BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig943

Length=999
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275453.1|  respiratory burst oxidase homolog protein C        278   8e-82   Solanum tuberosum [potatoes]
ref|NP_001234271.1|  whitefly-induced gp91-phox                         277   2e-81   
ref|XP_009619772.1|  PREDICTED: respiratory burst oxidase homolog...    276   4e-81   Nicotiana tomentosiformis
ref|XP_009775685.1|  PREDICTED: respiratory burst oxidase homolog...    276   5e-81   Nicotiana sylvestris
emb|CAC84140.1|  NADPH oxidase                                          275   8e-81   Nicotiana tabacum [American tobacco]
dbj|BAC56865.1|  respiratory burst oxidase homolog                      272   1e-79   Nicotiana benthamiana
gb|ABW87870.1|  NADPH oxidase                                           267   9e-78   Nicotiana attenuata
emb|CDO98277.1|  unnamed protein product                                265   3e-77   Coffea canephora [robusta coffee]
ref|XP_011073263.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    263   2e-76   Sesamum indicum [beniseed]
gb|EYU21773.1|  hypothetical protein MIMGU_mgv1a002672mg                254   9e-75   Erythranthe guttata [common monkey flower]
ref|XP_007038195.1|  NADPH/respiratory burst oxidase protein D          251   5e-72   
gb|AII25876.1|  NADPH oxidase A                                         250   7e-72   Camellia sinensis [black tea]
gb|KDO57669.1|  hypothetical protein CISIN_1g003558mg                   234   2e-66   Citrus sinensis [apfelsine]
gb|KDO57668.1|  hypothetical protein CISIN_1g003558mg                   234   2e-66   Citrus sinensis [apfelsine]
ref|XP_006485050.1|  PREDICTED: respiratory burst oxidase homolog...    233   1e-65   Citrus sinensis [apfelsine]
ref|XP_006437008.1|  hypothetical protein CICLE_v10030649mg             232   2e-65   Citrus clementina [clementine]
ref|XP_010249370.1|  PREDICTED: respiratory burst oxidase homolog...    230   1e-64   Nelumbo nucifera [Indian lotus]
ref|XP_011015154.1|  PREDICTED: respiratory burst oxidase homolog...    229   3e-64   Populus euphratica
ref|XP_011003531.1|  PREDICTED: respiratory burst oxidase homolog...    229   3e-64   Populus euphratica
ref|XP_008797083.1|  PREDICTED: respiratory burst oxidase homolog...    228   6e-64   Phoenix dactylifera
ref|XP_002511059.1|  respiratory burst oxidase, putative                228   7e-64   
ref|XP_007210905.1|  hypothetical protein PRUPE_ppa000984mg             226   4e-63   Prunus persica
ref|XP_006844712.1|  PREDICTED: respiratory burst oxidase homolog...    226   4e-63   Amborella trichopoda
ref|XP_008239295.1|  PREDICTED: respiratory burst oxidase homolog...    225   6e-63   Prunus mume [ume]
ref|XP_002318793.2|  respiratory burst oxidase C family protein         224   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010250429.1|  PREDICTED: respiratory burst oxidase homolog...    222   8e-62   Nelumbo nucifera [Indian lotus]
ref|XP_002322314.2|  respiratory burst oxidase C family protein         220   3e-61   
gb|KJB07927.1|  hypothetical protein B456_001G053300                    219   7e-61   Gossypium raimondii
ref|XP_012090542.1|  PREDICTED: respiratory burst oxidase homolog...    218   2e-60   Jatropha curcas
ref|XP_011040313.1|  PREDICTED: respiratory burst oxidase homolog...    218   3e-60   Populus euphratica
ref|XP_010929525.1|  PREDICTED: respiratory burst oxidase homolog...    217   4e-60   Elaeis guineensis
gb|ADR70880.1|  respiratory burst oxidase A                             215   2e-59   Manihot esculenta [manioc]
gb|KHG02500.1|  Respiratory burst oxidase C                             214   4e-59   Gossypium arboreum [tree cotton]
gb|KJB51324.1|  hypothetical protein B456_008G212100                    211   2e-58   Gossypium raimondii
gb|KJB51327.1|  hypothetical protein B456_008G212100                    211   4e-58   Gossypium raimondii
gb|KJB51328.1|  hypothetical protein B456_008G212100                    211   5e-58   Gossypium raimondii
gb|KJB51323.1|  hypothetical protein B456_008G212100                    211   5e-58   Gossypium raimondii
gb|KJB51326.1|  hypothetical protein B456_008G212100                    211   6e-58   Gossypium raimondii
gb|KHG00108.1|  Respiratory burst oxidase C                             209   2e-57   Gossypium arboreum [tree cotton]
ref|XP_008807835.1|  PREDICTED: respiratory burst oxidase homolog...    209   3e-57   
ref|XP_008807834.1|  PREDICTED: respiratory burst oxidase homolog...    209   3e-57   Phoenix dactylifera
ref|XP_008807833.1|  PREDICTED: respiratory burst oxidase homolog...    209   3e-57   Phoenix dactylifera
gb|KJB19752.1|  hypothetical protein B456_003G117900                    206   1e-56   Gossypium raimondii
gb|KJB19751.1|  hypothetical protein B456_003G117900                    206   4e-56   Gossypium raimondii
ref|XP_010942321.1|  PREDICTED: respiratory burst oxidase homolog...    204   2e-55   Elaeis guineensis
gb|ADQ74913.1|  respiratory burst oxidase protein 1                     198   3e-53   Picea abies
ref|XP_009404193.1|  PREDICTED: respiratory burst oxidase homolog...    197   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011082784.1|  PREDICTED: respiratory burst oxidase homolog...    195   2e-52   Sesamum indicum [beniseed]
ref|XP_009792212.1|  PREDICTED: respiratory burst oxidase homolog...    192   1e-51   Nicotiana sylvestris
ref|XP_009792218.1|  PREDICTED: respiratory burst oxidase homolog...    192   2e-51   Nicotiana sylvestris
ref|XP_009792203.1|  PREDICTED: respiratory burst oxidase homolog...    192   4e-51   Nicotiana sylvestris
gb|ADR70892.1|  respiratory burst oxidase C                             191   7e-51   Manihot esculenta [manioc]
ref|XP_010657584.1|  PREDICTED: respiratory burst oxidase homolog...    186   9e-49   Vitis vinifera
gb|EPS73914.1|  hypothetical protein M569_00842                         183   5e-48   Genlisea aurea
ref|XP_004979405.1|  PREDICTED: respiratory burst oxidase homolog...    180   7e-47   Setaria italica
ref|XP_009421001.1|  PREDICTED: respiratory burst oxidase homolog...    176   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010032776.1|  PREDICTED: respiratory burst oxidase homolog...    176   2e-45   Eucalyptus grandis [rose gum]
gb|KHN31235.1|  Respiratory burst oxidase like protein C                176   3e-45   Glycine soja [wild soybean]
ref|XP_002450884.1|  hypothetical protein SORBIDRAFT_05g020380          175   5e-45   
gb|ABA94089.2|  respiratory burst oxidase protein D, putative, ex...    174   7e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007137830.1|  hypothetical protein PHAVU_009G159200g             174   9e-45   Phaseolus vulgaris [French bean]
gb|AEX56133.1|  NADPH oxidase                                           174   9e-45   Phaseolus vulgaris [French bean]
gb|ADR70882.1|  respiratory burst oxidase D                             174   1e-44   Manihot esculenta [manioc]
gb|ACF05504.2|  respiratory burst oxidase-like protein                  174   1e-44   Citrullus colocynthis [alhandal]
gb|AFW64932.1|  respiratory burst oxidase protein D variant beta        171   2e-44   
ref|NP_001108123.1|  LOC100136880 isoform 2                             171   2e-44   
ref|XP_008375433.1|  PREDICTED: respiratory burst oxidase homolog...    173   2e-44   Malus domestica [apple tree]
ref|XP_009360267.1|  PREDICTED: respiratory burst oxidase homolog...    172   3e-44   Pyrus x bretschneideri [bai li]
ref|XP_003522455.1|  PREDICTED: respiratory burst oxidase homolog...    172   4e-44   Glycine max [soybeans]
gb|AFW64934.1|  hypothetical protein ZEAMMB73_295489                    171   4e-44   
ref|XP_008465165.1|  PREDICTED: respiratory burst oxidase homolog...    172   6e-44   Cucumis melo [Oriental melon]
ref|XP_009610990.1|  PREDICTED: respiratory burst oxidase homolog...    169   1e-43   
ref|XP_003577502.1|  PREDICTED: respiratory burst oxidase homolog...    171   1e-43   Brachypodium distachyon [annual false brome]
ref|XP_009610989.1|  PREDICTED: respiratory burst oxidase homolog...    169   1e-43   Nicotiana tomentosiformis
gb|AFW64933.1|  respiratory burst oxidase protein D variant alpha       170   2e-43   
ref|NP_001157759.1|  LOC100136880 isoform 1                             170   2e-43   Zea mays [maize]
ref|XP_009610988.1|  PREDICTED: respiratory burst oxidase homolog...    169   3e-43   Nicotiana tomentosiformis
ref|XP_002268641.1|  PREDICTED: respiratory burst oxidase homolog...    169   4e-43   Vitis vinifera
ref|XP_009610987.1|  PREDICTED: respiratory burst oxidase homolog...    169   5e-43   Nicotiana tomentosiformis
gb|KJB58284.1|  hypothetical protein B456_009G202500                    168   1e-42   Gossypium raimondii
ref|XP_007017524.1|  Respiratory burst oxidase D                        166   6e-42   
ref|XP_007225362.1|  hypothetical protein PRUPE_ppa000883mg             166   9e-42   Prunus persica
emb|CBI29289.3|  unnamed protein product                                165   2e-41   Vitis vinifera
ref|XP_008369593.1|  PREDICTED: respiratory burst oxidase homolog...    164   4e-41   Malus domestica [apple tree]
ref|XP_002512702.1|  respiratory burst oxidase, putative                162   4e-41   
ref|XP_003526909.1|  PREDICTED: respiratory burst oxidase homolog...    164   5e-41   Glycine max [soybeans]
gb|KHN09692.1|  Respiratory burst oxidase like protein C                163   6e-41   Glycine soja [wild soybean]
gb|KJB59802.1|  hypothetical protein B456_009G273400                    161   8e-41   Gossypium raimondii
ref|XP_008222292.1|  PREDICTED: respiratory burst oxidase homolog...    163   9e-41   Prunus mume [ume]
ref|XP_009353482.1|  PREDICTED: respiratory burst oxidase homolog...    162   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_009390376.1|  PREDICTED: respiratory burst oxidase homolog...    162   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299201.1|  PREDICTED: respiratory burst oxidase homolog...    162   1e-40   Fragaria vesca subsp. vesca
gb|EEC68302.1|  hypothetical protein OsI_36373                          162   1e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_012088674.1|  PREDICTED: respiratory burst oxidase homolog...    162   2e-40   Jatropha curcas
ref|XP_003602726.1|  Respiratory burst oxidase-like protein             162   2e-40   Medicago truncatula
ref|XP_009359839.1|  PREDICTED: respiratory burst oxidase homolog...    162   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_008378424.1|  PREDICTED: respiratory burst oxidase homolog...    161   5e-40   
gb|KJB59801.1|  hypothetical protein B456_009G273400                    160   8e-40   Gossypium raimondii
gb|KHG05306.1|  Respiratory burst oxidase D -like protein               159   1e-39   Gossypium arboreum [tree cotton]
gb|KJB14501.1|  hypothetical protein B456_002G128200                    158   2e-39   Gossypium raimondii
ref|XP_004141156.1|  PREDICTED: respiratory burst oxidase homolog...    158   4e-39   Cucumis sativus [cucumbers]
ref|XP_006423884.1|  hypothetical protein CICLE_v10027774mg             158   4e-39   
ref|XP_006487656.1|  PREDICTED: respiratory burst oxidase homolog...    158   5e-39   Citrus sinensis [apfelsine]
ref|XP_004503030.1|  PREDICTED: respiratory burst oxidase homolog...    157   9e-39   Cicer arietinum [garbanzo]
gb|KJB45301.1|  hypothetical protein B456_007G299500                    157   1e-38   Gossypium raimondii
ref|XP_009404716.1|  PREDICTED: respiratory burst oxidase homolog...    156   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404717.1|  PREDICTED: respiratory burst oxidase homolog...    156   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ97450.1|  predicted protein                                      156   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03403.1|  predicted protein                                      155   3e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002303736.2|  hypothetical protein POPTR_0003s15810g             155   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010536571.1|  PREDICTED: respiratory burst oxidase homolog...    154   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_011020924.1|  PREDICTED: respiratory burst oxidase homolog...    153   3e-37   Populus euphratica
ref|XP_004241641.1|  PREDICTED: respiratory burst oxidase homolog...    152   3e-37   Solanum lycopersicum
dbj|BAJ94299.1|  predicted protein                                      152   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86360.1|  predicted protein                                      152   5e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGI65628.1|  NADPH oxidase                                           150   1e-36   Fragaria x ananassa
ref|XP_010530642.1|  PREDICTED: respiratory burst oxidase homolog...    147   2e-35   Tarenaya hassleriana [spider flower]
sp|Q2HXK9.2|RBOHD_SOLTU  RecName: Full=Respiratory burst oxidase ...    147   2e-35   Solanum tuberosum [potatoes]
ref|XP_010522982.1|  PREDICTED: respiratory burst oxidase homolog...    147   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_010259644.1|  PREDICTED: respiratory burst oxidase homolog...    146   5e-35   Nelumbo nucifera [Indian lotus]
gb|AAC39477.1|  respiratory burst oxidase protein C                     145   6e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAS15724.1|  respiratory burst oxidase protein C                     145   7e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41837.1|  putative respiratory burst oxidase protein             145   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199919.1|  Respiratory burst oxidase homolog protein C           145   8e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AFJ66196.1|  hypothetical protein 7G9.15                             145   1e-34   Boechera stricta
ref|XP_006279397.1|  hypothetical protein CARUB_v10007974mg             145   1e-34   Capsella rubella
gb|AFJ66168.1|  hypothetical protein 11M19.12                           145   1e-34   Arabidopsis halleri
ref|XP_010482026.1|  PREDICTED: respiratory burst oxidase homolog...    144   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_007030987.1|  Respiratory burst oxidase B                        144   3e-34   
gb|AAC39479.1|  respiratory burst oxidase protein D                     144   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199602.1|  respiratory burst oxidase-D                           144   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863831.1|  hypothetical protein ARALYDRAFT_917612             142   9e-34   Arabidopsis lyrata subsp. lyrata
gb|KFK36751.1|  hypothetical protein AALP_AA4G165200                    142   1e-33   Arabis alpina [alpine rockcress]
ref|XP_002299364.2|  hypothetical protein POPTR_0001s12650g             142   2e-33   
ref|XP_002865839.1|  hypothetical protein ARALYDRAFT_495172             142   2e-33   
ref|XP_002512422.1|  respiratory burst oxidase, putative                141   2e-33   Ricinus communis
gb|KHN17442.1|  Respiratory burst oxidase like protein C                140   4e-33   Glycine soja [wild soybean]
ref|XP_003525163.2|  PREDICTED: respiratory burst oxidase homolog...    140   4e-33   
ref|XP_006402027.1|  hypothetical protein EUTSA_v10012613mg             140   4e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010442849.1|  PREDICTED: respiratory burst oxidase homolog...    140   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010442839.1|  PREDICTED: respiratory burst oxidase homolog...    140   6e-33   Camelina sativa [gold-of-pleasure]
emb|CDY38845.1|  BnaA03g13340D                                          140   7e-33   Brassica napus [oilseed rape]
ref|XP_009132634.1|  PREDICTED: respiratory burst oxidase homolog...    140   8e-33   Brassica rapa
ref|XP_010442586.1|  PREDICTED: respiratory burst oxidase homolog...    140   8e-33   Camelina sativa [gold-of-pleasure]
emb|CDY32647.1|  BnaC03g16150D                                          139   9e-33   Brassica napus [oilseed rape]
ref|XP_012089018.1|  PREDICTED: respiratory burst oxidase homolog...    139   1e-32   Jatropha curcas
gb|AFJ66221.1|  hypothetical protein 34G24.26                           139   1e-32   Capsella rubella
ref|XP_006282261.1|  hypothetical protein CARUB_v10028541mg             139   1e-32   Capsella rubella
ref|XP_008670768.1|  PREDICTED: respiratory burst oxidase homolog...    139   1e-32   
tpg|DAA42070.1|  TPA: hypothetical protein ZEAMMB73_604696              139   2e-32   
emb|CDX85316.1|  BnaC07g26270D                                          138   3e-32   
ref|XP_010438870.1|  PREDICTED: respiratory burst oxidase homolog...    138   4e-32   Camelina sativa [gold-of-pleasure]
gb|KFK35232.1|  hypothetical protein AALP_AA5G257400                    137   5e-32   Arabis alpina [alpine rockcress]
ref|XP_003630437.1|  Respiratory burst oxidase-like protein             137   5e-32   Medicago truncatula
gb|AAW78863.1|  respiratory burst oxidase 1                             137   5e-32   Medicago truncatula
ref|XP_010482435.1|  PREDICTED: respiratory burst oxidase homolog...    137   5e-32   Camelina sativa [gold-of-pleasure]
gb|KHN43296.1|  Respiratory burst oxidase like protein B                137   8e-32   Glycine soja [wild soybean]
ref|XP_009151593.1|  PREDICTED: respiratory burst oxidase homolog...    135   2e-31   Brassica rapa
emb|CDX86335.1|  BnaA06g30520D                                          135   2e-31   
ref|XP_010523349.1|  PREDICTED: respiratory burst oxidase homolog...    135   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_010523340.1|  PREDICTED: respiratory burst oxidase homolog...    135   4e-31   Tarenaya hassleriana [spider flower]
gb|KDO56233.1|  hypothetical protein CISIN_1g002711mg                   135   4e-31   Citrus sinensis [apfelsine]
ref|XP_006433403.1|  hypothetical protein CICLE_v10000227mg             134   4e-31   Citrus clementina [clementine]
ref|XP_007147029.1|  hypothetical protein PHAVU_006G090200g             134   4e-31   Phaseolus vulgaris [French bean]
ref|XP_003554649.1|  PREDICTED: respiratory burst oxidase homolog...    134   5e-31   Glycine max [soybeans]
ref|XP_003532261.1|  PREDICTED: respiratory burst oxidase homolog...    134   6e-31   Glycine max [soybeans]
ref|XP_010112007.1|  Respiratory burst oxidase-like protein D           134   1e-30   
ref|XP_009402525.1|  PREDICTED: respiratory burst oxidase homolog...    133   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009778242.1|  PREDICTED: respiratory burst oxidase homolog...    132   2e-30   Nicotiana sylvestris
ref|XP_009129697.1|  PREDICTED: respiratory burst oxidase homolog...    132   3e-30   Brassica rapa
emb|CDY45918.1|  BnaAnng07990D                                          132   3e-30   Brassica napus [oilseed rape]
ref|XP_008450638.1|  PREDICTED: respiratory burst oxidase homolog...    130   6e-30   Cucumis melo [Oriental melon]
ref|XP_008246413.1|  PREDICTED: respiratory burst oxidase homolog...    130   1e-29   
ref|XP_008246416.1|  PREDICTED: respiratory burst oxidase homolog...    130   1e-29   Prunus mume [ume]
ref|XP_008450637.1|  PREDICTED: respiratory burst oxidase homolog...    130   2e-29   Cucumis melo [Oriental melon]
ref|XP_011659890.1|  PREDICTED: respiratory burst oxidase homolog...    128   3e-29   Cucumis sativus [cucumbers]
gb|EYU24549.1|  hypothetical protein MIMGU_mgv1a001003mg                129   4e-29   Erythranthe guttata [common monkey flower]
ref|XP_006382490.1|  respiratory burst oxidase protein B                129   5e-29   
ref|XP_011036858.1|  PREDICTED: respiratory burst oxidase homolog...    128   8e-29   Populus euphratica
ref|XP_004135613.1|  PREDICTED: respiratory burst oxidase homolog...    128   8e-29   Cucumis sativus [cucumbers]
ref|XP_010931626.1|  PREDICTED: respiratory burst oxidase homolog...    127   1e-28   Elaeis guineensis
gb|AEP25512.1|  putative respiratory burst oxidase-like protein A       127   2e-28   Vicia faba [broad bean]
ref|XP_004309557.1|  PREDICTED: respiratory burst oxidase homolog...    127   2e-28   Fragaria vesca subsp. vesca
ref|XP_003521697.1|  PREDICTED: respiratory burst oxidase homolog...    126   2e-28   Glycine max [soybeans]
ref|NP_001274981.1|  respiratory burst oxidase homolog protein B        126   3e-28   Solanum tuberosum [potatoes]
ref|XP_002283888.1|  PREDICTED: respiratory burst oxidase homolog...    125   5e-28   Vitis vinifera
emb|CAN64415.1|  hypothetical protein VITISV_013316                     125   5e-28   Vitis vinifera
ref|XP_006395230.1|  hypothetical protein EUTSA_v10003619mg             125   5e-28   Eutrema salsugineum [saltwater cress]
ref|XP_008800853.1|  PREDICTED: respiratory burst oxidase homolog...    125   7e-28   Phoenix dactylifera
ref|XP_004503856.1|  PREDICTED: respiratory burst oxidase homolog...    125   8e-28   Cicer arietinum [garbanzo]
gb|KCW61821.1|  hypothetical protein EUGRSUZ_H04514                     124   8e-28   Eucalyptus grandis [rose gum]
ref|XP_010269487.1|  PREDICTED: respiratory burst oxidase homolog...    125   1e-27   Nelumbo nucifera [Indian lotus]
gb|KHN16903.1|  Respiratory burst oxidase like protein C                124   1e-27   Glycine soja [wild soybean]
ref|XP_010025215.1|  PREDICTED: respiratory burst oxidase homolog...    124   1e-27   Eucalyptus grandis [rose gum]
emb|CDY35764.1|  BnaC02g38300D                                          124   2e-27   Brassica napus [oilseed rape]
ref|XP_010041041.1|  PREDICTED: respiratory burst oxidase homolog...    124   2e-27   Eucalyptus grandis [rose gum]
gb|KCW44695.1|  hypothetical protein EUGRSUZ_L017712                    124   2e-27   Eucalyptus grandis [rose gum]
ref|XP_009611315.1|  PREDICTED: respiratory burst oxidase homolog...    123   3e-27   Nicotiana tomentosiformis
gb|KDP44025.1|  hypothetical protein JCGZ_05492                         117   4e-27   Jatropha curcas
gb|ADR70881.1|  respiratory burst oxidase B                             122   5e-27   Manihot esculenta [manioc]
ref|XP_010674039.1|  PREDICTED: respiratory burst oxidase homolog...    122   6e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010644201.1|  PREDICTED: respiratory burst oxidase homolog...    121   1e-26   Vitis vinifera
ref|XP_007206556.1|  hypothetical protein PRUPE_ppa019730mg             121   1e-26   Prunus persica
ref|XP_004230232.1|  PREDICTED: respiratory burst oxidase homolog...    120   2e-26   Solanum lycopersicum
ref|XP_003602723.1|  Respiratory burst oxidase-like protein             118   1e-25   Medicago truncatula
ref|XP_008670770.1|  PREDICTED: respiratory burst oxidase homolog...    118   2e-25   
ref|XP_004494602.1|  PREDICTED: respiratory burst oxidase homolog...    117   2e-25   Cicer arietinum [garbanzo]
tpg|DAA42073.1|  TPA: hypothetical protein ZEAMMB73_696625              117   3e-25   
ref|XP_007159934.1|  hypothetical protein PHAVU_002G279700g             115   9e-25   Phaseolus vulgaris [French bean]
ref|XP_003626254.1|  Respiratory burst oxidase-like protein             114   2e-24   
ref|XP_003536070.1|  PREDICTED: respiratory burst oxidase homolog...    115   2e-24   
ref|XP_003626253.1|  Respiratory burst oxidase-like protein             114   3e-24   Medicago truncatula
ref|XP_003626255.1|  Respiratory burst oxidase-like protein             114   3e-24   
ref|XP_003556516.1|  PREDICTED: respiratory burst oxidase homolog...    114   4e-24   Glycine max [soybeans]
ref|XP_003591142.1|  Respiratory burst oxidase-like protein             113   5e-24   Medicago truncatula
ref|XP_006399223.1|  hypothetical protein EUTSA_v10012617mg             113   6e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010452698.1|  PREDICTED: respiratory burst oxidase homolog...    112   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010423214.1|  PREDICTED: respiratory burst oxidase homolog...    111   4e-23   
gb|EMT26659.1|  hypothetical protein F775_52502                         110   1e-22   
ref|XP_010491345.1|  PREDICTED: respiratory burst oxidase homolog...    109   2e-22   Camelina sativa [gold-of-pleasure]
emb|CBI39505.3|  unnamed protein product                                108   3e-22   Vitis vinifera
emb|CDP15485.1|  unnamed protein product                                107   4e-22   Coffea canephora [robusta coffee]
ref|XP_007144946.1|  hypothetical protein PHAVU_007G196800g             107   5e-22   Phaseolus vulgaris [French bean]
ref|XP_002873307.1|  respiratory burst oxidase protein A                107   7e-22   
gb|EEC69442.1|  hypothetical protein OsI_38619                          107   8e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_004495711.1|  PREDICTED: respiratory burst oxidase homolog...    106   1e-21   Cicer arietinum [garbanzo]
ref|XP_010549734.1|  PREDICTED: respiratory burst oxidase homolog...    103   1e-20   Tarenaya hassleriana [spider flower]
gb|ABA99454.2|  respiratory burst oxidase, putative, expressed          101   6e-20   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99453.1|  respiratory burst oxidase, putative, expressed          101   7e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010445141.1|  PREDICTED: putative respiratory burst oxidas...  99.8    8e-20   
gb|EAZ20766.1|  hypothetical protein OsJ_36390                          100   8e-20   Oryza sativa Japonica Group [Japonica rice]
emb|CDX98976.1|  BnaC09g48590D                                          100   9e-20   
ref|NP_001190250.1|  Respiratory burst oxidase-A                        100   1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196356.1|  Respiratory burst oxidase-A                           100   2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122345.1|  PREDICTED: respiratory burst oxidase homolog...    100   2e-19   Brassica rapa
emb|CDX70035.1|  BnaA10g23840D                                        99.8    2e-19   
gb|AAC39475.1|  respiratory burst oxidase protein A                   99.8    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448480.1|  PREDICTED: putative respiratory burst oxidas...  99.8    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006285093.1|  hypothetical protein CARUB_v10006425mg           99.8    2e-19   Capsella rubella
ref|XP_010433689.1|  PREDICTED: putative respiratory burst oxidas...  99.8    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010433690.1|  PREDICTED: putative respiratory burst oxidas...  99.4    2e-19   
ref|XP_009137496.1|  PREDICTED: putative respiratory burst oxidas...  96.3    3e-18   Brassica rapa
ref|XP_006283129.1|  hypothetical protein CARUB_v10004156mg           94.7    8e-18   Capsella rubella
ref|XP_006413344.1|  hypothetical protein EUTSA_v10024426mg           94.4    1e-17   Eutrema salsugineum [saltwater cress]
dbj|BAJ99162.1|  predicted protein                                    93.2    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEX56131.1|  NADPH oxidase                                         92.8    4e-17   Phaseolus vulgaris [French bean]
emb|CDX81049.1|  BnaC03g03030D                                        92.4    4e-17   
emb|CDX92675.1|  BnaC07g39330D                                        90.1    6e-17   
ref|XP_006413343.1|  hypothetical protein EUTSA_v10024427mg           91.7    7e-17   Eutrema salsugineum [saltwater cress]
gb|EYU24552.1|  hypothetical protein MIMGU_mgv1a001077mg              91.3    1e-16   Erythranthe guttata [common monkey flower]
emb|CDY11054.1|  BnaA03g47130D                                        88.6    7e-16   Brassica napus [oilseed rape]
ref|NP_001043020.1|  Os01g0360200                                     88.6    7e-16   
ref|XP_006663498.1|  PREDICTED: respiratory burst oxidase homolog...  88.6    7e-16   Oryza brachyantha
emb|CDM82708.1|  unnamed protein product                              88.2    1e-15   Triticum aestivum [Canadian hard winter wheat]
gb|KEH35677.1|  respiratory burst oxidase-like protein D              87.8    1e-15   Medicago truncatula
emb|CDY26109.1|  BnaC06g10870D                                        87.8    1e-15   Brassica napus [oilseed rape]
emb|CAB36751.1|  respiratory burst oxidase-like protein               87.8    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194239.2|  riboflavin synthase-like superfamily protein        87.8    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190833.1|  riboflavin synthase-like superfamily protein     87.8    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|EMT32939.1|  Respiratory burst oxidase-B-like protein              87.8    1e-15   
gb|AES72972.2|  respiratory burst oxidase-like protein D              87.8    1e-15   Medicago truncatula
ref|XP_003602721.1|  Respiratory burst oxidase-like protein           87.4    1e-15   
gb|KEH35680.1|  respiratory burst oxidase-like protein D              87.4    1e-15   Medicago truncatula
ref|XP_006644164.1|  PREDICTED: respiratory burst oxidase homolog...  87.0    3e-15   Oryza brachyantha
ref|XP_006664613.1|  PREDICTED: respiratory burst oxidase homolog...  86.3    4e-15   
gb|EYU26891.1|  hypothetical protein MIMGU_mgv1a001109mg              86.3    4e-15   Erythranthe guttata [common monkey flower]
ref|XP_004968726.1|  PREDICTED: respiratory burst oxidase homolog...  86.3    4e-15   Setaria italica
ref|XP_002867627.1|  hypothetical protein ARALYDRAFT_492327           85.9    5e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_009137494.1|  PREDICTED: putative respiratory burst oxidas...  85.1    9e-15   Brassica rapa
emb|CDY11053.1|  BnaA03g47120D                                        85.1    9e-15   Brassica napus [oilseed rape]
ref|XP_009137493.1|  PREDICTED: putative respiratory burst oxidas...  85.1    9e-15   Brassica rapa
gb|ACB56482.1|  respiratory burst oxidase-like protein B2             85.1    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH35678.1|  respiratory burst oxidase-like protein D              83.2    4e-14   Medicago truncatula
gb|KEH35679.1|  respiratory burst oxidase-like protein D              82.8    5e-14   Medicago truncatula
ref|XP_004304974.1|  PREDICTED: respiratory burst oxidase homolog...  82.0    1e-13   Fragaria vesca subsp. vesca
gb|EMS56450.1|  Respiratory burst oxidase-like protein B              80.5    3e-13   Triticum urartu
ref|XP_003567677.1|  PREDICTED: respiratory burst oxidase homolog...  79.7    6e-13   
gb|ADR70883.1|  respiratory burst oxidase E                           79.3    7e-13   Manihot esculenta [manioc]
emb|CDX81047.1|  BnaC03g03010D                                        79.0    9e-13   
ref|XP_010656089.1|  PREDICTED: respiratory burst oxidase homolog...  79.0    9e-13   
ref|XP_002972507.1|  hypothetical protein SELMODRAFT_97417            79.0    9e-13   
ref|XP_002277540.1|  PREDICTED: respiratory burst oxidase homolog...  79.0    1e-12   
ref|XP_002457825.1|  hypothetical protein SORBIDRAFT_03g014430        78.2    2e-12   
ref|XP_008673282.1|  PREDICTED: uncharacterized protein LOC100384...  78.2    2e-12   
gb|EMT01380.1|  Respiratory burst oxidase-B-like protein              77.0    4e-12   
ref|XP_008655905.1|  PREDICTED: respiratory burst oxidase homolog...  76.6    7e-12   
ref|XP_004962826.1|  PREDICTED: respiratory burst oxidase homolog...  76.3    8e-12   
ref|XP_003517484.1|  PREDICTED: respiratory burst oxidase homolog...  76.3    9e-12   
emb|CDX78290.1|  BnaA03g02020D                                        75.9    1e-11   
tpg|DAA54556.1|  TPA: hypothetical protein ZEAMMB73_247137            75.1    2e-11   
gb|KHN03979.1|  Respiratory burst oxidase like protein B              74.3    3e-11   
ref|XP_006417613.1|  hypothetical protein EUTSA_v10006793mg           73.9    4e-11   
ref|XP_012077105.1|  PREDICTED: respiratory burst oxidase homolog...  73.6    6e-11   
gb|KHF98208.1|  Respiratory burst oxidase A                           73.6    6e-11   
gb|KJB19099.1|  hypothetical protein B456_003G085100                  73.6    7e-11   
ref|XP_010273898.1|  PREDICTED: respiratory burst oxidase homolog...  73.2    8e-11   
gb|KJB19100.1|  hypothetical protein B456_003G085100                  73.2    8e-11   
gb|KJB19101.1|  hypothetical protein B456_003G085100                  73.2    8e-11   
ref|XP_011039926.1|  PREDICTED: respiratory burst oxidase homolog...  72.8    1e-10   
gb|KHN35050.1|  Respiratory burst oxidase like protein F              72.8    1e-10   
ref|XP_011039925.1|  PREDICTED: respiratory burst oxidase homolog...  72.8    1e-10   
dbj|BAJ96652.1|  predicted protein                                    72.4    2e-10   
gb|ACB56486.1|  respiratory burst oxidase-like protein J              72.4    2e-10   
ref|XP_006306752.1|  hypothetical protein CARUB_v10008289mg           72.0    2e-10   
ref|XP_004503663.1|  PREDICTED: respiratory burst oxidase homolog...  72.0    2e-10   
ref|XP_006381569.1|  hypothetical protein POPTR_0006s13950g           71.6    3e-10   
ref|XP_003538264.1|  PREDICTED: respiratory burst oxidase homolog...  71.2    3e-10   
ref|XP_009118326.1|  PREDICTED: respiratory burst oxidase homolog...  71.2    4e-10   
ref|XP_007158539.1|  hypothetical protein PHAVU_002G160700g           71.2    4e-10   
ref|XP_004980520.1|  PREDICTED: respiratory burst oxidase homolog...  71.2    4e-10   
emb|CDY06348.1|  BnaA09g48550D                                        71.2    4e-10   
gb|KHM99939.1|  Respiratory burst oxidase like protein F              71.2    4e-10   
gb|ADR70884.1|  respiratory burst oxidase F                           70.9    5e-10   
ref|XP_010458177.1|  PREDICTED: respiratory burst oxidase homolog...  70.9    5e-10   
ref|XP_010489693.1|  PREDICTED: respiratory burst oxidase homolog...  70.9    5e-10   
gb|EPS63122.1|  hypothetical protein M569_11665                       69.3    6e-10   
gb|ACB56481.1|  respiratory burst oxidase-like protein B1             70.5    6e-10   
ref|XP_010475733.1|  PREDICTED: respiratory burst oxidase homolog...  70.1    8e-10   
gb|AEP25513.1|  putative respiratory burst oxidase-like protein C     70.1    9e-10   
gb|KDO76360.1|  hypothetical protein CISIN_1g002259mg                 69.7    1e-09   
ref|XP_007040366.1|  Respiratory burst oxidase protein A              69.7    1e-09   
ref|XP_010414479.1|  PREDICTED: respiratory burst oxidase homolog...  67.0    1e-09   
ref|XP_004970493.1|  PREDICTED: putative respiratory burst oxidas...  69.3    1e-09   
ref|XP_002456595.1|  hypothetical protein SORBIDRAFT_03g039050        68.9    2e-09   
ref|XP_008242282.1|  PREDICTED: respiratory burst oxidase homolog...  69.3    2e-09   
emb|CDY22645.1|  BnaC08g42790D                                        66.6    2e-09   
ref|XP_009416413.1|  PREDICTED: respiratory burst oxidase homolog...  69.3    2e-09   
ref|XP_007012555.1|  Respiratory burst oxidase protein E              68.9    2e-09   
ref|XP_006439453.1|  hypothetical protein CICLE_v10018741mg           68.9    2e-09   
ref|XP_003525369.1|  PREDICTED: respiratory burst oxidase homolog...  68.9    2e-09   
ref|XP_010323981.1|  PREDICTED: respiratory burst oxidase homolog...  68.9    2e-09   
ref|XP_012086808.1|  PREDICTED: respiratory burst oxidase homolog...  68.9    2e-09   
ref|XP_010323982.1|  PREDICTED: respiratory burst oxidase homolog...  68.6    3e-09   
pdb|3A8R|A  Chain A, The Structure Of The N-terminal Regulatory D...  65.5    3e-09   
ref|XP_007138622.1|  hypothetical protein PHAVU_009G224100g           68.6    3e-09   
emb|CBI29288.3|  unnamed protein product                              68.6    3e-09   
ref|XP_010922463.1|  PREDICTED: putative respiratory burst oxidas...  68.2    4e-09   
ref|XP_010922464.1|  PREDICTED: putative respiratory burst oxidas...  68.2    4e-09   
ref|XP_010922461.1|  PREDICTED: putative respiratory burst oxidas...  68.2    4e-09   
ref|XP_010922462.1|  PREDICTED: putative respiratory burst oxidas...  68.2    4e-09   
gb|KEH21155.1|  respiratory burst oxidase-like protein                68.2    4e-09   
ref|XP_008783635.1|  PREDICTED: putative respiratory burst oxidas...  67.8    5e-09   
gb|KEH21156.1|  respiratory burst oxidase-like protein                67.4    6e-09   
gb|EMS46678.1|  Respiratory burst oxidase-like protein B              67.8    6e-09   
gb|AAB70399.1|  F7G19.4                                               65.9    6e-09   
ref|XP_002974429.1|  hypothetical protein SELMODRAFT_101139           67.8    6e-09   
gb|KJB52203.1|  hypothetical protein B456_008G250500                  67.4    7e-09   
ref|XP_003532995.1|  PREDICTED: respiratory burst oxidase homolog...  67.0    8e-09   
ref|XP_010047445.1|  PREDICTED: respiratory burst oxidase homolog...  67.0    8e-09   
ref|XP_010112614.1|  Respiratory burst oxidase-like protein F         67.4    8e-09   
gb|KJB52204.1|  hypothetical protein B456_008G250500                  67.0    8e-09   
gb|KCW79354.1|  hypothetical protein EUGRSUZ_C00773                   67.0    9e-09   
emb|CDY34341.1|  BnaA01g14440D                                        65.1    9e-09   
gb|EMS62035.1|  Respiratory burst oxidase-like protein C              63.2    1e-08   
ref|XP_009359699.1|  PREDICTED: respiratory burst oxidase homolog...  67.0    1e-08   
gb|KJB52205.1|  hypothetical protein B456_008G250500                  67.0    1e-08   
emb|CDY70539.1|  BnaC01g41590D                                        65.5    1e-08   
tpg|DAA42075.1|  TPA: hypothetical protein ZEAMMB73_871898            66.6    1e-08   
ref|XP_002966462.1|  hypothetical protein SELMODRAFT_168047           66.6    1e-08   
ref|XP_006646457.1|  PREDICTED: putative respiratory burst oxidas...  66.2    2e-08   
ref|XP_003574580.1|  PREDICTED: respiratory burst oxidase homolog...  66.2    2e-08   
ref|NP_172383.3|  Respiratory burst oxidase-B                         66.2    2e-08   
ref|NP_973799.1|  Respiratory burst oxidase-B                         66.2    2e-08   
ref|XP_002516222.1|  respiratory burst oxidase, putative              66.2    2e-08   
ref|NP_001105930.1|  LOC778438                                        65.9    2e-08   
gb|AFS18257.1|  respiratory burst oxidase protein F                   65.9    2e-08   
ref|XP_006301285.1|  hypothetical protein CARUB_v10021686mg           65.9    2e-08   
gb|AFW56509.1|  hypothetical protein ZEAMMB73_659141                  65.9    2e-08   
tpg|DAA56955.1|  TPA: respiratory burst oxidase protein A             65.9    2e-08   
ref|XP_008662098.1|  PREDICTED: uncharacterized protein LOC100381...  65.9    2e-08   
dbj|BAJ33963.1|  unnamed protein product                              65.9    2e-08   
ref|XP_006391675.1|  hypothetical protein EUTSA_v10023240mg           65.9    2e-08   
ref|XP_009618954.1|  PREDICTED: respiratory burst oxidase homolog...  65.9    2e-08   
ref|XP_011655429.1|  PREDICTED: respiratory burst oxidase homolog...  65.9    2e-08   
gb|AAC39478.1|  respiratory burst oxidase protein E                   65.5    3e-08   
gb|AAF82233.1|AC069143_9  Contains a strong similarity to a respi...  65.5    3e-08   
ref|NP_173357.1|  riboflavin synthase-like superfamily protein        65.5    3e-08   
sp|O81211.2|RBOHE_ARATH  RecName: Full=Respiratory burst oxidase ...  65.5    3e-08   
ref|XP_008797383.1|  PREDICTED: respiratory burst oxidase homolog...  65.5    3e-08   
ref|NP_001185032.1|  riboflavin synthase-like protein                 65.5    3e-08   
ref|XP_011655430.1|  PREDICTED: respiratory burst oxidase homolog...  65.5    3e-08   
ref|XP_002985727.1|  hypothetical protein SELMODRAFT_122844           65.5    3e-08   
ref|XP_009343364.1|  PREDICTED: respiratory burst oxidase homolog...  65.5    3e-08   
ref|XP_007203796.1|  hypothetical protein PRUPE_ppa001114mg           64.7    5e-08   
ref|XP_002887923.1|  respiratory burst oxidase                        64.7    5e-08   
gb|KFK43209.1|  hypothetical protein AALP_AA1G094400                  62.8    5e-08   
ref|XP_006844082.1|  PREDICTED: respiratory burst oxidase homolog...  64.7    6e-08   
ref|XP_010237191.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...  64.3    6e-08   
gb|EYU28303.1|  hypothetical protein MIMGU_mgv1a001011mg              64.3    7e-08   
gb|KHN49079.1|  Respiratory burst oxidase like protein E              60.5    7e-08   
emb|CDY38202.1|  BnaA09g11870D                                        64.3    7e-08   
ref|XP_009112796.1|  PREDICTED: respiratory burst oxidase homolog...  64.3    7e-08   
ref|XP_008337815.1|  PREDICTED: respiratory burst oxidase homolog...  64.3    8e-08   
ref|XP_006655391.1|  PREDICTED: putative respiratory burst oxidas...  63.9    8e-08   
ref|XP_010430522.1|  PREDICTED: respiratory burst oxidase homolog...  63.9    8e-08   
ref|XP_004143967.2|  PREDICTED: respiratory burst oxidase homolog...  63.9    9e-08   
ref|XP_008437348.1|  PREDICTED: respiratory burst oxidase homolog...  63.9    9e-08   
dbj|BAF00352.1|  cytochrome b245 beta chain homolog RbohAp108         63.5    9e-08   
ref|XP_011461008.1|  PREDICTED: respiratory burst oxidase homolog...  63.9    1e-07   
ref|XP_003567250.1|  PREDICTED: putative respiratory burst oxidas...  63.9    1e-07   
ref|XP_004289002.1|  PREDICTED: respiratory burst oxidase homolog...  63.5    1e-07   
emb|CDY08347.1|  BnaC09g12490D                                        63.5    1e-07   
ref|XP_011022605.1|  PREDICTED: respiratory burst oxidase homolog...  63.5    1e-07   
ref|XP_006476481.1|  PREDICTED: respiratory burst oxidase homolog...  63.5    1e-07   
ref|XP_009348907.1|  PREDICTED: respiratory burst oxidase homolog...  63.5    1e-07   
ref|XP_009631606.1|  PREDICTED: respiratory burst oxidase homolog...  63.5    1e-07   
dbj|BAC56864.1|  respiratory burst oxidase homolog                    63.5    1e-07   
ref|XP_010473652.1|  PREDICTED: respiratory burst oxidase homolog...  63.5    1e-07   
gb|KJB07346.1|  hypothetical protein B456_001G017400                  63.5    1e-07   
ref|XP_011080899.1|  PREDICTED: respiratory burst oxidase homolog...  63.5    1e-07   
ref|XP_011022604.1|  PREDICTED: respiratory burst oxidase homolog...  63.5    1e-07   
ref|XP_007210398.1|  hypothetical protein PRUPE_ppa000913mg           63.2    1e-07   
emb|CDP03040.1|  unnamed protein product                              63.2    2e-07   
ref|XP_006385777.1|  NADPH oxidase family protein                     63.2    2e-07   
ref|XP_008776161.1|  PREDICTED: putative respiratory burst oxidas...  63.2    2e-07   
ref|XP_009138851.1|  PREDICTED: respiratory burst oxidase homolog...  62.0    2e-07   
ref|XP_009774197.1|  PREDICTED: respiratory burst oxidase homolog...  62.4    2e-07   
gb|ADR70890.1|  respiratory burst oxidase G                           63.2    2e-07   
emb|CDP12086.1|  unnamed protein product                              62.8    2e-07   
gb|AAF24574.1|AC007764_16  F22C12.18                                  62.8    2e-07   
ref|XP_010917407.1|  PREDICTED: respiratory burst oxidase homolog...  62.8    2e-07   
gb|KDO73804.1|  hypothetical protein CISIN_1g0028302mg                60.8    2e-07   
ref|XP_006353773.1|  PREDICTED: respiratory burst oxidase homolog...  62.8    2e-07   
ref|XP_002992564.1|  hypothetical protein SELMODRAFT_135543           62.8    2e-07   
dbj|BAA28953.1|  Atrboh F                                             62.8    3e-07   
ref|XP_002890325.1|  hypothetical protein ARALYDRAFT_312861           62.8    3e-07   
ref|NP_564821.1|  respiratory burst oxidase                           62.8    3e-07   
ref|XP_006353772.1|  PREDICTED: respiratory burst oxidase homolog...  62.4    3e-07   
ref|XP_010917405.1|  PREDICTED: respiratory burst oxidase homolog...  62.4    3e-07   
ref|XP_006368770.1|  hypothetical protein POPTR_0001s09970g           62.4    3e-07   
gb|ABS85195.1|  RbohF                                                 62.4    3e-07   
ref|XP_011078139.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...  62.4    3e-07   
ref|XP_006474684.1|  PREDICTED: respiratory burst oxidase homolog...  62.4    3e-07   
ref|XP_008670771.1|  PREDICTED: respiratory burst oxidase homolog...  62.4    3e-07   
ref|XP_010917450.1|  PREDICTED: respiratory burst oxidase homolog...  62.0    3e-07   
ref|XP_010251608.1|  PREDICTED: respiratory burst oxidase homolog...  62.4    3e-07   
gb|KEH37646.1|  respiratory burst oxidase-like protein                62.4    3e-07   
ref|XP_002982059.1|  hypothetical protein SELMODRAFT_115913           62.0    3e-07   
ref|XP_002969827.1|  hypothetical protein SELMODRAFT_92462            62.0    4e-07   
gb|KEH37648.1|  respiratory burst oxidase-like protein                62.0    4e-07   
ref|XP_010533624.1|  PREDICTED: respiratory burst oxidase homolog...  62.0    4e-07   
gb|KEH37647.1|  respiratory burst oxidase-like protein                62.0    4e-07   
ref|XP_010533625.1|  PREDICTED: respiratory burst oxidase homolog...  61.6    5e-07   
ref|XP_008238986.1|  PREDICTED: respiratory burst oxidase homolog...  61.6    5e-07   
ref|XP_006349977.1|  PREDICTED: respiratory burst oxidase homolog...  61.6    5e-07   
gb|EEC79369.1|  hypothetical protein OsI_20265                        61.6    5e-07   
ref|NP_001055783.1|  Os05g0465800                                     61.6    5e-07   
ref|XP_010924767.1|  PREDICTED: respiratory burst oxidase homolog...  61.6    5e-07   
gb|AAT58779.1|  putative respiratory burst oxidase                    61.6    5e-07   
ref|XP_010418449.1|  PREDICTED: respiratory burst oxidase homolog...  61.6    5e-07   
gb|EEE68901.1|  hypothetical protein OsJ_27740                        61.6    5e-07   
gb|AAT58757.1|  putative respiratory burst oxidase                    61.2    6e-07   
gb|ACB56483.1|  respiratory burst oxidase-like protein E              61.6    6e-07   
dbj|BAJ89716.1|  predicted protein                                    61.2    6e-07   
ref|XP_004239582.1|  PREDICTED: respiratory burst oxidase homolog...  61.2    6e-07   
gb|KFK40474.1|  hypothetical protein AALP_AA2G000500                  61.2    7e-07   
dbj|BAK05237.1|  predicted protein                                    61.2    7e-07   
ref|XP_006452870.1|  hypothetical protein CICLE_v10007394mg           60.8    8e-07   
ref|XP_011026969.1|  PREDICTED: respiratory burst oxidase homolog...  60.8    8e-07   
ref|XP_009391217.1|  PREDICTED: respiratory burst oxidase homolog...  60.8    1e-06   
ref|XP_004969859.1|  PREDICTED: respiratory burst oxidase homolog...  60.8    1e-06   
ref|XP_008792374.1|  PREDICTED: respiratory burst oxidase homolog...  60.8    1e-06   
ref|XP_007160115.1|  hypothetical protein PHAVU_002G293700g           60.5    1e-06   
ref|XP_006597890.1|  PREDICTED: respiratory burst oxidase homolog...  60.5    1e-06   
ref|XP_009769453.1|  PREDICTED: respiratory burst oxidase homolog...  60.5    1e-06   
ref|XP_003578168.1|  PREDICTED: respiratory burst oxidase homolog...  60.5    1e-06   
ref|XP_009350322.1|  PREDICTED: respiratory burst oxidase homolog...  60.5    1e-06   
ref|XP_006597889.1|  PREDICTED: respiratory burst oxidase homolog...  60.5    1e-06   
ref|XP_002442264.1|  hypothetical protein SORBIDRAFT_08g017240        60.5    1e-06   
ref|XP_006598414.1|  PREDICTED: respiratory burst oxidase homolog...  60.5    1e-06   
ref|XP_010687558.1|  PREDICTED: respiratory burst oxidase homolog...  60.1    1e-06   
ref|XP_010103077.1|  Respiratory burst oxidase-like protein E         60.1    2e-06   
emb|CBI34401.3|  unnamed protein product                              60.1    2e-06   
ref|XP_009414001.1|  PREDICTED: respiratory burst oxidase homolog...  59.7    2e-06   
ref|XP_010459581.1|  PREDICTED: respiratory burst oxidase homolog...  59.7    2e-06   
ref|XP_009609858.1|  PREDICTED: respiratory burst oxidase homolog...  59.7    2e-06   
ref|XP_009799187.1|  PREDICTED: respiratory burst oxidase homolog...  59.7    2e-06   
gb|KJB24293.1|  hypothetical protein B456_004G137300                  59.7    2e-06   
ref|XP_009609859.1|  PREDICTED: respiratory burst oxidase homolog...  59.3    3e-06   
gb|EMT26124.1|  Putative respiratory burst oxidase-H-like protein     59.3    3e-06   
ref|XP_009799189.1|  PREDICTED: respiratory burst oxidase homolog...  59.3    3e-06   
gb|EEC84635.1|  hypothetical protein OsI_31509                        59.3    3e-06   
ref|XP_008460577.1|  PREDICTED: respiratory burst oxidase homolog...  58.9    3e-06   
ref|NP_001105965.1|  LOC100037794                                     59.3    3e-06   
tpg|DAA57759.1|  TPA: respiratory burst oxidase protein B variant...  59.3    3e-06   
ref|NP_001063267.1|  Os09g0438000                                     59.3    3e-06   
ref|XP_009406782.1|  PREDICTED: respiratory burst oxidase homolog...  59.3    3e-06   
tpg|DAA57760.1|  TPA: respiratory burst oxidase protein B             59.3    3e-06   
gb|ACJ02085.1|  respiratory burst oxidase protein B variant beta      59.3    3e-06   
ref|XP_008664615.1|  PREDICTED: respiratory burst oxidase homolog...  58.9    3e-06   
ref|XP_009384814.1|  PREDICTED: putative respiratory burst oxidas...  58.9    4e-06   
ref|XP_002509871.1|  respiratory burst oxidase, putative              58.9    4e-06   
ref|NP_001275304.1|  respiratory burst oxidase homolog protein A      58.9    4e-06   
gb|EMT26660.1|  Respiratory burst oxidase-B-like protein              58.9    4e-06   
dbj|BAD36442.1|  putative respiratory burst oxidase protein E         58.5    5e-06   
gb|EMT31178.1|  Putative respiratory burst oxidase-H-like protein     58.5    5e-06   
ref|NP_001044725.1|  Os01g0835500                                     58.5    6e-06   
ref|XP_002444463.1|  hypothetical protein SORBIDRAFT_07g022250        58.5    6e-06   
ref|XP_008651821.1|  PREDICTED: uncharacterized protein LOC100502...  58.5    6e-06   
ref|XP_004488138.1|  PREDICTED: respiratory burst oxidase homolog...  58.2    6e-06   



