb|ESW24401.1| hypothetical protein PHAVU_004G127500g [Phaseolus vulgaris]
Length=445

 Score =   389 bits (998),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEVDV LS+  ++RAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIKVVKARQIFDSRGNPTVEVDVTLSDGTFSRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV+KAV NVN+II PAL+GKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVNKAVENVNTIIAPALIGKDPTKQTEIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA K IPLY+HIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAAKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|ACN50180.1| enolase [Annona cherimola]
Length=445

 Score =   388 bits (997),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIKS+KARQIFDSRGNPTVEVD  L++  +ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDCTLNDGSFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+II PALVGKDPTDQ GIDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVGNVNTIIAPALVGKDPTDQAGIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYH+LKAVIKKKYGQDATN
Sbjct  181  ASFKEAMKMGVEVYHNLKAVIKKKYGQDATN  211



>ref|XP_010096850.1| hypothetical protein L484_003561 [Morus notabilis]
 gb|EXB66234.1| hypothetical protein L484_003561 [Morus notabilis]
Length=444

 Score =   388 bits (997),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV LSN    RAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIQIVKARQIFDSRGNPTVEVDVGLSNGTKHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVENVNTIIGPALIGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V NIPLY+HIANL+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVNNIPLYKHIANLSGNKSLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            S+FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  STFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>sp|P42896.1|ENO_RICCO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Ricinus 
communis]
 emb|CAA82232.1| enolase [Ricinus communis]
Length=445

 Score =   388 bits (997),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SV+ARQIFDSRGNPTVE D+ LS+ H ARAAVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TIVSVRARQIFDSRGNPTVEADIKLSDGHLARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV NVNSIIGPAL+GKDPT+QT +DN MVQ+LDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVENVNSIIGPALIGKDPTEQTALDNFMVQELDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            +CKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  LCKAGAHVKGIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  184  FKEAMKMGAEVYHHLKSVIKKKYGQDATN  212



>ref|XP_004308163.1| PREDICTED: enolase [Fragaria vesca subsp. vesca]
Length=446

 Score =   388 bits (997),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TIK +KARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTG+YEALE+RDGGSDYLGKG
Sbjct  4    TIKLIKARQIFDSRGNPTVEVDVTLSDGTLARAAVPSGASTGVYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV NVN IIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVENVNGIIGPALIGKDPTEQTQIDNYMVQQLDGTTNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGATVKKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKAVIKKKYGQDATN  212



>ref|XP_008376333.1| PREDICTED: enolase [Malus domestica]
Length=445

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTGIYEALE+RDGGS+YLG
Sbjct  1    MATIKLVKARQIFDSRGNPTVEVDVTLSDGTYARAAVPSGASTGIYEALELRDGGSNYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            S FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SCFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_003557232.1| PREDICTED: enolase 1 [Brachypodium distachyon]
Length=447

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI+SVKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  5    TIQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  64

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAVNNVN+IIGPAL+GKDPT+Q  IDN MVQQLDGT N+WGWCKQKLGANAILAVSLA
Sbjct  65   VLKAVNNVNAIIGPALIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  124

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  125  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  184

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  185  FKEAMKMGVEVYHHLKSIIKKKYGQDATN  213



>gb|EMT10090.1| Enolase 1 [Aegilops tauschii]
Length=448

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI+SVKARQIFDSRGNPTVEVD+ LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  6    TIQSVKARQIFDSRGNPTVEVDIGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  65

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV+NVN+IIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  66   VLKAVSNVNAIIGPALIGKDPTEQTDIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  125

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+S
Sbjct  126  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAAS  185

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  186  FKEAMKMGVEVYHHLKSIIKKKYGQDATN  214



>ref|XP_009365316.1| PREDICTED: enolase [Pyrus x bretschneideri]
Length=444

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+S+KARQIFDSRGNPTVEVD+ LS+   ARAAVPSGASTG+YEALE+RDGG DYLG
Sbjct  1    MATIQSIKARQIFDSRGNPTVEVDIILSDGTLARAAVPSGASTGVYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVAKAGASVKKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>gb|KJB16681.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=383

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>gb|AIR93791.1| enolase [Kalanchoe fedtschenkoi]
Length=445

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+ VKARQIFDSRGNPTVEV+V LSN   ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQFVKARQIFDSRGNPTVEVEVGLSNGVKARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAVNNVN+IIGPAL+GKDPT+Q+ IDN MVQQLDGT NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVNNVNTIIGPALIGKDPTEQSSIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA   NIPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGANALNIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>ref|XP_010933076.1| PREDICTED: enolase 2 [Elaeis guineensis]
Length=445

 Score =   387 bits (995),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK +KARQIFDSRGNPTVEVD  LS+  ++RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLSDGTFSRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT Q  ID  MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVTNVNSIIGPALIGKDPTAQAEIDTFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_002283632.1| PREDICTED: enolase 1 [Vitis vinifera]
 emb|CBI30238.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   387 bits (995),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TI+ VKARQIFDSRGNPTVEVD+ LSN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MVTIQFVKARQIFDSRGNPTVEVDIGLSNGAKVSAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDP+DQTGIDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVANVNTIIGPALIGKDPSDQTGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VKNIPLY+HIAN+AGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAIVKNIPLYKHIANIAGNKHLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             SFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  PSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_004964466.1| PREDICTED: enolase 1-like isoform X4 [Setaria italica]
Length=446

 Score =   387 bits (995),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAVNNVNSIIGPA++GKDPT+Q  IDN MVQQLDGT N+WGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVNNVNSIIGPAIIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKSIIKKKYGQDATN  212



>ref|XP_004303035.1| PREDICTED: enolase [Fragaria vesca subsp. vesca]
Length=444

 Score =   387 bits (994),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVD+ LS+ + ARAAVPSGASTG+YEALE+RDGGS+YLG
Sbjct  1    MATIQCVKARQIFDSRGNPTVEVDIILSDGYLARAAVPSGASTGVYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK  PLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKTPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_007218006.1| hypothetical protein PRUPE_ppa005739mg [Prunus persica]
 gb|EMJ19205.1| hypothetical protein PRUPE_ppa005739mg [Prunus persica]
Length=446

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TIK VKARQIFDSRGNPTVEVDV L +  +ARAAVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TIKLVKARQIFDSRGNPTVEVDVTLFDGTYARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV NVNSIIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVENVNSIIGPALIGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA V  IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAIVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKAVIKKKYGQDATN  212



>ref|XP_008234357.1| PREDICTED: enolase [Prunus mume]
Length=446

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TIK VKARQIFDSRGNPTVEVDV L +  +ARAAVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TIKLVKARQIFDSRGNPTVEVDVTLFDGTYARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV NVNSIIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVENVNSIIGPALIGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA V  IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAIVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKAVIKKKYGQDATN  212



>gb|AGH20062.1| enolase [Triticum aestivum]
Length=446

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAVNNVNSII PALVGKDPT QT +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVNNVNSIIAPALVGKDPTAQTELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASVKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAT  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>gb|KHN24421.1| Enolase [Glycine soja]
Length=448

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK+VKARQIFDSRGNPTVEVDV LS+  + RAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIKAVKARQIFDSRGNPTVEVDVILSDGTFHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSII PAL+GKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLY+HIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_002322420.1| hypothetical protein POPTR_0015s14380g [Populus trichocarpa]
 gb|ABK94302.1| unknown [Populus trichocarpa]
 gb|EEF06547.1| hypothetical protein POPTR_0015s14380g [Populus trichocarpa]
Length=445

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIK+VKARQIFDSRGNPTVE D+ LS+  +ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MVTIKAVKARQIFDSRGNPTVEADILLSDGSYARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+Q  IDN MVQ+LDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVGNVNSIIGPALIGKDPTEQVQIDNFMVQELDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|ABW21688.1| enolase [Gossypium hirsutum]
Length=445

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDG  DYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGDFDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>sp|Q9LEI9.1|ENO2_HEVBR RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 2; AltName: Full=2-phosphoglycerate dehydratase 
2; AltName: Allergen=Hev b 9 [Hevea brasiliensis]
 emb|CAC00533.1| enolase, isoform 2 [Hevea brasiliensis]
Length=445

 Score =   387 bits (993),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SV+ARQIFDSRGNPTVE DV LS+ + ARAAVP GASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV NVN IIGPALVGKDPTDQ GIDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+H+ANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  184  FKEAMKMGAEVYHHLKSVIKKKYGQDATN  212



>ref|XP_006481907.1| PREDICTED: enolase-like [Citrus sinensis]
 gb|ADD12953.1| 2-phospho-D-glycerate hydrolase [Citrus trifoliata]
Length=445

 Score =   387 bits (993),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI +VKARQIFDSRGNPTVEVDV  S+ H ARAAVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITAVKARQIFDSRGNPTVEVDVTTSDGHVARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV+NVN+IIGPAL GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKAVIKKKYGQDATN  212



>ref|XP_011041692.1| PREDICTED: enolase [Populus euphratica]
Length=445

 Score =   387 bits (993),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIK+VKARQIFDSRGNPTVE D+ LS+  +ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MVTIKAVKARQIFDSRGNPTVEADIVLSDGTYARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+Q  IDN MVQ+LDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVGNVNSIIGPALIGKDPTEQVQIDNFMVQELDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>ref|XP_010278245.1| PREDICTED: enolase 1-like [Nelumbo nucifera]
Length=445

 Score =   386 bits (992),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVE DV LS+   ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKCVKARQIFDSRGNPTVEADVILSDGTMARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+II PALVGKDPT+Q  +DN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIAPALVGKDPTEQVSVDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVNKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGAEVYHHLKAVIKKKYGQDATN  211



>ref|XP_006851831.1| PREDICTED: enolase [Amborella trichopoda]
 gb|ERN13298.1| hypothetical protein AMTR_s00041p00062460 [Amborella trichopoda]
Length=445

 Score =   386 bits (992),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TI SVKARQIFDSRGNPTVEVDV LS+    RAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MVTITSVKARQIFDSRGNPTVEVDVGLSDGTCHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+G+DPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVMKAVGNVNSIIGPALIGRDPTEQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKE+MKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKESMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_004514974.1| PREDICTED: enolase-like [Cicer arietinum]
Length=445

 Score =   386 bits (991),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIKFVKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+II PAL+GKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVGNVNTIIAPALIGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA  K IPLY+HIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGALAKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_008391739.1| PREDICTED: enolase-like [Malus domestica]
Length=444

 Score =   386 bits (991),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVD+ LS+   ARAAVPSGASTG+YEALE+RDGG DYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDIILSDGTLARAAVPSGASTGVYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVN+IIGPAL+GKDP++QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNTIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK +PLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVAKAGASVKKVPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_006430314.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
 gb|ESR43554.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
Length=356

 Score =   383 bits (983),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI +VKARQIFDSRGNPTVEVDV  S+ H ARAAVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITAVKARQIFDSRGNPTVEVDVTTSDGHVARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV+NVN+IIGPAL GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            +CKAGA VK IPLY+HIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS 
Sbjct  124  ICKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASC  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKAVIKKKYGQDATN  212



>ref|XP_004964465.1| PREDICTED: enolase 1-like isoform X3 [Setaria italica]
Length=470

 Score =   387 bits (993),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAVNNVNSIIGPA++GKDPT+Q  IDN MVQQLDGT N+WGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVNNVNSIIGPAIIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKSIIKKKYGQDATN  212



>ref|XP_010558960.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Tarenaya 
hassleriana]
Length=444

 Score =   386 bits (991),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV LS+     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIAAVKARQIFDSRGNPTVEVDVVLSSGFKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKGIPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF EAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFSEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_008386927.1| PREDICTED: enolase [Malus domestica]
Length=444

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVD+ LS+   ARAAVPSGASTG+YEALE+RDGG DYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDIILSDGTLARAAVPSGASTGVYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK IPLY+HIANLAGN  LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVAKAGASVKKIPLYKHIANLAGNXNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_009401920.1| PREDICTED: enolase-like [Musa acuminata subsp. malaccensis]
Length=445

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIKSVKARQIFDSRGNPTVEVD++  +  +ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEVDLHCDDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+II PAL+GKDPT+Q  IDN MVQQLDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIAPALIGKDPTEQAQIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LALCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKAVIKKKYGQDATN  211



>ref|XP_010050038.1| PREDICTED: enolase-like [Eucalyptus grandis]
Length=444

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MA IK +KARQIFDSRGNPTVE DV L +  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MAKIKCIKARQIFDSRGNPTVEADVTLDDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV N+NSIIGPALVGKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNINSIIGPALVGKDPTEQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV  IPLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVNKIPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>emb|CBI24517.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK +KARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTGIYEALE+RDGGSD+LG
Sbjct  1    MATIKVIKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGIYEALELRDGGSDFLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+II PAL+GKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNAIIAPALIGKDPTEQVKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAMVNKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPLGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|KJB16683.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=444

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 196/210 (93%), Gaps = 1/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQ FMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQ-FMILPVGAS  181

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  182  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>ref|NP_001056727.1| Os06g0136600 [Oryza sativa Japonica Group]
 dbj|BAD68461.1| putative enolase [Oryza sativa Japonica Group]
 dbj|BAD68886.1| putative enolase [Oryza sativa Japonica Group]
 dbj|BAF18641.1| Os06g0136600 [Oryza sativa Japonica Group]
 gb|EEC79946.1| hypothetical protein OsI_21538 [Oryza sativa Indica Group]
Length=446

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI+SVKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TIQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV+NVN+IIGPAL+GKDPT+Q  IDN MVQQLDGT N WGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVSNVNTIIGPALIGKDPTEQVDIDNFMVQQLDGTSNNWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKSIIKKKYGQDATN  212



>ref|XP_010907928.1| PREDICTED: enolase-like [Elaeis guineensis]
Length=445

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK +KARQIFDSRGNPTVEVD  LS+  + RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLSDGSFCRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+Q  ID  MVQQLDGT NEWGWCK+KLGANAIL VS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQAQIDTFMVQQLDGTSNEWGWCKEKLGANAILTVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>ref|XP_002528580.1| enolase, putative [Ricinus communis]
 gb|EEF33788.1| enolase, putative [Ricinus communis]
Length=445

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SV+ARQIFDSRGNPTVE D+ LS+ H ARAAVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TIVSVRARQIFDSRGNPTVEADIKLSDGHLARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV NVNSIIGPAL+GKDPT+QT +DN MVQ+LDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVENVNSIIGPALIGKDPTEQTALDNFMVQELDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            +CKAGA VK IPLY+HIAN AGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  LCKAGAHVKGIPLYKHIANHAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  184  FKEAMKMGAEVYHHLKSVIKKKYGQDATN  212



>gb|EEC74867.1| hypothetical protein OsI_10758 [Oryza sativa Indica Group]
Length=445

 Score =   385 bits (988),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVD+  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDICCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GV KAV+NVNSIIGPAL+GKDPT+QT IDN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVLKAVDNVNSIIGPALIGKDPTEQTVIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  ALCKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>ref|NP_001049556.1| Os03g0248600 [Oryza sativa Japonica Group]
 gb|ABF94968.1| Enolase 2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11470.1| Os03g0248600 [Oryza sativa Japonica Group]
 dbj|BAG93549.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94076.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58701.1| hypothetical protein OsJ_10141 [Oryza sativa Japonica Group]
Length=445

 Score =   385 bits (988),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVD+  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDICCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GV KAV+NVNSIIGPAL+GKDPT+QT IDN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVLKAVDNVNSIIGPALIGKDPTEQTVIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  ALCKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>ref|XP_002267091.2| PREDICTED: enolase [Vitis vinifera]
Length=510