>ref|NP_001275453.1| respiratory burst oxidase homolog protein C [Solanum tuberosum]
 sp|Q2HXL0.2|RBOHC_SOLTU RecName: Full=Respiratory burst oxidase homolog protein C; AltName: 
Full=NADPH oxidase RBOHC; AltName: Full=StRBOHC [Solanum 
tuberosum]
 dbj|BAE79344.2| NADPH oxidase [Solanum tuberosum]
Length=938

 Score =   278 bits (711),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  541
            M +S+     H HHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  542  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  721
                 +    +NDDAYVEITLDVREDSVAVHSVKTA GADVEDPELALLA+GLEKK+TLG
Sbjct  58   SAGAGAK---SNDDAYVEITLDVREDSVAVHSVKTAGGADVEDPELALLAKGLEKKSTLG  114

Query  722  SSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG  901
            +SLVRNASSRIRQVSQELKR+AS+      P GR DRNKSAAA ALKGLKFISKTDG +G
Sbjct  115  ASLVRNASSRIRQVSQELKRLASLNKRP-IPTGRFDRNKSAAAHALKGLKFISKTDGGAG  173

Query  902  WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            WAAVEKRFD++TA + GLLPRA FGECIGMNK
Sbjct  174  WAAVEKRFDEITAPTTGLLPRAKFGECIGMNK  205



>ref|NP_001234271.1| whitefly-induced gp91-phox [Solanum lycopersicum]
 gb|AAF73104.1|AF147783_1 whitefly-induced gp91-phox [Solanum lycopersicum]
 gb|AAF73124.1|AF148534_1 whitefly-induced gp91-phox [Solanum lycopersicum]
Length=938

 Score =   277 bits (709),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  541
            M +S+     H HHHSDTEV  +G D R SYSGPLSGPLNKR GKK ARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEV--IGND-RASYSGPLSGPLNKRGGKKCARFNIPESTDIGT  57

Query  542  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  721
                 +    +NDDAYVEITLDVREDSVAVHSVKTA GADVEDPELALLA+GLEKK+TLG
Sbjct  58   SAGAGAK---SNDDAYVEITLDVREDSVAVHSVKTAGGADVEDPELALLAKGLEKKSTLG  114

Query  722  SSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG  901
            +SLVRNASSRIRQVSQELKR+AS+      P GR DRNKSAAA ALKGLKFISKTDG +G
Sbjct  115  ASLVRNASSRIRQVSQELKRLASLNKRP-IPTGRFDRNKSAAAHALKGLKFISKTDGGAG  173

Query  902  WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            WAAVEKRFD++TA++ GLLPRA FGECIGMNK
Sbjct  174  WAAVEKRFDEITASTTGLLPRAKFGECIGMNK  205



>ref|XP_009619772.1| PREDICTED: respiratory burst oxidase homolog protein C [Nicotiana 
tomentosiformis]
Length=938

 Score =   276 bits (706),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  541
            M +S+     H HHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  542  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  721
                 +    +NDDAYVEITLDVREDSVAVHSVKTA G DVEDPELALLA+GLEKK+TLG
Sbjct  58   SVGTGAK---SNDDAYVEITLDVREDSVAVHSVKTAGGDDVEDPELALLAKGLEKKSTLG  114

Query  722  SSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG  901
            SSLVRNASSRIRQVSQEL+R+AS+      P GR DRNKSAAA ALKGLKFISKTDG +G
Sbjct  115  SSLVRNASSRIRQVSQELRRLASLNKRP-IPTGRFDRNKSAAAHALKGLKFISKTDGGAG  173

Query  902  WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            WAAVEKRFD++TA++ GLLPRA FGECIGMNK
Sbjct  174  WAAVEKRFDEITASTTGLLPRAKFGECIGMNK  205



>ref|XP_009775685.1| PREDICTED: respiratory burst oxidase homolog protein C [Nicotiana 
sylvestris]
 gb|AAM28891.1| NADPH oxidase [Nicotiana tabacum]
 gb|ABN58915.1| rbohD [Nicotiana tabacum]
Length=938

 Score =   276 bits (705),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  541
            M +S+     HQHHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHQHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  542  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  721
                      +NDDAYVEITLDVREDSVAVHSVKTA G DVEDPELALLA+GLEKK+TLG
Sbjct  58   SVGTGGK---SNDDAYVEITLDVREDSVAVHSVKTAGGDDVEDPELALLAKGLEKKSTLG  114

Query  722  SSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG  901
            SSLVRNASSRIRQVSQEL+R+AS+      P GR DRNKSAAA ALKGLKFISKTDG +G
Sbjct  115  SSLVRNASSRIRQVSQELRRLASLNKRP-IPTGRFDRNKSAAAHALKGLKFISKTDGGAG  173

Query  902  WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            WAAVEKRFD++TA++ GLLPRA FGECIGMNK
Sbjct  174  WAAVEKRFDEITASTTGLLPRAKFGECIGMNK  205



>emb|CAC84140.1| NADPH oxidase [Nicotiana tabacum]
Length=939

 Score =   275 bits (704),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 168/212 (79%), Gaps = 7/212 (3%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  541
            M +S+     HQHHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHQHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  542  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  721
                      +NDDAYVEITLDVREDSVAVHSVKTA G DVEDPELALLA+GLEKK+TLG
Sbjct  58   SVGTGGK---SNDDAYVEITLDVREDSVAVHSVKTAGGDDVEDPELALLAKGLEKKSTLG  114

Query  722  SSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG  901
            SSLVRNASSRIRQVSQEL+R+AS+      P GR DRNKSAAA ALKGLKFISKTDG +G
Sbjct  115  SSLVRNASSRIRQVSQELRRLASLNKRP-IPTGRFDRNKSAAAHALKGLKFISKTDGGAG  173

Query  902  WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            WAAVEKRFD++TA++ GLLPRA FGECIGMNK
Sbjct  174  WAAVEKRFDEITASTTGLLPRAKFGECIGMNK  205



>dbj|BAC56865.1| respiratory burst oxidase homolog [Nicotiana benthamiana]
Length=939

 Score =   272 bits (695),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 167/212 (79%), Gaps = 6/212 (3%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  541
            M +S+     H HHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  542  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  721
                +  +  +NDDAYVEITLDVREDSVAVHSVKTA G DVEDPELALLA+GLEKK+ LG
Sbjct  58   SVGTAGGK--SNDDAYVEITLDVREDSVAVHSVKTAGGDDVEDPELALLAKGLEKKSALG  115

Query  722  SSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG  901
            SSLVRNASSRIRQVSQEL+R+AS+      P GR DRNKSAAA ALKGLKFISKTDG +G
Sbjct  116  SSLVRNASSRIRQVSQELRRLASLNKRP-IPTGRFDRNKSAAAHALKGLKFISKTDGGAG  174

Query  902  WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            W AVEKRFD++TA++ GLLPRA FGECIGMNK
Sbjct  175  WPAVEKRFDEITASTTGLLPRAKFGECIGMNK  206



>gb|ABW87870.1| NADPH oxidase [Nicotiana attenuata]
Length=937

 Score =   267 bits (682),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 164/212 (77%), Gaps = 7/212 (3%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  541
            M +S+     H HHHSDTE+  +G D R SYSGPLSGPLNKR GKKSARFN+        
Sbjct  1    MQNSENHHPHHHHHHSDTEI--IGND-RASYSGPLSGPLNKRGGKKSARFNIPESTDIGT  57

Query  542  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  721
                      +NDDAYVEITLDVREDSVAVHS KTA G DVEDPELALLA+GLEKK+T G
Sbjct  58   SVGTGGK---SNDDAYVEITLDVREDSVAVHSAKTAGGDDVEDPELALLAKGLEKKSTSG  114

Query  722  SSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG  901
            SSLVRNASSRIRQVSQEL+R+AS+      P GR DRNKSAAA ALKGLKFISKTDG +G
Sbjct  115  SSLVRNASSRIRQVSQELRRLASLNKRP-IPTGRFDRNKSAAAHALKGLKFISKTDGGAG  173

Query  902  WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            WAAVEKRF+ +TA++ GLLPRA FGECIGMNK
Sbjct  174  WAAVEKRFEDITASTAGLLPRAKFGECIGMNK  205



>emb|CDO98277.1| unnamed protein product [Coffea canephora]
Length=933

 Score =   265 bits (678),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 166/212 (78%), Gaps = 13/212 (6%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssse  541
            M S + Q   H HHHSD E+  +G D R SYSGPLSGPLNKRTGKKSARFN++    ++ 
Sbjct  1    MQSPETQ---HYHHHSDNEI--IGND-RTSYSGPLSGPLNKRTGKKSARFNISDSAGNAN  54

Query  542  lgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG  721
              S       NNDDAYVEITLDVR+DSVAVHSVKTA GA +ED ELALLARGLEKK++ G
Sbjct  55   SSSG-----NNNDDAYVEITLDVRDDSVAVHSVKTADGAAIEDSELALLARGLEKKSSFG  109

Query  722  SSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG  901
            SS+VRNASS+IRQVSQELKR+AS++       G+ DR KSAAA ALKGLKFISKTDG +G
Sbjct  110  SSVVRNASSKIRQVSQELKRLASLSKRPQ--MGKFDRTKSAAAHALKGLKFISKTDGGAG  167

Query  902  WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            WAAVEKRFD+LT  +NGLLPR+ F ECIGMNK
Sbjct  168  WAAVEKRFDELTDTTNGLLPRSLFCECIGMNK  199



>ref|XP_011073263.1| PREDICTED: LOW QUALITY PROTEIN: respiratory burst oxidase homolog 
protein C-like [Sesamum indicum]
Length=918

 Score =   263 bits (672),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 158/203 (78%), Gaps = 13/203 (6%)
 Frame = +2

Query  389  RHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  568
            +H HHHSDTE+ V G   R SYSGPLSGPLNKR G+KSARFNL    SS    +      
Sbjct  7    KHHHHHSDTEI-VAG--DRTSYSGPLSGPLNKRGGRKSARFNLPADHSSGASPAA-----  58

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASS  748
                D YVEITLDVR+DSVAVHSVK A G +VEDPELALLA+GLEKK++ GSS+ RNASS
Sbjct  59   ----DDYVEITLDVRDDSVAVHSVKNAGGGEVEDPELALLAKGLEKKSSFGSSVARNASS  114

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            RIRQVS ELKR+AS+T  + HPAGR DR KSAAA ALKGLKFISKTD A+ WA VEKRFD
Sbjct  115  RIRQVSHELKRLASLTRRS-HPAGRFDRAKSAAAHALKGLKFISKTDCAAAWAGVEKRFD  173

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +LTA +NGLL R+ FGECIGMNK
Sbjct  174  ELTATTNGLLHRSLFGECIGMNK  196



>gb|EYU21773.1| hypothetical protein MIMGU_mgv1a002672mg [Erythranthe guttata]
Length=648

 Score =   254 bits (648),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 155/200 (78%), Gaps = 18/200 (9%)
 Frame = +2

Query  398  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANN  577
            +H+SD+EV    V  R SYSGPL    NKR GKKSARFN+    + +          A+ 
Sbjct  6    NHNSDSEV----VGDRTSYSGPL----NKRPGKKSARFNIPESSNRNSS--------ADA  49

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIR  757
            DD YVEITLDVREDSVAVHSVKTA G +VEDPELALLARGLEKK++ GSS+VRNASSRI+
Sbjct  50   DD-YVEITLDVREDSVAVHSVKTAGGGEVEDPELALLARGLEKKSSFGSSVVRNASSRIK  108

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            QVSQELKR+AS+T    HP GR DR KSAAA ALKGLKFISKTDG + WA VEKRF+ LT
Sbjct  109  QVSQELKRLASLTRRP-HPPGRFDRTKSAAAHALKGLKFISKTDGGAAWAGVEKRFNDLT  167

Query  938  AASNGLLPRAXFGECIGMNK  997
            AA+NGLLPRA FGECIGMNK
Sbjct  168  AATNGLLPRALFGECIGMNK  187



>ref|XP_007038195.1| NADPH/respiratory burst oxidase protein D [Theobroma cacao]
 gb|EOY22696.1| NADPH/respiratory burst oxidase protein D [Theobroma cacao]
Length=910

 Score =   251 bits (640),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 159/213 (75%), Gaps = 21/213 (10%)
 Frame = +2

Query  356  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  535
            +EM++ D   ++H HHHSDTEV+      +  +SGPLSGPLNKR GKKSARF++      
Sbjct  2    QEMTAEDGNRYQHHHHHSDTEVLA---GDKVPHSGPLSGPLNKRAGKKSARFSVPDST--  56

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKKT  712
                       ++ DD YVEITLDVR+DSVAVHSVK A GAD+ EDPEL LLA+GLEK++
Sbjct  57   -----------SSKDDGYVEITLDVRDDSVAVHSVKAANGADLQEDPELTLLAKGLEKRS  105

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
            T+GSS+VRNAS++IRQV  ELKR+ S +     PA R DR KSAAA ALKGLKFI+KTDG
Sbjct  106  TVGSSMVRNASAKIRQVGHELKRLTSFS---KKPA-RFDRTKSAAAHALKGLKFITKTDG  161

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
              GWAAVEKRFD++TA++NG LPRA FGECIGM
Sbjct  162  GHGWAAVEKRFDEITASNNGALPRARFGECIGM  194



>gb|AII25876.1| NADPH oxidase A [Camellia sinensis]
Length=922

 Score =   250 bits (639),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 160/203 (79%), Gaps = 12/203 (6%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTG-KKSARFNLAggdssselgspssars  568
            H  HHSDT++  VG D R SYSGPLSGPLNKR G +KSARFNL     +    +      
Sbjct  16   HHRHHSDTDI--VGGD-RASYSGPLSGPLNKRAGGRKSARFNLPDSAGAGGSVA------  66

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASS  748
             ++D +YVEITLDVR+DSVAVHSVKTA GA+VEDPEL LLA+GLEK+++  SS+VRNASS
Sbjct  67   GDDDQSYVEITLDVRDDSVAVHSVKTAGGAEVEDPELTLLAKGLEKRSSFKSSIVRNASS  126

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            RI+QVSQELK++ S++  +    GR DRNKSAAA ALKGLKFISKTDG +GWAAVEKRF+
Sbjct  127  RIKQVSQELKKLTSLSKRSHQ--GRFDRNKSAAAHALKGLKFISKTDGGAGWAAVEKRFN  184

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
             LT+++NGLL R+ FGECIGMNK
Sbjct  185  NLTSSTNGLLHRSLFGECIGMNK  207



>gb|KDO57669.1| hypothetical protein CISIN_1g003558mg [Citrus sinensis]
 gb|KDO57670.1| hypothetical protein CISIN_1g003558mg [Citrus sinensis]
Length=811

 Score =   234 bits (597),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 153/202 (76%), Gaps = 19/202 (9%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  586
            SDTEV+    ++R  YSGPLSGPLNKR G+KS +FNLA   SS           + +D+ 
Sbjct  13   SDTEVLG---NERIPYSGPLSGPLNKRVGRKSTKFNLATESSSGS---------SPHDEP  60

Query  587  YVEITLDVREDSVAVHSVKTAAGAD----VEDPELALLARGLEKKTT-LGSSLVRNASSR  751
            YVEITLDVR+DSVAVHSVK AAG D     EDPE+ LLA+GLEK++T  GSS+ R AS+R
Sbjct  61   YVEITLDVRDDSVAVHSVK-AAGGDHSNLQEDPEITLLAKGLEKRSTSFGSSVARTASAR  119

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            IRQVSQELKR+AS       PA R DRNKSAAA ALKGLKFISKTDG +GWA VEKRFD+
Sbjct  120  IRQVSQELKRLASFAKKPQPPA-RFDRNKSAAAYALKGLKFISKTDGGAGWANVEKRFDE  178

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            +TA++NG+LPRA FGECIGMNK
Sbjct  179  ITASTNGVLPRARFGECIGMNK  200



>gb|KDO57668.1| hypothetical protein CISIN_1g003558mg [Citrus sinensis]
Length=808

 Score =   234 bits (597),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 153/202 (76%), Gaps = 19/202 (9%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  586
            SDTEV+    ++R  YSGPLSGPLNKR G+KS +FNLA   SS           + +D+ 
Sbjct  13   SDTEVLG---NERIPYSGPLSGPLNKRVGRKSTKFNLATESSSGS---------SPHDEP  60

Query  587  YVEITLDVREDSVAVHSVKTAAGAD----VEDPELALLARGLEKKTT-LGSSLVRNASSR  751
            YVEITLDVR+DSVAVHSVK AAG D     EDPE+ LLA+GLEK++T  GSS+ R AS+R
Sbjct  61   YVEITLDVRDDSVAVHSVK-AAGGDHSNLQEDPEITLLAKGLEKRSTSFGSSVARTASAR  119

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            IRQVSQELKR+AS       PA R DRNKSAAA ALKGLKFISKTDG +GWA VEKRFD+
Sbjct  120  IRQVSQELKRLASFAKKPQPPA-RFDRNKSAAAYALKGLKFISKTDGGAGWANVEKRFDE  178

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            +TA++NG+LPRA FGECIGMNK
Sbjct  179  ITASTNGVLPRARFGECIGMNK  200



>ref|XP_006485050.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Citrus 
sinensis]
Length=929

 Score =   233 bits (594),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 153/202 (76%), Gaps = 19/202 (9%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  586
            SDTEV+    ++R  YSGPLSGPLNKR G+KS +FNLA   SS           + +D+ 
Sbjct  13   SDTEVLG---NERIPYSGPLSGPLNKRVGRKSTKFNLATESSSGS---------SPHDEP  60

Query  587  YVEITLDVREDSVAVHSVKTAAGAD----VEDPELALLARGLEKKTT-LGSSLVRNASSR  751
            YVEITLDVR+DSVAVHSVK AAG D     EDPE+ LLA+GLEK++T  GSS+ R AS++
Sbjct  61   YVEITLDVRDDSVAVHSVK-AAGGDHSNLQEDPEITLLAKGLEKRSTSFGSSVARTASAK  119

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            IRQVSQELKR+AS       PA R DRNKSAAA ALKGLKFISKTDG +GWA VEKRFD+
Sbjct  120  IRQVSQELKRLASFAKKPQPPA-RFDRNKSAAAYALKGLKFISKTDGGAGWANVEKRFDE  178

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            +TA++NG+LPRA FGECIGMNK
Sbjct  179  ITASTNGVLPRARFGECIGMNK  200



>ref|XP_006437008.1| hypothetical protein CICLE_v10030649mg [Citrus clementina]
 gb|ESR50248.1| hypothetical protein CICLE_v10030649mg [Citrus clementina]
Length=929

 Score =   232 bits (592),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 153/202 (76%), Gaps = 19/202 (9%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDA  586
            SDTEV+    ++R  YSGPLSGPLNKR G+KS +FNLA   SS           + +D+ 
Sbjct  13   SDTEVLG---NERIPYSGPLSGPLNKRVGRKSTKFNLATESSSGS---------SPHDEP  60

Query  587  YVEITLDVREDSVAVHSVKTAAGAD----VEDPELALLARGLEKKTT-LGSSLVRNASSR  751
            YVEITLDVR+DSVAVHSVK AAG D     EDPE+ LLA+GLEK++T  GSS+ R AS++
Sbjct  61   YVEITLDVRDDSVAVHSVK-AAGGDHSNLQEDPEITLLAKGLEKRSTSFGSSVARTASAK  119

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            IRQVSQELKR+AS       PA R DRNKSAAA ALKGLKFISKTDG +GWA VEKRFD+
Sbjct  120  IRQVSQELKRLASFAKKPQPPA-RFDRNKSAAACALKGLKFISKTDGGAGWANVEKRFDE  178

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            +TA++NG+LPRA FGECIGMNK
Sbjct  179  ITASTNGVLPRARFGECIGMNK  200



>ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog protein C [Nelumbo 
nucifera]
Length=926

 Score =   230 bits (587),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 155/204 (76%), Gaps = 14/204 (7%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNL----Aggdssselgspssars  568
            HHSDTE   VG ++  +YSGPL    NKR G+KSARFNL    A   S     S +S  +
Sbjct  16   HHSDTES--VGSERSSAYSGPL----NKR-GRKSARFNLPESTARTISGVGRTSSNSINA  68

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASS  748
            A +DDAYVEITLDVR+DSVAVHSVK A GAD EDPEL LLA+ LEK+++ GSS++R+ASS
Sbjct  69   APDDDAYVEITLDVRDDSVAVHSVKPAGGADAEDPELTLLAKNLEKRSSFGSSVMRSASS  128

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFI-SKTDGASGWAAVEKRF  925
            RI+QVSQELKR+AS+T      + R DR KSAAA ALKGLKFI SKTDG +GW AVEKRF
Sbjct  129  RIKQVSQELKRLASLTKRPS--STRFDRTKSAAAHALKGLKFISSKTDGTAGWVAVEKRF  186

Query  926  DQLTAASNGLLPRAXFGECIGMNK  997
            + LTA++NG+LPR  FGECIGMNK
Sbjct  187  NDLTASTNGVLPRTLFGECIGMNK  210



>ref|XP_011015154.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus 
euphratica]
Length=909

 Score =   229 bits (583),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 153/206 (74%), Gaps = 21/206 (10%)
 Frame = +2

Query  380  QSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspss  559
            Q    + HHSD+E+      +R +YSGPLSGPLNKR G+KSARF++AG            
Sbjct  2    QDMGREDHHSDSEM---SGSERLAYSGPLSGPLNKRPGRKSARFSIAGTT----------  48

Query  560  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRN  739
                + D+ YVEITLDVR DSVAVHSVK A G + EDPE+ALLA+GLEK++   S+LVR 
Sbjct  49   ---TSKDEQYVEITLDVRNDSVAVHSVKAANGVE-EDPEMALLAKGLEKRS--ASNLVRT  102

Query  740  ASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            AS+RIRQVS E+KR+AS +     P GR+DR+KSAAA ALKGLKFISKTDG +GWAAVEK
Sbjct  103  ASARIRQVSHEIKRLASFSKRP--PPGRLDRSKSAAAHALKGLKFISKTDGGAGWAAVEK  160

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            RFD++TA+++GLLPRA F ECIGM +
Sbjct  161  RFDEITASTDGLLPRARFCECIGMKE  186



>ref|XP_011003531.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus 
euphratica]
Length=909

 Score =   229 bits (583),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 153/206 (74%), Gaps = 21/206 (10%)
 Frame = +2

Query  380  QSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspss  559
            Q    + HHSD+E+      +R +YSGPLSGPLNKR G+KSARF++AG            
Sbjct  2    QDMGREDHHSDSEM---SGSERLAYSGPLSGPLNKRPGRKSARFSIAGTT----------  48

Query  560  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRN  739
                + D+ YVEITLDVR DSVAVHSVK A G + EDPE+ALLA+GLEK++   S+LVR 
Sbjct  49   ---TSKDEQYVEITLDVRNDSVAVHSVKAANGVE-EDPEMALLAKGLEKRS--ASNLVRT  102

Query  740  ASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            AS+RIRQVS E+KR+AS +     P GR+DR+KSAAA ALKGLKFISKTDG +GWAAVEK
Sbjct  103  ASARIRQVSHEIKRLASFSKRP--PPGRLDRSKSAAAHALKGLKFISKTDGGAGWAAVEK  160

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            RFD++TA+++GLLPRA F ECIGM +
Sbjct  161  RFDEITASTDGLLPRARFCECIGMKE  186



>ref|XP_008797083.1| PREDICTED: respiratory burst oxidase homolog protein C [Phoenix 
dactylifera]
Length=934

 Score =   228 bits (581),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 156/215 (73%), Gaps = 21/215 (10%)
 Frame = +2

Query  356  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  535
            ++M + D +   HQ    +TE   +G D R  YSGPLSGPLNKR G++SARFNLA     
Sbjct  2    QKMGTDDGRGGDHQSDVVETES--IGSD-RVPYSGPLSGPLNKRGGRRSARFNLADSA--  56

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  712
                         +D+ YVEITLDVR+DSVAVHSVK AAG D EDPE+ LLAR LEK++ 
Sbjct  57   -----------GGDDEQYVEITLDVRDDSVAVHSVKPAAGGDAEDPEVTLLARTLEKRSG  105

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
            ++GSS++R+ASSRIRQVSQELKR+AS T   G   GR+DR+KSAA  ALKGLKFISKTDG
Sbjct  106  SIGSSVIRSASSRIRQVSQELKRLASFTKRPG--PGRLDRSKSAATHALKGLKFISKTDG  163

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            A+GW AVEKRFD+L  A +G LPR+ FG+CIGM +
Sbjct  164  AAGWLAVEKRFDEL--AVDGALPRSLFGQCIGMKE  196



>ref|XP_002511059.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF51661.1| respiratory burst oxidase, putative [Ricinus communis]
Length=910

 Score =   228 bits (581),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 143/185 (77%), Gaps = 18/185 (10%)
 Frame = +2

Query  437  DKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRE  616
            D+R  YSGPLSGPLNKRT +KSARFN+                 ++ D+ Y+E+TLDVR+
Sbjct  22   DQRVPYSGPLSGPLNKRTTRKSARFNIPDST-------------SSQDEQYLEVTLDVRD  68

Query  617  DSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMT  796
            DSVAVHSVKTA GA+ EDPEL LLA+GLEKK+   S++VRNAS+R RQVSQE+KR+AS +
Sbjct  69   DSVAVHSVKTANGAE-EDPELTLLAKGLEKKS--NSNIVRNASNRFRQVSQEIKRLASFS  125

Query  797  MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFG  976
                 P GR+DR KSAAA ALKGLKFISKTDG +GWAAVEKRFD +TA+++GLLPR+ F 
Sbjct  126  KRP--PPGRLDRTKSAAAHALKGLKFISKTDGGAGWAAVEKRFDDITASTDGLLPRSRFC  183

Query  977  ECIGM  991
            ECIGM
Sbjct  184  ECIGM  188



>ref|XP_007210905.1| hypothetical protein PRUPE_ppa000984mg [Prunus persica]
 gb|EMJ12104.1| hypothetical protein PRUPE_ppa000984mg [Prunus persica]
Length=941

 Score =   226 bits (576),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 156/205 (76%), Gaps = 11/205 (5%)
 Frame = +2

Query  398  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTG-KKSARFNLAggdssselgspssarsAN  574
            H+HSDTE++  G ++  +YSGPLSGPLNKR+G KK+A+FN+A    S+     S     +
Sbjct  10   HYHSDTEIL--GSERMVNYSGPLSGPLNKRSGNKKTAKFNIAEPAGSAVKPGIS----TS  63

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEK-KTTLGSSLVRNASSR  751
            +++ YVE+ LDVREDSVAVHSVK AA    +  E+ LL +GLEK ++  GSS+VR AS+R
Sbjct  64   DEEPYVEVILDVREDSVAVHSVKPAADDHEDHVEMNLLGKGLEKNQSPKGSSVVRTASAR  123

Query  752  IRQVSQELKRIASMT---MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKR  922
            I+QVSQELKR+AS +   + A HP  R DR +SAAA ALKGLKFISKTDG +GW AVEK+
Sbjct  124  IKQVSQELKRLASFSKQAVAAPHPRRRFDRTQSAAAPALKGLKFISKTDGNAGWPAVEKK  183

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            F+QLTA+SNGLLPR+ FGECIGMNK
Sbjct  184  FNQLTASSNGLLPRSLFGECIGMNK  208



>ref|XP_006844712.1| PREDICTED: respiratory burst oxidase homolog protein C [Amborella 
trichopoda]
 gb|ERN06387.1| hypothetical protein AMTR_s00016p00250800 [Amborella trichopoda]
Length=917

 Score =   226 bits (575),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 141/182 (77%), Gaps = 19/182 (10%)
 Frame = +2

Query  455  SGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVH  634
            SGPLSGPLNKR G++SARFN+    +             N DD YVEITLDVR+DSVAVH
Sbjct  34   SGPLSGPLNKRGGRRSARFNIPEPSTQ------------NPDDGYVEITLDVRDDSVAVH  81

Query  635  SVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHP  814
            SVK  AG D EDPE+ LLAR LEKKT+LGSS++R+ASSRI+QVSQEL+R+AS+T     P
Sbjct  82   SVK-PAGQDNEDPEVTLLARTLEKKTSLGSSVIRSASSRIKQVSQELRRLASIT---KRP  137

Query  815  A-GRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
            A GR DR KSAAA ALKGLKFISKTDGASGW AVEKRFD+L  A NG+LP+A FG+CIGM
Sbjct  138  APGRFDRTKSAAAHALKGLKFISKTDGASGWPAVEKRFDEL--AVNGVLPKALFGQCIGM  195

Query  992  NK  997
             +
Sbjct  196  KE  197



>ref|XP_008239295.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Prunus 
mume]
Length=940

 Score =   225 bits (574),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 156/205 (76%), Gaps = 11/205 (5%)
 Frame = +2

Query  398  HHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTG-KKSARFNLAggdssselgspssarsAN  574
            H+HSDTE+  VG ++  +YSGPLSGPLNK++G KK+A+FN+A    S+     S     +
Sbjct  10   HYHSDTEI--VGSERMVTYSGPLSGPLNKKSGNKKTAKFNIAEPAGSAVKPGIS----TS  63

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEK-KTTLGSSLVRNASSR  751
            +++ YVE+ LDVREDSVAVHSVK +A    +  E+ LL +GLEK ++  GSS+VR AS+R
Sbjct  64   DEEPYVEVILDVREDSVAVHSVKPSADDHEDHVEMTLLGKGLEKNQSPKGSSVVRTASAR  123

Query  752  IRQVSQELKRIASMT---MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKR  922
            I+QVSQELKR+AS +   + A HP  R DR +SAAA ALKGLKFISKTDG +GW AVEK+
Sbjct  124  IKQVSQELKRMASFSKQAVAAPHPRRRFDRTQSAAAPALKGLKFISKTDGNAGWPAVEKK  183

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            F+QLTA+SNGLLPR+ FGECIGMNK
Sbjct  184  FNQLTASSNGLLPRSLFGECIGMNK  208



>ref|XP_002318793.2| respiratory burst oxidase C family protein [Populus trichocarpa]
 gb|EEE97013.2| respiratory burst oxidase C family protein [Populus trichocarpa]
Length=909

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 152/206 (74%), Gaps = 21/206 (10%)
 Frame = +2