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  75   SMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYL  254
            +MATIK +KARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTGIYEALE+RDGGSD+L
Sbjct  65   TMATIKVIKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGIYEALELRDGGSDFL  124

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV KAV NVN+II PAL+GKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAV
Sbjct  125  GKGVLKAVENVNAIIAPALIGKDPTEQVKIDNFMVQQLDGTVNEWGWCKQKLGANAILAV  184

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            SLAVCKAGA V  IPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP+G
Sbjct  185  SLAVCKAGAMVNKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPLG  244

Query  615  ASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            ASSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  245  ASSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  276



>gb|KDO61018.1| hypothetical protein CISIN_1g043137mg [Citrus sinensis]
Length=445

 Score =   384 bits (987),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI +VKARQIFDSRGNPTVEVDV  S+ H ARAAVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITAVKARQIFDSRGNPTVEVDVTTSDGHVARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV+NVN+IIGPAL GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS 
Sbjct  124  VCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASC  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKAVIKKKYGQDATN  212



>ref|XP_006661656.1| PREDICTED: enolase-like [Oryza brachyantha]
Length=446

 Score =   384 bits (987),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAVNNVNS+I PAL+GKDPT Q  IDN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVNNVNSVIAPALIGKDPTAQAEIDNYMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  212



>ref|XP_010243562.1| PREDICTED: enolase 1 [Nelumbo nucifera]
Length=444

 Score =   384 bits (987),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVE DV LS+   ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIQCVKARQIFDSRGNPTVEADVTLSDGTVARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVENVNTIIGPALIGKDPTEQTNIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGN+ LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAGVKKIPLYKHIANLAGNRTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH LK VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGSEVYHTLKGVIKKKYGQDATN  211



>ref|XP_007038456.1| Enolase isoform 1 [Theobroma cacao]
 gb|EOY22957.1| Enolase isoform 1 [Theobroma cacao]
Length=445

 Score =   384 bits (987),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIKSVKARQIFDSRGNPTVE DV LS+   ARAAVPSGASTG YEALE+RDGGSDYLG
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEADVTLSDGTVARAAVPSGASTGTYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDP +Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPKEQGKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>ref|XP_006421751.1| hypothetical protein CICLE_v10004965mg [Citrus clementina]
 gb|ESR34991.1| hypothetical protein CICLE_v10004965mg [Citrus clementina]
Length=445

 Score =   384 bits (986),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV+LS+   ARAAVPSGASTGIYEALE+RDGG DY G
Sbjct  1    MATINAVKARQIFDSRGNPTVEVDVSLSDGTLARAAVPSGASTGIYEALELRDGGWDYHG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            +GV KAV NVNSIIGPALVGKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   RGVLKAVQNVNSIIGPALVGKDPTQQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            S+FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  STFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_006430313.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
 gb|ESR43553.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
Length=445

 Score =   384 bits (986),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI +VKARQIFDSRGNPTVEVDV  S+ H ARAAVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITAVKARQIFDSRGNPTVEVDVTTSDGHVARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV+NVN+IIGPAL GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            +CKAGA VK IPLY+HIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS 
Sbjct  124  ICKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASC  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKAVIKKKYGQDATN  212



>gb|AGH20061.1| enolase [Triticum aestivum]
 gb|AGH20063.1| enolase [Triticum aestivum]
Length=446

 Score =   384 bits (986),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVNSII PAL+GKDPT QT +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVDNVNSIIAPALIGKDPTAQTELDNYMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASVKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>ref|XP_010277374.1| PREDICTED: enolase-like [Nelumbo nucifera]
Length=445

 Score =   384 bits (986),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIK+VKARQIFDSRGNPTVE DV LS+   ARAAVPSGASTG YEALE+RDGGS+YLG
Sbjct  1    MVTIKAVKARQIFDSRGNPTVEADVTLSDGTQARAAVPSGASTGCYEALELRDGGSNYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPAL+GKDPT+QT IDN MVQ+LDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALIGKDPTEQTKIDNFMVQELDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVKKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGTEVYHHLKAVIKKKYGQDATN  211



>ref|XP_003558351.1| PREDICTED: enolase 2 [Brachypodium distachyon]
Length=446

 Score =   384 bits (985),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GV KAV+NVNSIIGPAL+GKD T+QT IDN MV QLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVLKAVDNVNSIIGPALIGKDATEQTEIDNFMVHQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA++K IPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGASIKKIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>dbj|BAJ90134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   384 bits (986),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  6    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  65

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVNSII PAL+GKDPT QT +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  66   GVSKAVGNVNSIIAPALIGKDPTAQTELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  125

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  126  AVCKAGASVKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  185

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  186  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  215



>ref|XP_003521438.1| PREDICTED: enolase-like [Glycine max]
Length=444

 Score =   384 bits (985),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD+  S+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIVSIKARQIFDSRGNPTVEVDLTCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV+NVN+II PALVGKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVDNVNTIIAPALVGKDPTQQTAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV  +PLY+HIAN+AGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGAAVLKVPLYKHIANIAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDA N
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDAVN  211



>ref|XP_003573806.1| PREDICTED: enolase [Brachypodium distachyon]
Length=446

 Score =   384 bits (985),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAVNNVNSII PAL+GKDPT Q  +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVNNVNSIIAPALIGKDPTTQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASVKKIPLYQHIANLAGNKHLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAT  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>emb|CAB96173.1| enolase [Spinacia oleracea]
Length=444

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIKSVKARQIFDSRGNPTVE D++L +  +ARAAVPSGASTGIYEALE+RDGG DY+G
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEADIHLDDGTFARAAVPSGASTGIYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN IIGPALVGKDPT+QT IDN MVQ+LDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVFKAVQNVNEIIGPALVGKDPTEQTAIDNFMVQELDGTTNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIA ++GNKK+VLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAQVKKIPLYQHIAEISGNKKMVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF+EAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFREAMKMGSEVYHHLKSVIKKKYGQDATN  211



>ref|XP_008791284.1| PREDICTED: enolase isoform X1 [Phoenix dactylifera]
Length=445

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK +KARQIFDSRGNPTVEVD  L++  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLTDGSFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV +VN+II PAL+GKDPT Q  +DN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVGHVNTIIAPALIGKDPTQQAEVDNFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_008791285.1| PREDICTED: enolase isoform X2 [Phoenix dactylifera]
Length=436

 Score =   383 bits (983),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK +KARQIFDSRGNPTVEVD  L++  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLTDGSFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV +VN+II PAL+GKDPT Q  +DN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVGHVNTIIAPALIGKDPTQQAEVDNFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_007162849.1| hypothetical protein PHAVU_001G186100g [Phaseolus vulgaris]
 gb|ESW34843.1| hypothetical protein PHAVU_001G186100g [Phaseolus vulgaris]
Length=444

 Score =   383 bits (983),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD++ S+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATILSIKARQIFDSRGNPTVEVDLSCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV+NVNSII PAL+GKDPT QT IDN MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVDNVNSIIAPALIGKDPTQQTAIDNLMVQQLDGTVNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGASVLKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDA N
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDAIN  211



>ref|XP_009353019.1| PREDICTED: enolase-like [Pyrus x bretschneideri]
Length=444

 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+SVKARQIF SRGNPTVEVD+ LS+   ARAAVPSGASTG+YEALE+RDGG DYLG
Sbjct  1    MATIQSVKARQIFASRGNPTVEVDIILSDGTLARAAVPSGASTGVYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAVNNVN+IIGPAL+GKDP++QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVNNVNTIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK +PLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVAKAGASVKKVPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_010527847.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Tarenaya hassleriana]
Length=468

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/223 (85%), Positives = 201/223 (90%), Gaps = 1/223 (0%)
 Frame = +3

Query  42   VSFSRFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEA  221
            +S SR   +S SMATI +VKARQIFDSRGNPTVEVDV LSN     AAVPSGASTGIYEA
Sbjct  14   LSPSRSTRAS-SMATITAVKARQIFDSRGNPTVEVDVVLSNGAKVTAAVPSGASTGIYEA  72

Query  222  LEMRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCK  401
            LE+RDGGSDYLGKGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCK
Sbjct  73   LELRDGGSDYLGKGVSKAVGNVNTIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCK  132

Query  402  QKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKL  581
            QKLGANAILAVSLAVCKAGA V+ IPLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKL
Sbjct  133  QKLGANAILAVSLAVCKAGAVVEGIPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKL  192

Query  582  AMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            AMQEFMILPVGASSF EAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  193  AMQEFMILPVGASSFSEAMKMGVEVYHNLKSVIKKKYGQDATN  235



>gb|AEM97875.1| enolase [Corylus heterophylla]
Length=454

 Score =   382 bits (982),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK VKARQIFDSRGNPTVEV+V LS+   ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATIKLVKARQIFDSRGNPTVEVEVYLSDDRQARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN IIGPALVG DPT+QT ID+ MVQ+LDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNKIIGPALVGMDPTEQTKIDDYMVQKLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            S FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SCFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>gb|AGZ15373.1| enolase [Phaseolus vulgaris]
Length=444

 Score =   382 bits (981),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD++ S+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATILSIKARQIFDSRGNPTVEVDLSCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV+NVNSII PAL+GKDPT QT IDN MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVDNVNSIIAPALIGKDPTQQTAIDNLMVQQLDGTVNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGASVLKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDA N
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDAIN  211



>dbj|BAJ85279.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI+SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVN II PAL+GKDPT QT +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVDNVNLIIAPALIGKDPTAQTELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASVKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>gb|AAL16111.1|AF428279_1 At2g36530/F1O11.16 [Arabidopsis thaliana]
Length=325

 Score =   377 bits (969),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ SN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  ASFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>ref|XP_008778664.1| PREDICTED: enolase-like [Phoenix dactylifera]
Length=445

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATIK +KARQIFDSRGNPTVEVD  LS+  ++RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLSDGTFSRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPAL+GKDPT Q  ID  MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNAIIGPALIGKDPTAQAEIDTFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LALCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             SFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  CSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_006403745.1| hypothetical protein EUTSA_v10010378mg [Eutrema salsugineum]
 dbj|BAJ33773.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45198.1| hypothetical protein EUTSA_v10010378mg [Eutrema salsugineum]
Length=444

 Score =   382 bits (980),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ S     RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITHVKARQIFDSRGNPTVEVDVHTSTGVQVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>gb|AFB35652.1| enolase [Phytolacca americana]
Length=444

 Score =   382 bits (980),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIK VKARQI+DSRGNPTVE DV+L +  +ARAAVPSGASTGIYEALE+RDGGSDY+G
Sbjct  1    MVTIKCVKARQIYDSRGNPTVEADVHLDDGTFARAAVPSGASTGIYEALELRDGGSDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAVNNVN IIGPALVGKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVQKAVNNVNEIIGPALVGKDPTQQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK  PLY+HIA LAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAQVKKTPLYKHIAELAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFK+AMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKDAMKMGSEVYHHLKSVIKKKYGQDATN  211



>ref|XP_009384633.1| PREDICTED: enolase [Musa acuminata subsp. malaccensis]
Length=445

 Score =   381 bits (978),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M  I SVKARQIFDSRGNPTVEVD+   +  +ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MVRITSVKARQIFDSRGNPTVEVDLRCDDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+II PAL+GKDPT+Q  IDN MVQQLDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNAIIAPALIGKDPTEQAQIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYH+LKAVIKKKYGQDATN
Sbjct  181  ASFKEAMKMGVEVYHNLKAVIKKKYGQDATN  211



>ref|XP_009393022.1| PREDICTED: enolase-like [Musa acuminata subsp. malaccensis]
Length=445

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MA I SVKARQIFDSRGNPTVEVDV L++   ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MAAIASVKARQIFDSRGNPTVEVDVCLTDGTCARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPAL+GKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVANVNAIIGPALIGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYQHIAN+AGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANIAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKGVIKKKYGQDATN  211



>ref|XP_002984551.1| hypothetical protein SELMODRAFT_120189 [Selaginella moellendorffii]
 gb|EFJ14601.1| hypothetical protein SELMODRAFT_120189 [Selaginella moellendorffii]
Length=446

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            +I+ VKAR IFDSRGNPTVEVDV LS+  + RAAVPSGASTG+YEALE+RDGG DY+GKG
Sbjct  4    SIQQVKARTIFDSRGNPTVEVDVVLSDKSYYRAAVPSGASTGVYEALELRDGGKDYMGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAVNNVN+IIGPALVGKDPTDQTGIDN MV +LDGTQN+WGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVNNVNAIIGPALVGKDPTDQTGIDNFMVHELDGTQNKWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA V  IPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGASS
Sbjct  124  VCKAGAGVSKIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            F+EAMKMG EVYH LKAVIKKKYG DATN
Sbjct  184  FREAMKMGAEVYHSLKAVIKKKYGLDATN  212



>ref|XP_004964464.1| PREDICTED: enolase 1-like isoform X2 [Setaria italica]
Length=526

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAVNNVNSIIGPA++GKDPT+Q  IDN MVQQLDGT N+WGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVNNVNSIIGPAIIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKSIIKKKYGQDATN  212



>gb|KDO65391.1| hypothetical protein CISIN_1g013317mg [Citrus sinensis]
Length=445

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TI +VKARQIFDSRGNPTVEVDV+LS+   ARAAVPSGASTGIYEALE+RDGG DY G
Sbjct  1    MVTINAVKARQIFDSRGNPTVEVDVSLSDGTLARAAVPSGASTGIYEALELRDGGWDYHG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            +GV KAV NVNSIIGPALVGKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   RGVLKAVQNVNSIIGPALVGKDPTEQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHA NKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHADNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            S+FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  STFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_006490248.1| PREDICTED: enolase-like [Citrus sinensis]
Length=445

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TI +VKARQIFDSRGNPTVEVDV+LS+   ARAAVPSGASTGIYEALE+RDGG DY G
Sbjct  1    MVTINAVKARQIFDSRGNPTVEVDVSLSDGTLARAAVPSGASTGIYEALELRDGGWDYHG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            +GV KAV NVNSIIGPALVGKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   RGVLKAVQNVNSIIGPALVGKDPTEQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHA NKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKALVLPVPAFNVINGGSHADNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            S+FKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  STFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|XP_010050008.1| PREDICTED: enolase 1 [Eucalyptus grandis]
Length=444

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M  IK +KARQIFDSRGNPTVE D  L +  + RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MVKIKCIKARQIFDSRGNPTVEADATLDDGTFVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPALVGKDP DQ  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVENVNTIIGPALVGKDPRDQIAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA   IPLY+HIAN+AGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAANKIPLYKHIANIAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  211



>ref|NP_001237329.1| enolase [Glycine max]
 gb|AAS18240.1| enolase [Glycine max]
Length=444

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI S+ ARQIFDSRGNPTVEVD+  S+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIVSINARQIFDSRGNPTVEVDLTCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV+NVN++IGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAV 
Sbjct  61   KGVSKAVDNVNTVIGPALIGKDPTEQTAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVF  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLY+HIAN+AGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGASVLKIPLYKHIANIAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDA N
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDAIN  211



>ref|XP_006294225.1| hypothetical protein CARUB_v10023223mg [Capsella rubella]
 gb|EOA27123.1| hypothetical protein CARUB_v10023223mg [Capsella rubella]
Length=444