Query  380  QSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspss  559
            Q    + HHSD+E+      +R +YSGPLSGPLNKR G+KSARF++ G            
Sbjct  2    QDMGREDHHSDSEM---SGSERLAYSGPLSGPLNKRPGRKSARFSIPGTT----------  48

Query  560  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRN  739
                + D+ YVEITLDVR DSVAVHSVK A G + EDPE+ALLA+GLEK++   S+++R 
Sbjct  49   ---TSKDEQYVEITLDVRNDSVAVHSVKAANGVE-EDPEMALLAKGLEKRS--ASNVLRT  102

Query  740  ASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            AS+RIRQVS E+KR+AS +     P GR+DR+KSAAA ALKGLKFISKTDG +GWAAVEK
Sbjct  103  ASARIRQVSHEIKRLASFSKRP--PPGRLDRSKSAAAHALKGLKFISKTDGGAGWAAVEK  160

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            RFD++TA+++GLLPRA F ECIGM +
Sbjct  161  RFDEITASTDGLLPRARFCECIGMKE  186



>ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Nelumbo 
nucifera]
Length=924

 Score =   222 bits (566),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 147/190 (77%), Gaps = 7/190 (4%)
 Frame = +2

Query  440  KRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRED  619
            +R S+SGPLSGPLNKR G+KSARFNL    SS    S SS+ +  +DDAYVEIT+DVR D
Sbjct  19   ERSSFSGPLSGPLNKR-GRKSARFNLPEPISSVSRASCSSSNNIPDDDAYVEITIDVRGD  77

Query  620  SVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTM  799
            SVAVHSVK A G D ED EL LLA+ LEK+++ GSS++R AS RI+QVSQELKR+AS+T 
Sbjct  78   SVAVHSVKPAGGEDDEDHELTLLAKNLEKRSSFGSSVMRTASLRIKQVSQELKRLASLTT  137

Query  800  GAGHPAGRIDRNKSAAAQALKGLKFISK--TDGASG--WAAVEKRFDQLTAASNGLLPRA  967
                 A R DR KSAAA ALKGLKFIS   TDGA+G  W AVEKRFD+LTA++NG+LPR 
Sbjct  138  RPS--ATRFDRTKSAAAHALKGLKFISSKTTDGAAGNAWLAVEKRFDELTASTNGVLPRT  195

Query  968  XFGECIGMNK  997
             FGECIGMNK
Sbjct  196  LFGECIGMNK  205



>ref|XP_002322314.2| respiratory burst oxidase C family protein [Populus trichocarpa]
 gb|EEF06441.2| respiratory burst oxidase C family protein [Populus trichocarpa]
Length=915

 Score =   220 bits (561),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 145/201 (72%), Gaps = 21/201 (10%)
 Frame = +2

Query  395  QHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsAN  574
            + HHSDTE+      +R +YSGPLSGPLNKR GKKSARFN+                  +
Sbjct  7    EDHHSDTEL---SGSERVAYSGPLSGPLNKRPGKKSARFNIPETT-------------TS  50

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
             D+ YVEITLDVR D VAVHSVK + G   EDPE+ LLA+G +K++   S++VR AS+RI
Sbjct  51   KDEQYVEITLDVRNDFVAVHSVKPSHGVK-EDPEMTLLAKGPDKRSV--SNVVRTASARI  107

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            RQVS E+KR+AS +     P GR+DR+KSAAA ALKGLKFISKTDG +GWAAVEKRFD++
Sbjct  108  RQVSHEIKRLASFSKRP--PPGRLDRSKSAAAHALKGLKFISKTDGGAGWAAVEKRFDEI  165

Query  935  TAASNGLLPRAXFGECIGMNK  997
            TA++ GLLPRA F ECIGM +
Sbjct  166  TASTEGLLPRARFCECIGMKE  186



>gb|KJB07927.1| hypothetical protein B456_001G053300 [Gossypium raimondii]
Length=907

 Score =   219 bits (559),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 139/189 (74%), Gaps = 19/189 (10%)
 Frame = +2

Query  428  VGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLD  607
            +G DK   +SGPLSGPLNKR  +KSARFN+                 ++ DD YVEITLD
Sbjct  6    LGTDK-VPHSGPLSGPLNKRVPRKSARFNVPDSS-------------SSKDDGYVEITLD  51

Query  608  VREDSVAVHSVKTAAGADVE-DPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRI  784
            V +DSVAVHS+K A G D+E DPELALLA+GLEK+TTLGS + RNAS++IRQVS ELKR+
Sbjct  52   VCDDSVAVHSLKAANGDDLEQDPELALLAKGLEKRTTLGSLMARNASAKIRQVSHELKRL  111

Query  785  ASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPR  964
             S    A  PA R DR KSAAA AL GLKFISKTDG  GWAAVEKRFD++T ++NG LPR
Sbjct  112  TSF---AKKPA-RFDRTKSAAAHALTGLKFISKTDGGHGWAAVEKRFDEITGSNNGYLPR  167

Query  965  AXFGECIGM  991
            + FGECIGM
Sbjct  168  SQFGECIGM  176



>ref|XP_012090542.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Jatropha 
curcas]
 gb|KDP22507.1| hypothetical protein JCGZ_26338 [Jatropha curcas]
Length=904

 Score =   218 bits (555),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 147/202 (73%), Gaps = 24/202 (12%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsA  571
            HQHHHSDTE++     ++  YSGPLSGPLNKR  +KSARFN+                 +
Sbjct  8    HQHHHSDTELLS---GEKVPYSGPLSGPLNKRGTRKSARFNIPESS-------------S  51

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR  751
            + D+ YVE+TLDVR+DSVAVHSVK A G   EDPE+ LLA+GLEK++   S +VRNAS++
Sbjct  52   SQDEQYVEVTLDVRDDSVAVHSVKAANGV-AEDPEVTLLAKGLEKRS--ASKIVRNASAK  108

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            IRQ   E+KR+AS +     P  R+DR K+AAA ALKGL+FISKTDG +GWAAVEKRFD+
Sbjct  109  IRQ---EIKRLASFS--KRQPPSRLDRTKTAAAHALKGLEFISKTDGGAGWAAVEKRFDE  163

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            +TA+++GLLPR+ F ECIGM +
Sbjct  164  ITASTHGLLPRSRFCECIGMKE  185



>ref|XP_011040313.1| PREDICTED: respiratory burst oxidase homolog protein C [Populus 
euphratica]
Length=909

 Score =   218 bits (554),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 144/201 (72%), Gaps = 21/201 (10%)
 Frame = +2

Query  395  QHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsAN  574
            + HHSDTE+      +R +YSGPLSGPLNKR GKKSARFN+                  +
Sbjct  7    EDHHSDTEL---SGSERVAYSGPLSGPLNKRPGKKSARFNIPETA-------------TS  50

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
             D+ YVEITLDVR D VA+HSVK + G   EDPE+ LLA+G +K++   S++VR AS+RI
Sbjct  51   KDEQYVEITLDVRNDFVALHSVKPSHGVK-EDPEMTLLAKGADKRS--ASNVVRTASARI  107

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            RQVS E+KR+ S +     P GR+DR+KSAAA ALKGLKFISKTDG +GWAAVEKRFD++
Sbjct  108  RQVSHEIKRLTSFSKRP--PPGRLDRSKSAAAHALKGLKFISKTDGGAGWAAVEKRFDEI  165

Query  935  TAASNGLLPRAXFGECIGMNK  997
            TA++ GLLPRA F ECIGM +
Sbjct  166  TASTEGLLPRARFCECIGMKE  186



>ref|XP_010929525.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Elaeis 
guineensis]
Length=934

 Score =   217 bits (553),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 152/213 (71%), Gaps = 19/213 (9%)
 Frame = +2

Query  356  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  535
            +EM + D +   HQ    +TE   +G D R SYSGPLSGPLNKR G++SARFN+      
Sbjct  2    QEMGTDDGRGGDHQSDVMETES--IGSD-RVSYSGPLSGPLNKRGGRRSARFNIPDSAGG  58

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  712
                          D+ YVEITLDVR+DSVAVHSVK AA  + EDP++ LLAR LEK++ 
Sbjct  59   -----------GGGDEQYVEITLDVRDDSVAVHSVKPAAAGEEEDPDVTLLARTLEKRSG  107

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
            ++GSS++R+ASSRIRQVSQELKR+AS+    G   GR+DR+KSAAA ALKGLKFISKTDG
Sbjct  108  SIGSSVIRSASSRIRQVSQELKRLASLNKRPGQ--GRVDRSKSAAAHALKGLKFISKTDG  165

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
             +GW AVEKRFD+L  A +G L R+ FG+CIGM
Sbjct  166  TAGWPAVEKRFDEL--AVDGALARSLFGQCIGM  196



>gb|ADR70880.1| respiratory burst oxidase A [Manihot esculenta]
Length=908

 Score =   215 bits (548),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 144/201 (72%), Gaps = 21/201 (10%)
 Frame = +2

Query  395  QHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsAN  574
            QHH SDTE++     +R  YSGPLSGPLNKR  +KSARFN+                 + 
Sbjct  9    QHHRSDTELIS---GERAPYSGPLSGPLNKRGTRKSARFNIPESS-------------SA  52

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
             D+ YVE+TLDVR+DSVAV SVK A     EDPE  LL +GLEK++T  S ++RNAS+RI
Sbjct  53   QDEQYVEVTLDVRDDSVAVRSVKAAEME--EDPEATLLGKGLEKRST--SKVMRNASTRI  108

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            RQVSQE+KR+ S +     P GR+DR ++AAA ALKGLKFISKTDG +GWAAVEKRFD++
Sbjct  109  RQVSQEIKRLTSFSKRPP-PPGRLDRTRTAAAHALKGLKFISKTDGGAGWAAVEKRFDEI  167

Query  935  TAASNGLLPRAXFGECIGMNK  997
            TA+++GLLPR+ F ECIGM +
Sbjct  168  TASTDGLLPRSRFCECIGMKE  188



>gb|KHG02500.1| Respiratory burst oxidase C [Gossypium arboreum]
Length=919

 Score =   214 bits (546),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 150/213 (70%), Gaps = 24/213 (11%)
 Frame = +2

Query  356  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  535
            ++MSS D     + HHHSD E +  G DK   + GPLSG LNKR G+K +RFNL G    
Sbjct  2    QKMSSDDGI---YHHHHSDKEAL--GTDK-VPHIGPLSGSLNKRAGRKGSRFNLPGSS--  53

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARGLEKKT  712
                       ++  D YVEITLDV +DSVAVHS+K A G D++D PEL LLA+GLEKK+
Sbjct  54   -----------SSKGDDYVEITLDVGDDSVAVHSLKAANGDDLQDDPELTLLAKGLEKKS  102

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
            ++GSS+VRNAS++I+QV QELKR+ S++        R DR KSA A ALKGLKFISKTDG
Sbjct  103  SVGSSMVRNASAKIKQVGQELKRLTSLS----KKPPRFDRTKSAVAHALKGLKFISKTDG  158

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
              GW AVEK FD+++A++NG+LPR+ FGECIGM
Sbjct  159  EHGWVAVEKLFDEISASNNGVLPRSRFGECIGM  191



>gb|KJB51324.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
 gb|KJB51329.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=697

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 147/214 (69%), Gaps = 27/214 (13%)
 Frame = +2

Query  359  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  532
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  533  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  709
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  710  TTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTD  889
                S +VRNAS++IRQV  ELKR+ S +     PA R DR KSAAA AL GLKFISK +
Sbjct  107  ----SKVVRNASAKIRQVGHELKRLTSFS---KKPA-RFDRTKSAAAHALMGLKFISKNE  158

Query  890  GASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
               GW AVEKRFD +TA++NG+LPR  FGECIGM
Sbjct  159  CGHGWEAVEKRFDDITASNNGVLPRYRFGECIGM  192



>gb|KJB51327.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=888

 Score =   211 bits (538),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 147/214 (69%), Gaps = 27/214 (13%)
 Frame = +2

Query  359  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  532
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  533  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  709
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  710  TTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTD  889
                S +VRNAS++IRQV  ELKR+ S +     PA R DR KSAAA AL GLKFISK +
Sbjct  107  ----SKVVRNASAKIRQVGHELKRLTSFS---KKPA-RFDRTKSAAAHALMGLKFISKNE  158

Query  890  GASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
               GW AVEKRFD +TA++NG+LPR  FGECIGM
Sbjct  159  CGHGWEAVEKRFDDITASNNGVLPRYRFGECIGM  192



>gb|KJB51328.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=920

 Score =   211 bits (538),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 147/214 (69%), Gaps = 27/214 (13%)
 Frame = +2

Query  359  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  532
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  533  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  709
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  710  TTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTD  889
                S +VRNAS++IRQV  ELKR+ S +     PA R DR KSAAA AL GLKFISK +
Sbjct  107  ----SKVVRNASAKIRQVGHELKRLTSFS---KKPA-RFDRTKSAAAHALMGLKFISKNE  158

Query  890  GASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
               GW AVEKRFD +TA++NG+LPR  FGECIGM
Sbjct  159  CGHGWEAVEKRFDDITASNNGVLPRYRFGECIGM  192



>gb|KJB51323.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=918

 Score =   211 bits (537),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 147/214 (69%), Gaps = 27/214 (13%)
 Frame = +2

Query  359  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  532
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  533  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  709
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  710  TTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTD  889
                S +VRNAS++IRQV  ELKR+ S +     PA R DR KSAAA AL GLKFISK +
Sbjct  107  ----SKVVRNASAKIRQVGHELKRLTSFS---KKPA-RFDRTKSAAAHALMGLKFISKNE  158

Query  890  GASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
               GW AVEKRFD +TA++NG+LPR  FGECIGM
Sbjct  159  CGHGWEAVEKRFDDITASNNGVLPRYRFGECIGM  192



>gb|KJB51326.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=912

 Score =   211 bits (537),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 147/214 (69%), Gaps = 27/214 (13%)
 Frame = +2

Query  359  EMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggds  532
            +MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+     
Sbjct  3    KMSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS-  58

Query  533  sselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKK  709
                        ++NDD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK
Sbjct  59   ------------SSNDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK  106

Query  710  TTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTD  889
                S +VRNAS++IRQV  ELKR+ S +     PA R DR KSAAA AL GLKFISK +
Sbjct  107  ----SKVVRNASAKIRQVGHELKRLTSFS---KKPA-RFDRTKSAAAHALMGLKFISKNE  158

Query  890  GASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
               GW AVEKRFD +TA++NG+LPR  FGECIGM
Sbjct  159  CGHGWEAVEKRFDDITASNNGVLPRYRFGECIGM  192



>gb|KHG00108.1| Respiratory burst oxidase C [Gossypium arboreum]
Length=915

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 147/213 (69%), Gaps = 27/213 (13%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRT--GKKSARFNLAggdss  535
            MSS D   + H+HH+SDT+V+  G +K   +SGPLSGPLNK+   GKK+A FN+      
Sbjct  1    MSSEDGDRYHHRHHYSDTDVL--GSEK-VPHSGPLSGPLNKKVAAGKKTAHFNIPDSS--  55

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADV-EDPELALLARGLEKKT  712
                       ++ DD YVEITLDV  DSVAV SVK A G D+ EDPEL+LLA+GLEKK 
Sbjct  56   -----------SSKDDRYVEITLDVTADSVAVQSVKAANGGDLQEDPELSLLAKGLEKK-  103

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
               S++VRNAS++IRQV  ELKR+ S +     PA R DR KSAAA AL GLKFISK + 
Sbjct  104  ---SNVVRNASAKIRQVGHELKRLTSFS---KKPA-RFDRTKSAAAHALMGLKFISKNEC  156

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
              GW AVEKRFD +TA++NG+LPR+ FGECIGM
Sbjct  157  GHGWEAVEKRFDDITASNNGVLPRSRFGECIGM  189



>ref|XP_008807835.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
X3 [Phoenix dactylifera]
Length=929

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 152/215 (71%), Gaps = 23/215 (11%)
 Frame = +2

Query  356  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  535
            ++M + D +   HQ      E   VG D+        SGPL+KR+ +KSARFNL G    
Sbjct  2    QKMGTDDGKGGDHQSDSDIIETESVGSDRVGH-----SGPLSKRSSRKSARFNLPGSA--  54

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  712
                       A +D+ YVEITLDVR+DSVAVHSVK AAG + EDPE+ LLAR LEK++ 
Sbjct  55   -----------AGDDEQYVEITLDVRDDSVAVHSVKPAAGGEAEDPEMTLLARTLEKQSG  103

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
            ++GSS++R+ASSRIRQVSQELKR+AS+T  +G   G +DR+KSAAA ALKGLKFISKTDG
Sbjct  104  SIGSSVLRSASSRIRQVSQELKRLASVTKRSG--PGPVDRSKSAAAHALKGLKFISKTDG  161

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            A+GW A+EKRFD+L  A +G LPR+ FG+CIGM +
Sbjct  162  AAGWPAIEKRFDEL--AVDGALPRSLFGQCIGMKE  194



>ref|XP_008807834.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X2 [Phoenix dactylifera]
Length=921

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 152/215 (71%), Gaps = 23/215 (11%)
 Frame = +2

Query  356  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  535
            ++M + D +   HQ      E   VG D+        SGPL+KR+ +KSARFNL G    
Sbjct  2    QKMGTDDGKGGDHQSDSDIIETESVGSDRVGH-----SGPLSKRSSRKSARFNLPGSA--  54

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  712
                       A +D+ YVEITLDVR+DSVAVHSVK AAG + EDPE+ LLAR LEK++ 
Sbjct  55   -----------AGDDEQYVEITLDVRDDSVAVHSVKPAAGGEAEDPEMTLLARTLEKQSG  103

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
            ++GSS++R+ASSRIRQVSQELKR+AS+T  +G   G +DR+KSAAA ALKGLKFISKTDG
Sbjct  104  SIGSSVLRSASSRIRQVSQELKRLASVTKRSG--PGPVDRSKSAAAHALKGLKFISKTDG  161

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            A+GW A+EKRFD+L  A +G LPR+ FG+CIGM +
Sbjct  162  AAGWPAIEKRFDEL--AVDGALPRSLFGQCIGMKE  194



>ref|XP_008807833.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X1 [Phoenix dactylifera]
Length=921

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 152/215 (71%), Gaps = 23/215 (11%)
 Frame = +2

Query  356  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  535
            ++M + D +   HQ      E   VG D+        SGPL+KR+ +KSARFNL G    
Sbjct  2    QKMGTDDGKGGDHQSDSDIIETESVGSDRVGH-----SGPLSKRSSRKSARFNLPGSA--  54

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT-  712
                       A +D+ YVEITLDVR+DSVAVHSVK AAG + EDPE+ LLAR LEK++ 
Sbjct  55   -----------AGDDEQYVEITLDVRDDSVAVHSVKPAAGGEAEDPEMTLLARTLEKQSG  103

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
            ++GSS++R+ASSRIRQVSQELKR+AS+T  +G   G +DR+KSAAA ALKGLKFISKTDG
Sbjct  104  SIGSSVLRSASSRIRQVSQELKRLASVTKRSG--PGPVDRSKSAAAHALKGLKFISKTDG  161

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            A+GW A+EKRFD+L  A +G LPR+ FG+CIGM +
Sbjct  162  AAGWPAIEKRFDEL--AVDGALPRSLFGQCIGMKE  194



>gb|KJB19752.1| hypothetical protein B456_003G117900 [Gossypium raimondii]
Length=691

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 147/213 (69%), Gaps = 24/213 (11%)
 Frame = +2

Query  356  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  535
            ++MSS D     + HHHS  EV+  G DK   + GPLSG LNKR G+K +RFNL G    
Sbjct  2    QKMSSDDGI---YHHHHSGKEVL--GTDK-VPHIGPLSGSLNKRAGRKGSRFNLPGSS--  53

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARGLEKKT  712
                       ++  D YVEITLDV +DSVAVHS+K   G D++D  EL LLA+GLEKK+
Sbjct  54   -----------SSKGDDYVEITLDVGDDSVAVHSLKATNGDDLQDDAELTLLAKGLEKKS  102

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
            ++GSS+VRNAS++I+QV QELKR+ S++        R DR KSA A ALKGLKFISKTD 
Sbjct  103  SVGSSMVRNASAKIKQVGQELKRLTSLS----KKPSRFDRTKSAVAHALKGLKFISKTDC  158

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
              GW AVEK FD+++A++NG+LPR+ FGECIGM
Sbjct  159  GHGWVAVEKLFDEISASNNGVLPRSRFGECIGM  191



>gb|KJB19751.1| hypothetical protein B456_003G117900 [Gossypium raimondii]
Length=919

 Score =   206 bits (524),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 147/213 (69%), Gaps = 24/213 (11%)
 Frame = +2

Query  356  REMSSSDQQSFRHQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdss  535
            ++MSS D     + HHHS  EV+  G DK   + GPLSG LNKR G+K +RFNL G    
Sbjct  2    QKMSSDDGI---YHHHHSGKEVL--GTDK-VPHIGPLSGSLNKRAGRKGSRFNLPGSS--  53

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARGLEKKT  712
                       ++  D YVEITLDV +DSVAVHS+K   G D++D  EL LLA+GLEKK+
Sbjct  54   -----------SSKGDDYVEITLDVGDDSVAVHSLKATNGDDLQDDAELTLLAKGLEKKS  102

Query  713  TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG  892
            ++GSS+VRNAS++I+QV QELKR+ S++        R DR KSA A ALKGLKFISKTD 
Sbjct  103  SVGSSMVRNASAKIKQVGQELKRLTSLS----KKPSRFDRTKSAVAHALKGLKFISKTDC  158

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
              GW AVEK FD+++A++NG+LPR+ FGECIGM
Sbjct  159  GHGWVAVEKLFDEISASNNGVLPRSRFGECIGM  191



>ref|XP_010942321.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Elaeis 
guineensis]
Length=928

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 134/178 (75%), Gaps = 18/178 (10%)
 Frame = +2

Query  467  SGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKT  646
            SGPL+KR  +KSARFNL                 A +D+ YVEITLDVR+DSVAVHSVK 
Sbjct  32   SGPLSKRGSRKSARFNLPESA-------------AGDDEQYVEITLDVRDDSVAVHSVKP  78

Query  647  AAGADVEDPELALLARGLEKKT-TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGR  823
            AAG +VEDPE+ LLAR LEK++ ++GS+++R+ASSRIRQVSQELKR+AS     G   G 
Sbjct  79   AAGGEVEDPEVTLLARTLEKQSGSIGSAVLRSASSRIRQVSQELKRLASFNKRPG--PGP  136

Query  824  IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            IDR+KSAAA ALKGLKFISKTDGA+GW  VEKRFD+L  A +G LPR+ FG+CIGM +
Sbjct  137  IDRSKSAAAHALKGLKFISKTDGAAGWPTVEKRFDEL--AVDGALPRSLFGQCIGMKE  192



>gb|ADQ74913.1| respiratory burst oxidase protein 1 [Picea abies]
Length=954

 Score =   198 bits (504),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 135/183 (74%), Gaps = 11/183 (6%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R ++SGPLSGPLNKR G++SARFN+ G  +++   +         D+ YVEITLDV +DS
Sbjct  67   RVAFSGPLSGPLNKRPGRRSARFNIPGDGATTSKSN-------GGDEGYVEITLDVMDDS  119

Query  623  VAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMG  802
            +AVHSVK A   D EDPE+ALLA+ LEKKT+ GSS++RNAS+RI+ VSQELKR+ S T  
Sbjct  120  IAVHSVKPAGPGDQEDPEIALLAKDLEKKTSFGSSIIRNASARIKHVSQELKRLTSFTKR  179

Query  803  AGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGEC  982
            + HP GR+DR+K+ A  AL GLKFI+KT G + W  V+++FD+L  A  G LPRA FG+C
Sbjct  180  S-HP-GRLDRSKTGAHHALLGLKFITKTKGGADWNLVDQKFDEL--AVEGYLPRAHFGQC  235

Query  983  IGM  991
            IGM
Sbjct  236  IGM  238



>ref|XP_009404193.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa 
acuminata subsp. malaccensis]
Length=938

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 140/182 (77%), Gaps = 17/182 (9%)
 Frame = +2

Query  464  LSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVK  643
             SGPL+KR  +KSARFNL    +++            +D+AYVEITLDVR+D+VAVHSVK
Sbjct  29   FSGPLSKRGSRKSARFNLPASSAAA----------GEDDEAYVEITLDVRDDTVAVHSVK  78

Query  644  TAAGA---DVEDPELALLARGLEKKT-TLGSSLVRNASSRIRQVSQELKRIASMTMGAGH  811
             AAGA   ++EDPE++LLAR LE+++ + GSS++R ASSRIRQVSQEL+R+AS+T     
Sbjct  79   PAAGAGGGEMEDPEVSLLARTLERRSASFGSSVIRTASSRIRQVSQELRRLASVTKRPT-  137

Query  812  PAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
              G++DR++SAAA ALKGLKFI+KTDGA+GW AVEKRFD+L  A++G LPR+ F +CIGM
Sbjct  138  AGGKVDRSRSAAAHALKGLKFITKTDGAAGWLAVEKRFDEL--AADGALPRSLFAQCIGM  195

Query  992  NK  997
             +
Sbjct  196  KE  197



>ref|XP_011082784.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Sesamum 
indicum]
Length=921

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 138/201 (69%), Gaps = 26/201 (13%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGPLNKRTG--KKSARFNLAggdssselgspssarsANND  580
            SDTEV  +G D R S+SGPLSGPLNKR G  +KS +F+            P +  SA   
Sbjct  17   SDTEV--IGGD-RTSFSGPLSGPLNKRAGGGRKSPQFS-----------HPDTPTSAATA  62

Query  581  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI-R  757
            D YVEITLDVREDSVAVHSVK A G +VEDP L  L   LEKK    SS  RNA +RI R
Sbjct  63   DDYVEITLDVREDSVAVHSVKAAGGGEVEDPGLTKL---LEKK----SSFARNAPARIIR  115

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDG-ASGWAAVEKRFDQL  934
            QVS ELKR+AS T    HP  R+DR KS AA ALKGLKFIS+TDG A+ WA VE RFD+L
Sbjct  116  QVSLELKRLASFTRHP-HPGRRLDRTKSGAAYALKGLKFISQTDGGAACWAGVENRFDEL  174

Query  935  TAASNGLLPRAXFGECIGMNK  997
            TA +NGLLPR+ F ECIGMNK
Sbjct  175  TATTNGLLPRSLFCECIGMNK  195



>ref|XP_009792212.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X2 [Nicotiana sylvestris]
Length=711

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALL--ARGLEKKTTLGSSLVRNASSR  751
            DD YVEITLDVRED+VAVHSVK A+GA+VE+ EL +L  A+ L KK + G+S+VRN S R
Sbjct  32   DDTYVEITLDVREDTVAVHSVKNASGANVEEAELQVLRLAKNLRKKQSFGTSVVRNTSIR  91

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQ-ALKGLKFISKTDGASGWAAVEKRFD  928
            +RQV+QELKR+A++     HP+ R DR  S AA  ALKGLKFISKTDG +GWAAVEKRF 
Sbjct  92   MRQVAQELKRLATLKKQQPHPSRRFDRTNSVAAHHALKGLKFISKTDGGAGWAAVEKRFH  151

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +L+A S+GLLPRA FGECIGMN+
Sbjct  152  ELSATSDGLLPRAKFGECIGMNR  174



>ref|XP_009792218.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X3 [Nicotiana sylvestris]
Length=707

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALL--ARGLEKKTTLGSSLVRNASSR  751
            DD YVEITLDVRED+VAVHSVK A+GA+VE+ EL +L  A+ L KK + G+S+VRN S R
Sbjct  32   DDTYVEITLDVREDTVAVHSVKNASGANVEEAELQVLRLAKNLRKKQSFGTSVVRNTSIR  91