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ SN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>sp|Q42971.2|ENO_ORYSJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase; AltName: 
Full=OSE1 [Oryza sativa Japonica Group]
 gb|AAP94211.1| enolase [Oryza sativa Japonica Group]
 gb|ABL74573.1| enolase [Oryza sativa Japonica Group]
 gb|ADM86850.1| enolase [Oryza sativa Japonica Group]
Length=446

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>gb|AAC49173.1| enolase [Oryza sativa Japonica Group]
Length=446

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>ref|XP_004964463.1| PREDICTED: enolase 1-like isoform X1 [Setaria italica]
Length=550

 Score =   383 bits (984),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAVNNVNSIIGPA++GKDPT+Q  IDN MVQQLDGT N+WGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVNNVNSIIGPAIIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHHLKSIIKKKYGQDATN  212



>gb|AFW85965.1| enolase1 [Zea mays]
Length=422

 Score =   379 bits (972),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYH+LK++IKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHNLKSIIKKKYGQDATN  212



>gb|KEH24119.1| phosphopyruvate hydratase [Medicago truncatula]
Length=444

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MA I S+KARQIFDSRGNPTVEVD+ +S+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MAAITSIKARQIFDSRGNPTVEVDITVSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+II PAL+GKDPT QT IDN MVQ+LDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVANVNTIIAPALIGKDPTQQTEIDNFMVQKLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIAN+AGNK LVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGANVLKIPLYKHIANIAGNKHLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLKAVIKKKYGQDA N
Sbjct  181  SSFKEAMKMGVEVYHHLKAVIKKKYGQDAVN  211



>gb|ABG65935.1| Enolase, putative, expressed [Oryza sativa Japonica Group]
Length=457

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  37   ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  96

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  97   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  156

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  157  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  216

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  217  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  246



>gb|AFW85964.1| enolase1 [Zea mays]
Length=446

 Score =   379 bits (974),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYH+LK++IKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHNLKSIIKKKYGQDATN  212



>gb|ACL53816.1| unknown [Zea mays]
Length=446

 Score =   379 bits (974),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYH+LK++IKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHNLKSIIKKKYGQDATN  212



>ref|NP_001105896.1| enolase 1 [Zea mays]
 sp|P26301.1|ENO1_MAIZE RecName: Full=Enolase 1; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 1; AltName: Full=2-phosphoglycerate dehydratase 
1 [Zea mays]
 emb|CAA39454.1| enolase [Zea mays]
Length=446

 Score =   379 bits (973),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYH+LK++IKKKYGQDATN
Sbjct  184  FKEAMKMGVEVYHNLKSIIKKKYGQDATN  212



>ref|XP_001751337.1| predicted protein [Physcomitrella patens]
 gb|EDQ83654.1| predicted protein [Physcomitrella patens]
Length=445

 Score =   379 bits (973),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+S+KAR IFDSRGNPTVE D+ LS+  W RAAVPSGASTG+YEALE+RDGG DY+G
Sbjct  1    MATIQSIKARSIFDSRGNPTVEADILLSDGSWYRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV+NVN+IIGPALVGKDPTDQTGIDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVQKAVDNVNNIIGPALVGKDPTDQTGIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V   PLYQHIANLAGNK++V+PVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAGVLKTPLYQHIANLAGNKEIVMPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF EAMK+G EVYH+LKAVIKKKYGQDATN
Sbjct  181  SSFTEAMKIGSEVYHNLKAVIKKKYGQDATN  211



>ref|XP_010515776.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=444

 Score =   379 bits (972),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ S     RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNYMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  +PLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGVPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>gb|ABB46862.2| Enolase, putative, expressed [Oryza sativa Japonica Group]
Length=480

 Score =   380 bits (976),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  37   ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  96

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  97   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  156

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  157  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  216

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  217  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  246



>ref|NP_181192.1| bifunctional enolase 2/transcriptional activator [Arabidopsis 
thaliana]
 sp|P25696.1|ENO2_ARATH RecName: Full=Bifunctional enolase 2/transcriptional activator; 
AltName: Full=2-phospho-D-glycerate hydro-lyase 2; AltName: 
Full=2-phosphoglycerate dehydratase 2; AltName: Full=LOW 
EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1 [Arabidopsis thaliana]
 gb|AAL11597.1|AF424603_1 At2g36530/F1O11.16 [Arabidopsis thaliana]
 emb|CAA41114.1| enolase [Arabidopsis thaliana]
 gb|AAD24635.1| enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis thaliana]
 gb|AAN12963.1| enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis thaliana]
 gb|AEC09265.1| bifunctional enolase 2/transcriptional activator [Arabidopsis 
thaliana]
Length=444

 Score =   379 bits (972),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ SN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  ASFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|AAS66001.1| LOS2 [Capsella bursa-pastoris]
Length=444

 Score =   379 bits (972),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ SN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VI+KKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIEKKYGQDATN  211



>ref|XP_011018872.1| PREDICTED: enolase 2 [Populus euphratica]
Length=445

 Score =   378 bits (971),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVE DV  S+   +RAAVPSGASTG+YEALE+RDGGSDYLGKG
Sbjct  4    TIVSVKARQIFDSRGNPTVEADVTTSDGVLSRAAVPSGASTGVYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV NVN+IIGPAL+GKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVGNVNTIIGPALIGKDPTEQVAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA  K IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAHAKGIPLYKHIANLAGNKSLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  184  FKEAMKMGAEVYHHLKSVIKKKYGQDATN  212



>ref|XP_009133088.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Brassica rapa]
Length=444

 Score =   378 bits (971),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV+ S+     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>gb|KFK32725.1| hypothetical protein AALP_AA6G281000 [Arabis alpina]
Length=444

 Score =   378 bits (971),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ SN     AAVPSGASTGIYEALE+RDGG DYLG
Sbjct  1    MATITGVKARQIFDSRGNPTVEVDIHTSNGVKVTAAVPSGASTGIYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNDIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|AAL06912.1| At2g36530/F1O11.16 [Arabidopsis thaliana]
Length=444

 Score =   378 bits (970),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ SN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN++IGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNVIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  ASFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>ref|XP_006381325.1| phosphopyruvate hydratase family protein [Populus trichocarpa]
 gb|ABK96195.1| unknown [Populus trichocarpa]
 gb|ERP59122.1| phosphopyruvate hydratase family protein [Populus trichocarpa]
Length=445

 Score =   378 bits (970),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVE DV  S+   +RAAVPSGASTG+YEALE+RDGGSDYLGKG
Sbjct  4    TIVSVKARQIFDSRGNPTVEADVTTSDGVLSRAAVPSGASTGVYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV NVN+IIGPAL+GKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVGNVNTIIGPALIGKDPTEQVAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA  K IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAHAKGIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  184  FKEAMKMGAEVYHHLKSVIKKKYGQDATN  212



>ref|XP_002877895.1| enolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54154.1| enolase [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI ++KARQIFDSRGNPTVEVDV+ S     RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITAIKARQIFDSRGNPTVEVDVHTSTGVKVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+G DPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGNDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN KL+LPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGIPLYKHIANLAGNPKLMLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>gb|KJB16685.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=435

 Score =   377 bits (968),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 192/210 (91%), Gaps = 10/210 (5%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVE          ARAAVPSGASTGIYEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVE----------ARAAVPSGASTGIYEALELRDGGSDYLGK  52

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QT IDN MVQQLDGTQNEWGWCKQKLGANAILAVSL
Sbjct  53   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  112

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  113  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  172

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  173  SFKEAMKMGVEVYHHLKSVIKKKYGQDATN  202



>gb|KFK34543.1| hypothetical protein AALP_AA5G159700 [Arabis alpina]
Length=444

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ S      AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTSIDNFMVHELDGTQNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|NP_001064223.1| Os10g0167300 [Oryza sativa Japonica Group]
 dbj|BAF26137.1| Os10g0167300 [Oryza sativa Japonica Group]
Length=446

 Score =   377 bits (968),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQ FMILP GA+
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQAFMILPTGAA  182

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>ref|XP_010683886.1| PREDICTED: enolase [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   377 bits (968),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M  IK +KARQI+DSRGNPTVE DV+L +  +ARAAVPSGASTG+YEALE+RDGG DY+G
Sbjct  1    MVAIKGIKARQIYDSRGNPTVEADVHLDDGTYARAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN IIGPALVGKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVQNVNEIIGPALVGKDPTEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIA +AGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAQVKKIPLYQHIAEIAGNPKMVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGSEVYHNLKSVIKKKYGQDATN  211



>ref|XP_010504049.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=444

 Score =   377 bits (968),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ S     RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV +LDGTQNE GWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNYMVHELDGTQNELGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYQHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGIPLYQHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_002881452.1| hypothetical protein ARALYDRAFT_902771 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57711.1| hypothetical protein ARALYDRAFT_902771 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   377 bits (967),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ S+     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITGVKARQIFDSRGNPTVEVDIHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF EAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFTEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>ref|XP_006403746.1| hypothetical protein EUTSA_v10010379mg [Eutrema salsugineum]
 gb|ESQ45199.1| hypothetical protein EUTSA_v10010379mg [Eutrema salsugineum]
Length=444

 Score =   377 bits (967),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ S      AAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MATITLVKARQIFDSRGNPTVEVDIHTSTGVKVTAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_007038457.1| Enolase isoform 2, partial [Theobroma cacao]
 gb|EOY22958.1| Enolase isoform 2, partial [Theobroma cacao]
Length=394

 Score =   375 bits (963),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 193/223 (87%), Gaps = 12/223 (5%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIKSVKARQIFDSRGNPTVE DV LS+   ARAAVPSGASTG YEALE+RDGGSDYLG
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEADVTLSDGTVARAAVPSGASTGTYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDP +Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPKEQGKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLY------------QHIANLAGNKKLVLPVPAFNVINGGSHAGNKL  581
            LAVCKAGA VK IPLY            QHIANLAGNK LVLPVPAFNVINGGSHAGNKL
Sbjct  121  LAVCKAGAMVKKIPLYQVIFTLFVSSNLQHIANLAGNKTLVLPVPAFNVINGGSHAGNKL  180

Query  582  AMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            AMQEFMILPVGASSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  AMQEFMILPVGASSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  223



>ref|XP_007038458.1| Enolase isoform 3 [Theobroma cacao]
 gb|EOY22959.1| Enolase isoform 3 [Theobroma cacao]
Length=418

 Score =   376 bits (965),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 193/223 (87%), Gaps = 12/223 (5%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIKSVKARQIFDSRGNPTVE DV LS+   ARAAVPSGASTG YEALE+RDGGSDYLG
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEADVTLSDGTVARAAVPSGASTGTYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDP +Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPKEQGKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLY------------QHIANLAGNKKLVLPVPAFNVINGGSHAGNKL  581
            LAVCKAGA VK IPLY            QHIANLAGNK LVLPVPAFNVINGGSHAGNKL
Sbjct  121  LAVCKAGAMVKKIPLYQVIFTLFVSSNLQHIANLAGNKTLVLPVPAFNVINGGSHAGNKL  180

Query  582  AMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            AMQEFMILPVGASSFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  AMQEFMILPVGASSFKEAMKMGVEVYHHLKSVIKKKYGQDATN  223



>ref|XP_001751336.1| predicted protein [Physcomitrella patens]
 gb|EDQ83653.1| predicted protein [Physcomitrella patens]
Length=445

 Score =   377 bits (967),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI+S+KAR I+DSRGNPTVE D++LS+  W RAAVPSGASTG+YEALE+RDGG DY+G
Sbjct  1    MATIQSIKARAIYDSRGNPTVEADIHLSDGSWYRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV+NVN IIGPALVGKDPT+QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVQKAVDNVNKIIGPALVGKDPTNQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V   PLYQHIANLAGNK++V+PVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAGVSKTPLYQHIANLAGNKEIVMPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMK+G EVYH+LKAVIKKKYGQDATN
Sbjct  181  SSFKEAMKIGSEVYHNLKAVIKKKYGQDATN  211



>gb|AAL59917.1| putative enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis 
thaliana]
Length=444

 Score =   376 bits (966),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ SN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYHHLK+VIKKKYG DATN
Sbjct  181  ASFKEAMKMGVEVYHHLKSVIKKKYGHDATN  211



>ref|XP_010050020.1| PREDICTED: enolase-like isoform X1 [Eucalyptus grandis]
Length=491

 Score =   378 bits (970),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   FNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRD  236
             NL   +MA IK VKARQIFDSRGNP VE DV L +  +ARAAVPS ASTGIYEALE+RD
Sbjct  41   LNLRFVAMAKIKCVKARQIFDSRGNPMVEADVTLDDGTFARAAVPSDASTGIYEALEVRD  100

Query  237  GGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGA  416
            G SDYLGKGVSKAV NVN+IIGPALVG DP DQT IDN MVQ+LDGT NEWGWCKQKLGA
Sbjct  101  GSSDYLGKGVSKAVENVNTIIGPALVGMDPRDQTAIDNFMVQKLDGTVNEWGWCKQKLGA  160

Query  417  NAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEF  596
            NAILAVSLAVCKAGAA   IPLY+HIAN+AGN KLVLPVPAFNVINGGSHAGNKLAMQEF
Sbjct  161  NAILAVSLAVCKAGAAANKIPLYKHIANVAGNSKLVLPVPAFNVINGGSHAGNKLAMQEF  220

Query  597  MILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            MILPVGASSFKEAMKMG EVYHHLKA+I+KKYGQDATN
Sbjct  221  MILPVGASSFKEAMKMGVEVYHHLKAIIEKKYGQDATN  258



>gb|ABB46861.2| Enolase, putative, expressed [Oryza sativa Japonica Group]
Length=480

 Score =   377 bits (969),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  37   ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  96

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  97   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  156

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQ FMILP GA+
Sbjct  157  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQAFMILPTGAA  216

Query  621  SFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  217  SFKEAMKMGVEVYHNLKSVIKKKYGQDATN  246



>gb|AAM12985.1| enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis thaliana]
Length=444

 Score =   376 bits (965),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ SN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVIN GSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINDGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  ASFKEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|AAN04181.1| Putative enolase (2-phospho-D-glycerate hydroylase) [Oryza sativa 
Japonica Group]
Length=428

 Score =   375 bits (964),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 196/211 (93%), Gaps = 1/211 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQ-EFMILPVGA  617
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQ EFMILP GA
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQAEFMILPTGA  182

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  ASFKEAMKMGVEVYHNLKSVIKKKYGQDATN  213



>gb|ABD92697.1| los [Brassica rapa subsp. chinensis]
Length=444

 Score =   376 bits (965),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV+ SN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSNGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLA N K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLADNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_010505199.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Camelina 
sativa]
Length=444

 Score =   376 bits (965),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ S      AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF EAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFTEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>ref|XP_010509461.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Camelina 
sativa]
Length=444

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ S      AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF EAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFTEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|AAA21277.1| 2-phospho-D-glycerate hydrolase [Mesembryanthemum crystallinum]
Length=444

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIK VKARQI+DSRGNPTVE D++L +  +ARAAVPSGASTG+YEALE+RDGG DY+G
Sbjct  1    MVTIKCVKARQIYDSRGNPTVEADIHLDDGTYARAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN IIGPALVGKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVYKAVKNVNEIIGPALVGKDPTQQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIA +AGNK +VLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAQVKKIPLYQHIAEIAGNKNMVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGSEVYHNLKSVIKKKYGQDATN  211



>ref|XP_006291136.1| hypothetical protein CARUB_v10017251mg [Capsella rubella]
 gb|EOA24034.1| hypothetical protein CARUB_v10017251mg [Capsella rubella]
Length=444

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MA+I +VKARQIFDSRGNPTVEVDV+ S      AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MASITAVKARQIFDSRGNPTVEVDVHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNYMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_010050029.1| PREDICTED: enolase-like isoform X2 [Eucalyptus grandis]
Length=491

 Score =   377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +3

Query  57   FNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRD  236
             NL   +MA IK VKARQIFDSRGNP VE DV L +  +ARAAVPS ASTGIYEALE+RD
Sbjct  41   LNLRFVAMAKIKCVKARQIFDSRGNPMVEADVTLDDGTFARAAVPSDASTGIYEALEVRD  100

Query  237  GGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGA  416
            G SDYLGKGVSKAV NVN+IIGPALVG DP DQT IDN MVQ+LDGT NEWGWCKQKLGA
Sbjct  101  GSSDYLGKGVSKAVENVNTIIGPALVGMDPRDQTAIDNFMVQKLDGTVNEWGWCKQKLGA  160

Query  417  NAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEF  596
            NAILAVSLAVCKAGAA   IPLY+HIAN+AGN KLVLPVPAFNVINGGSHAGNKLAMQEF
Sbjct  161  NAILAVSLAVCKAGAAANKIPLYKHIANVAGNSKLVLPVPAFNVINGGSHAGNKLAMQEF  220

Query  597  MILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            MILPVGASSFKEAMKMG EVYHHLKA+I+KKYGQDATN
Sbjct  221  MILPVGASSFKEAMKMGVEVYHHLKAIIEKKYGQDATN  258



>ref|XP_010516879.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=444

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD++ S      AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSF EAMKMG EVYHHLK+VIKKKYGQDATN
Sbjct  181  SSFTEAMKMGVEVYHHLKSVIKKKYGQDATN  211



>gb|EEC66609.1| hypothetical protein OsI_32842 [Oryza sativa Indica Group]
 gb|EEE50625.1| hypothetical protein OsJ_30829 [Oryza sativa Japonica Group]
Length=447

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 196/211 (93%), Gaps = 1/211 (0%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+  +ARAAVPSGASTG+YEALE+RDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DN MVQQLDGT+NEWGWCKQKLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQ-EFMILPVGA  617
            A+CKAGA +K IPLYQHIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQ EFMILP GA
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQAEFMILPTGA  182

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  183  ASFKEAMKMGVEVYHNLKSVIKKKYGQDATN  213



>ref|XP_009143574.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Brassica rapa]
Length=444

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ S      AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>sp|Q43130.1|ENO_MESCR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Mesembryanthemum 
crystallinum]
 gb|AAB34986.1| 2-phospho-D-glycerate hydrolase [Mesembryanthemum crystallinum]
Length=444

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M TIK VKARQI+DSRGNPTVE D++L +  +ARAAVPSGASTG+YEALE+RDGG DY+G
Sbjct  1    MVTIKCVKARQIYDSRGNPTVEADIHLDDGTYARAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN IIGPALVGKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVYKAVKNVNEIIGPALVGKDPTQQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYQHIA +AGNK +VLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAQVKKIPLYQHIAEIAGNKNMVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGSEVYHNLKSVIKKKYGQDATN  211



>gb|AAQ77240.1| enolase [Brassica rapa subsp. oleifera]
Length=444

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV+ S+     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPA +GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPASIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_002965441.1| hypothetical protein SELMODRAFT_167539 [Selaginella moellendorffii]
 gb|EFJ32861.1| hypothetical protein SELMODRAFT_167539 [Selaginella moellendorffii]
Length=446

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            +I+ VKAR IFDSRGNPTVEVDV LS+    RAAVPSGASTG+YEALE+RDGG DY+GKG
Sbjct  4    SIQQVKARTIFDSRGNPTVEVDVVLSDKSCYRAAVPSGASTGVYEALELRDGGKDYMGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAVNNVN+IIGPALVGKDPTDQTGIDN MV +LDGTQN+WGWCKQKLGANAILAVSLA
Sbjct  64   VSKAVNNVNAIIGPALVGKDPTDQTGIDNFMVHELDGTQNKWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA V  IPLY HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGASS
Sbjct  124  VCKAGAGVSKIPLYLHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGASS  183

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            F+EAMKMG EVYH LKAVIKKKYG DATN
Sbjct  184  FREAMKMGAEVYHSLKAVIKKKYGLDATN  212



>ref|XP_004494139.1| PREDICTED: enolase-like [Cicer arietinum]
Length=442

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 195/211 (92%), Gaps = 2/211 (1%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MA+I S+KARQIFDSRGNPTVEVD+ +S+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MASITSIKARQIFDSRGNPTVEVDITVSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV+NVNSII PAL+GKDPT QT IDN M  QLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVDNVNSIIAPALIGKDPTQQTEIDNLM--QLDGTVNEWGWCKQKLGANAILAVS  118

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLY+HIAN+AGNK LVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  119  LAVCKAGASVLKIPLYKHIANIAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  178

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFKEAMKMG EVYHHLK+VIKKKYGQDA N
Sbjct  179  TSFKEAMKMGVEVYHHLKSVIKKKYGQDAVN  209



>gb|EEE65047.1| hypothetical protein OsJ_20044 [Oryza sativa Japonica Group]
Length=462

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 194/225 (86%), Gaps = 16/225 (7%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI+SVKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TIQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  V----------------SKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGW  395
            V                 KAV+NVN+IIGPAL+GKDPT+Q  IDN MVQQLDGT N WGW
Sbjct  64   VLKAVSNVNTIIGPALIGKAVSNVNTIIGPALIGKDPTEQVDIDNFMVQQLDGTSNNWGW  123

Query  396  CKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGN  575
            CKQKLGANAILAVSLAVCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGN
Sbjct  124  CKQKLGANAILAVSLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGN  183

Query  576  KLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            KLAMQEFMILP GASSFKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  184  KLAMQEFMILPTGASSFKEAMKMGVEVYHHLKSIIKKKYGQDATN  228



>gb|KHN02262.1| Enolase [Glycine soja]
Length=457

 Score =   374 bits (961),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 183/224 (82%), Positives = 199/224 (89%), Gaps = 13/224 (6%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD+  S+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIVSIKARQIFDSRGNPTVEVDLTCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV+NVN++IGPAL+GKDPT+QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVDNVNTVIGPALIGKDPTEQTAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQ---------  590
            LAVCKAGA+V  IPLY+HIAN+AGNKKLVLPVPAFNVINGGSHAGNKLAMQ         
Sbjct  121  LAVCKAGASVLKIPLYKHIANIAGNKKLVLPVPAFNVINGGSHAGNKLAMQACFLRPFFC  180

Query  591  ----EFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
                EFM+LPVGASSFKEAMKMG EVYH+LK+VIKKKYGQDA N
Sbjct  181  LSVCEFMVLPVGASSFKEAMKMGVEVYHNLKSVIKKKYGQDAIN  224



>ref|XP_009141601.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Brassica 
rapa]
Length=444

 Score =   373 bits (958),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ SN     AAVPSGASTGIYEALE+RD GSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSNGVKVTAAVPSGASTGIYEALELRDCGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>gb|KHN18726.1| Enolase [Glycine soja]
Length=455

 Score =   374 bits (959),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 184/222 (83%), Positives = 197/222 (89%), Gaps = 11/222 (5%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD+  S+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIVSIKARQIFDSRGNPTVEVDLTCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV+NVN+II PALVGKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVDNVNTIIAPALVGKDPTQQTAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQ---------  590
            LAVCKAGAAV  +PLY+HIAN+AGNKKLVLPVPAFNVINGGSHAGNKLAMQ         
Sbjct  121  LAVCKAGAAVLKVPLYKHIANIAGNKKLVLPVPAFNVINGGSHAGNKLAMQACIQRPFFC  180

Query  591  --EFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
              EFM+LPVGASSFKEAMKMG EVYH+LK+VIKKKYGQDA N
Sbjct  181  VWEFMVLPVGASSFKEAMKMGVEVYHNLKSVIKKKYGQDAVN  222



>gb|AFW85966.1| enolase1 [Zea mays]
Length=445

 Score =   373 bits (957),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDN MVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYQHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQ FMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQ-FMILPTGASS  182

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYH+LK++IKKKYGQDATN
Sbjct  183  FKEAMKMGVEVYHNLKSIIKKKYGQDATN  211



>gb|KHG20587.1| Enolase 2 [Gossypium arboreum]
Length=434

 Score =   372 bits (956),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 192/209 (92%), Gaps = 11/209 (5%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEV          RAAVPSGASTGIYEALE+RDGGSD+LGKG
Sbjct  4    TIVSVKARQIFDSRGNPTVEV----------RAAVPSGASTGIYEALELRDGGSDFLGKG  53

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            VSKAV NVN+IIGPAL+GKDPTDQT IDN MVQ LDGTQN+WGWCKQKLGANAILAVSLA
Sbjct  54   VSKAVANVNTIIGPALIGKDPTDQTAIDNFMVQ-LDGTQNQWGWCKQKLGANAILAVSLA  112

Query  444  VCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VKNIPLY+HIANL+GNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  113  VCKAGAEVKNIPLYKHIANLSGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  172

Query  624  FKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            FKEAMKMG EVYHHLKA+IKKKYGQDATN
Sbjct  173  FKEAMKMGVEVYHHLKAMIKKKYGQDATN  201



>emb|CAB75428.1| enolase [Lupinus luteus]
Length=444

 Score =   372 bits (955),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI ++KARQIFDSRGNPTVEVD+ LS+  +ARAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATIATIKARQIFDSRGNPTVEVDLTLSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV+NVN+II PAL+GKDPT+QT IDN +VQ+LDGT NEWGW KQKLGANAILAVS
Sbjct  61   KGVSKAVDNVNTIIAPALIGKDPTEQTAIDNFIVQELDGTVNEWGWGKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+   IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASALKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            S+FKEA+K+G EVYH+LK+VIKKKYGQDA N
Sbjct  181  STFKEALKIGVEVYHNLKSVIKKKYGQDAVN  211



>emb|CDX73592.1| BnaC08g24110D [Brassica napus]
Length=444

 Score =   370 bits (949),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV+ S      A++PSGASTGIYEA+E+RDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSTGVKVTASIPSGASTGIYEAVELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV QLDGTQNEWGWCKQ+LGANAI +VS
Sbjct  61   KGVSKAVRNVNSIIGPALIGKDPTQQTAIDNFMVHQLDGTQNEWGWCKQELGANAIGSVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKVVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHTLKSVIKKKYGQDATN  211



>sp|Q43321.1|ENO_ALNGL RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Alnus 
glutinosa]
 emb|CAA63121.1| enolase [Alnus glutinosa]
Length=440

 Score =   370 bits (949),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MA I  +KARQIFDSRGNPTVE +V  +N   +RAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  1    MAEITHIKARQIFDSRGNPTVEAEVTTANGVVSRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGID-NCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            KGV KAV+NVN IIGPAL+GKD T+QT ID + M QQLDGT NEWGWCKQKLGANAILAV
Sbjct  61   KGVLKAVDNVNKIIGPALIGKDATEQTAIDIDFMFQQLDGTVNEWGWCKQKLGANAILAV  120

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            SLAVCKAGA+VK IPLY+HIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG
Sbjct  121  SLAVCKAGASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  180

Query  615  ASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            ASSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  181  ASSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  212



>gb|AAQ77241.1| enolase [Brassica napus]
Length=444

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ S+     AAVPSGASTGIYEAL +RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALGLRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KG SKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGASKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGG HAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGLHAGNKLAMQEFMILPVGA  180

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  211



>ref|XP_010426928.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=445

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 190/212 (90%), Gaps = 1/212 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ S     RAAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGK-DPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            KGVSKAV NVNSIIGPAL+GK  P  +T IDN MV +LDGTQNEWGWCKQKLGANAILAV
Sbjct  61   KGVSKAVGNVNSIIGPALIGKVTPLLRTAIDNYMVHELDGTQNEWGWCKQKLGANAILAV  120

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            SLAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVG
Sbjct  121  SLAVCKAGAVVNGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  180

Query  615  ASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            ASSF EAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  181  ASSFTEAMKMGVEVYHNLKSVIKKKYGQDATN  212



>ref|XP_006656609.1| PREDICTED: enolase 1-like [Oryza brachyantha]
Length=452

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  141  EVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKGVSKAVNNVNSIIGPALVGK  320
            +VDV LS+  +AR AVPSGASTGIYEALE+RDGGSDYLGKGV KAVNNVN+IIGPAL+GK
Sbjct  29   QVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKGVLKAVNNVNTIIGPALIGK  88

Query  321  DPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIAN  500
            DPT+Q  IDN MVQQLDGT N WGWCKQKLGANAILAVSLAVCKAGA VK IPLYQHIAN
Sbjct  89   DPTEQVDIDNFMVQQLDGTSNNWGWCKQKLGANAILAVSLAVCKAGAMVKKIPLYQHIAN  148

Query  501  LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVI  680
            LAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASSFKEAMKMG EVYHHLK++I
Sbjct  149  LAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASSFKEAMKMGVEVYHHLKSII  208

Query  681  KKKYGQDATN  710
            KKKYGQDATN
Sbjct  209  KKKYGQDATN  218



>emb|CDX84555.1| BnaA03g16750D [Brassica napus]
Length=429

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 179/211 (85%), Gaps = 15/211 (7%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV+ S+     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFN               EFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFN---------------EFMILPVGA  165

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  166  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  196



>emb|CDY65842.1| BnaAnng21140D [Brassica napus]
Length=429

 Score =   338 bits (866),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 178/211 (84%), Gaps = 15/211 (7%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ SN     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSNGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFN               EFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFN---------------EFMILPVGA  165

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  166  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  196



>emb|CDX79684.1| BnaC03g20200D [Brassica napus]
Length=429

 Score =   337 bits (865),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 178/211 (84%), Gaps = 15/211 (7%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ S+     AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFN               EFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFN---------------EFMILPVGA  165

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  166  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  196



>gb|AES75861.2| phosphopyruvate hydratase [Medicago truncatula]
Length=429

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 177/211 (84%), Gaps = 17/211 (8%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            + TIK VKARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTG+YEALE+RDGGSDYLG
Sbjct  2    VVTIKIVKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGVYEALELRDGGSDYLG  61

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVNSII PAL+GKDPT QT IDN MVQQLDGT NEWGWCKQKLGANAILAVS
Sbjct  62   KGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  121

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA  K IPLY+HIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQ         
Sbjct  122  LAVCKAGALAKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQ---------  172

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
                    MG EVYH+LKAVIKKKYGQDATN
Sbjct  173  --------MGVEVYHYLKAVIKKKYGQDATN  195



>emb|CDY33161.1| BnaC04g08780D [Brassica napus]
 emb|CDX75031.1| BnaA05g07770D [Brassica napus]
Length=429

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 177/211 (84%), Gaps = 15/211 (7%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV+ S      AAVPSGASTGIYEALE+RDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDN MV +LDGTQNEWGWCKQKLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFN               EFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFN---------------EFMILPVGA  165

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SSFKEAMKMG EVYH+LK+VIKKKYGQDATN
Sbjct  166  SSFKEAMKMGVEVYHNLKSVIKKKYGQDATN  196



>ref|XP_003619643.1| Enolase [Medicago truncatula]
Length=434

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 177/216 (82%), Gaps = 22/216 (10%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGI-----YEALEMRDGG  242
            + TIK VKARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTGI     YEALE+RDGG
Sbjct  2    VVTIKIVKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGIFGSGVYEALELRDGG  61