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQ-ALKGLKFISKTDGASGWAAVEKRFD  928
            +RQV+QELKR+A++     HP+ R DR  S AA  ALKGLKFISKTDG +GWAAVEKRF 
Sbjct  92   MRQVAQELKRLATLKKQQPHPSRRFDRTNSVAAHHALKGLKFISKTDGGAGWAAVEKRFH  151

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +L+A S+GLLPRA FGECIGMN+
Sbjct  152  ELSATSDGLLPRAKFGECIGMNR  174



>ref|XP_009792203.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X1 [Nicotiana sylvestris]
Length=892

 Score =   192 bits (487),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALL--ARGLEKKTTLGSSLVRNASSR  751
            DD YVEITLDVRED+VAVHSVK A+GA+VE+ EL +L  A+ L KK + G+S+VRN S R
Sbjct  32   DDTYVEITLDVREDTVAVHSVKNASGANVEEAELQVLRLAKNLRKKQSFGTSVVRNTSIR  91

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQ-ALKGLKFISKTDGASGWAAVEKRFD  928
            +RQV+QELKR+A++     HP+ R DR  S AA  ALKGLKFISKTDG +GWAAVEKRF 
Sbjct  92   MRQVAQELKRLATLKKQQPHPSRRFDRTNSVAAHHALKGLKFISKTDGGAGWAAVEKRFH  151

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +L+A S+GLLPRA FGECIGMN+
Sbjct  152  ELSATSDGLLPRAKFGECIGMNR  174



>gb|ADR70892.1| respiratory burst oxidase C [Manihot esculenta]
Length=882

 Score =   191 bits (485),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 128/178 (72%), Gaps = 17/178 (10%)
 Frame = +2

Query  464  LSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVK  643
            +SGPLNK+ GKKSARFN+                 +  D+ YVE+TLDVR+DSVAVHSVK
Sbjct  1    MSGPLNKKGGKKSARFNIPESS-------------SAQDEQYVEVTLDVRDDSVAVHSVK  47

Query  644  TAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGR  823
            TA G + E  E+ LL RGLEK++T  S + RNAS+RI+QVSQE+KR+ S +     P  R
Sbjct  48   TAKGGE-EVGEMTLLGRGLEKRST--SKVARNASARIKQVSQEIKRLTSFSKRPP-PGRR  103

Query  824  IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
             DR KSAAA ALKGLKFISKT+G +GW  VEKRFD++TA+++GLLPR+ F ECIGM +
Sbjct  104  FDRTKSAAAHALKGLKFISKTEGGAGWDGVEKRFDEITASTDGLLPRSRFCECIGMKE  161



>ref|XP_010657584.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
 ref|XP_010657595.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
Length=923

 Score =   186 bits (471),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 143/201 (71%), Gaps = 13/201 (6%)
 Frame = +2

Query  404  HSDTEVMVVGVDKRKSYSGPLSGPLNK-RTGKKSARFNLAggdssselgspssarsANND  580
            +SDTE   V  DK  SYSGPL+GP NK R+ +KSARFN+    S     S  + R  ++D
Sbjct  7    NSDTES--VQSDK-ASYSGPLAGPPNKKRSARKSARFNIPPETSPQLKTSSVTRR--DDD  61

Query  581  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKTTLGSSLVRNASSRIR  757
            DAYVEITLD+ +DS+AVHSV+ A GA  EDPELALLA + LEKK++LGSS+ RN SSRI+
Sbjct  62   DAYVEITLDILDDSIAVHSVQAAGGAKGEDPELALLAKKTLEKKSSLGSSVFRNTSSRIK  121

Query  758  QVSQELKRIASMTMGAGHPAGR-IDRNKSAAAQALKGLKFIS--KTDGASGWAAVEKRFD  928
            QVSQELKR AS++     P+ R  DR KSA   ALKGLKFI+     GA+GW AVEKRFD
Sbjct  122  QVSQELKRFASLSR---RPSARHFDRTKSAVTHALKGLKFITTKAGGGAAGWPAVEKRFD  178

Query  929  QLTAASNGLLPRAXFGECIGM  991
            +LTA +NG L  + F ECIGM
Sbjct  179  ELTAPTNGHLHFSLFCECIGM  199



>gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea]
Length=887

 Score =   183 bits (464),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 127/177 (72%), Gaps = 17/177 (10%)
 Frame = +2

Query  467  SGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKT  646
            SGPL+ R  ++S RF L+   +SS          A  D+ YVEITLDVREDSVAVHS+KT
Sbjct  20   SGPLSGRDSRRSTRFGLSEKRNSSA---------AGADEDYVEITLDVREDSVAVHSLKT  70

Query  647  AAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRI  826
            A G DV+DPE ALLA GLE +    +S V+NASS+++QVSQEL R+AS+      P   I
Sbjct  71   AGGGDVDDPEFALLANGLEAR----ASAVKNASSKLKQVSQELIRLASLRRRP-RP---I  122

Query  827  DRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            DR KSAA +ALKGLKFISK +  + WA V+K++D+LTA+SN LLPRA FGECIGMNK
Sbjct  123  DRTKSAAGRALKGLKFISKAESGAAWAVVDKKYDELTASSNWLLPRALFGECIGMNK  179



>ref|XP_004979405.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Setaria 
italica]
Length=931

 Score =   180 bits (457),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 137/185 (74%), Gaps = 11/185 (6%)
 Frame = +2

Query  461  PLSGPLNKRTG-KKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHS  637
            P SGPL+K+TG +KSARF      +      P ++ SA +DD YVEITLDVR+DSVAVHS
Sbjct  37   PHSGPLSKKTGARKSARFA-ESVSAPLSAPPPRASPSATDDDDYVEITLDVRDDSVAVHS  95

Query  638  VKTAA--GADVEDPELALLARGLEKK--TTLGSSLVRNASSRIRQVSQELKRIASMTMGA  805
            VK AA  GA  EDP++ LLAR LE +  ++ G +++RNASSRI+QVSQEL+R+AS+    
Sbjct  96   VKPAAHGGAGGEDPDVTLLARTLENRRSSSYGHNVIRNASSRIKQVSQELRRLASINRHG  155

Query  806  GHPAGR-IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGEC  982
            G   GR +DR+KSAAA ALKGLKFISK +GA GW AVE+RFD+L  A NGLL R+ FG+C
Sbjct  156  G--GGRTLDRSKSAAAHALKGLKFISKAEGAKGWEAVEERFDKL--APNGLLHRSKFGQC  211

Query  983  IGMNK  997
            IGM +
Sbjct  212  IGMRE  216



>ref|XP_009421001.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa 
acuminata subsp. malaccensis]
Length=940

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 129/187 (69%), Gaps = 6/187 (3%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R S+SGPLSGPLNKR  K  AR +  G  SS            ++DD YVEITLDVR+D+
Sbjct  28   RISFSGPLSGPLNKRGEKSGARVSFPGSPSSVGSVKGKEQEEEDDDDTYVEITLDVRDDT  87

Query  623  VAVHSVKTAAGADVED--PELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMT  796
            VAVHSVK A         PE+A LAR LE+++  G+S++R AS R RQVSQEL+R+AS  
Sbjct  88   VAVHSVKAAGAGGDAAGDPEVAALARELERRSAFGASVMRTASWRFRQVSQELRRLASFG  147

Query  797  MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFG  976
               G  AG+ DR++SAAAQALKGLKFISK DG +GWAAVE+RFD+L  A +G L R+ F 
Sbjct  148  RRPG--AGKFDRSRSAAAQALKGLKFISKADGVAGWAAVERRFDEL--AVDGTLDRSKFA  203

Query  977  ECIGMNK  997
            +CIGM +
Sbjct  204  QCIGMKE  210



>ref|XP_010032776.1| PREDICTED: respiratory burst oxidase homolog protein D [Eucalyptus 
grandis]
 gb|KCW52247.1| hypothetical protein EUGRSUZ_J01662 [Eucalyptus grandis]
Length=967

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 134/206 (65%), Gaps = 16/206 (8%)
 Frame = +2

Query  428  VGVDKRKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEIT  601
            VG D R ++SGPL   L  +KR  +KSARFN+    +       +S     + D YVEIT
Sbjct  26   VGSDGRTAFSGPLGSALRSSKRGSRKSARFNIPAETAGLRSAGATSKDEQEDGDPYVEIT  85

Query  602  LDVREDSVAVHSVKTAAGA-DVEDPELALLA-RGLE--KKTTLGSSLVRNASSRIRQVSQ  769
            LD+R+D VAVHSV+ A GA + EDPELALLA R  E  + ++ GSS+ R+ SSR RQVSQ
Sbjct  86   LDIRDDGVAVHSVQAAGGATNFEDPELALLAKRTFETRRSSSFGSSVFRSTSSRFRQVSQ  145

Query  770  ELKRIASMTM-GAGHPAGRIDRNKSAAAQALKGLKFIS---------KTDGASGWAAVEK  919
            ELKRIAS+T      PA R DR +SAAA ALKGLKFI+             ASGW +VEK
Sbjct  146  ELKRIASLTRRPTAPPARRFDRTRSAAAHALKGLKFIAAKTGGGGGGAGSAASGWPSVEK  205

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            +FDQLTA+S GLL  + F ECIGMNK
Sbjct  206  KFDQLTASSGGLLHCSQFCECIGMNK  231



>gb|KHN31235.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=928

 Score =   176 bits (445),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 133/201 (66%), Gaps = 14/201 (7%)
 Frame = +2

Query  395  QHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsAN  574
             HHH D+++ ++     +    P SGPLNKR   +S++ N       +   + +SA    
Sbjct  15   HHHHRDSDIELIA----ERAPLPHSGPLNKR---RSSKLN-------NTSSASTSATEEQ  60

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
            ++  YVE+T+D++ DSVA+HSVKT      ED +L LL +G+EKK + G+S+VR+AS RI
Sbjct  61   DEGDYVEVTMDIQGDSVALHSVKTVNNDQSEDEKLILLGKGMEKKRSFGASVVRSASIRI  120

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            +QVSQELKR AS++          DRNKSAA+ ALKGLKFISKTD  +GW  VE++FD L
Sbjct  121  QQVSQELKRFASLSKQTASSRLHYDRNKSAASHALKGLKFISKTDAGAGWVEVERQFDAL  180

Query  935  TAASNGLLPRAXFGECIGMNK  997
            TA++NG L R+ F +CIGMNK
Sbjct  181  TASTNGYLHRSLFAKCIGMNK  201



>ref|XP_002450884.1| hypothetical protein SORBIDRAFT_05g020380 [Sorghum bicolor]
 gb|EES09872.1| hypothetical protein SORBIDRAFT_05g020380 [Sorghum bicolor]
Length=936

 Score =   175 bits (443),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 136/184 (74%), Gaps = 7/184 (4%)
 Frame = +2

Query  461  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  631
            P SGPL+K+TG +KSARF  +++   ++      SSA + ++DD YVEITLDVR+DSVAV
Sbjct  36   PHSGPLSKKTGARKSARFAESVSAPLTAPPPPRASSANNNDDDDDYVEITLDVRDDSVAV  95

Query  632  HSVKTA--AGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGA  805
            HSVK A   G   +D ++ LLAR LE +   G S++RNASSRI+QVSQEL+RIAS+    
Sbjct  96   HSVKPAHGGGGGGDDSDVTLLARTLENRRASGHSVIRNASSRIKQVSQELRRIASINRRG  155

Query  806  GHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECI  985
            G    R+DR+KSAAA ALKGLKFISK +GA+GW AVEKRFD+L  A NGLL R+ FG+CI
Sbjct  156  GGGGARLDRSKSAAAHALKGLKFISKAEGAAGWEAVEKRFDKL--AENGLLHRSKFGQCI  213

Query  986  GMNK  997
            GM +
Sbjct  214  GMKE  217



>gb|ABA94089.2| respiratory burst oxidase protein D, putative, expressed [Oryza 
sativa Japonica Group]
Length=936

 Score =   174 bits (442),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 136/188 (72%), Gaps = 12/188 (6%)
 Frame = +2

Query  461  PLSGPLNKRTG-KKSARF------NLAggdssselgspssarsANNDDAYVEITLDVRED  619
            P SGPL+KR+G +KSARF       L+     +     ++A + ++++ YVEITLDVR+D
Sbjct  36   PHSGPLSKRSGMRKSARFAESVSAPLSAPSGVAAARRAAAAANDDDEEDYVEITLDVRDD  95

Query  620  SVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQELKRIASMT  796
            SVAVHSVK A G   ED ++ LLAR LEK+ ++ G S++RNASSRI+QVSQEL+R+AS+ 
Sbjct  96   SVAVHSVKPAGGGG-EDSDVTLLARTLEKRSSSFGHSVIRNASSRIKQVSQELRRLASVN  154

Query  797  -MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXF  973
              G G    R DR+KSAAA ALKGLKFIS+ DG +GW AVEKRFD L  A +GLLPR+ F
Sbjct  155  RRGGGGGGPRFDRSKSAAAHALKGLKFISRADGGAGWPAVEKRFDDL--AKDGLLPRSKF  212

Query  974  GECIGMNK  997
            G+CIGM +
Sbjct  213  GQCIGMKE  220



>ref|XP_007137830.1| hypothetical protein PHAVU_009G159200g [Phaseolus vulgaris]
 gb|ESW09824.1| hypothetical protein PHAVU_009G159200g [Phaseolus vulgaris]
Length=930

 Score =   174 bits (442),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 137/201 (68%), Gaps = 8/201 (4%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  580
            H  D+++ ++G ++      P SGPL+KR G++S++ + A   +S      S ++  +  
Sbjct  14   HLRDSDIELIGGER-----APHSGPLSKRVGRRSSKLSNASASTSGSDVGHSISQEQDEG  68

Query  581  DAYVEITLDVREDSVAVHSVKTAAGA--DVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
            D YVE+T+D++ DSVA+HSV   AG     ED +L LL +G+EKK + G+S+VR+AS RI
Sbjct  69   D-YVEVTMDIKGDSVALHSVIPVAGNSDQGEDEKLVLLGKGMEKKRSFGASVVRSASIRI  127

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            +QVSQELKR+AS +          DR KSAA+ ALKGLKFISKTDG +GWA VEK+FD L
Sbjct  128  QQVSQELKRLASSSKQGATARVHYDRTKSAASHALKGLKFISKTDGGAGWAEVEKKFDAL  187

Query  935  TAASNGLLPRAXFGECIGMNK  997
            TA++NG L R+ F +CIGMNK
Sbjct  188  TASTNGYLHRSLFAKCIGMNK  208



>gb|AEX56133.1| NADPH oxidase [Phaseolus vulgaris]
Length=930

 Score =   174 bits (442),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 137/201 (68%), Gaps = 8/201 (4%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  580
            H  D+++ ++G ++      P SGPL+KR G++S++ + A   +S      S ++  +  
Sbjct  14   HLRDSDIELIGGER-----APHSGPLSKRVGRRSSKLSNASASTSGSDVGHSISQEQDEG  68

Query  581  DAYVEITLDVREDSVAVHSVKTAAGADV--EDPELALLARGLEKKTTLGSSLVRNASSRI  754
            D YVE+T+D++ DSVA+HSV   AG     ED +L LL +G+EKK + G+S+VR+AS RI
Sbjct  69   D-YVEVTMDIKGDSVALHSVIPVAGNSDQGEDEKLVLLGKGMEKKRSFGASVVRSASIRI  127

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            +QVSQELKR+AS +          DR KSAA+ ALKGLKFISKTDG +GWA VEK+FD L
Sbjct  128  QQVSQELKRLASSSKQGATARVHYDRTKSAASHALKGLKFISKTDGGAGWAEVEKKFDAL  187

Query  935  TAASNGLLPRAXFGECIGMNK  997
            TA++NG L R+ F +CIGMNK
Sbjct  188  TASTNGYLHRSLFAKCIGMNK  208



>gb|ADR70882.1| respiratory burst oxidase D [Manihot esculenta]
Length=914

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 138/207 (67%), Gaps = 26/207 (13%)
 Frame = +2

Query  404  HSDTEVMVVGVDKRKSYSGPLSGP-LNK-RTGKKSARFNLAggdssselgspssarsANN  577
            +SD+E +      R ++SGPL GP LNK R+ KKSAR N+    +++          +N 
Sbjct  6    YSDSESIA---SDRTAFSGPLGGPPLNKKRSSKKSARLNIPPETTTTY---------SNA  53

Query  578  DD---AYVEITLDVREDSVAVHSVKTAAGADVEDPELALLAR-GLEKKTT-LGSSLVRNA  742
            D+   +YVEITLD+R+DSVAVHSV  A     EDPE ALLA+  LE KT+   +SL RN 
Sbjct  54   DEDPSSYVEITLDIRDDSVAVHSVHPAN----EDPEFALLAKKTLENKTSSFRASLFRNT  109

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG--WAAVE  916
            SS I+QVSQELKR AS++      A R DR KSAAA ALKGLKFI+   GASG  W AVE
Sbjct  110  SSHIKQVSQELKRFASLSRRPS-AARRFDRTKSAAAHALKGLKFIAAKTGASGNGWPAVE  168

Query  917  KRFDQLTAASNGLLPRAXFGECIGMNK  997
            KRF +LTA++NGLL  + FGECIGMNK
Sbjct  169  KRFQELTASTNGLLHCSSFGECIGMNK  195



>gb|ACF05504.2| respiratory burst oxidase-like protein [Citrullus colocynthis]
Length=926

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 135/195 (69%), Gaps = 23/195 (12%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R+++SGP+S     R   K+A+F+L+   SS +         A++DD YVEITLD+R+DS
Sbjct  26   RRAFSGPISSTTKPR---KNAKFDLSSSSSSPKA--------ADDDDTYVEITLDIRDDS  74

Query  623  VAVHSVKTAAGAD----VEDPELALLA-RGLEKKTT-LGSSLVRNASSRIRQVSQELKRI  784
            VAVHSV TA  A     +EDPEL+LLA R LEKK++   +S++R+ SSR +QVSQELKR 
Sbjct  75   VAVHSVHTAGAAQDPNSLEDPELSLLAKRTLEKKSSSFRASVLRSTSSRFKQVSQELKRF  134

Query  785  ASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS-KTDG---ASGWAAVEKRFDQLTAASNG  952
             S+   A     R DR KSAA  ALKGLKFI+ KT G   + GWA VEKRFD+LTA++NG
Sbjct  135  TSLNRRAS--TRRFDRTKSAATHALKGLKFIAAKTGGGGSSPGWAPVEKRFDELTASTNG  192

Query  953  LLPRAXFGECIGMNK  997
            LLP + FGECIGMNK
Sbjct  193  LLPSSLFGECIGMNK  207



>gb|AFW64932.1| respiratory burst oxidase protein D variant beta [Zea mays]
Length=648

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 143/193 (74%), Gaps = 18/193 (9%)
 Frame = +2

Query  461  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  631
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  632  HSVKTA--------AGADVEDPELALLARGLEKK--TTLGSSLVRNASSRIRQVSQELKR  781
            HSVK A        AGA  +DP++ LLAR LE +  ++ G S++RNASSRI+QVSQEL+R
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQELRR  145

Query  782  IASMTM-GAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLL  958
            IAS+   GA  P  RIDR+KSAAA ALKGLKFISK +GA+GW AVE+RFD+L  A NGLL
Sbjct  146  IASINRRGAAGP--RIDRSKSAAAHALKGLKFISKAEGAAGWEAVERRFDKL--AENGLL  201

Query  959  PRAXFGECIGMNK  997
             R+ FG+CIGM +
Sbjct  202  HRSKFGQCIGMKE  214



>ref|NP_001108123.1| LOC100136880 isoform 2 [Zea mays]
 gb|ABP48737.1| respiratory burst oxidase protein D variant beta [Zea mays]
Length=648

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 143/193 (74%), Gaps = 18/193 (9%)
 Frame = +2

Query  461  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  631
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  632  HSVKTA--------AGADVEDPELALLARGLEKK--TTLGSSLVRNASSRIRQVSQELKR  781
            HSVK A        AGA  +DP++ LLAR LE +  ++ G S++RNASSRI+QVSQEL+R
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQELRR  145

Query  782  IASMTM-GAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLL  958
            IAS+   GA  P  RIDR+KSAAA ALKGLKFISK +GA+GW AVE+RFD+L  A NGLL
Sbjct  146  IASINRRGAAGP--RIDRSKSAAAHALKGLKFISKAEGAAGWEAVERRFDKL--AENGLL  201

Query  959  PRAXFGECIGMNK  997
             R+ FG+CIGM +
Sbjct  202  HRSKFGQCIGMKE  214



>ref|XP_008375433.1| PREDICTED: respiratory burst oxidase homolog protein C [Malus 
domestica]
Length=941

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 139/208 (67%), Gaps = 19/208 (9%)
 Frame = +2

Query  398  HHHSDTEVMVVGVDKRKSYSGPLSGPLN-----KRTG-KKSARFNLAggdssselgspss  559
            H+HSDTE+ + G +K  +YSGPLSGPL+     KR+G KK+A+ N     +   + +   
Sbjct  10   HYHSDTEI-IGGNEKMANYSGPLSGPLSGPLNKKRSGTKKNAKIN-----TPEPISATKP  63

Query  560  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPE--LALLARGLEKKTTLGSSLV  733
              S+N++++YVE+TLDVR+DSVAVHSVK A     ED E  + LL +GLEK      S V
Sbjct  64   GISSNDEESYVEVTLDVRDDSVAVHSVKPADHPPHEDHEDHVELLGKGLEK----SRSFV  119

Query  734  RNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAV  913
            RNAS  I++++   K+     +   HP  R DR +SAAA ALKGLKFISKTDG + W  V
Sbjct  120  RNASFHIKRLASFSKQAVVAAVPHHHPRRRFDRTQSAAAPALKGLKFISKTDG-NEWPEV  178

Query  914  EKRFDQLTAASNGLLPRAXFGECIGMNK  997
            EKRF +LTA++NGLL RA FGECIGMNK
Sbjct  179  EKRFCKLTASTNGLLSRALFGECIGMNK  206



>ref|XP_009360267.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Pyrus 
x bretschneideri]
 ref|XP_009360299.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Pyrus 
x bretschneideri]
Length=947

 Score =   172 bits (437),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 144/209 (69%), Gaps = 16/209 (8%)
 Frame = +2

Query  398  HHHSDTEVMVVGVDKRKSYSGPLSGPLN-----KRTG-KKSARFNLAggdssselgspss  559
            H+HSDTE+ + G +K  +YSGPLSGPL+     KR+G KK+A+FN     +   + +   
Sbjct  10   HYHSDTEI-IDGNEKMANYSGPLSGPLSGPLNKKRSGTKKNAKFN-----TPEPISATKP  63

Query  560  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPE--LALLARGLEKKTTLGSS-L  730
              S+N++++YVE+TLDVR+DSVAVHSVK A     ED E  + LL +GLEK  +  SS +
Sbjct  64   GISSNDEESYVEVTLDVRDDSVAVHSVKPADHPHHEDHEDHVELLGKGLEKSPSSLSSSV  123

Query  731  VRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAA  910
            VRNAS  I++++   K+     +   HP  R DR +SAAA ALKGLKFISKTDG + W  
Sbjct  124  VRNASFHIKRLASFSKQAVVAAVPHHHPRRRFDRTQSAAAPALKGLKFISKTDG-NEWPE  182

Query  911  VEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            VEKRF +LTA++NGLLPRA FGECIGMNK
Sbjct  183  VEKRFCKLTASTNGLLPRALFGECIGMNK  211



>ref|XP_003522455.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Glycine 
max]
Length=928

 Score =   172 bits (437),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 132/201 (66%), Gaps = 14/201 (7%)
 Frame = +2

Query  395  QHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsAN  574
             HHH D+++ ++     +    P SGPLNKR   +S++ N       +   + +SA    
Sbjct  15   HHHHRDSDIELIA----ERAPLPHSGPLNKR---RSSKLN-------NTSSASTSATEEQ  60

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
            ++  YVE+T+D++ DSVA+HSVKT      ED +L LL +G+EKK + G+S+VR+AS RI
Sbjct  61   DEGDYVEVTMDIQGDSVALHSVKTVNNDQSEDEKLILLGKGMEKKRSFGASVVRSASIRI  120

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            +QVSQELKR AS++          DRNKSAA+ ALKGLKFISKTD  +GW  VE++FD L
Sbjct  121  QQVSQELKRFASLSKQTASSRLHYDRNKSAASHALKGLKFISKTDAGAGWVEVERQFDAL  180

Query  935  TAASNGLLPRAXFGECIGMNK  997
            TA++NG L R+ F +CI MNK
Sbjct  181  TASTNGYLHRSLFAKCIEMNK  201



>gb|AFW64934.1| hypothetical protein ZEAMMB73_295489 [Zea mays]
Length=724

 Score =   171 bits (432),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 143/193 (74%), Gaps = 18/193 (9%)
 Frame = +2

Query  461  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  631
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  632  HSVKTA--------AGADVEDPELALLARGLEKK--TTLGSSLVRNASSRIRQVSQELKR  781
            HSVK A        AGA  +DP++ LLAR LE +  ++ G S++RNASSRI+QVSQEL+R
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQELRR  145

Query  782  IASMTM-GAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLL  958
            IAS+   GA  P  RIDR+KSAAA ALKGLKFISK +GA+GW AVE+RFD+L  A NGLL
Sbjct  146  IASINRRGAAGP--RIDRSKSAAAHALKGLKFISKAEGAAGWEAVERRFDKL--AENGLL  201

Query  959  PRAXFGECIGMNK  997
             R+ FG+CIGM +
Sbjct  202  HRSKFGQCIGMKE  214



>ref|XP_008465165.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
melo]
 ref|XP_008465166.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
melo]
Length=924

 Score =   172 bits (435),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 137/193 (71%), Gaps = 20/193 (10%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R+++SGP+S    K   +K+A+F+L+   SS +         A+ DD YVEITLD+R+DS
Sbjct  25   RRAFSGPISSSTTK--PRKNAKFDLSSSSSSLKA--------ADEDDTYVEITLDIRDDS  74

Query  623  VAVHSVKTA-AGAD---VEDPELALLAR-GLEKKTT-LGSSLVRNASSRIRQVSQELKRI  784
            VAVHSV TA AG D   +EDPEL+LLA+  LEKK++   +S++R+ SSRI+QVSQELKR 
Sbjct  75   VAVHSVHTAGAGQDPNSLEDPELSLLAKKTLEKKSSSFRASVLRSTSSRIKQVSQELKRF  134

Query  785  ASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS-KTDGAS-GWAAVEKRFDQLTAASNGLL  958
             S+         R DR KSAA  ALKG+KFI+ KT G+S GW  VEKRFD+LTA++NGLL
Sbjct  135  TSLNRRTS--TRRFDRTKSAATHALKGMKFITAKTGGSSAGWGPVEKRFDELTASTNGLL  192

Query  959  PRAXFGECIGMNK  997
            P + FG+CIGMNK
Sbjct  193  PSSLFGQCIGMNK  205



>ref|XP_009610990.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X4 [Nicotiana tomentosiformis]
Length=681

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGAD-VEDPELALL--ARGLEKKTTLGSSLVRNASS  748
            DD YVEITLD+RED+VAVHSVK A+GA+ VE+ E+ +L  A+ ++KK + G+S+VRN S 
Sbjct  28   DDTYVEITLDIREDTVAVHSVKNASGANIVEEAEVEVLGLAKNVKKKHSFGASVVRNTSM  87

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            R+RQV+QELK +AS+      P  R   N  AA  ALKGLKFISKTDG +GWAAVE  FD
Sbjct  88   RMRQVAQELKLLASLKKQQPRPFDR--TNSVAAHHALKGLKFISKTDGCAGWAAVENHFD  145

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +L+A S+GLLPR  FGECIGMN+
Sbjct  146  ELSATSDGLLPRGKFGECIGMNR  168