Query  243  SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANA  422
            SDYLGKGV KAV NVNSII PAL+GKDPT QT IDN MVQQLDGT NEWGWCKQKLGANA
Sbjct  62   SDYLGKGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANA  121

Query  423  ILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMI  602
            ILAVSLAVCKAGA  K IPLY+HIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQ    
Sbjct  122  ILAVSLAVCKAGALAKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQ----  177

Query  603  LPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
                         MG EVYH+LKAVIKKKYGQDATN
Sbjct  178  -------------MGVEVYHYLKAVIKKKYGQDATN  200



>gb|ETK83693.1| enolase, partial [Phytophthora parasitica]
 gb|ETK83706.1| enolase, partial [Phytophthora parasitica]
Length=215

 Score =   318 bits (815),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>gb|ETL37108.1| enolase, partial [Phytophthora parasitica]
 gb|ETL37122.1| enolase, partial [Phytophthora parasitica]
Length=221

 Score =   318 bits (815),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>gb|EPS60909.1| enolase, partial [Genlisea aurea]
Length=291

 Score =   320 bits (819),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = +3

Query  210  IYEALEMRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEW  389
            IYEALE+RDGGSDYLGKGVSKAVNNVN+II PAL+GK+PT+QT IDN MVQ LDGTQNEW
Sbjct  1    IYEALELRDGGSDYLGKGVSKAVNNVNAIIAPALIGKNPTEQTAIDNFMVQTLDGTQNEW  60

Query  390  GWCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHA  569
            GWCKQKLGANAILAVSLAVCKAGAA  NIPLY+HIANLAGNKKLVLPVPAFNVINGGSHA
Sbjct  61   GWCKQKLGANAILAVSLAVCKAGAASLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHA  120

Query  570  GNKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            GNKLAMQEFMILPVGASSFKEAMKMG EVYHHLKAVIKKKYGQDATN
Sbjct  121  GNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAVIKKKYGQDATN  167



>gb|ETL90278.1| phosphopyruvate hydratase, partial [Phytophthora parasitica]
Length=329

 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>gb|ETO99514.1| enolase, partial [Phytophthora parasitica CJ01A1]
Length=419

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>gb|ETI29888.1| enolase, partial [Phytophthora parasitica P1569]
 gb|ETP41532.1| enolase, partial [Phytophthora parasitica P10297]
Length=453

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>gb|ETP27738.1| enolase, partial [Phytophthora parasitica P10297]
Length=449

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>gb|KDO32627.1| enolase 2 [Saprolegnia parasitica CBS 223.65]
Length=453

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 177/207 (86%), Gaps = 1/207 (0%)
 Frame = +3

Query  87   IKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKGV  266
            I+S+KARQIFDSRGNPTVEVD+ ++     RAAVPSGASTG +EALE+RDGG DY+GKGV
Sbjct  3    IQSIKARQIFDSRGNPTVEVDL-VTEKGLFRAAVPSGASTGEFEALELRDGGKDYMGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLAV  446
              AV NVN II P+L+GK+  +Q  ID  MV+ LDGTQNEWGWCK+KLGAN+ILAVSLAV
Sbjct  62   LTAVKNVNEIIAPSLIGKNEVEQKEIDQYMVEVLDGTQNEWGWCKKKLGANSILAVSLAV  121

Query  447  CKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA KN+PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA+SF
Sbjct  122  CKAGAAAKNVPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGATSF  181

Query  627  KEAMKMGCEVYHHLKAVIKKKYGQDAT  707
             E+MK+G EVYHHLK VI K+YG DAT
Sbjct  182  TESMKIGSEVYHHLKKVINKRYGLDAT  208



>ref|XP_008619366.1| enolase 2 [Saprolegnia diclina VS20]
 gb|EQC27179.1| enolase 2 [Saprolegnia diclina VS20]
Length=453

 Score =   320 bits (821),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 177/207 (86%), Gaps = 1/207 (0%)
 Frame = +3

Query  87   IKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKGV  266
            I+S+KARQIFDSRGNPTVEVD+ ++     RAAVPSGASTG +EALE+RDGG DY+GKGV
Sbjct  3    IQSIKARQIFDSRGNPTVEVDL-VTEKGLFRAAVPSGASTGEFEALELRDGGKDYMGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLAV  446
              AV NVN II P+L+GK+  +Q  ID  MV+ LDGTQNEWGWCK+KLGAN+ILAVSLAV
Sbjct  62   LTAVKNVNEIIAPSLIGKNEVEQKEIDQYMVEVLDGTQNEWGWCKKKLGANSILAVSLAV  121

Query  447  CKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA KN+PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA+SF
Sbjct  122  CKAGAAAKNVPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGAASF  181

Query  627  KEAMKMGCEVYHHLKAVIKKKYGQDAT  707
             E+MK+G EVYHHLK VI K+YG DAT
Sbjct  182  TESMKIGSEVYHHLKKVINKRYGLDAT  208



>gb|ETM43595.1| enolase, partial [Phytophthora parasitica]
 gb|ETM47238.1| enolase, partial [Phytophthora parasitica]
Length=474

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  21   MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  79

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  80   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  139

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  140  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  199

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  200  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  229



>gb|ETI47488.1| enolase, partial [Phytophthora parasitica P1569]
Length=476

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  23   MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  81

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  82   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  141

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  142  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  201

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  202  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  231



>ref|XP_008907532.1| enolase [Phytophthora parasitica INRA-310]
 ref|XP_008916865.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETM97838.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETN07156.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETO72281.1| enolase [Phytophthora parasitica P1976]
Length=483

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  30   MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  88

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  89   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  148

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  149  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  208

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  209  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  238



>gb|ETM43582.1| enolase, partial [Phytophthora parasitica]
Length=482

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  30   MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  88

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  89   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  148

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  149  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  208

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  209  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  238



>ref|XP_011133483.1| enolase, partial [Gregarina niphandrodes]
 gb|EZG43261.1| enolase, partial [Gregarina niphandrodes]
Length=333

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 178/213 (84%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYLG  257
            A I SV ARQI DSRGNPTVEVD+      + RAAVPSGASTGIYEALE+RDG  S YLG
Sbjct  3    AKIVSVHARQILDSRGNPTVEVDLTTEQGCF-RAAVPSGASTGIYEALELRDGDKSTYLG  61

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KA+NNVN+II PALVGKD TDQ G+D  MV+ LDGTQNEWGWCKQKLGANAILA S
Sbjct  62   KGVLKAINNVNTIIAPALVGKDATDQAGLDKLMVESLDGTQNEWGWCKQKLGANAILACS  121

Query  438  LAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+ +AGAA   +PLY+++A LAG   +K  LPVPAFNVINGGSHAGNKLAMQEFMILPV
Sbjct  122  MAISRAGAAASKMPLYKYVAKLAGKPTEKFCLPVPAFNVINGGSHAGNKLAMQEFMILPV  181

Query  612  GASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            GASSF +A++MG EVYH+LK++IKK+YG DATN
Sbjct  182  GASSFSQAVQMGAEVYHNLKSIIKKQYGMDATN  214



>ref|XP_002906751.1| enolase [Phytophthora infestans T30-4]
 gb|EEY66152.1| enolase [Phytophthora infestans T30-4]
Length=454

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 174/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PAL+GKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVKNVNEIIAPALIGKDVTKQAEIDRFMVEKLDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
             +F EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  KNFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>emb|CCI48932.1| unnamed protein product [Albugo candida]
 emb|CCI48939.1| unnamed protein product [Albugo candida]
Length=447

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 177/207 (86%), Gaps = 1/207 (0%)
 Frame = +3

Query  87   IKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKGV  266
            I+S+KARQIFDSRGNPTVEVD++     + RA+VPSGASTG +EA E+RDGG DY+GKGV
Sbjct  3    IRSIKARQIFDSRGNPTVEVDLHTEKGSF-RASVPSGASTGDFEARELRDGGKDYMGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLAV  446
             +A+ NVN II PAL+ K+  DQ+ +D  MV+ LDGT+NEWGWCK+KLGANAILAVSLA+
Sbjct  62   LQAIANVNDIIAPALISKNEVDQSVLDKLMVESLDGTKNEWGWCKEKLGANAILAVSLAI  121

Query  447  CKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA K +PL++HIANLAGN    +PVP+FN+INGGSHAGNKLAMQEFMI+P+GA++F
Sbjct  122  CKAGAAAKEVPLWRHIANLAGNPSPCMPVPSFNIINGGSHAGNKLAMQEFMIVPIGAATF  181

Query  627  KEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            KEAMK+GCEVYH LK VIK +YG DAT
Sbjct  182  KEAMKIGCEVYHTLKKVIKDRYGLDAT  208



>ref|XP_002906750.1| enolase [Phytophthora infestans T30-4]
 gb|EEY66151.1| enolase [Phytophthora infestans T30-4]
Length=454

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 174/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PAL+GKD T Q  ID  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVKNVNEIIAPALIGKDVTKQAEIDRFMVEKLDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
             +F EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  KNFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>ref|XP_005791836.1| hypothetical protein EMIHUDRAFT_420746 [Emiliania huxleyi CCMP1516]
 gb|EOD39407.1| hypothetical protein EMIHUDRAFT_420746 [Emiliania huxleyi CCMP1516]
Length=499

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 182/230 (79%), Gaps = 5/230 (2%)
 Frame = +3

Query  33   ETPVSFSRFNLSSK-SMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTG  209
            E P +     L+SK S   I    ARQIFDSRGNPTVEVDV+ +   + RAAVPSGASTG
Sbjct  36   EDPCAHMSETLASKASPEKITKCVARQIFDSRGNPTVEVDVHTTKGSY-RAAVPSGASTG  94

Query  210  IYEALEMRDG-GSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNE  386
            IYEALE+RD    DY+GKGVS+AV NVN II PAL    P DQ  ID+ MV++LDG QNE
Sbjct  95   IYEALELRDNIKEDYMGKGVSQAVKNVNEIISPALKDMSPIDQKAIDDKMVKELDGQQNE  154

Query  387  WGWCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGN--KKLVLPVPAFNVINGG  560
            WGW K KLGANAILAVS+AVCKAGAA K +PLY+HIANLA N   K+ +PVP+FN+INGG
Sbjct  155  WGWSKSKLGANAILAVSMAVCKAGAAAKGVPLYKHIANLADNPTDKMYMPVPSFNIINGG  214

Query  561  SHAGNKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SHAGNKLAMQEFMILPVGASSF EAMKMG EVYH+LK+VIKKKYGQDA N
Sbjct  215  SHAGNKLAMQEFMILPVGASSFSEAMKMGSEVYHNLKSVIKKKYGQDACN  264



>ref|XP_009834734.1| enolase [Aphanomyces astaci]
 gb|ETV75603.1| enolase [Aphanomyces astaci]
Length=453

 Score =   315 bits (807),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 176/207 (85%), Gaps = 1/207 (0%)
 Frame = +3

Query  87   IKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKGV  266
            I S+KARQIFDSRGNPTVEVD+ ++     RAAVPSGASTG +EALE+RDGG  YLGKGV
Sbjct  3    IISIKARQIFDSRGNPTVEVDL-VTEHGLFRAAVPSGASTGEFEALELRDGGKAYLGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLAV  446
            SKAVNNVNSII PAL+GKD  +Q  +D  MV+ LDGT+NEWGWCK+KLGAN+ILAVSLAV
Sbjct  62   SKAVNNVNSIIAPALIGKDEKNQQELDVYMVETLDGTKNEWGWCKKKLGANSILAVSLAV  121

Query  447  CKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA K +PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILP GA+SF
Sbjct  122  CKAGAAAKGVPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPTGATSF  181

Query  627  KEAMKMGCEVYHHLKAVIKKKYGQDAT  707
             E+M++G EVYH LK VI K+YG DAT
Sbjct  182  TESMQIGTEVYHTLKKVINKRYGLDAT  208



>ref|XP_009515820.1| hypothetical protein PHYSODRAFT_284295 [Phytophthora sojae]
 gb|EGZ28545.1| hypothetical protein PHYSODRAFT_284295 [Phytophthora sojae]
Length=454

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 174/210 (83%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG  Y+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLTTELGQY-RAAVPSGASTGEFEALEMRDGGKAYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PAL+GKD T Q  +D  MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVKNVNEIIAPALIGKDVTKQGELDRYMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+Q+IA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQYIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  TSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>ref|XP_002772277.1| Enolase, putative [Perkinsus marinus ATCC 50983]
 gb|EER04093.1| Enolase, putative [Perkinsus marinus ATCC 50983]
Length=365

 Score =   311 bits (798),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 175/211 (83%), Gaps = 4/211 (2%)
 Frame = +3

Query  87   IKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYLGKG  263
            I ++ AR+I DSRGNPTVEVD+      + RAAVPSGASTG+YEALE+RDG  + YLGKG
Sbjct  5    IVTLHAREIIDSRGNPTVEVDLTTDRGMF-RAAVPSGASTGVYEALELRDGDKTRYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KA+ NVN II PAL+GKD TDQ GID  MV++LDGTQNEWGWCK KLGANAILAVS+A
Sbjct  64   VQKAIKNVNDIIAPALIGKDVTDQAGIDKLMVEELDGTQNEWGWCKAKLGANAILAVSMA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            VC+AGA  KNIPLY+HIA++ G +  +  +PVP+FNVINGGSHAGN+LA QEFMILPVGA
Sbjct  124  VCRAGATAKNIPLYKHIADIGGKRSDQFTMPVPSFNVINGGSHAGNRLACQEFMILPVGA  183

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFK AM++G EVYH LK VIK KYGQDATN
Sbjct  184  TSFKHAMQIGAEVYHSLKKVIKAKYGQDATN  214



>emb|CCA14125.1| unnamed protein product [Albugo laibachii Nc14]
Length=449

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 176/207 (85%), Gaps = 1/207 (0%)
 Frame = +3

Query  87   IKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKGV  266
            I+S+KARQIFDSRGNPTVEVD++  N  + RA+VPSGASTG +EA E+RDGG DY+GKGV
Sbjct  3    IQSIKARQIFDSRGNPTVEVDLHTENGSF-RASVPSGASTGDFEARELRDGGKDYMGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLAV  446
              AV NVN +I PAL+ K+  +Q+ +D  MV+ LDGT NEWGWCK+KLGANAILAVSLA+
Sbjct  62   LHAVANVNDVIAPALLHKNEVNQSELDKMMVESLDGTLNEWGWCKKKLGANAILAVSLAI  121

Query  447  CKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA K IPL++HIA+LAGN    +PVP+FN+INGGSHAGNKLAMQEFMILP+GASSF
Sbjct  122  CKAGAAAKKIPLWKHIADLAGNPSPCMPVPSFNIINGGSHAGNKLAMQEFMILPIGASSF  181

Query  627  KEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            +EAMK+GCEVYH LK VIK +YG DAT
Sbjct  182  QEAMKIGCEVYHTLKKVIKDRYGLDAT  208



>ref|XP_009515818.1| phosphopyruvate hydratase [Phytophthora sojae]
 gb|EGZ28543.1| phosphopyruvate hydratase [Phytophthora sojae]
Length=485

 Score =   314 bits (805),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 176/214 (82%), Gaps = 1/214 (0%)
 Frame = +3

Query  66   SSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGS  245
            S  +M +I ++KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG 
Sbjct  28   SISTMVSIVAIKARQIFDSRGNPTVEVDLTTELGQY-RAAVPSGASTGEFEALEMRDGGK  86