>ref|XP_003577502.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Brachypodium 
distachyon]
Length=924

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 131/188 (70%), Gaps = 13/188 (7%)
 Frame = +2

Query  461  PLSGPLN-KRTG-KKSARF------NLAggdssselgspssarsANNDDAYVEITLDVRE  616
            P SGPL  KR+  +KSARF       L     +    + +     N+D+ YVEITLDVR+
Sbjct  30   PHSGPLGAKRSAMRKSARFAESVSAPLTAPHGAPRPRNNNDESDDNDDNDYVEITLDVRD  89

Query  617  DSVAVHSVKTAAGADVEDPELALLARGLEKKT-TLGSSLVRNASSRIRQVSQELKRIASM  793
            DSVAVHSVK AAG   ED ++ LLAR LEK++ + G  ++RNASSRI+QVS EL+R+AS 
Sbjct  90   DSVAVHSVKPAAGGSAEDSDVTLLARTLEKRSASYGHGVLRNASSRIKQVSHELRRLASG  149

Query  794  TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXF  973
                G    R D++KSAAA ALKGLKFISKTDG++GW AVEKRFD+L  A NGLLPR+ F
Sbjct  150  NNRRGQ--ARFDKSKSAAAHALKGLKFISKTDGSAGWTAVEKRFDEL--AENGLLPRSKF  205

Query  974  GECIGMNK  997
            G+CIGM +
Sbjct  206  GKCIGMKE  213



>ref|XP_009610989.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X3 [Nicotiana tomentosiformis]
Length=701

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGAD-VEDPELALL--ARGLEKKTTLGSSLVRNASS  748
            DD YVEITLD+RED+VAVHSVK A+GA+ VE+ E+ +L  A+ ++KK + G+S+VRN S 
Sbjct  28   DDTYVEITLDIREDTVAVHSVKNASGANIVEEAEVEVLGLAKNVKKKHSFGASVVRNTSM  87

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            R+RQV+QELK +AS+      P  R   N  AA  ALKGLKFISKTDG +GWAAVE  FD
Sbjct  88   RMRQVAQELKLLASLKKQQPRPFDR--TNSVAAHHALKGLKFISKTDGCAGWAAVENHFD  145

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +L+A S+GLLPR  FGECIGMN+
Sbjct  146  ELSATSDGLLPRGKFGECIGMNR  168



>gb|AFW64933.1| respiratory burst oxidase protein D variant alpha [Zea mays]
Length=932

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 143/193 (74%), Gaps = 18/193 (9%)
 Frame = +2

Query  461  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  631
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  632  HSVKTA--------AGADVEDPELALLARGLEKK--TTLGSSLVRNASSRIRQVSQELKR  781
            HSVK A        AGA  +DP++ LLAR LE +  ++ G S++RNASSRI+QVSQEL+R
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQELRR  145

Query  782  IASMTM-GAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLL  958
            IAS+   GA  P  RIDR+KSAAA ALKGLKFISK +GA+GW AVE+RFD+L  A NGLL
Sbjct  146  IASINRRGAAGP--RIDRSKSAAAHALKGLKFISKAEGAAGWEAVERRFDKL--AENGLL  201

Query  959  PRAXFGECIGMNK  997
             R+ FG+CIGM +
Sbjct  202  HRSKFGQCIGMKE  214



>ref|NP_001157759.1| LOC100136880 isoform 1 [Zea mays]
 gb|ACJ05393.1| respiratory burst oxidase protein D variant alpha [Zea mays]
Length=932

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 143/193 (74%), Gaps = 18/193 (9%)
 Frame = +2

Query  461  PLSGPLNKRTG-KKSARF--NLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  631
            P SGPL+K++G +KSARF  +++   S+    + ++  + N+DD YVEITLDVR+DSVAV
Sbjct  26   PHSGPLSKKSGARKSARFAESVSAPLSAPPPRASANNNNNNDDDDYVEITLDVRDDSVAV  85

Query  632  HSVKTA--------AGADVEDPELALLARGLEKK--TTLGSSLVRNASSRIRQVSQELKR  781
            HSVK A        AGA  +DP++ LLAR LE +  ++ G S++RNASSRI+QVSQEL+R
Sbjct  86   HSVKPAHGGGAGAGAGAGGDDPDVTLLARTLESRRSSSYGHSVIRNASSRIKQVSQELRR  145

Query  782  IASMTM-GAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLL  958
            IAS+   GA  P  RIDR+KSAAA ALKGLKFISK +GA+GW AVE+RFD+L  A NGLL
Sbjct  146  IASINRRGAAGP--RIDRSKSAAAHALKGLKFISKAEGAAGWEAVERRFDKL--AENGLL  201

Query  959  PRAXFGECIGMNK  997
             R+ FG+CIGM +
Sbjct  202  HRSKFGQCIGMKE  214



>ref|XP_009610988.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X2 [Nicotiana tomentosiformis]
Length=850

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGAD-VEDPELALL--ARGLEKKTTLGSSLVRNASS  748
            DD YVEITLD+RED+VAVHSVK A+GA+ VE+ E+ +L  A+ ++KK + G+S+VRN S 
Sbjct  28   DDTYVEITLDIREDTVAVHSVKNASGANIVEEAEVEVLGLAKNVKKKHSFGASVVRNTSM  87

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            R+RQV+QELK +AS+      P  R   N  AA  ALKGLKFISKTDG +GWAAVE  FD
Sbjct  88   RMRQVAQELKLLASLKKQQPRPFDRT--NSVAAHHALKGLKFISKTDGCAGWAAVENHFD  145

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +L+A S+GLLPR  FGECIGMN+
Sbjct  146  ELSATSDGLLPRGKFGECIGMNR  168



>ref|XP_002268641.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
Length=922

 Score =   169 bits (429),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 132/204 (65%), Gaps = 12/204 (6%)
 Frame = +2

Query  398  HHHSDTEVMVVGVDKRKSYSGPLSGPLNK-RTGKKSARFNLAggdssselgspssarsAN  574
            H +SDTE   V  DK  SY GPL GP +K R+ ++SARFN+    SS    +  +     
Sbjct  4    HDNSDTEN--VQSDK-ASYCGPLGGPPDKKRSARESARFNIPPVTSSQLKSTSVT---PR  57

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLAR-GLEKKTTLGSSLVRNASSR  751
            +DD YVEITL V +DS+ VHSV+   GA  EDP+LA LA+  L+KK++  SS+    SSR
Sbjct  58   DDDDYVEITLGVLDDSITVHSVQAPGGAKGEDPQLAQLAKKSLQKKSSYASSIFCTTSSR  117

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISK--TDGASGWAAVEKRF  925
            I+ VSQELKR  S +     PA   DR KSA   ALKGLKFI+   + GA+GW  VEKRF
Sbjct  118  IKPVSQELKRFPSFSERP--PARHFDRTKSAVTHALKGLKFITTKASGGATGWPVVEKRF  175

Query  926  DQLTAASNGLLPRAXFGECIGMNK  997
            D+LTA++NGLL  + F ECIGM+K
Sbjct  176  DELTASTNGLLHFSLFCECIGMDK  199



>ref|XP_009610987.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X1 [Nicotiana tomentosiformis]
Length=882

 Score =   169 bits (428),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGAD-VEDPELALL--ARGLEKKTTLGSSLVRNASS  748
            DD YVEITLD+RED+VAVHSVK A+GA+ VE+ E+ +L  A+ ++KK + G+S+VRN S 
Sbjct  28   DDTYVEITLDIREDTVAVHSVKNASGANIVEEAEVEVLGLAKNVKKKHSFGASVVRNTSM  87

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            R+RQV+QELK +AS+      P  R   N  AA  ALKGLKFISKTDG +GWAAVE  FD
Sbjct  88   RMRQVAQELKLLASLKKQQPRPFDRT--NSVAAHHALKGLKFISKTDGCAGWAAVENHFD  145

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +L+A S+GLLPR  FGECIGMN+
Sbjct  146  ELSATSDGLLPRGKFGECIGMNR  168



>gb|KJB58284.1| hypothetical protein B456_009G202500 [Gossypium raimondii]
Length=936

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 142/213 (67%), Gaps = 21/213 (10%)
 Frame = +2

Query  404  HSDTEVMVVGVDKRKSYSGPLS--GPL--NKRTGKKSARFNLAggdssselgsp------  553
            +SDTE +     +R ++SGPL   G +  +KR  KKSA FNL    + S+  S       
Sbjct  14   NSDTESIA---SERATFSGPLGVGGGIVSSKRASKKSATFNLPPEITMSKANSAGSFASF  70

Query  554  -ssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKT-TLGS  724
             SSA +A  DD YVEITLD+ +DS+AVH V+ A G   EDPEL+LLA R LE K+ +  S
Sbjct  71   DSSAVAAAGDDDYVEITLDILDDSIAVHRVQGADGGH-EDPELSLLAKRTLENKSASFRS  129

Query  725  SLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG-  901
             L+RN S+RI+Q SQELKR  S    + +  GR DRNKSAAA ALKGLKFI+   GASG 
Sbjct  130  YLLRNTSARIKQFSQELKRAVSRR--SSNAGGRFDRNKSAAAHALKGLKFITTKTGASGN  187

Query  902  -WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
             W++VEKRFD LTA++NGLL R+ F ECIGMN+
Sbjct  188  GWSSVEKRFDDLTASTNGLLHRSQFAECIGMNQ  220



>ref|XP_007017524.1| Respiratory burst oxidase D [Theobroma cacao]
 gb|EOY14749.1| Respiratory burst oxidase D [Theobroma cacao]
Length=961

 Score =   166 bits (421),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 128/178 (72%), Gaps = 8/178 (4%)
 Frame = +2

Query  479  NKRTGKKSARFNLAggdssselgsp-ssarsANNDDAYVEITLDVREDSVAVHSVKTAAG  655
            NKR  KKSARFNL    + ++  S  SSA  A  D+ YVEITLD+R+DSVAVHSV+ A G
Sbjct  75   NKRASKKSARFNLPPEITLAKTNSTGSSASFAAADNDYVEITLDIRDDSVAVHSVQGAGG  134

Query  656  ADVEDPELALLA-RGLEKKT-TLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRID  829
             D EDPELALLA R LE K+ +  S L  N S+ I+QVSQELKR  +++  + +   R D
Sbjct  135  GD-EDPELALLAKRTLENKSASFRSYLFGNTSAHIKQVSQELKR--ALSRRSSNAGRRFD  191

Query  830  RNKSAAAQALKGLKFISKTDGASG--WAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            R KSAAA ALKGLKFI+   GASG  W++VEKRF+ LTA++NGLL ++ FGECIGMN+
Sbjct  192  RTKSAAAHALKGLKFITTKTGASGNGWSSVEKRFNDLTASTNGLLHQSQFGECIGMNQ  249



>ref|XP_007225362.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica]
 gb|EMJ26561.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica]
Length=971

 Score =   166 bits (420),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 133/206 (65%), Gaps = 25/206 (12%)
 Frame = +2

Query  440  KRKSYSGPLSGP--------LNKRTGKKSARFNLAggdssselgspssarsANNDDAYVE  595
            +R+++SGPL  P        L+ ++ +   R   A  D S+   + +     N DDAYVE
Sbjct  38   ERRAFSGPLGEPHNSYAPSSLSSKSTRAWRRIKSAKFDKSAVDSNRNPGTDQNEDDAYVE  97

Query  596  ITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG-------SSLVRNASSRI  754
            ITLD+R+D+VAVHSV+ A GA  EDPELALLA    KKT  G       SSL+RN SS I
Sbjct  98   ITLDIRDDTVAVHSVQAAGGASNEDPELALLA----KKTLEGKKSSSFRSSLLRNTSSHI  153

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS-KTDG----ASGWAAVEK  919
            RQVSQELKR+AS +    + A R DR KSA A ALK LKFI+ KT G    ++GW AVEK
Sbjct  154  RQVSQELKRLASFSKRPSN-ARRFDRTKSATAYALKSLKFITAKTGGGASSSAGWVAVEK  212

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            RFD+LT  SNGLLP + FGECIGMNK
Sbjct  213  RFDELTVKSNGLLPSSLFGECIGMNK  238



>emb|CBI29289.3| unnamed protein product [Vitis vinifera]
Length=906

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 129/201 (64%), Gaps = 12/201 (6%)
 Frame = +2

Query  398  HHHSDTEVMVVGVDKRKSYSGPLSGPLNK-RTGKKSARFNLAggdssselgspssarsAN  574
            H +SDTE   V  DK  SY GPL GP +K R+ ++SARFN+    SS    +  +     
Sbjct  4    HDNSDTEN--VQSDK-ASYCGPLGGPPDKKRSARESARFNIPPVTSSQLKSTSVT---PR  57

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKTTLGSSLVRNASSR  751
            +DD YVEITL V +DS+ VHSV+   GA  EDP+LA LA + L+KK++  SS+    SSR
Sbjct  58   DDDDYVEITLGVLDDSITVHSVQAPGGAKGEDPQLAQLAKKSLQKKSSYASSIFCTTSSR  117

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISK--TDGASGWAAVEKRF  925
            I+ VSQELKR  S +     PA   DR KSA   ALKGLKFI+   + GA+GW  VEKRF
Sbjct  118  IKPVSQELKRFPSFSERP--PARHFDRTKSAVTHALKGLKFITTKASGGATGWPVVEKRF  175

Query  926  DQLTAASNGLLPRAXFGECIG  988
            D+LTA++NGLL  + F ECIG
Sbjct  176  DELTASTNGLLHFSLFCECIG  196



>ref|XP_008369593.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus 
domestica]
Length=965

 Score =   164 bits (415),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 112/148 (76%), Gaps = 7/148 (5%)
 Frame = +2

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE--KKTTLGSSLVRNA  742
            N+DD YVEITLD+R+DSVAVHSV+ A GA  EDPELALLA R LE  K ++  SSL+RN 
Sbjct  88   NDDDTYVEITLDIRDDSVAVHSVQAAGGASNEDPELALLAKRTLEGKKSSSFRSSLLRNT  147

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGA---SGWAAV  913
            SS IRQVSQELKR+AS +    + A R DR KSA A ALK LKFI+   GA   SGWAAV
Sbjct  148  SSHIRQVSQELKRLASFSKRPSN-AKRFDRTKSATAHALKSLKFITTKTGAGATSGWAAV  206

Query  914  EKRFDQLTAASNGLLPRAXFGECIGMNK  997
            +KR+D+LTA SN LLP + FGECIGMNK
Sbjct  207  DKRYDELTAKSNWLLPSSLFGECIGMNK  234



>ref|XP_002512702.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF50154.1| respiratory burst oxidase, putative [Ricinus communis]
Length=709

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 143/226 (63%), Gaps = 33/226 (15%)
 Frame = +2

Query  356  REMSSSDQQ----SFRHQHHHSDTEVMVVGVDKRKSYSGPLS----GPLNK-RTGKKSAR  508
            +E +++D      ++    + SDTE +      R ++SGPL      PL+K R+ KKSAR
Sbjct  3    KETTTTDPHQGKGTYYFSDNTSDTESIA---SDRTAFSGPLGVGVGAPLHKKRSSKKSAR  59

Query  509  FNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALL  688
            FNL    SS+ +         +   +YVEITLD+R+DSVAVHSV+   GA+ EDP+LALL
Sbjct  60   FNLPPETSSAGVE--------DPSSSYVEITLDIRDDSVAVHSVQ---GANYEDPDLALL  108

Query  689  A-RGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKG  865
            A R LE K+T   SL RN SS I+Q   ELKR AS++      A R DR KSAAA ALKG
Sbjct  109  AKRTLENKST---SLFRNTSSHIKQ---ELKRFASLSRRPS-AAKRFDRTKSAAAHALKG  161

Query  866  LKFISKTDGAS--GWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            LKFI+   G+S  GW++VEKRF QLT  ++GLL  + FGECIGMNK
Sbjct  162  LKFIAAKTGSSANGWSSVEKRFQQLTVNTDGLLHCSLFGECIGMNK  207



>ref|XP_003526909.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
1 [Glycine max]
Length=941

 Score =   164 bits (414),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 139/205 (68%), Gaps = 10/205 (5%)
 Frame = +2

Query  395  QHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsAN  574
             HHH ++++ ++   +R     P SGPLNKR   +S++ + A   S+S   S S+     
Sbjct  15   HHHHRNSDIELIATAERAPL--PHSGPLNKR---RSSKLSNASSASASASASISAPEEQQ  69

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
            ++  YVE+T+D++  SVA+HSVKT      ED +L LL +G+EKK + G+S+VR+AS RI
Sbjct  70   DEGDYVEVTMDIQGGSVALHSVKTVNNDQGEDEKLILLGKGMEKKRSFGASVVRSASIRI  129

Query  755  RQVSQELKRIASMTMGAGHPAGRI--DRNKSAAAQALKGLKFIS--KTDGASGWAAVEKR  922
            +QVSQELKR+AS++     PA R+  DRNKSAA+ ALKGLKFIS   TD  +GW  VE++
Sbjct  130  QQVSQELKRLASLSKQTA-PAARVHYDRNKSAASHALKGLKFISIKTTDADAGWVEVERQ  188

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD LTA++NG L R+ F +CIGMNK
Sbjct  189  FDALTASTNGYLHRSLFAKCIGMNK  213



>gb|KHN09692.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=939

 Score =   163 bits (413),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 135/206 (66%), Gaps = 14/206 (7%)
 Frame = +2

Query  395  QHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsAN  574
             HHH ++++ ++   +R     P SGPLNKR      R +     SS+   +  SA    
Sbjct  15   HHHHRNSDIELIATAERAPL--PHSGPLNKR------RSSKLSNASSASASASISAPEEQ  66

Query  575  NDDA-YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR  751
             D+  YVE+T+D++  SVA+HSVKT      ED +L LL +G+EKK + G+S+VR+AS R
Sbjct  67   QDEGDYVEVTMDIQGGSVALHSVKTVNNDQGEDEKLILLGKGMEKKRSFGASVVRSASIR  126

Query  752  IRQVSQELKRIASMTMGAGHPAGRI--DRNKSAAAQALKGLKFIS--KTDGASGWAAVEK  919
            I+QVSQELKR+AS++     PA R+  DRNKSAA+ ALKGLKFIS   TD  +GW  VE+
Sbjct  127  IQQVSQELKRLASLSKQTA-PAARVHYDRNKSAASHALKGLKFISIKTTDADAGWVEVER  185

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            +FD LTA++NG L R+ F +CIGMNK
Sbjct  186  QFDALTASTNGYLHRSLFAKCIGMNK  211



>gb|KJB59802.1| hypothetical protein B456_009G273400 [Gossypium raimondii]
Length=673

 Score =   161 bits (407),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 146/215 (68%), Gaps = 19/215 (9%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPL------SGPLNKRTGKKSARFNLAggdssselgsp  553
            +  ++SDTE +      R ++SGPL       G  NK++ KKS RFNL    + ++  S 
Sbjct  10   YSENNSDTESIA---SDRATFSGPLVLGGGGGGVSNKKSSKKSTRFNLPPEITMAKTNST  66

Query  554  ssars---ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKT-TL  718
             SA S   A+NDD+YVEITLD+R+DSVAVHSV+ A G + EDPELALLA + LE K+ + 
Sbjct  67   RSAASLAGADNDDSYVEITLDIRDDSVAVHSVQGAGGGN-EDPELALLAKKTLENKSASF  125

Query  719  GSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGAS  898
             S L+RN S+RI+QVSQELK++ S      +   R DR KSAAA ALKGLKFI+   G S
Sbjct  126  RSYLLRNTSNRIKQVSQELKQVLSRR--PSNTGRRFDRTKSAAAHALKGLKFITTKTGGS  183

Query  899  --GWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
              GW++VEKRF+ LTA++NG+L ++ F ECIGMN+
Sbjct  184  GNGWSSVEKRFNDLTASTNGVLHQSQFAECIGMNQ  218



>ref|XP_008222292.1| PREDICTED: respiratory burst oxidase homolog protein D [Prunus 
mume]
Length=971

 Score =   163 bits (412),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 132/206 (64%), Gaps = 25/206 (12%)
 Frame = +2

Query  440  KRKSYSGPLSGP--------LNKRTGKKSARFNLAggdssselgspssarsANNDDAYVE  595
            +R+++SGPL  P        L+ ++ +   R   A  D S+   + +     N DDAYVE
Sbjct  38   ERRAFSGPLGEPHNSYAPSSLSSKSTRAWRRIKSAKFDKSAVDSNRNPGTDQNEDDAYVE  97

Query  596  ITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLG-------SSLVRNASSRI  754
            ITLD+ +D+VAVHSV+ A GA  EDPELALLA    KKT  G       SSL+RN SS I
Sbjct  98   ITLDILDDTVAVHSVQAAGGASNEDPELALLA----KKTLEGKKSSSFRSSLLRNTSSHI  153

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS-KTDG----ASGWAAVEK  919
            RQVSQELKR+AS +    + A R DR KSA A ALK LKFI+ KT G    ++GW AVEK
Sbjct  154  RQVSQELKRLASFSKRPSN-ARRFDRTKSATAHALKSLKFITAKTGGGASSSAGWVAVEK  212

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            RFD+LT  SNGLLP + FGECIGMNK
Sbjct  213  RFDELTVKSNGLLPSSLFGECIGMNK  238



>ref|XP_009353482.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus 
x bretschneideri]
Length=962

 Score =   162 bits (411),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 111/148 (75%), Gaps = 7/148 (5%)
 Frame = +2

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE--KKTTLGSSLVRNA  742
            NNDD YVEITLD+R+DSVAVHSV+ A GA  EDPELALLA R LE  K ++L SSL RN 
Sbjct  85   NNDDDYVEITLDIRDDSVAVHSVQAAGGASSEDPELALLAKRTLEGKKSSSLRSSLFRNT  144

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGA---SGWAAV  913
            SS IRQVSQELKR+AS T    + A R DR KSA A ALK LKFI+   GA   SGWAAV
Sbjct  145  SSHIRQVSQELKRLASFTKRPSN-AKRFDRTKSATAYALKNLKFITAKTGAASTSGWAAV  203

Query  914  EKRFDQLTAASNGLLPRAXFGECIGMNK  997
            +KR+D+LTA SN LL  + FGECIGMNK
Sbjct  204  DKRYDELTAKSNWLLHSSLFGECIGMNK  231



>ref|XP_009390376.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Musa 
acuminata subsp. malaccensis]
Length=909

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 130/186 (70%), Gaps = 23/186 (12%)
 Frame = +2

Query  464  LSGPLNKRTG---KKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVH  634
             SGPLNK  G   +KSARFNL    ++             + + ++EITLDV +DSVAVH
Sbjct  25   FSGPLNKHGGGSNRKSARFNLPPPPAAPV-----------DGETFLEITLDVTDDSVAVH  73

Query  635  SVKTAAGA---DVEDPE-LALLARGLEKKT-TLGSSLVRNASSRIRQVSQELKRIASMTM  799
            SVK AAG      EDPE ++LL + LE+++ + GSS++R+ASSRIRQVSQEL+++AS+T 
Sbjct  74   SVKPAAGGVGGKEEDPEEVSLLVQKLERQSASFGSSVLRSASSRIRQVSQELRQLASLTK  133

Query  800  GAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGE  979
                P  R+DR+KSAAA ALKGLKFI+K +GA+GW AVEKRFD+L+   +G L  + FG+
Sbjct  134  RPAAP--RLDRSKSAAAHALKGLKFITKANGAAGWPAVEKRFDRLSV--DGALHLSLFGQ  189

Query  980  CIGMNK  997
            CIGM +
Sbjct  190  CIGMKE  195



>ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog protein D [Fragaria 
vesca subsp. vesca]
Length=935

 Score =   162 bits (411),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 4/146 (3%)
 Frame = +2

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLAR-GLE--KKTTLGSSLVRNA  742
            ++D+AYVEITLD+ +DSVAVHSV+ A G   EDP+LALLA+  LE  K  +  SSL+R+ 
Sbjct  56   DDDEAYVEITLDILDDSVAVHSVQAAGGGGHEDPQLALLAKKTLEGKKSASFRSSLLRST  115

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS-KTDGASGWAAVEK  919
            S+ IRQVSQELKR+AS +        RIDR +SA A ALK LKFI+ K   A+GWA+VEK
Sbjct  116  STHIRQVSQELKRLASFSKRNSGAGRRIDRTRSATAHALKSLKFITAKASAANGWASVEK  175

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            RFD LTA SNGLL  + FGECIGMNK
Sbjct  176  RFDDLTANSNGLLNSSLFGECIGMNK  201



>gb|EEC68302.1| hypothetical protein OsI_36373 [Oryza sativa Indica Group]
Length=983

 Score =   162 bits (411),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 130/183 (71%), Gaps = 14/183 (8%)
 Frame = +2

Query  461  PLSGPLNKRTG-KKSARF----NLAggdssselgspssarsANNDDA--YVEITLDVRED  619
            P SGPL+KR+G +KSARF    +      S    +  +A +AN+DD   YVEITLDVR+D
Sbjct  36   PHSGPLSKRSGMRKSARFAESVSAPLSAPSGVAAARRAAAAANDDDEEDYVEITLDVRDD  95

Query  620  SVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQELKRIASMT  796
            SVAVHSVK A G   ED ++ LLAR LEK+ ++ G S++RNASSRI+QVSQEL+R+AS+ 
Sbjct  96   SVAVHSVKPAGGGG-EDSDVTLLARTLEKRSSSFGHSVIRNASSRIKQVSQELRRLASVN  154

Query  797  ---MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRA  967
                G G    R DR+KSAAA ALKGLKFIS+ DG +GW AVEKRFD L  A +GLLPR+
Sbjct  155  RRGGGGGAGGPRFDRSKSAAAHALKGLKFISRADGGAGWPAVEKRFDDL--AKDGLLPRS  212

Query  968  XFG  976
             FG
Sbjct  213  KFG  215



>ref|XP_012088674.1| PREDICTED: respiratory burst oxidase homolog protein C [Jatropha 
curcas]
 gb|KDP23231.1| hypothetical protein JCGZ_23064 [Jatropha curcas]
Length=923

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 134/206 (65%), Gaps = 28/206 (14%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPL----SGPLNK-RTGKKSARFNLAggdssselgspssarsA  571
            SDTE +      R ++SGPL      PLNK R+ KKSARFN+    ++           A
Sbjct  20   SDTESIA---SDRTAFSGPLGVGGQAPLNKKRSSKKSARFNIPPETTA-----------A  65

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLAR-GLEKKTTLGSSLVR-NAS  745
            ++  +YVEITLD+R+DSVAVHSV  A     EDPELALLA+  LE K++   S +  N S
Sbjct  66   DDASSYVEITLDIRDDSVAVHSVHPAN----EDPELALLAKKTLENKSSSFRSSLFRNTS  121

Query  746  SRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG--WAAVEK  919
            S I+QVSQELKR+AS++      A R DR KSAAA ALKGLKFI+   GA+G  W AVEK
Sbjct  122  SHIKQVSQELKRLASLSRRPS-AARRFDRTKSAAAHALKGLKFITAKTGAAGNGWLAVEK  180

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            RF +LTA++NG L  + FGECIGMNK
Sbjct  181  RFQELTASTNGQLHCSSFGECIGMNK  206



>ref|XP_003602726.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES72977.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=923

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 130/203 (64%), Gaps = 13/203 (6%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsA  571
            H H  SDTE++ +       ++G  SGPLNKR G++SA+ N++   S+ +L         
Sbjct  11   HNHRDSDTELIAL-------HNGSFSGPLNKRVGRRSAKLNVSNSTSAIDLNHQEQDEEK  63

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR  751
               D YVE+T+D++ DSVA+HSVKT  G + ED +L LL +G+EKK + G+S VR AS R
Sbjct  64   AEQD-YVEVTMDIQGDSVALHSVKTVPGNNGEDEKLVLLGKGMEKKRSFGASFVRTASIR  122

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFI-SKTDGASGWAAVEKRFD  928
            ++ VSQELK++ S +   G P    DR KSAA+ AL+GLKFI +KTD   GW  VEK+FD
Sbjct  123  MKHVSQELKKLTSFSKQVG-PQKVYDRTKSAASHALRGLKFINNKTD--VGWFEVEKQFD  179

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
             L +  +  L R+ F +CIGMNK
Sbjct  180  IL-STHDAFLHRSLFAKCIGMNK  201



>ref|XP_009359839.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus 
x bretschneideri]
Length=964

 Score =   162 bits (409),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 110/148 (74%), Gaps = 8/148 (5%)
 Frame = +2

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE--KKTTLGSSLVRNA  742
            N+DD YVEITLD+R+DSVAVHSV+ A GA  EDPELALLA R LE  K ++  SSL+RN 
Sbjct  88   NDDDTYVEITLDIRDDSVAVHSVQAAGGASNEDPELALLAKRTLEGKKSSSFRSSLLRNT  147

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGA---SGWAAV  913
            SS IRQVSQELKR+AS +        R DR KSA A ALK LKFI+   GA   SGWAAV
Sbjct  148  SSHIRQVSQELKRLASFSKRPS--TKRFDRTKSATAYALKSLKFITTKTGAGATSGWAAV  205

Query  914  EKRFDQLTAASNGLLPRAXFGECIGMNK  997
            +KR+D+LTA SN LLP + FGECIGMNK
Sbjct  206  DKRYDELTAKSNWLLPSSLFGECIGMNK  233



>ref|XP_008378424.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus 
domestica]
Length=962

 Score =   161 bits (407),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 132/198 (67%), Gaps = 13/198 (7%)
 Frame = +2

Query  440  KRKSYSGPL----SGPLNKRTGKKSARFNLAggdssselgspssarsA--NNDDAYVEIT  601
            +R+++SGPL      P       ++ R N +    +S     +++ ++  NND+ YVEIT
Sbjct  35   ERRAFSGPLGTSNYAPTTSSNSSRAWRRNKSTKVDNSGGTDKTTSXTSDKNNDNDYVEIT  94

Query  602  LDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE--KKTTLGSSLVRNASSRIRQVSQE  772
            LD+R+DSVAVHSV+ A GA  EDPELALLA R LE  K ++  SSL RN SS IRQVSQE
Sbjct  95   LDIRDDSVAVHSVQAAGGASSEDPELALLAKRTLEGKKSSSFRSSLFRNTSSHIRQVSQE  154

Query  773  LKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGA---SGWAAVEKRFDQLTAA  943
            LKR+AS T    + A R DR KSA A ALK LKFI+   GA   SGWAAV+KR+D+LTA 
Sbjct  155  LKRLASFTKRPSN-AKRFDRTKSATAYALKNLKFITAKTGAASTSGWAAVDKRYDELTAK  213

Query  944  SNGLLPRAXFGECIGMNK  997
            SN LL  + FGECIGMNK
Sbjct  214  SNWLLHSSLFGECIGMNK  231



>gb|KJB59801.1| hypothetical protein B456_009G273400 [Gossypium raimondii]
Length=930

 Score =   160 bits (405),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 146/215 (68%), Gaps = 19/215 (9%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPL------SGPLNKRTGKKSARFNLAggdssselgsp  553
            +  ++SDTE +      R ++SGPL       G  NK++ KKS RFNL    + ++  S 
Sbjct  10   YSENNSDTESIA---SDRATFSGPLVLGGGGGGVSNKKSSKKSTRFNLPPEITMAKTNST  66

Query  554  ssars---ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKT-TL  718
             SA S   A+NDD+YVEITLD+R+DSVAVHSV+ A G + EDPELALLA + LE K+ + 
Sbjct  67   RSAASLAGADNDDSYVEITLDIRDDSVAVHSVQGAGGGN-EDPELALLAKKTLENKSASF  125

Query  719  GSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGAS  898
             S L+RN S+RI+QVSQELK++ S      +   R DR KSAAA ALKGLKFI+   G S
Sbjct  126  RSYLLRNTSNRIKQVSQELKQVLSRR--PSNTGRRFDRTKSAAAHALKGLKFITTKTGGS  183

Query  899  --GWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
              GW++VEKRF+ LTA++NG+L ++ F ECIGMN+
Sbjct  184  GNGWSSVEKRFNDLTASTNGVLHQSQFAECIGMNQ  218



>gb|KHG05306.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
Length=916

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 136/211 (64%), Gaps = 24/211 (11%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPL---SGPL-NKRTGKKSARFNLAggdssselgspss  559
            +  ++SDTE +     +R ++S PL   + P  NKR  KKSA FNL    ++    +   
Sbjct  10   YSENNSDTESIA---SERTTFSEPLPLNAAPFSNKRGSKKSATFNLPPEITTMPNSAAED  66

Query  560  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLEKKTT-LGSSLV  733
                + D+ YVEITLD+R+DSVAV+S +   G + EDPELALL+ R +E K+T L SSL 
Sbjct  67   ----DEDEGYVEITLDIRDDSVAVYSFQ---GGN-EDPELALLSLRTMENKSTSLRSSLF  118

Query  734  RNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASG---W  904
             N S+RI+QVSQELKR+ S          +IDR KSAAA ALKGLKFI+   GA G   W
Sbjct  119  SNTSARIKQVSQELKRVVSRRSSNR----KIDRTKSAAAHALKGLKFITSKTGACGNIGW  174

Query  905  AAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            + VEKRF+ LT+++NGLL R+ F ECIGMN+
Sbjct  175  SFVEKRFNDLTSSTNGLLHRSQFAECIGMNQ  205



>gb|KJB14501.1| hypothetical protein B456_002G128200 [Gossypium raimondii]
Length=786

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 137/210 (65%), Gaps = 23/210 (11%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPL---SGPL-NKRTGKKSARFNLAggdssselgspss  559
            +  ++SDTE +     +R ++S PL   + P  NKR  KKSA FNL    ++    +   
Sbjct  10   YSENNSDTESIA---SERTTFSEPLPLNAAPFSNKRGSKKSATFNLPPEITTMPNSAAED  66

Query  560  arsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARG-LEKKT-TLGSSLV  733
                + D+ YVEITLD+R++SVAV+SV+   G + EDPELALLA   +E KT +L SSL 
Sbjct  67   ----DEDEGYVEITLDIRDNSVAVYSVQ---GGN-EDPELALLALSTMENKTMSLRSSLF  118

Query  734  RNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGA--SGWA  907
             N S+RI+QVSQELKR+ S          +IDR KSAAA ALKGLKFI+   GA  +GW+
Sbjct  119  SNTSARIKQVSQELKRVVSRRSSNR----KIDRTKSAAAHALKGLKFITSKTGACGNGWS  174

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
             VEKRF+ LT+++NGLL R+ F ECIGMN+
Sbjct  175  FVEKRFNDLTSSANGLLHRSQFAECIGMNQ  204



>ref|XP_004141156.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
sativus]
 gb|KGN59783.1| hypothetical protein Csa_3G845500 [Cucumis sativus]
Length=926

 Score =   158 bits (399),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 135/195 (69%), Gaps = 22/195 (11%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R+++SGP+S    K   +K+A+F+L+   SS +         A++DD YVEITLD+R+DS
Sbjct  25   RRAFSGPISSSTTK--PRKNAKFDLSSSSSSLKA--------ADDDDTYVEITLDIRDDS  74

Query  623  VAVHSVKTAA-GAD---VEDPELALLA-RGLEKKTT-LGSSLVRNASSRIRQVSQELKRI  784
            VAVHSV TA  G D   +EDPEL+LLA R LEKK++   +S++R+ SSRI+QVSQELKR 
Sbjct  75   VAVHSVHTAGPGQDPNSLEDPELSLLAKRTLEKKSSSFRASVLRSTSSRIKQVSQELKRF  134

Query  785  ASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS----KTDGASGWAAVEKRFDQLTAASNG  952
             S+         R DR KSAA  ALKG+KFI+        ++GWA VEKRFD+LTA++NG
Sbjct  135  TSLNRRTS--TRRFDRTKSAATHALKGMKFITAKTGGGGSSAGWAPVEKRFDELTASTNG  192

Query  953  LLPRAXFGECIGMNK  997
            LLP + FG+CIGMNK
Sbjct  193  LLPSSLFGQCIGMNK  207



>ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citrus clementina]
 gb|ESR37124.1| hypothetical protein CICLE_v10027774mg [Citrus clementina]
 gb|KDO45136.1| hypothetical protein CISIN_1g002525mg [Citrus sinensis]
Length=912

 Score =   158 bits (399),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 139/208 (67%), Gaps = 27/208 (13%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  580
            ++SDTE   +G DK  ++SGPL+   NKR  KKSARFNL    + +   +       NND
Sbjct  13   NNSDTES--IGSDK-SAFSGPLA---NKRASKKSARFNLPPEAAVTSSSN-------NND  59

Query  581  DA-YVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE---KKTTLGSSLVRNAS  745
            D  YVEITLD+R+DSVAVHSV+ A     EDPEL+LLA + LE   K ++  SSL RN S
Sbjct  60   DGGYVEITLDIRDDSVAVHSVQGALHH--EDPELSLLAKKTLEINNKSSSFRSSLFRNTS  117

Query  746  SRIRQVSQELKRIASMTMGAGHPAG-RIDRNKSAAAQALKGLKFISKTDGAS--GWAAVE  916
            S I+QVSQELKR AS+T     P+  R DR KSAAA ALKGLKFI+   GA+  GW AVE
Sbjct  118  SHIKQVSQELKRFASLTR---RPSSRRFDRTKSAAAHALKGLKFITTKTGAAGNGWPAVE  174

Query  917  KRFDQL-TAASNGLLPRAXFGECIGMNK  997
            KR+++L    S+GLL  + FGECIGMNK
Sbjct  175  KRYNELAITTSDGLLHCSMFGECIGMNK  202



>ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Citrus 
sinensis]
Length=915

 Score =   158 bits (399),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 139/208 (67%), Gaps = 27/208 (13%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANND  580
            ++SDTE   +G DK  ++SGPL+   NKR  KKSARFNL    + +   +       NND
Sbjct  16   NNSDTES--IGSDK-SAFSGPLA---NKRASKKSARFNLPPEAAVTSSSN-------NND  62

Query  581  DA-YVEITLDVREDSVAVHSVKTAAGADVEDPELALLA-RGLE---KKTTLGSSLVRNAS  745
            D  YVEITLD+R+DSVAVHSV+ A     EDPEL+LLA + LE   K ++  SSL RN S
Sbjct  63   DGGYVEITLDIRDDSVAVHSVQGALHH--EDPELSLLAKKTLEINNKSSSFRSSLFRNTS  120

Query  746  SRIRQVSQELKRIASMTMGAGHPAG-RIDRNKSAAAQALKGLKFISKTDGAS--GWAAVE  916
            S I+QVSQELKR AS+T     P+  R DR KSAAA ALKGLKFI+   GA+  GW AVE
Sbjct  121  SHIKQVSQELKRFASLTR---RPSSRRFDRTKSAAAHALKGLKFITTKTGAAGNGWPAVE  177

Query  917  KRFDQL-TAASNGLLPRAXFGECIGMNK  997
            KR+++L    S+GLL  + FGECIGMNK
Sbjct  178  KRYNELAITTSDGLLHCSMFGECIGMNK  205



>ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer 
arietinum]
Length=927

 Score =   157 bits (397),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 130/210 (62%), Gaps = 16/210 (8%)
 Frame = +2

Query  395  QHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsAN  574
            Q H+ ++++ ++      + S  LSGPLNKR  +KS++       + S   S        
Sbjct  14   QIHNQESDIELIQTLPHTTTS--LSGPLNKRVVRKSSKL-----LNVSNSSSAIDLCQDE  66

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADV---EDPELALLARGLEKKTTLGSSLVRNAS  745
             +  YVEIT+D++ DSVA+HSVK   G      ED +L LL +G+EKK + G+S VR+AS
Sbjct  67   QEQDYVEITMDIQGDSVALHSVKPVTGNSNDRGEDEKLVLLGKGMEKKRSFGASFVRSAS  126

Query  746  SRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS------KTDGASGWA  907
             R++QVSQELKR++S     G    + DR KSAA+ AL GLKFIS      KTDG +GW 
Sbjct  127  IRMKQVSQELKRLSSFAKQVGPEKVKYDRTKSAASYALMGLKFISQKTDGDKTDGGAGWF  186

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
             VEK+F  LT++++GLL R+ F +CIGMNK
Sbjct  187  EVEKQFQILTSSNDGLLHRSLFAKCIGMNK  216



>gb|KJB45301.1| hypothetical protein B456_007G299500 [Gossypium raimondii]
Length=884

 Score =   157 bits (396),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 116/191 (61%), Gaps = 40/191 (21%)
 Frame = +2

Query  443  RKSYSGPLSGPL------NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITL  604
            R  YSGPLSGP+       K + KKSARF                     + D YVEITL
Sbjct  21   RVGYSGPLSGPILVNNANKKHSSKKSARFK--------------------DGDEYVEITL  60

Query  605  DVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRI  784
            D+REDSV+V ++K        DPE A+LA  LEK+ + GS L    S +IRQVSQELKR+
Sbjct  61   DIREDSVSVQNIKGG------DPETAMLATKLEKRHSFGSQL----SFKIRQVSQELKRM  110

Query  785  ASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPR  964
             SM   A  P  R DRNKS AA+AL+GLKF++K  G  GW+ ++ RFD+L+   NG LP+
Sbjct  111  TSMKAAA--PFNRADRNKSGAARALRGLKFMTKNVGTEGWSEIDSRFDELSV--NGSLPK  166

Query  965  AXFGECIGMNK  997
            + FG+CIGMN+
Sbjct  167  SLFGQCIGMNE  177



>ref|XP_009404716.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=938

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 125/188 (66%), Gaps = 13/188 (7%)
 Frame = +2

Query  449  SYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVA  628
            S+SGPL+GPL  + G + +         SS   +  +      D  YVEITLDVR+D+VA
Sbjct  29   SFSGPLTGPLGDKNGARCS----VPDSPSSAATAKGTEEEEEEDGTYVEITLDVRDDAVA  84

Query  629  VHSVKTAAGADVED--PELALLARGLEKKTT---LGSSLVRNASSRIRQVSQELKRIASM  793
            VHSVK A G    +  PE+A LAR LE+++     GSS++R AS + RQVSQE++R+AS 
Sbjct  85   VHSVKAAGGGGDGEGDPEVAALARELERRSAAAAFGSSVMRTASLKFRQVSQEIRRLASF  144

Query  794  TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXF  973
               +G   G++DR +SAAA ALKGLKFIS+ DGA+GWAAVE+RFD+L  A +G L R+ F
Sbjct  145  GRRSG--VGKLDRTRSAAAHALKGLKFISRADGAAGWAAVERRFDEL--AVDGNLHRSRF  200

Query  974  GECIGMNK  997
             +CIGM +
Sbjct  201  AQCIGMKE  208



>ref|XP_009404717.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 125/188 (66%), Gaps = 13/188 (7%)
 Frame = +2

Query  449  SYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVA  628
            S+SGPL+GPL  + G + +         SS   +  +      D  YVEITLDVR+D+VA
Sbjct  29   SFSGPLTGPLGDKNGARCS----VPDSPSSAATAKGTEEEEEEDGTYVEITLDVRDDAVA  84

Query  629  VHSVKTAAGADVED--PELALLARGLEKKTT---LGSSLVRNASSRIRQVSQELKRIASM  793
            VHSVK A G    +  PE+A LAR LE+++     GSS++R AS + RQVSQE++R+AS 
Sbjct  85   VHSVKAAGGGGDGEGDPEVAALARELERRSAAAAFGSSVMRTASLKFRQVSQEIRRLASF  144

Query  794  TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXF  973
               +G   G++DR +SAAA ALKGLKFIS+ DGA+GWAAVE+RFD+L  A +G L R+ F
Sbjct  145  GRRSG--VGKLDRTRSAAAHALKGLKFISRADGAAGWAAVERRFDEL--AVDGNLHRSRF  200

Query  974  GECIGMNK  997
             +CIGM +
Sbjct  201  AQCIGMKE  208



>dbj|BAJ97450.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 135/188 (72%), Gaps = 13/188 (7%)
 Frame = +2

Query  452  YSGPLSGPLNKRTG-KKSARF-NLAggdssselgspssarsANNDDAYVEITLDVREDSV  625
            +SGPL G   KR+  +KSARF        ++  G+P      ++DD YVEITLDVR+DSV
Sbjct  23   HSGPLGG---KRSAMRKSARFAESVSAPLTAPHGAPRGGGGNDDDDDYVEITLDVRDDSV  79

Query  626  AVHSVKTAAGADVEDPELALLARGLEKKTT-LGSSLVRNASSRIRQVSQELKRIASMTMG  802
            AVHSVK AAG   ED ++ LLA+ LEK+++  G  ++RNAS+RI+QVSQEL+R+AS+   
Sbjct  80   AVHSVKPAAGG--EDSDVKLLAQTLEKRSSSYGQGVLRNASTRIKQVSQELRRLASVNRR  137

Query  803  AGHPAGR---IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXF  973
             G  AG    +D++KSAAA ALKGLKFIS+TDG++GW AVEKRFD L  A NGLL R+ F
Sbjct  138  GGGGAGGPGRVDKSKSAAAHALKGLKFISRTDGSAGWPAVEKRFDDL--AENGLLHRSKF  195

Query  974  GECIGMNK  997
            G+CIGM +
Sbjct  196  GKCIGMKE  203



>dbj|BAK03403.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score =   155 bits (393),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 135/188 (72%), Gaps = 13/188 (7%)
 Frame = +2

Query  452  YSGPLSGPLNKRTG-KKSARF-NLAggdssselgspssarsANNDDAYVEITLDVREDSV  625
            +SGPL G   KR+  +KSARF        ++  G+P      ++DD YVEITLDVR+DSV
Sbjct  23   HSGPLGG---KRSAMRKSARFAESVSAPLTAPHGAPRGGGGNDDDDDYVEITLDVRDDSV  79

Query  626  AVHSVKTAAGADVEDPELALLARGLEKKTT-LGSSLVRNASSRIRQVSQELKRIASMTMG  802
            AVHSVK AAG   ED ++ LLA+ LEK+++  G  ++RNAS+RI+QVSQEL+R+AS+   
Sbjct  80   AVHSVKPAAGG--EDSDVKLLAQTLEKRSSSYGQGVLRNASTRIKQVSQELRRLASVNRR  137

Query  803  AGHPAGR---IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXF  973
             G  AG    +D++KSAAA ALKGLKFIS+TDG++GW AVEKRFD L  A NGLL R+ F
Sbjct  138  GGGGAGGPGRVDKSKSAAAHALKGLKFISRTDGSAGWPAVEKRFDDL--AENGLLHRSKF  195

Query  974  GECIGMNK  997
            G+CIGM +
Sbjct  196  GKCIGMKE  203



>ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa]
 gb|EEE78715.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa]
Length=926

 Score =   155 bits (392),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 121/175 (69%), Gaps = 17/175 (10%)
 Frame = +2

Query  482  KRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGAD  661
            KR+ +KSARFN+      +           ++  +YVEITLD+REDSVAVHSV+   GA+
Sbjct  43   KRSSRKSARFNIPTETVINSGV-------PDDPSSYVEITLDIREDSVAVHSVQ---GAN  92

Query  662  VEDPELALLAR-GLE--KKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDR  832
             EDPEL LLA+  LE    ++L SSL RN SSRIRQVSQELKR AS++        R DR
Sbjct  93   -EDPELTLLAKTALEGNNSSSLRSSLFRNTSSRIRQVSQELKRFASLSRRTS--TRRFDR  149

Query  833  NKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            NKSAAA ALKGLKFI+   G +GW AVEKRF  LTA+++GLLP + FGECIGMNK
Sbjct  150  NKSAAAHALKGLKFITTKTG-NGWPAVEKRFQGLTASTSGLLPCSLFGECIGMNK  203



>ref|XP_010536571.1| PREDICTED: respiratory burst oxidase homolog protein C [Tarenaya 
hassleriana]
Length=911

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 126/210 (60%), Gaps = 42/210 (20%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSGPLN---KRTGKKSARFNLAggdssselgspssarsA  571
            +HSD +    G      +SGP+ GPL    K+  KKS R                   +A
Sbjct  15   YHSDADATTNG---GAHHSGPMGGPLPPALKKPAKKSPR------------------SAA  53

Query  572  NNDDA--YVEITLDVREDSVAVHSVKTAA---GADVEDPELALLARG-LEKKTTLGSSLV  733
             N  A  YV++ LDV ED V+VHSV++ A   G+ VEDPEL LL R  LEKKT++     
Sbjct  54   ENHRAPPYVDLALDVDEDRVSVHSVRSPASDGGSSVEDPELTLLRRKRLEKKTSV-----  108

Query  734  RNASSRIRQVSQELKRIASMTMGAGHPA---GRIDRNKSAAAQALKGLKFISKTDGASGW  904
                 R+  VS ELKR+ S++ GA  P     RIDR KSAAA ALKGLKFISK DG +GW
Sbjct  109  ---VQRLASVSHELKRLTSVS-GARKPPRAPPRIDRTKSAAAHALKGLKFISKKDGGAGW  164

Query  905  AAVEKRFDQLTAASNGLLPRAXFGECIGMN  994
            AAVE+RFDQ+TA ++GLL R+ FGECIGMN
Sbjct  165  AAVERRFDQITATTDGLLLRSKFGECIGMN  194



>ref|XP_011020924.1| PREDICTED: respiratory burst oxidase homolog protein D [Populus 
euphratica]
Length=926

 Score =   153 bits (386),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 121/175 (69%), Gaps = 17/175 (10%)
 Frame = +2

Query  482  KRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGAD  661
            KR+ +KSARFN+      +           ++  +YVEITLD+ EDSVAVHSV+   GA+
Sbjct  43   KRSSRKSARFNIPPETIINPGV-------PDDPSSYVEITLDIHEDSVAVHSVQ---GAN  92

Query  662  VEDPELALLAR-GLE--KKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDR  832
             EDPEL LLA+  LE    ++L SSL RN SSRIRQVSQEL+R AS++        R DR
Sbjct  93   -EDPELTLLAKTALEGNNSSSLRSSLFRNTSSRIRQVSQELRRFASLSRRTS--TRRFDR  149

Query  833  NKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            NKSAAA ALKGLKFI+   G +GW AVEKRF +LTA+++GLLP + FGECIGMNK
Sbjct  150  NKSAAAHALKGLKFITTKTG-NGWPAVEKRFQELTASTSGLLPCSLFGECIGMNK  203



>ref|XP_004241641.1| PREDICTED: respiratory burst oxidase homolog protein D [Solanum 
lycopersicum]
Length=857

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 97/142 (68%), Gaps = 14/142 (10%)
 Frame = +2

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR  751
            +NDD YVE+TLD+R+D+VAVHSVK A     E+ E+  L + L+KK + G+++VRN S R
Sbjct  22   SNDDKYVEVTLDIRDDTVAVHSVKNATKTKAEEAEIEALGKNLQKKRSFGATIVRNLSKR  81

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            +R  SQ             HP   IDR+ +AA   LKG KFIS+TDG SGW  V++RFD+
Sbjct  82   LR--SQP------------HPPRTIDRSSTAAQNVLKGFKFISRTDGGSGWDTVQQRFDE  127

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            LTA S+ LLP+A FGECIGMNK
Sbjct  128  LTANSDSLLPKAKFGECIGMNK  149



>dbj|BAJ94299.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=925

 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 139/204 (68%), Gaps = 21/204 (10%)
 Frame = +2

Query  416  EVMVVGVDKRKSYSGPLSGPLNKRTGKKSARF--NLAggdssselgspssarsANNDDAY  589
            +++  G ++   +SGPL G   +   +KSARF  +++    +   G  +  +  ++DD Y
Sbjct  16   DIVEAGGERVVPHSGPLVG--KRSATRKSARFADSVSAPLRAGAGGRGNHHQDHDDDDDY  73

Query  590  VEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTT--------LGSSLVRNAS  745
            VE+TLDVR+DSVAVHSVK AAG + EDP++ LLAR LE +++         G  ++RNAS
Sbjct  74   VEVTLDVRDDSVAVHSVKPAAGGE-EDPDVTLLARALETRSSSYGGRAGGHGGGVLRNAS  132

Query  746  SRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRF  925
            +RI+QVSQEL+RIAS+      P+ RIDR+KSAAA ALKGLKFISK DG   W AVEKRF
Sbjct  133  TRIKQVSQELRRIASVKR---RPS-RIDRSKSAAAHALKGLKFISKPDG---WPAVEKRF  185

Query  926  DQLTAASNGLLPRAXFGECIGMNK  997
            D+L A + GLL R+ FG+CIGM +
Sbjct  186  DEL-AENGGLLHRSKFGKCIGMKE  208



>dbj|BAJ86360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=925

 Score =   152 bits (384),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 139/204 (68%), Gaps = 21/204 (10%)
 Frame = +2

Query  416  EVMVVGVDKRKSYSGPLSGPLNKRTGKKSARF--NLAggdssselgspssarsANNDDAY  589
            +++  G ++   +SGPL G   +   +KSARF  +++    +   G  +  +  ++DD Y
Sbjct  16   DIVEAGGERVVPHSGPLVG--KRSATRKSARFADSVSAPLRAGAGGRGNHHQDHDDDDDY  73

Query  590  VEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTT--------LGSSLVRNAS  745
            VE+TLDVR+DSVAVHSVK AAG + EDP++ LLAR LE +++         G  ++RNAS
Sbjct  74   VEVTLDVRDDSVAVHSVKPAAGGE-EDPDVTLLARALETRSSSYGGRAGGHGGGVLRNAS  132

Query  746  SRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRF  925
            +RI+QVSQEL+RIAS+      P+ RIDR+KSAAA ALKGLKFISK DG   W AVEKRF
Sbjct  133  TRIKQVSQELRRIASVKR---RPS-RIDRSKSAAAHALKGLKFISKPDG---WPAVEKRF  185

Query  926  DQLTAASNGLLPRAXFGECIGMNK  997
            D+L A + GLL R+ FG+CIGM +
Sbjct  186  DEL-AENGGLLHRSKFGKCIGMKE  208



>gb|AGI65628.1| NADPH oxidase, partial [Fragaria x ananassa]
Length=817

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 108/146 (74%), Gaps = 4/146 (3%)
 Frame = +2

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLAR-GLE--KKTTLGSSLVRNA  742
            ++D+AYVEITLD+ +DSVAVHSV+ A G   EDP+LALLA+  LE  K  +  SSL+R+ 
Sbjct  1    DDDEAYVEITLDILDDSVAVHSVQAAGGGGHEDPQLALLAKKTLEGKKSASFRSSLLRST  60

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS-KTDGASGWAAVEK  919
            SS IRQVSQELKR+AS +        RIDR +SA A ALK LKFI+ K   A+GWA+VEK
Sbjct  61   SSHIRQVSQELKRLASFSKRNSGAGRRIDRTRSATAHALKSLKFITAKASAANGWASVEK  120

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            RFD LTA SNGLL  + FGECIGMNK
Sbjct  121  RFDDLTANSNGLLNSSLFGECIGMNK  146



>ref|XP_010530642.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya 
hassleriana]
Length=929

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 131/225 (58%), Gaps = 19/225 (8%)
 Frame = +2

Query  362  MSSSDQQSFRHQHH--------HSDTEVMVVGV-DKRKSYSGPLSGPLNKRTGKKSARFN  514
            M SS+  S  H HH        +SDT      +   R ++SGPL     KR  KK+ARF 
Sbjct  1    MRSSNSGSEDHHHHELGILRGAYSDTNSDADSITSDRSAFSGPLGRGGAKRASKKNARFA  60