Query  246  DYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAI  425
             Y+GKGV  AV NVN II PAL+GKD T Q  +D  MV++LDGTQNEWGWCK+KLGANAI
Sbjct  87   AYMGKGVLNAVKNVNEIIAPALIGKDVTKQGELDRYMVEELDGTQNEWGWCKKKLGANAI  146

Query  426  LAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMIL  605
            L VSLA+C+AGAA K  PL+Q+IA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMIL
Sbjct  147  LGVSLALCRAGAAAKKQPLWQYIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMIL  206

Query  606  PVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
            PVGA+SF EAMK+G EVYH+LK VIK +YG DAT
Sbjct  207  PVGATSFTEAMKIGSEVYHNLKKVIKGRYGLDAT  240



>gb|AAN31479.1| enolase [Phytophthora infestans]
Length=454

 Score =   313 bits (802),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 173/210 (82%), Gaps = 1/210 (0%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+      + RAAVPSGASTG +EALEMRDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV  AV NVN II PAL+GKD T Q  ID  MV++LDGTQNEWGW K+KLGANAIL VS
Sbjct  60   KGVLNAVKNVNEIIAPALIGKDVTKQAEIDRFMVEKLDGTQNEWGWYKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+QHIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDAT  707
             +F EAMK+G EVYH+LK VIK +YG DAT
Sbjct  180  KNFTEAMKIGSEVYHNLKKVIKGRYGLDAT  209



>ref|XP_001415437.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93729.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=477

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 181/226 (80%), Gaps = 6/226 (3%)
 Frame = +3

Query  33   ETPVSFSRFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGI  212
            + P++F    +  ++   I  V  RQIFDSRGNPTVE DV  ++    RA VPSGASTGI
Sbjct  29   DEPLAFVSEYMKKRTTPAITKVVGRQIFDSRGNPTVEADV-YTHKGMFRAMVPSGASTGI  87

Query  213  YEALEMRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWG  392
            YEA+E+RDGG +Y+GKGV +AV N+N II PAL+GKDP DQ  ID+ M + LDGT N   
Sbjct  88   YEAVELRDGGKEYMGKGVMQAVKNLNEIIAPALIGKDPRDQKAIDDFMCKDLDGTDN---  144

Query  393  WCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAG  572
              K KLGANA+LAVS+AV KAGAA K++PLYQHIA+LAGN KLVLPVPAFNVINGGSHAG
Sbjct  145  --KGKLGANAVLAVSMAVAKAGAAEKDVPLYQHIADLAGNGKLVLPVPAFNVINGGSHAG  202

Query  573  NKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            NKLAMQEFMILPVGASSFKEAM+MG EVYH+LK+VIKKKYGQDA N
Sbjct  203  NKLAMQEFMILPVGASSFKEAMQMGSEVYHNLKSVIKKKYGQDACN  248



>ref|XP_002771110.1| Enolase, putative [Perkinsus marinus ATCC 50983]
 gb|EER02926.1| Enolase, putative [Perkinsus marinus ATCC 50983]
Length=445

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 175/211 (83%), Gaps = 4/211 (2%)
 Frame = +3

Query  87   IKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYLGKG  263
            I ++ AR+I DSRGNPTVEVD+      + RAAVPSGASTG+YEALE+RDG  + YLGKG
Sbjct  5    IVTLHAREIIDSRGNPTVEVDLTTDRGMF-RAAVPSGASTGVYEALELRDGDKTRYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLA  443
            V KA+ NVN II PAL+GKD TDQ GID  MV++LD TQNEWGWCK KLGANAILAVS+A
Sbjct  64   VQKAIKNVNDIIAPALIGKDVTDQAGIDKFMVEELDSTQNEWGWCKAKLGANAILAVSMA  123

Query  444  VCKAGAAVKNIPLYQHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            VC+AGAA KNIPLY+HIA++ G +  +  +PVP+FNVINGGSHAGN+LA QEFMILPVGA
Sbjct  124  VCRAGAAAKNIPLYKHIADIGGKRSDQFTMPVPSFNVINGGSHAGNRLACQEFMILPVGA  183

Query  618  SSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            +SFK AM++G EVYH LK VIK KYGQDATN
Sbjct  184  TSFKHAMQIGAEVYHSLKKVIKAKYGQDATN  214



>ref|XP_003884000.1| unnamed protein product [Neospora caninum Liverpool]
 emb|CBZ53968.1| unnamed protein product [Neospora caninum Liverpool]
Length=475

 Score =   311 bits (796),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 183/232 (79%), Gaps = 4/232 (2%)
 Frame = +3

Query  24   VLFETPVSFSRFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGAS  203
            V F  P S S  +L+   M  IK + ARQI DSRGNPTVEVD+ L++    RAAVPSGAS
Sbjct  14   VRFRYPFSASYPSLTFSKMVAIKDITARQILDSRGNPTVEVDL-LTDGGCFRAAVPSGAS  72

Query  204  TGIYEALEMRDGG-SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQ  380
            TGIYEALE+RD   S +LGK V KAV N++ +I PAL+GKDP DQ GID  MV++LDGT+
Sbjct  73   TGIYEALELRDKDQSKFLGKSVMKAVENIHKVIKPALIGKDPCDQKGIDKLMVEELDGTK  132

Query  381  NEWGWCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVIN  554
            NEWGWCK KLGANAILAVS+A C+AGAA K +PLY++IA LAG    K+V+PVP FNVIN
Sbjct  133  NEWGWCKCKLGANAILAVSMACCRAGAAAKGLPLYKYIATLAGTPTDKMVMPVPFFNVIN  192

Query  555  GGSHAGNKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            GGSHAGNKLAMQEFMI PVGAS+  EA+++G EVYH+LK VIKKKYG DATN
Sbjct  193  GGSHAGNKLAMQEFMIAPVGASTIHEAIQIGAEVYHNLKNVIKKKYGLDATN  244



>ref|XP_002365578.1| enolase 2 [Toxoplasma gondii ME49]
 gb|EPR64867.1| enolase 2 [Toxoplasma gondii GT1]
 gb|EPT28275.1| enolase 2 [Toxoplasma gondii ME49]
 gb|ESS36338.1| enolase 2 [Toxoplasma gondii VEG]
 gb|KFG39200.1| enolase 2 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG52456.1| enolase 2 [Toxoplasma gondii p89]
 gb|KFG54556.1| enolase 2 [Toxoplasma gondii FOU]
 gb|KFG61437.1| enolase 2 [Toxoplasma gondii RUB]
 gb|KFH06202.1| enolase 2 [Toxoplasma gondii VAND]
 gb|KFH16828.1| enolase 2 [Toxoplasma gondii MAS]
Length=475

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 187/235 (80%), Gaps = 10/235 (4%)
 Frame = +3

Query  30   FETPVSFS-----RFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPS  194
            +  P+ F      R++ S+K M  IK + ARQI DSRGNPTVEVD+ L++    RAAVPS
Sbjct  12   YSVPLRFPFCKIYRYSTSNK-MVAIKDITARQILDSRGNPTVEVDL-LTDGGCFRAAVPS  69

Query  195  GASTGIYEALEMRDGG-SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLD  371
            GASTGIYEALE+RD   + ++GKGV KAV N++ II PAL+GKDP DQ GID  MV++LD
Sbjct  70   GASTGIYEALELRDKDQTKFMGKGVMKAVENIHKIIKPALIGKDPCDQKGIDKLMVEELD  129

Query  372  GTQNEWGWCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGN--KKLVLPVPAFN  545
            GT+NEWGWCK KLGANAILAVS+A C+AGAA K +PLY++IA LAGN   K+V+PVP FN
Sbjct  130  GTKNEWGWCKSKLGANAILAVSMACCRAGAAAKGMPLYKYIATLAGNPTDKMVMPVPFFN  189

Query  546  VINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            VINGGSHAGNK+AMQEFMI PVGAS+ +EA+++G EVY HLK VIKKKYG DATN
Sbjct  190  VINGGSHAGNKVAMQEFMIAPVGASTIQEAIQIGAEVYQHLKVVIKKKYGLDATN  244



>ref|XP_008882278.1| enolase 2 [Hammondia hammondi]
 gb|KEP66655.1| enolase 2 [Hammondia hammondi]
Length=475

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 182/230 (79%), Gaps = 8/230 (3%)
 Frame = +3

Query  30   FETPVSFSRFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTG  209
            F     +S FN     M  IK + ARQI DSRGNPTVEVD+ L++    RAAVPSGASTG
Sbjct  20   FRKIYRYSTFN----KMVAIKDITARQILDSRGNPTVEVDL-LTDGGCFRAAVPSGASTG  74

Query  210  IYEALEMRDGG-SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNE  386
            IYEALE+RD   + ++GKGV KAV N++ II PAL+GKDP DQ GID  MV++LDGT+NE
Sbjct  75   IYEALELRDKDQTKFMGKGVMKAVENIHKIIKPALIGKDPCDQKGIDKLMVEELDGTKNE  134

Query  387  WGWCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGN--KKLVLPVPAFNVINGG  560
            WGWCK KLGANAILAVS+A C+AGAA K +PLY++IA LAGN   K+V+PVP FNVINGG
Sbjct  135  WGWCKSKLGANAILAVSMACCRAGAAAKGMPLYKYIATLAGNPTDKMVMPVPFFNVINGG  194

Query  561  SHAGNKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            SHAGNK+AMQEFMI PVGAS+ +EA+++G EVY HLK VIKKKYG DATN
Sbjct  195  SHAGNKVAMQEFMIAPVGASTIQEAIQIGAEVYQHLKIVIKKKYGLDATN  244



>gb|AAB35826.2| enolase, partial [Echinochloa phyllopogon]
Length=180

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = +3

Query  189  PSGASTGIYEALEMRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQL  368
            PSGASTGIYEALE+RD  SDYLGKGV KAV+NVNSIIGPA+ GK+PT+Q  IDN MVQQL
Sbjct  1    PSGASTGIYEALELRDRPSDYLGKGVLKAVDNVNSIIGPAIYGKEPTEQVDIDNLMVQQL  60

Query  369  DGTQNEWGWCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNV  548
            DGT NEWGWCKQKLGANAILA SLA  KAG+ VK IPLYQHIANLAGNKK+VLPVPA NV
Sbjct  61   DGTSNEWGWCKQKLGANAILAASLAAVKAGSMVK-IPLYQHIANLAGNKKIVLPVPALNV  119

Query  549  INGGSHAGNKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            INGGSHAGNKLAMQEFMILP G SSFKE MKMG EVYH+LK++IKKKYGQDATN
Sbjct  120  INGGSHAGNKLAMQEFMILPTGVSSFKEPMKMGVEVYHNLKSIIKKKYGQDATN  173



>sp|Q9BPL7.1|ENO2_TOXGO RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 2; AltName: Full=2-phosphoglycerate dehydratase 
2 [Toxoplasma gondii]
 gb|AAG60329.1|AF123457_1 enolase [Toxoplasma gondii]
 gb|AAP24057.1| enolase 2 [Toxoplasma gondii]
Length=444

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 177/214 (83%), Gaps = 4/214 (2%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYL  254
            M  IK + ARQI DSRGNPTVEVD+ L++    RAAVPSGASTGIYEALE+RD   + ++
Sbjct  1    MVAIKDITARQILDSRGNPTVEVDL-LTDGGCFRAAVPSGASTGIYEALELRDKDQTKFM  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV KAV N++ II PAL+GKDP DQ GID  MV++LDGT+NEWGWCK KLGANAILAV
Sbjct  60   GKGVMKAVENIHKIIKPALIGKDPCDQKGIDKLMVEELDGTKNEWGWCKSKLGANAILAV  119

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGN--KKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            S+A C+AGAA K +PLY++IA LAGN   K+V+PVP FNVINGGSHAGNK+AMQEFMI P
Sbjct  120  SMACCRAGAAAKGMPLYKYIATLAGNPTDKMVMPVPFFNVINGGSHAGNKVAMQEFMIAP  179

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            VGAS+ +EA+++G EVY HLK VIKKKYG DATN
Sbjct  180  VGASTIQEAIQIGAEVYQHLKVVIKKKYGLDATN  213



>emb|CEF96573.1| Enolase, N-terminal [Ostreococcus tauri]
Length=477

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 182/226 (81%), Gaps = 6/226 (3%)
 Frame = +3

Query  33   ETPVSFSRFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGI  212
            + P++F    +  ++   I  V  RQIFDSRGNPTVE DV  ++    RA VPSGASTGI
Sbjct  29   DEPLAFVSEYMKKRTAPAITKVVGRQIFDSRGNPTVEADV-YTHKGMFRAMVPSGASTGI  87

Query  213  YEALEMRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWG  392
            YEA+E+RDGG+ Y+GKGV +AV N+N II PALVGKDP +Q  +D+ M ++LDGT+N   
Sbjct  88   YEAVELRDGGNTYMGKGVQQAVKNLNEIIAPALVGKDPREQKALDDFMCKELDGTEN---  144

Query  393  WCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAG  572
              K KLGANAILAVS+A+ KAGAA K++PLY+H+A+LAGN KLVLPVPAFNVINGGSHAG
Sbjct  145  --KGKLGANAILAVSMAIAKAGAAEKDVPLYKHLADLAGNGKLVLPVPAFNVINGGSHAG  202

Query  573  NKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            NKLAMQEFMILPVGA +FKEAM+MG EVYH+LK+VIKKKYGQDA N
Sbjct  203  NKLAMQEFMILPVGAKTFKEAMQMGSEVYHNLKSVIKKKYGQDACN  248



>ref|XP_002788374.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
 gb|EER20170.1| enolase 2, putative, partial [Perkinsus marinus ATCC 50983]
Length=264

 Score =   297 bits (760),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 172/214 (80%), Gaps = 4/214 (2%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYL  254
            M+TI S+KAR+I DSRGNPTVEVD+   +  + RAA PSGASTG +EALE+RDG  + Y 
Sbjct  1    MSTIISIKAREILDSRGNPTVEVDLTTKDGMF-RAACPSGASTGEFEALELRDGDKARYQ  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV KAV NV  +I PA++GKD TDQ GID  MV++LDGTQNEWGWCK KLGANAILAV
Sbjct  60   GKGVLKAVANVEKVIAPAIIGKDVTDQAGIDKFMVEELDGTQNEWGWCKAKLGANAILAV  119

Query  435  SLAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            S+AVC+AGAA  N+PLYQ+IA LAG   +K ++P P FNVINGG HAGN+LA QEFM++P
Sbjct  120  SMAVCRAGAAASNMPLYQYIAKLAGKDTEKFLMPCPCFNVINGGKHAGNRLACQEFMLVP  179

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GASS  EA+++  EVYH LK+VIK KYGQDATN
Sbjct  180  CGASSIHEAIRIASEVYHELKSVIKAKYGQDATN  213



>ref|XP_002507278.1| enolase [Micromonas sp. RCC299]
 gb|ACO68536.1| enolase [Micromonas sp. RCC299]
Length=477

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 183/225 (81%), Gaps = 8/225 (4%)
 Frame = +3

Query  39   PVSFSRFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYE  218
            P++F    L  ++ A I  V ARQIFDSRGNPTVE DV      + RA  PSGASTGI+E
Sbjct  31   PIAFMAEYLKKQTPAAITKVVARQIFDSRGNPTVEADVYTHKGMF-RAMTPSGASTGIHE  89

Query  219  ALEMRDG-GSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGW  395
            A+E+RDG  + ++GKGV++AV NVNSII PAL+GKDPTDQ GID+ M++ LDGT+N    
Sbjct  90   AVELRDGDATKWMGKGVTRAVENVNSIIAPALIGKDPTDQKGIDDLMIE-LDGTKN----  144

Query  396  CKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGN  575
             K KLGANAILAVS+AV KAGAA K++PLY+HI+ L+GN KLVLPVPAFNVINGGSHAGN
Sbjct  145  -KGKLGANAILAVSMAVSKAGAAEKDVPLYKHISELSGNTKLVLPVPAFNVINGGSHAGN  203

Query  576  KLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            KLAMQEFMILPVGA++F EAM+MG EVYH+LK+VIKKKYGQDA N
Sbjct  204  KLAMQEFMILPVGATTFAEAMRMGSEVYHNLKSVIKKKYGQDACN  248



>gb|AAL05454.1|AF348915_1 enolase [Nitella opaca]
Length=355

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  222  LEMRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCK  401
            LE+RDGG D++GKGV KAV+NVN +I PAL+GKDPT+QT +DN MV++LDGTQNEWGWCK
Sbjct  1    LELRDGGKDFMGKGVLKAVSNVNDVIAPALIGKDPTEQTALDNFMVEELDGTQNEWGWCK  60

Query  402  QKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKL  581
            Q+LGANAILAVSLAVCKAGA  K IPLYQHIANL+GN KLVLPVP+FN+INGGSHAGNKL
Sbjct  61   QRLGANAILAVSLAVCKAGAGAKKIPLYQHIANLSGNTKLVLPVPSFNIINGGSHAGNKL  120

Query  582  AMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            AMQEFMILP GASSFKEAMKMG EVYHHLK++IKKKYGQDATN
Sbjct  121  AMQEFMILPTGASSFKEAMKMGSEVYHHLKSIIKKKYGQDATN  163



>ref|XP_011129750.1| enolase [Gregarina niphandrodes]
 gb|EZG72778.1| enolase [Gregarina niphandrodes]
Length=445

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 179/213 (84%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYLG  257
            + I SV ARQI DSRGNPTVEVD++     + RAAVPSGASTGIYEALE+RDG  + YLG
Sbjct  3    SKIVSVHARQILDSRGNPTVEVDLSTEQGCF-RAAVPSGASTGIYEALELRDGDKTTYLG  61

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KA+NNVN+II PAL+GKD  DQTG+D  MV+ LDGTQNEWGWCKQKLGANAILA S
Sbjct  62   KGVLKAINNVNTIIAPALIGKDAVDQTGLDKLMVETLDGTQNEWGWCKQKLGANAILACS  121

Query  438  LAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+ +AGAA   +PLY+++A LAG   +K VLPVPA NVINGGSHAGNKLAMQEFMILPV
Sbjct  122  MAIARAGAAANKMPLYKYVAKLAGKDTEKFVLPVPAMNVINGGSHAGNKLAMQEFMILPV  181

Query  612  GASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            GA+SF +A++MG EVYH+LK++IKK+YG DATN
Sbjct  182  GATSFSQAIQMGAEVYHNLKSIIKKQYGMDATN  214



>ref|XP_002785646.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
 gb|EER17442.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
Length=445

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 171/214 (80%), Gaps = 4/214 (2%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSD-YL  254
            M+ I SVKAR+I DSRGNPTVEVD+ +++    RAA PSGASTG +EALE+RDG    Y 
Sbjct  1    MSKIISVKAREILDSRGNPTVEVDL-VTDRGMFRAACPSGASTGEFEALELRDGDKKRYG  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV KAV+NVN IIGPA++GKDPTDQTGID  MV++LDGTQNEWGWCK KLGANAIL V
Sbjct  60   GKGVQKAVDNVNKIIGPAIIGKDPTDQTGIDKLMVEELDGTQNEWGWCKAKLGANAILGV  119

Query  435  SLAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            S+AVC+AGAA   +PLY++IA LAG   +K  +P P FNVINGG HAGN+LA QEFM++P
Sbjct  120  SMAVCRAGAATSGMPLYKYIAKLAGKDTEKFTMPCPCFNVINGGKHAGNRLACQEFMLVP  179

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GA S  EA++   EVYH LK+VIK KYGQDATN
Sbjct  180  CGAKSIHEAIRFAAEVYHELKSVIKAKYGQDATN  213



>ref|XP_001014643.1| enolase family protein [Tetrahymena thermophila]
 gb|EAR94453.1| phosphopyruvate hydratase [Tetrahymena thermophila SB210]
Length=464

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 175/214 (82%), Gaps = 4/214 (2%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSD-YL  254
             ++I++V AR+I DSRGNPT+E +V  S   + RAAVPSGASTGIYEALE+RDG    YL
Sbjct  18   FSSIQNVFAREILDSRGNPTIEAEVVTSKGAF-RAAVPSGASTGIYEALELRDGDKKRYL  76

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV KAVNNVN++I PAL GK+P +Q  +D  MV+ LDG++N++GWCK  LGANAIL V
Sbjct  77   GKGVQKAVNNVNNVIAPALKGKNPAEQEKLDRFMVESLDGSKNQYGWCKSNLGANAILGV  136

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            SLA+ +AGAA KNIPLYQ++  LAG K  K +LPVP+ NVINGG HAGNKLAMQEFMILP
Sbjct  137  SLALARAGAAEKNIPLYQYLGQLAGKKQNKYILPVPSLNVINGGKHAGNKLAMQEFMILP  196

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GA+SFKE+M++GCEVYH LK+VIKKKYG DATN
Sbjct  197  TGATSFKESMQIGCEVYHSLKSVIKKKYGLDATN  230



>ref|XP_002948092.1| hypothetical protein VOLCADRAFT_79991 [Volvox carteri f. nagariensis]
 gb|EFJ51080.1| hypothetical protein VOLCADRAFT_79991 [Volvox carteri f. nagariensis]
Length=477

 Score =   298 bits (763),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 177/227 (78%), Gaps = 8/227 (4%)
 Frame = +3

Query  33   ETPVSFSRFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGI  212
            E P+SF    L   S   I  V  RQI DSRGNPTVE DV  +     RAAVPSGASTG+
Sbjct  29   EEPLSFMAKALQQLSPPEIVKVVGRQIIDSRGNPTVEADV-FTRKGMFRAAVPSGASTGV  87

Query  213  YEALEMRDGG-SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEW  389
            +EA+E+RDG  S YLGKGVSKAV N+N+II PAL G DPT+QT IDN M ++LDGT N  
Sbjct  88   HEAVELRDGDKSKYLGKGVSKAVENINAIIAPALKGMDPTNQTEIDNKM-KELDGTDN--  144

Query  390  GWCKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHA  569
               K KLGANAILAVS+AVCKAGAA K +PLY+HIA+LAGN KL+LPVP+FN+INGGSHA
Sbjct  145  ---KGKLGANAILAVSIAVCKAGAAEKGVPLYKHIADLAGNGKLILPVPSFNIINGGSHA  201

Query  570  GNKLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            GN LAMQEFMILPVGASSF EAM+MGCEVYH LK +IK KYGQDA N
Sbjct  202  GNALAMQEFMILPVGASSFAEAMRMGCEVYHALKGLIKSKYGQDACN  248



>ref|XP_008903925.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETN10819.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETP46351.1| enolase [Phytophthora parasitica P10297]
Length=457

 Score =   297 bits (760),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 171/214 (80%), Gaps = 7/214 (3%)
 Frame = +3

Query  72   KSMATIKSVKARQIFDSRGNPTVEVDVNLSNS-HWARAAVPSGASTGIYEALEMRDGGSD  248
            ++ +TI+S+ AR+I DSRGNPTVEVD+ LS S    RA+VPSGASTGI+EA+E+RDGG  
Sbjct  20   RNASTIQSIHAREIIDSRGNPTVEVDLTLSGSTEIFRASVPSGASTGIHEAVELRDGGKR  79

Query  249  YLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAIL  428
            Y GKGV +AV NV S++ P L+G DPT Q  IDN M +++DGT+N     K KLGANAIL
Sbjct  80   YAGKGVQQAVQNVKSVLAPKLIGADPTKQRDIDNLM-REIDGTEN-----KGKLGANAIL  133

Query  429  AVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
             VSLAV KAGA  K +PLYQH A+L GNK LVLPVP+FNVINGGSHAGNKLA QEFM+LP
Sbjct  134  GVSLAVAKAGATAKGVPLYQHFADLIGNKNLVLPVPSFNVINGGSHAGNKLAFQEFMLLP  193

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GA SF EAM MGCEVYH LK+VIKKKYGQDATN
Sbjct  194  TGAESFSEAMVMGCEVYHQLKSVIKKKYGQDATN  227



>gb|AAR97546.1| enolase 1 [Apodachlya brachynema]
Length=401

 Score =   295 bits (755),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  126  GNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSDYLGKGVSKAVNNVNSIIGP  305
            GNP+VEVD+ ++     RAAVPSGASTG +EALE+RDGG DY+GKGV  AV+NVN II P
Sbjct  2    GNPSVEVDL-VTEDGLFRAAVPSGASTGEFEALELRDGGKDYMGKGVKTAVHNVNDIIAP  60

Query  306  ALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLAVCKAGAAVKNIPLY  485
            AL+GKD   QT +D  MV+ LDGT+NEWGWCK+KLGAN+ILAVSLA+CKAGAA + +PL+
Sbjct  61   ALIGKDQNKQTELDTFMVETLDGTKNEWGWCKKKLGANSILAVSLALCKAGAAAEKVPLW  120

Query  486  QHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGCEVYHH  665
            QHIANLAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA+SF E+M++GCEVYH 
Sbjct  121  QHIANLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGATSFTESMQIGCEVYHX  180

Query  666  LKAVIKKKYGQDAT  707
            LK VI K+YG DAT
Sbjct  181  LKKVINKRYGLDAT  194



>ref|XP_011131468.1| enolase [Gregarina niphandrodes]
 gb|EZG55680.1| enolase [Gregarina niphandrodes]
Length=445

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 179/213 (84%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYLG  257
            + I SV ARQI DSRGNPTVEVD++     + RAAVPSGASTGIYEALE+RDG  + YLG
Sbjct  3    SKIVSVHARQILDSRGNPTVEVDLSTEQGCF-RAAVPSGASTGIYEALELRDGDKTTYLG  61

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KA++NVN+II PALVGKD TDQ G+D  MV+ LDGTQNEWGWCKQKLGANAILA S
Sbjct  62   KGVLKAISNVNTIIAPALVGKDVTDQAGLDKLMVETLDGTQNEWGWCKQKLGANAILACS  121

Query  438  LAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+ +AGAA   +PLY+++A LAG   +K VLPVPA NVINGGSHAGNKLAMQEFMILPV
Sbjct  122  MAIARAGAAANKMPLYKYVAKLAGKDTEKFVLPVPAMNVINGGSHAGNKLAMQEFMILPV  181

Query  612  GASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            GA+SF +A++MG EVYH+LK++IKK+YG DATN
Sbjct  182  GATSFSQAIQMGAEVYHNLKSIIKKQYGMDATN  214



>gb|ETO77406.1| enolase [Phytophthora parasitica P1976]
Length=457

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 171/214 (80%), Gaps = 7/214 (3%)
 Frame = +3

Query  72   KSMATIKSVKARQIFDSRGNPTVEVDVNLSNS-HWARAAVPSGASTGIYEALEMRDGGSD  248
            ++ +TI+S+ AR+I DSRGNPTVEVD+ LS S    RA+VPSGASTGI+EA+E+RDGG  
Sbjct  20   RNASTIQSIHAREIIDSRGNPTVEVDLTLSGSTEIFRASVPSGASTGIHEAVELRDGGKR  79

Query  249  YLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAIL  428
            Y GKGV +AV NV S++ P L+G DPT Q  IDN M +++DGT+N     K KLGANAIL
Sbjct  80   YAGKGVQQAVQNVKSVLAPKLIGADPTKQRDIDNLM-REIDGTEN-----KGKLGANAIL  133

Query  429  AVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
             VSLAV KAGA  K +PLYQH A+L GNK LVLPVP+FNVINGGSHAGNKLA QEFM+LP
Sbjct  134  GVSLAVAKAGATAKGVPLYQHFADLIGNKNLVLPVPSFNVINGGSHAGNKLAFQEFMLLP  193

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GA SF EAM MGCEVYH LK+VIKKKYGQDATN
Sbjct  194  TGAESFSEAMVMGCEVYHQLKSVIKKKYGQDATN  227



>dbj|BAE07165.1| enolase 3 [Karenia brevis]
Length=438

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 173/213 (81%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSD-YLG  257
            A + S+KAR+IFDSRGNPTVEVD+ L++ H  RAAVPSGASTGIYEALE+RDG     LG
Sbjct  37   AKVVSIKAREIFDSRGNPTVEVDL-LTDMHLFRAAVPSGASTGIYEALELRDGDKKRLLG  95

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN+IIGP LVG D T Q+ ID  MV+ LDG+QN+WGW K  LGANA+LAVS
Sbjct  96   KGVLKAVENVNTIIGPKLVGMDVTKQSEIDKLMVETLDGSQNDWGWSKSNLGANAVLAVS  155

Query  438  LAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+C+AGAA   IPLY+++A L+G    K V+PVP+FNVINGGSHAGN+LA QEFMILPV
Sbjct  156  MAICRAGAASMQIPLYEYVAYLSGRPTDKFVMPVPSFNVINGGSHAGNRLACQEFMILPV  215

Query  612  GASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            GA SFKEA+ +G EVYH LK+ IKKKYGQDA N
Sbjct  216  GAKSFKEALIIGAEVYHTLKSCIKKKYGQDACN  248



>ref|XP_002772948.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
 gb|EER04764.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
Length=445

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 172/214 (80%), Gaps = 4/214 (2%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYL  254
            M+TI S+KAR+I DSRGNPTVEVD+   +  + RAA PSGASTG +EALE+RDG  + Y 
Sbjct  1    MSTIISIKAREILDSRGNPTVEVDLTTKDGMF-RAACPSGASTGEFEALELRDGDKARYQ  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV KAV NV  +I PA++GKD TDQ GID  MV++LDGTQNEWGWCK KLGANAILAV
Sbjct  60   GKGVLKAVANVEKVIAPAIIGKDVTDQAGIDKFMVEELDGTQNEWGWCKAKLGANAILAV  119

Query  435  SLAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            S+AVC+AGAA  N+PLYQ+IA LAG   +K ++P P FNVINGG HAGN+LA QEFM++P
Sbjct  120  SMAVCRAGAAASNMPLYQYIAKLAGKDTEKFLMPCPCFNVINGGKHAGNRLACQEFMLVP  179

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GASS  EA+++  EVYH LK+VIK KYGQDATN
Sbjct  180  CGASSIHEAIRIASEVYHELKSVIKAKYGQDATN  213



>dbj|BAE07171.1| enolase 3 [Karenia mikimotoi]
Length=438

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 173/213 (81%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   ATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSD-YLG  257
            A + S+KAR+IFDSRGNPTVEVD+ L++ H  RAAVPSGASTG+YEALE+RDG     LG
Sbjct  37   AKVVSIKAREIFDSRGNPTVEVDL-LTDMHLFRAAVPSGASTGVYEALELRDGDKKRLLG  95

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVS  437
            KGV KAV NVN++IGP LVG D T Q+ ID  MV+ LDGTQN+WGW K  LGANAILAVS
Sbjct  96   KGVLKAVENVNNLIGPKLVGMDVTKQSEIDKFMVETLDGTQNDWGWSKSTLGANAILAVS  155

Query  438  LAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+C+AGAA   IPLY++IA L+G    K V+PVP FNVINGGSHAGN+LA QEFMILPV
Sbjct  156  MAICRAGAASMQIPLYEYIAYLSGRSTDKFVMPVPCFNVINGGSHAGNRLACQEFMILPV  215

Query  612  GASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            GA+SFK+A+  G EVYH LK+VIKKKYGQDA N
Sbjct  216  GATSFKDALITGAEVYHTLKSVIKKKYGQDACN  248



>ref|XP_003056091.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59467.1| predicted protein [Micromonas pusilla CCMP1545]
Length=478

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 178/225 (79%), Gaps = 8/225 (4%)
 Frame = +3

Query  39   PVSFSRFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYE  218
            P+SF    L  ++ A I  +  RQIFDSRGNPTVE DV      + RA  PSGASTGI+E
Sbjct  31   PISFMAEYLKKQTPAAITKIVGRQIFDSRGNPTVEADVYTYKGMF-RAMTPSGASTGIHE  89

Query  219  ALEMRDGGSD-YLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGW  395
            A+E+RDG  + ++GKGV KAV N+N+II PAL+GKDP DQ  ID+ M++ LDGT+N    
Sbjct  90   AVELRDGDKEKWMGKGVLKAVENINTIIAPALIGKDPADQKMIDDLMIE-LDGTKN----  144

Query  396  CKQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGN  575
             K KLGANAILAVS+AV KAGAA K +PLY+HI+ LAGN KLVLPVPAFNVINGGSHAGN
Sbjct  145  -KGKLGANAILAVSMAVSKAGAAEKGVPLYKHISELAGNSKLVLPVPAFNVINGGSHAGN  203

Query  576  KLAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            KLAMQEFMILPVGAS+F EAM+MG EVYH+LK+VIKKKYGQDA N
Sbjct  204  KLAMQEFMILPVGASTFAEAMRMGSEVYHNLKSVIKKKYGQDACN  248



>gb|KDO32432.1| enolase [Saprolegnia parasitica CBS 223.65]
Length=449

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 169/216 (78%), Gaps = 7/216 (3%)
 Frame = +3

Query  63   LSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG  242
            L  +  +TIK V AR+I DSRGNPTVEVD+   +  + RA+VPSGASTGI+EA E+RDGG
Sbjct  11   LQRRFASTIKKVHAREIIDSRGNPTVEVDLTTEHGLF-RASVPSGASTGIHEACELRDGG  69

Query  243  SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANA  422
              YLGKGV++AVNNV +I+GP L G DPT Q  ID  M + LDGT+N     K KLGANA
Sbjct  70   KRYLGKGVTQAVNNVKNILGPKLEGMDPTKQADIDQLM-RDLDGTEN-----KGKLGANA  123

Query  423  ILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMI  602
            IL VSLAV KAGA  K +PL+QH A++ GN KLVLPVPAFNVINGGSHAGN LA QEFMI
Sbjct  124  ILGVSLAVAKAGARAKGVPLFQHFADMIGNDKLVLPVPAFNVINGGSHAGNALAFQEFMI  183

Query  603  LPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            LP GA+SF EAM MGCEVYHHLK VIKKKYGQDATN
Sbjct  184  LPTGAASFSEAMAMGCEVYHHLKGVIKKKYGQDATN  219



>ref|XP_002771109.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
 gb|EER02925.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
Length=302

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 167/212 (79%), Gaps = 3/212 (1%)
 Frame = +3

Query  84   TIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYLGK  260
            TI ++KAR+I DSRGNPTVEVD+  +N    RAA PSGASTG +EA+E+RDG  + + GK
Sbjct  4    TITAIKAREILDSRGNPTVEVDLFTNNKGMFRAACPSGASTGEFEAVELRDGDKTRFQGK  63

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSL  440
            GV KAV NV  II PAL+GKD TDQ GID  MV++LDGTQNEWGWCK KLGANAIL+VS+
Sbjct  64   GVLKAVANVEKIIAPALIGKDVTDQAGIDKLMVEELDGTQNEWGWCKAKLGANAILSVSM  123

Query  441  AVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            AVC+AGAA   +PLYQ+IA LAG   +K  +P P FNVINGG HAGN+LA QEFM++P G
Sbjct  124  AVCRAGAAASGMPLYQYIAKLAGKDTEKFTMPCPCFNVINGGKHAGNRLACQEFMLVPCG  183

Query  615  ASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            A S  EA+++  EVYH LK+VIK KYGQDATN
Sbjct  184  AKSIHEAIRIASEVYHELKSVIKAKYGQDATN  215



>gb|AAR97553.1| enolase [Prymnesium parvum]
Length=437

 Score =   294 bits (753),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 166/198 (84%), Gaps = 3/198 (2%)
 Frame = +3

Query  126  GNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYLGKGVSKAVNNVNSIIG  302
            GNPTVEVD+  +     RAAVPSGASTGIYEALEMRDG  S Y+GKGVSKAV+NVN+IIG
Sbjct  2    GNPTVEVDLITAKGQTYRAAVPSGASTGIYEALEMRDGDKSMYMGKGVSKAVHNVNTIIG  61

Query  303  PALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAVSLAVCKAGAAVKNIPL  482
            PALVG DP  Q  ID+ MV+ LDG++N+WGW K KLGANAIL VS+AVCKAGAA K IPL
Sbjct  62   PALVGMDPVQQKEIDDKMVKTLDGSKNDWGWSKSKLGANAILGVSMAVCKAGAASKGIPL  121

Query  483  YQHIANLAGN--KKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGCEV  656
            Y+HIA LAGN   K+ +PVP+FNVINGGSHAGNKLAMQEFMILPVGA+ F EAM+MG EV
Sbjct  122  YKHIAELAGNPTDKMYMPVPSFNVINGGSHAGNKLAMQEFMILPVGATDFTEAMRMGSEV  181

Query  657  YHHLKAVIKKKYGQDATN  710
            YH+LK+VIK KYGQDA N
Sbjct  182  YHNLKSVIKAKYGQDACN  199



>ref|XP_004337411.1| Enolase, Cterminal TIM barrel domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR15398.1| Enolase, Cterminal TIM barrel domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=435

 Score =   294 bits (753),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 177/213 (83%), Gaps = 9/213 (4%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYL  254
            MATI +V ARQIFDSRGNPTVEVDV      + RAAVPSGASTGIYEA+E+RDG  S +L
Sbjct  1    MATITAVHARQIFDSRGNPTVEVDVTTEKGLF-RAAVPSGASTGIYEAIELRDGDKSKWL  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV+KAV+NVN +I P ++GKD T Q  +DN +++ +DGT+N     K  LGANAIL V
Sbjct  60   GKGVTKAVSNVNEVIAPKIIGKDVTKQEELDNLLLE-IDGTEN-----KGNLGANAILGV  113

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGNKKLV-LPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            S+AVCKAGAAVK +PLY+HIA+LAG K+ V LPVPAFN+INGGSHAGNKLAMQEFMILPV
Sbjct  114  SMAVCKAGAAVKGVPLYRHIADLAGKKEAVTLPVPAFNIINGGSHAGNKLAMQEFMILPV  173

Query  612  GASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            GASSF EAM+MG EVYH+LK VIK+KYGQDATN
Sbjct  174  GASSFTEAMRMGVEVYHNLKNVIKEKYGQDATN  206



>ref|XP_009829255.1| enolase [Aphanomyces astaci]
 gb|ETV81397.1| enolase [Aphanomyces astaci]
Length=454

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 172/214 (80%), Gaps = 7/214 (3%)
 Frame = +3

Query  69   SKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSD  248
            ++  +TIK V AR+I DSRGNPTVEVD+      + RA+VPSGASTGI+EA+E+RDGG  
Sbjct  17   ARFASTIKKVHAREIIDSRGNPTVEVDLTTEQGLF-RASVPSGASTGIHEAVELRDGGKR  75

Query  249  YLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAIL  428
            YLGKGV +AVNNV +IIGP L G DPT+Q+ ID  +++QLDGT N     K  LGANAIL
Sbjct  76   YLGKGVIQAVNNVKNIIGPKLEGMDPTNQSEID-LLMKQLDGTDN-----KGNLGANAIL  129

Query  429  AVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
             VSLAV KAGA  K+IPL+QH A+L+GN KLVLPVP+FNVINGGSHAGN+LA QEFMILP
Sbjct  130  GVSLAVAKAGARAKSIPLFQHFADLSGNDKLVLPVPSFNVINGGSHAGNQLAFQEFMILP  189

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GA SF EAM MGCEVYHHLK VIKKKYGQDATN
Sbjct  190  TGAESFSEAMVMGCEVYHHLKGVIKKKYGQDATN  223



>ref|XP_001452406.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAI39017.1| enolase, putative [Paramecium tetraurelia]
 emb|CAK85009.1| unnamed protein product [Paramecium tetraurelia]
Length=449

 Score =   294 bits (753),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 177/214 (83%), Gaps = 4/214 (2%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYL  254
             ++IK+V AR+I DSRGNPTVE DV  S   + R+AVPSGASTGIYEALE+RDG  S YL
Sbjct  7    FSSIKNVIAREILDSRGNPTVEADVITSKGVF-RSAVPSGASTGIYEALELRDGDKSRYL  65

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV+KAV NVN II PALVGK+ T+QT +D  +V+QLDG++N++GW K KLGANAILAV
Sbjct  66   GKGVAKAVANVNEIIRPALVGKNVTEQTKLDKSIVEQLDGSKNKYGWSKSKLGANAILAV  125

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            SL++ +AGAA +N+PLYQ++A LAG +  K V PVP+ NVINGG HAGNKLAMQEFMILP
Sbjct  126  SLSLARAGAAEQNVPLYQYLAQLAGKRTDKFVTPVPSLNVINGGKHAGNKLAMQEFMILP  185

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GA SFK+A+++GCEVYH LK+VIK KYG DATN
Sbjct  186  TGAKSFKDAIQIGCEVYHSLKSVIKSKYGLDATN  219



>ref|XP_001423791.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK56393.1| unnamed protein product [Paramecium tetraurelia]
Length=440

 Score =   294 bits (752),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 177/214 (83%), Gaps = 4/214 (2%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYL  254
             ++IK+V AR+I DSRGNPTVE DV  S   + R+AVPSGASTGIYEALE+RDG  S YL
Sbjct  7    FSSIKNVIAREILDSRGNPTVEADVITSKGVF-RSAVPSGASTGIYEALELRDGDKSRYL  65

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV+KAV NVN +I PALVGK+ T+QT +D  +V+QLDG++N++GW K KLGANAILAV
Sbjct  66   GKGVAKAVANVNEVIRPALVGKNVTEQTKLDKSIVEQLDGSKNKYGWSKSKLGANAILAV  125

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            SL++ +AGAA +N+PLYQ++A LAG +  K V PVP+ NVINGG HAGNKLAMQEFMILP
Sbjct  126  SLSLARAGAAEQNVPLYQYLAQLAGKRTDKFVTPVPSLNVINGGKHAGNKLAMQEFMILP  185

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GA SFK+A+++GCEVYH LK+VIK KYG DATN
Sbjct  186  TGAKSFKDAIQIGCEVYHSLKSVIKSKYGLDATN  219



>emb|CAI39008.1| enolase, putative [Paramecium tetraurelia]
Length=449

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 177/214 (83%), Gaps = 4/214 (2%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGG-SDYL  254
             ++IK+V AR+I DSRGNPTVE DV  S   + R+AVPSGASTGIYEALE+RDG  S YL
Sbjct  7    FSSIKNVIAREILDSRGNPTVEADVITSKGVF-RSAVPSGASTGIYEALELRDGDKSRYL  65

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKGV+KAV NVN +I PALVGK+ T+QT +D  +V+QLDG++N++GW K KLGANAILAV
Sbjct  66   GKGVAKAVANVNEVIRPALVGKNVTEQTKLDKSIVEQLDGSKNKYGWSKSKLGANAILAV  125

Query  435  SLAVCKAGAAVKNIPLYQHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            SL++ +AGAA +N+PLYQ++A LAG +  K V PVP+ NVINGG HAGNKLAMQEFMILP
Sbjct  126  SLSLARAGAAEQNVPLYQYLAQLAGKRTDKFVTPVPSLNVINGGKHAGNKLAMQEFMILP  185

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GA SFK+A+++GCEVYH LK+VIK KYG DATN
Sbjct  186  TGAKSFKDAIQIGCEVYHSLKSVIKSKYGLDATN  219



>ref|XP_007515230.1| enolase [Bathycoccus prasinos]
 emb|CCO14109.1| enolase [Bathycoccus prasinos]
Length=509

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 172/224 (77%), Gaps = 6/224 (3%)
 Frame = +3

Query  39   PVSFSRFNLSSKSMATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYE  218
            P+SF   +L  ++   I  V  RQ+FDSRGNPTVE D+      + RA VPSGASTGIYE
Sbjct  63   PISFMADHLRKQTPPAITKVVGRQVFDSRGNPTVECDIYTGKGMY-RAMVPSGASTGIYE  121

Query  219  ALEMRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWC  398
            A+E+RDGG  ++GKG   AV N+N IIGPAL+GKDP +Q  +D  M ++LDGT N     
Sbjct  122  AVELRDGGKAWMGKGCMTAVKNINEIIGPALIGKDPREQKALDEFMCKELDGTDN-----  176

Query  399  KQKLGANAILAVSLAVCKAGAAVKNIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNK  578
            K KLGANAILAVS A+ KAGA  K IPLY+HI+ LAGN KLVLPVPAFN+INGGSHAGNK
Sbjct  177  KGKLGANAILAVSTALAKAGAGEKGIPLYKHISELAGNSKLVLPVPAFNIINGGSHAGNK  236

Query  579  LAMQEFMILPVGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
            LAMQEFMILPVGA SF EAM+MG EVYH+LK+VIKKKYGQDA N
Sbjct  237  LAMQEFMILPVGAKSFAEAMQMGSEVYHNLKSVIKKKYGQDACN  280



>ref|XP_002783667.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
 gb|EER15463.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
Length=445

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 168/214 (79%), Gaps = 4/214 (2%)
 Frame = +3

Query  78   MATIKSVKARQIFDSRGNPTVEVDVNLSNSHWARAAVPSGASTGIYEALEMRDGGSD-YL  254
            M+ I SVKAR+I DSRGNPTVEVD+ +++    RAA PSGASTG +EALE+RDG    Y 
Sbjct  1    MSKIISVKAREILDSRGNPTVEVDL-VTDRGMFRAACPSGASTGEFEALELRDGDKKRYG  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTGIDNCMVQQLDGTQNEWGWCKQKLGANAILAV  434
            GKG  KAV NVN IIGPA++GKDPTDQ GID  MV++LDGTQNEWGWCK KLGANAIL V
Sbjct  60   GKGAQKAVANVNKIIGPAIIGKDPTDQAGIDKLMVEELDGTQNEWGWCKAKLGANAILGV  119

Query  435  SLAVCKAGAAVKNIPLYQHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            S+AVC+AGAA   +PLYQ+IA LAG   +K  +P P FNVINGG HAGN+LA QEFM++P
Sbjct  120  SMAVCRAGAAASGMPLYQYIAKLAGKDTQKFTMPCPCFNVINGGKHAGNRLACQEFMLVP  179

Query  609  VGASSFKEAMKMGCEVYHHLKAVIKKKYGQDATN  710
             GA S  EA++   EVYH LK+VIK KYGQDATN
Sbjct  180  CGAKSIHEAIRFAAEVYHELKSVIKAKYGQDATN  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1281324548632