Query  515  LAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAA-GADVEDPELALLA  691
                   S+ GS     S+  DD +VEITLD+RED+VAVHSV+ AA G DVEDPELA L 
Sbjct  61   -PDLPKKSQSGSSRGGGSSVMDDEFVEITLDIREDAVAVHSVQNAAIGGDVEDPELAFLT  119

Query  692  -RGLEKKTTLGSS--LVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALK  862
             R LE      SS   + + SSRI+  S+EL  + S    AG    R DRN+SAA  ALK
Sbjct  120  KRKLETSLNKSSSVGFLGSTSSRIKSASRELLSVFSKRSNAGR---RFDRNRSAAFHALK  176

Query  863  GLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            GLKFI+     + W A+EKRFD+L A +NGLLP + F +CIG+NK
Sbjct  177  GLKFIATK--TATWPAIEKRFDELAAPTNGLLPSSLFWDCIGLNK  219



>sp|Q2HXK9.2|RBOHD_SOLTU RecName: Full=Respiratory burst oxidase homolog protein D; AltName: 
Full=NADPH oxidase RBOHD; AltName: Full=StRBOHD [Solanum 
tuberosum]
 dbj|BAE79345.2| NADPH oxidase [Solanum tuberosum]
Length=858

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 9/141 (6%)
 Frame = +2

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
            NDD  VEITLD+R+D++A  SVK A     E+ EL  L + L+KK + G+++VRN S R+
Sbjct  23   NDDKNVEITLDIRDDTMAGQSVKNATKTKAEEAELEALGKNLQKKCSFGATIVRNVSMRM  82

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            R  S   KR         HP    DR+ +AA  ALKG KFISKTDG SGW  V++RFD+L
Sbjct  83   RLPS--FKR-------QPHPPQTFDRSSTAAQNALKGFKFISKTDGGSGWDTVQQRFDEL  133

Query  935  TAASNGLLPRAXFGECIGMNK  997
            TA S+ LLPRA FGECIGMN+
Sbjct  134  TATSDSLLPRAKFGECIGMNR  154



>ref|XP_010522982.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya 
hassleriana]
Length=945

 Score =   147 bits (370),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 132/210 (63%), Gaps = 22/210 (10%)
 Frame = +2

Query  404  HSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARF--NLAggd--ssselgspssarsA  571
            +SDTE +      R ++SGPL G   KR  KK+ARF  +L       S    S S + ++
Sbjct  26   NSDTESIA---SDRTAFSGPLGG--GKRGSKKNARFAPDLPKRSHSVSGVSVSGSGSGAS  80

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAA--GAD-VEDPELALLA-RGLEKKTTLGSSL--V  733
              DD YVEITLD+R+D+VAVHSV+ AA  G D  EDPELALL  R LE      SSL  +
Sbjct  81   VADDEYVEITLDIRDDAVAVHSVQNAAIGGRDGSEDPELALLTKRTLETSLNNSSSLGFL  140

Query  734  RNASSRIRQVSQELKRIASM--TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWA  907
            R+ SSRI+  S+EL+R+ S   T  AG    R DR +SAA+ ALKGLKFI+     + W 
Sbjct  141  RSTSSRIKHASRELRRVFSKRPTASAGR---RFDRTRSAASHALKGLKFIATK--TATWP  195

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            AVEKRFD+L+  +NGLLP + F ECIGMNK
Sbjct  196  AVEKRFDELSGPTNGLLPSSMFWECIGMNK  225



>ref|XP_010259644.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
 ref|XP_010259645.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
Length=890

 Score =   146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 115/187 (61%), Gaps = 40/187 (21%)
 Frame = +2

Query  443  RKSYSGPLSGPL--NKRT-GKKSARFNLAggdssselgspssarsANNDDAYVEITLDVR  613
            R  +SGPLSGPL  NKR+  ++SARF                     + + YVEITLDVR
Sbjct  26   RVGFSGPLSGPLTSNKRSSNRRSARFK--------------------DGEDYVEITLDVR  65

Query  614  EDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASM  793
            +DSV+VH+VK        DPE ALLA  LE++ +LGS      S +IRQVSQEL+RI S 
Sbjct  66   DDSVSVHNVKGG------DPETALLASRLERRPSLGSQF----SMKIRQVSQELRRITS-  114

Query  794  TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXF  973
                 +   R+DR KS A +AL+GL+FI+K  G+ GWA VE+RF++L    +G LPR  F
Sbjct  115  ----NNKFNRVDRTKSGATRALRGLQFITKNVGSDGWAEVERRFNELQV--DGSLPRTRF  168

Query  974  GECIGMN  994
            G+CIGMN
Sbjct  169  GKCIGMN  175



>gb|AAC39477.1| respiratory burst oxidase protein C [Arabidopsis thaliana]
Length=867

 Score =   145 bits (367),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 124/208 (60%), Gaps = 44/208 (21%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSG----PLNKRTGKKSARFNLAggdssselgspssars  568
            +HSD E            SGP+SG    P+ K+ G  ++RF              +    
Sbjct  12   YHSDAEA---------GNSGPMSGGQLPPIYKKPG--NSRFT-------------AENSQ  47

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNA  742
                  YV++T+DV++D+V+VHS+K   G+ VE+ PEL LL R  LEKKTT+        
Sbjct  48   RTRTAPYVDLTVDVQDDTVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------  99

Query  743  SSRIRQVSQELKRIASMTMGAG-----HPAGRIDRNKSAAAQALKGLKFISKTDGASGWA  907
              R+  VS ELKR+ S++ G G      PA ++DR KSAA+QALKGLKFISKTDG +GW+
Sbjct  100  VKRLASVSHELKRLTSVSGGIGGRKPPRPA-KLDRTKSAASQALKGLKFISKTDGGAGWS  158

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGM  991
            AVEKRF+Q+TA + GLL R  FGECIGM
Sbjct  159  AVEKRFNQITATTGGLLLRTKFGECIGM  186



>gb|AAS15724.1| respiratory burst oxidase protein C [Arabidopsis thaliana]
Length=905

 Score =   145 bits (367),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 124/208 (60%), Gaps = 44/208 (21%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSG----PLNKRTGKKSARFNLAggdssselgspssars  568
            +HSD E            SGP+SG    P+ K+ G  ++RF              +    
Sbjct  12   YHSDAEA---------GNSGPMSGGQLPPIYKKPG--NSRFT-------------AENSQ  47

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNA  742
                  YV++T+DV++D+V+VHS+K   G+ VE+ PEL LL R  LEKKTT+        
Sbjct  48   RTRTAPYVDLTVDVQDDTVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------  99

Query  743  SSRIRQVSQELKRIASMTMGAG-----HPAGRIDRNKSAAAQALKGLKFISKTDGASGWA  907
              R+  VS ELKR+ S++ G G      PA ++DR KSAA+QALKGLKFISKTDG +GW+
Sbjct  100  VKRLASVSHELKRLTSVSGGIGGRKPPRPA-KLDRTKSAASQALKGLKFISKTDGGAGWS  158

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGM  991
            AVEKRF+Q+TA + GLL R  FGECIGM
Sbjct  159  AVEKRFNQITATTGGLLLRTKFGECIGM  186



>dbj|BAC41837.1| putative respiratory burst oxidase protein [Arabidopsis thaliana]
Length=905

 Score =   145 bits (367),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 124/208 (60%), Gaps = 44/208 (21%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSG----PLNKRTGKKSARFNLAggdssselgspssars  568
            +HSD E            SGP+SG    P+ K+ G  ++RF              +    
Sbjct  12   YHSDAEA---------GNSGPMSGGQLPPIYKKPG--NSRFT-------------AENSQ  47

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNA  742
                  YV++T+DV++D+V+VHS+K   G+ VE+ PEL LL R  LEKKTT+        
Sbjct  48   RTRTAPYVDLTVDVQDDTVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------  99

Query  743  SSRIRQVSQELKRIASMTMGAG-----HPAGRIDRNKSAAAQALKGLKFISKTDGASGWA  907
              R+  VS ELKR+ S++ G G      PA ++DR KSAA+QALKGLKFISKTDG +GW+
Sbjct  100  VKRLASVSHELKRLTSVSGGIGGRKPPRPA-KLDRTKSAASQALKGLKFISKTDGGAGWS  158

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGM  991
            AVEKRF+Q+TA + GLL R  FGECIGM
Sbjct  159  AVEKRFNQITATTGGLLLRTKFGECIGM  186



>ref|NP_199919.1| Respiratory burst oxidase homolog protein C [Arabidopsis thaliana]
 sp|O81210.2|RBOHC_ARATH RecName: Full=Respiratory burst oxidase homolog protein C; AltName: 
Full=NADPH oxidase RBOHC; Short=AtRBOHC; AltName: Full=Protein 
ROOT HAIR DEFECTIVE 2 [Arabidopsis thaliana]
 dbj|BAB08752.1| respiratory burst oxidase protein [Arabidopsis thaliana]
 gb|AED96028.1| Respiratory burst oxidase homolog protein C [Arabidopsis thaliana]
Length=905

 Score =   145 bits (367),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 124/208 (60%), Gaps = 44/208 (21%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSG----PLNKRTGKKSARFNLAggdssselgspssars  568
            +HSD E            SGP+SG    P+ K+ G  ++RF              +    
Sbjct  12   YHSDAEA---------GNSGPMSGGQLPPIYKKPG--NSRFT-------------AENSQ  47

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNA  742
                  YV++T+DV++D+V+VHS+K   G+ VE+ PEL LL R  LEKKTT+        
Sbjct  48   RTRTAPYVDLTVDVQDDTVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------  99

Query  743  SSRIRQVSQELKRIASMTMGAG-----HPAGRIDRNKSAAAQALKGLKFISKTDGASGWA  907
              R+  VS ELKR+ S++ G G      PA ++DR KSAA+QALKGLKFISKTDG +GW+
Sbjct  100  VKRLASVSHELKRLTSVSGGIGGRKPPRPA-KLDRTKSAASQALKGLKFISKTDGGAGWS  158

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGM  991
            AVEKRF+Q+TA + GLL R  FGECIGM
Sbjct  159  AVEKRFNQITATTGGLLLRTKFGECIGM  186



>gb|AFJ66196.1| hypothetical protein 7G9.15 [Boechera stricta]
Length=893

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 122/211 (58%), Gaps = 45/211 (21%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSG-----PLNKRTGKKSARFNLAggdssselgspssar  565
            +HSD E           YSGP+SG     P+ K+    ++RF              +   
Sbjct  12   YHSDAEA---------GYSGPMSGGGQLPPIYKKPATTNSRF-------------AAENS  49

Query  566  sANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRN  739
                   YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+       
Sbjct  50   QRTRTAPYVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV-------  102

Query  740  ASSRIRQVSQELKRIASMTMGAG-------HPAGRIDRNKSAAAQALKGLKFISKTDGAS  898
               R+  VS ELKR+ S++ G G        PA ++DR KSAA QALKGLKFISKTDG +
Sbjct  103  -VKRLASVSHELKRLTSVSGGGGGGGRKPPRPA-KLDRTKSAATQALKGLKFISKTDGGA  160

Query  899  GWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
            GW+AVEKRF+Q+TA + GLL R  FGECIGM
Sbjct  161  GWSAVEKRFNQITATTGGLLLRTKFGECIGM  191



>ref|XP_006279397.1| hypothetical protein CARUB_v10007974mg [Capsella rubella]
 gb|EOA12295.1| hypothetical protein CARUB_v10007974mg [Capsella rubella]
Length=921

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 133/229 (58%), Gaps = 27/229 (12%)
 Frame = +2

Query  344  LKEEREMSSSDQQ--SFR--HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARF  511
            +K  R  SSSD +    R  +  ++SDTE M      R ++SGPL  P  KR  KK+ARF
Sbjct  1    MKMRRGNSSSDHELGILRGANSDNNSDTETMPA---DRGAFSGPLGRP--KRASKKNARF  55

Query  512  NLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELAL  685
                  +     S S      +DD YVEITLD+R+DSVAVHSV+ AA  G  +EDPELAL
Sbjct  56   -----AADLPKRSNSLTGGRGDDDEYVEITLDIRDDSVAVHSVQQAAGGGGHLEDPELAL  110

Query  686  LAR-----GLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAA  850
            L +      L   T+L  S  R+ SSRI+  S+EL+R+ S          R DR  SAA 
Sbjct  111  LTKKTLESSLNNTTSL--SFFRSTSSRIKNASRELRRVFSRRPSPA--VRRFDRTSSAAI  166

Query  851  QALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
             ALKGLKFI+    A  W AV++RFD+L+A SNGLL  + F EC+GMNK
Sbjct  167  HALKGLKFIATKTAA--WPAVDQRFDKLSADSNGLLLSSKFWECLGMNK  213



>gb|AFJ66168.1| hypothetical protein 11M19.12 [Arabidopsis halleri]
Length=819

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 101/142 (71%), Gaps = 16/142 (11%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNASSRIRQ  760
            YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+          R+  
Sbjct  55   YVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------VKRLAS  106

Query  761  VSQELKRIASMTMGAG-----HPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRF  925
            VS ELKR+ S++ G G      PA ++DR KSAA QALKGLKFISKTDG +GW+AVEKRF
Sbjct  107  VSHELKRLTSVSGGVGGRKPPRPA-KLDRTKSAATQALKGLKFISKTDGGAGWSAVEKRF  165

Query  926  DQLTAASNGLLPRAXFGECIGM  991
            +Q+TA + GLL R  FGECIGM
Sbjct  166  NQITATTGGLLVRTKFGECIGM  187



>ref|XP_010482026.1| PREDICTED: respiratory burst oxidase homolog protein D [Camelina 
sativa]
Length=923

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 123/205 (60%), Gaps = 23/205 (11%)
 Frame = +2

Query  404  HSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDD  583
            +SDTE +      R + SGPL GP  KR  KK+ARF      +     S S      +DD
Sbjct  25   NSDTESIA---SDRGALSGPLGGP--KRASKKNARF-----AADLPKRSNSVTGGHGDDD  74

Query  584  AYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLAR-----GLEKKTTLGSSLVRNA  742
             YVEITLD+R+DSVAVHSV+ AA  G+ +EDPELALL +      L   T+L  S  R+ 
Sbjct  75   EYVEITLDIRDDSVAVHSVQQAAGGGSHLEDPELALLTKKTLESSLNNTTSL--SFFRST  132

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKR  922
            SSRI+  S+EL+R+ S          R DR  SAA  ALKGLKFI+    A  W AV++R
Sbjct  133  SSRIKNASRELRRVFSRRPSPA--VRRFDRTSSAAIHALKGLKFIATKTAA--WPAVDQR  188

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+L+A SNGLL  + F EC+GMNK
Sbjct  189  FDKLSADSNGLLLSSKFWECLGMNK  213



>ref|XP_007030987.1| Respiratory burst oxidase B [Theobroma cacao]
 gb|EOY11489.1| Respiratory burst oxidase B [Theobroma cacao]
Length=889

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 125/210 (60%), Gaps = 43/210 (20%)
 Frame = +2

Query  389  RHQHHHS--DTEVMVVGVDKRKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgs  550
            RH  H S  DTE        R  YSGPLSGP+     K + KKSARF             
Sbjct  4    RHSKHESWSDTESTS---SNRVGYSGPLSGPILMNNKKSSSKKSARFK------------  48

Query  551  pssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSL  730
                   + DD YVEITLD+REDSV+V ++K        DPE A+LA  LEK+ + GS L
Sbjct  49   -------DGDDEYVEITLDIREDSVSVQNIKGG------DPETAMLATRLEKRPSFGSQL  95

Query  731  VRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFI-SKTDGASGWA  907
                S RIRQVSQELKR+ S    A  P  ++DR+KS AA+AL+GLKF+ +K  G+ GW+
Sbjct  96   ----SFRIRQVSQELKRMTSTKAAA--PFNKVDRSKSGAARALQGLKFMTTKNVGSEGWS  149

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
             VEKRFD+L+   +G L ++ FG+CIGMN+
Sbjct  150  EVEKRFDELSV--DGSLLKSLFGQCIGMNE  177



>gb|AAC39479.1| respiratory burst oxidase protein D [Arabidopsis thaliana]
Length=921

 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 122/205 (60%), Gaps = 23/205 (11%)
 Frame = +2

Query  404  HSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDD  583
            +SDTE +      R ++SGPL  P  KR  KK+ARF            S S A    +DD
Sbjct  25   NSDTESIA---SDRGAFSGPLGRP--KRASKKNARF-----ADDLPKRSNSVAGGRGDDD  74

Query  584  AYVEITLDVREDSVAVHSVKTAAGA--DVEDPELALLAR-----GLEKKTTLGSSLVRNA  742
             YVEITLD+R+DSVAVHSV+ AAG    +EDPELALL +      L   T+L  S  R+ 
Sbjct  75   EYVEITLDIRDDSVAVHSVQQAAGGGGHLEDPELALLTKKTLESSLNNTTSL--SFFRST  132

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKR  922
            SSRI+  S+EL+R+ S          R DR  SAA  ALKGLKFI+    A  W AV++R
Sbjct  133  SSRIKNASRELRRVFSRRPSPA--VRRFDRTSSAAIHALKGLKFIATKTAA--WPAVDQR  188

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+L+A SNGLL  A F EC+GMNK
Sbjct  189  FDKLSADSNGLLLSAKFWECLGMNK  213



>ref|NP_199602.1| respiratory burst oxidase-D [Arabidopsis thaliana]
 sp|Q9FIJ0.1|RBOHD_ARATH RecName: Full=Respiratory burst oxidase homolog protein D; AltName: 
Full=NADPH oxidase RBOHD; Short=AtRBOHD [Arabidopsis 
thaliana]
 gb|AAL11618.1|AF424625_1 AT5g47910/MCA23_25 [Arabidopsis thaliana]
 dbj|BAB11338.1| respiratory burst oxidase protein [Arabidopsis thaliana]
 gb|AAO11567.1| At5g47910/MCA23_25 [Arabidopsis thaliana]
 gb|AED95593.1| respiratory burst oxidase-D [Arabidopsis thaliana]
Length=921

 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 122/205 (60%), Gaps = 23/205 (11%)
 Frame = +2

Query  404  HSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDD  583
            +SDTE +      R ++SGPL  P  KR  KK+ARF            S S A    +DD
Sbjct  25   NSDTESIA---SDRGAFSGPLGRP--KRASKKNARF-----ADDLPKRSNSVAGGRGDDD  74

Query  584  AYVEITLDVREDSVAVHSVKTAAGA--DVEDPELALLAR-----GLEKKTTLGSSLVRNA  742
             YVEITLD+R+DSVAVHSV+ AAG    +EDPELALL +      L   T+L  S  R+ 
Sbjct  75   EYVEITLDIRDDSVAVHSVQQAAGGGGHLEDPELALLTKKTLESSLNNTTSL--SFFRST  132

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKR  922
            SSRI+  S+EL+R+ S          R DR  SAA  ALKGLKFI+    A  W AV++R
Sbjct  133  SSRIKNASRELRRVFSRRPSPA--VRRFDRTSSAAIHALKGLKFIATKTAA--WPAVDQR  188

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+L+A SNGLL  A F EC+GMNK
Sbjct  189  FDKLSADSNGLLLSAKFWECLGMNK  213



>ref|XP_002863831.1| hypothetical protein ARALYDRAFT_917612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40090.1| hypothetical protein ARALYDRAFT_917612 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score =   142 bits (359),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 122/205 (60%), Gaps = 23/205 (11%)
 Frame = +2

Query  404  HSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDD  583
            +SDTE +      R ++SGPL  P  KR  KK+ARF            S S A    +DD
Sbjct  25   NSDTESIA---SDRGAFSGPLGRP--KRASKKNARF-----ADDLPKRSNSVAGGRGDDD  74

Query  584  AYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLAR-----GLEKKTTLGSSLVRNA  742
             YVEITLD+R+DSVAVHSV+ AA  GA +EDPELALL +      L   T+L  S  R+ 
Sbjct  75   EYVEITLDIRDDSVAVHSVQQAAGGGAHLEDPELALLTKKTLESSLNNTTSL--SFFRST  132

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKR  922
            SSRI+  S+EL+R+ S          R DR  SAA  ALKGLKFI+    A  W AV++R
Sbjct  133  SSRIKNASRELRRVFSRRPSPA--VRRFDRTSSAAIHALKGLKFIATKTAA--WPAVDQR  188

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+L+A SNG L  + F EC+GMNK
Sbjct  189  FDKLSADSNGFLLSSKFWECLGMNK  213



>gb|KFK36751.1| hypothetical protein AALP_AA4G165200 [Arabis alpina]
Length=900

 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 126/211 (60%), Gaps = 41/211 (19%)
 Frame = +2

Query  383  SFRHQHHHSDTEVMVVGVDKRKSYSGPLSG---PLNKRTGKKSARFNLAggdssselgsp  553
            SF    ++SD E+           SGP+SG   P+ K+   K A  N      ++     
Sbjct  5    SFEVSGYNSDCEI-----------SGPMSGQLPPIYKKPALKKAAGNSQRTRQAAM----  49

Query  554  ssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSS  727
                       YV++T+DV++D V+V+S+K+  G+ VE+ PEL LL R   E+KTT+   
Sbjct  50   ----------PYVDLTVDVQDDRVSVNSLKSEGGSSVEESPELTLLKRNRPERKTTV---  96

Query  728  LVRNASSRIRQVSQELKRIASMTMGAG--HPAGRIDRNKSAAAQALKGLKFISKTDGASG  901
                   R+  VS ELKR+ S++ G G   PA ++DR KSAA+QALKGLKFISKTDG +G
Sbjct  97   -----VKRLASVSHELKRLTSVSGGPGTKKPA-KLDRTKSAASQALKGLKFISKTDGGAG  150

Query  902  WAAVEKRFDQLTAASNGLLPRAXFGECIGMN  994
            W+AVEKRF+Q+TA + GLL R  FGECIGMN
Sbjct  151  WSAVEKRFNQITATTGGLLLRTKFGECIGMN  181



>ref|XP_002299364.2| hypothetical protein POPTR_0001s12650g [Populus trichocarpa]
 gb|EEE84169.2| hypothetical protein POPTR_0001s12650g [Populus trichocarpa]
Length=926

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 118/175 (67%), Gaps = 18/175 (10%)
 Frame = +2

Query  482  KRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGAD  661
            K + KKSA FN+    + +           ++  ++VEITLD+ +DSVAVHSV+   GA+
Sbjct  43   KHSSKKSAGFNIPPETTINSGF-------TDDSSSFVEITLDICDDSVAVHSVQ---GAN  92

Query  662  VEDPELALLAR-GLE--KKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDR  832
             EDPEL LLA+  LE    ++L SSL RN SS+IRQVSQELKR AS        A R DR
Sbjct  93   -EDPELTLLAKTALEGNNSSSLRSSLFRNTSSKIRQVSQELKRFASRRSST---ARRFDR  148

Query  833  NKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
             KSAAA ALKGLKFI+   G +GW AVEKRF +LTA+++GLLP + FGECIGMNK
Sbjct  149  TKSAAAHALKGLKFITAKTG-NGWPAVEKRFQELTASTDGLLPCSLFGECIGMNK  202



>ref|XP_002865839.1| hypothetical protein ARALYDRAFT_495172 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42098.1| hypothetical protein ARALYDRAFT_495172 [Arabidopsis lyrata subsp. 
lyrata]
Length=906

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 100/142 (70%), Gaps = 16/142 (11%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNASSRIRQ  760
            YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+          R+  
Sbjct  55   YVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------VKRLAS  106

Query  761  VSQELKRIASMTMGAG-----HPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRF  925
            VS ELKR+ S++   G      PA ++DR KSAA QALKGLKFISKTDG +GW+AVEKRF
Sbjct  107  VSHELKRLTSVSGSVGGRKPPRPA-KLDRTKSAATQALKGLKFISKTDGGAGWSAVEKRF  165

Query  926  DQLTAASNGLLPRAXFGECIGM  991
            +Q+TA + GLL R  FGECIGM
Sbjct  166  NQITATTGGLLLRTKFGECIGM  187



>ref|XP_002512422.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF49874.1| respiratory burst oxidase, putative [Ricinus communis]
Length=888

 Score =   141 bits (356),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 112/192 (58%), Gaps = 45/192 (23%)
 Frame = +2

Query  440  KRKSYSGPLSGPL---NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDV  610
            +R  YSGP+SGPL    K + KKSARF                       D YVEITLDV
Sbjct  22   RRFGYSGPMSGPLVTNAKNSSKKSARFK----------------------DEYVEITLDV  59

Query  611  REDSVAVHSVKTAAGADVEDPELALLARGLEKK---TTLGSSLVRNASSRIRQVSQELKR  781
            R+DSV+V +++        D E A LA  LEKK    +LGS L    S R+RQVSQELKR
Sbjct  60   RDDSVSVQNIRGG------DSETAYLASQLEKKKNHPSLGSQL----SFRLRQVSQELKR  109

Query  782  IASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLP  961
                 M + +   R+DR KS AA+ALKGLKF+SK  G  GW+ VE RFD+L+   +G LP
Sbjct  110  -----MTSNNKFDRVDRTKSGAARALKGLKFMSKNVGTEGWSEVEARFDKLSV--DGALP  162

Query  962  RAXFGECIGMNK  997
            +  FG+CIGMN+
Sbjct  163  KTKFGQCIGMNE  174



>gb|KHN17442.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=898

 Score =   140 bits (354),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 103/142 (73%), Gaps = 13/142 (9%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKT-AAGADVEDPE---LALLARGLEKKTTLGSSLVRNASSRI  754
            YVE+T+D+  DSVA+HSVKT AAG D+ + E   L L+ + LEKKTT G+S+V++A++R+
Sbjct  55   YVEVTMDIHRDSVALHSVKTVAAGVDMVEEEGDKLGLMGKRLEKKTTFGASVVQSAANRM  114

Query  755  RQVSQELKRIASMTMGAGHPAGR-IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            +Q    LKR+AS +     PA +  +R KSA   AL GLKFISKTDG +GW  VEK+F++
Sbjct  115  KQ----LKRLASFS----KPAPKHFERTKSAVGHALTGLKFISKTDGGAGWGEVEKQFNK  166

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            LTA + G LPRA F +C+G+NK
Sbjct  167  LTATTGGYLPRALFAQCLGLNK  188



>ref|XP_003525163.2| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
3 [Glycine max]
Length=898

 Score =   140 bits (354),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 103/142 (73%), Gaps = 13/142 (9%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKT-AAGADVEDPE---LALLARGLEKKTTLGSSLVRNASSRI  754
            YVE+T+D+  DSVA+HSVKT AAG D+ + E   L L+ + LEKKTT G+S+V++A++R+
Sbjct  55   YVEVTMDIHRDSVALHSVKTVAAGVDMVEEEGDKLGLMGKRLEKKTTFGASVVQSAANRM  114

Query  755  RQVSQELKRIASMTMGAGHPAGR-IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            +Q    LKR+AS +     PA +  +R KSA   AL GLKFISKTDG +GW  VEK+F++
Sbjct  115  KQ----LKRLASFS----KPAPKHFERTKSAVGHALTGLKFISKTDGGAGWGEVEKQFNK  166

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            LTA + G LPRA F +C+G+NK
Sbjct  167  LTATTGGYLPRALFAQCLGLNK  188



>ref|XP_006402027.1| hypothetical protein EUTSA_v10012613mg [Eutrema salsugineum]
 gb|ESQ43480.1| hypothetical protein EUTSA_v10012613mg [Eutrema salsugineum]
Length=913

 Score =   140 bits (354),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 117/191 (61%), Gaps = 31/191 (16%)
 Frame = +2

Query  455  SGPLSG---PLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSV  625
            SGP+SG   P+ K+   K++ F               +++       YV++TLD+ +D V
Sbjct  25   SGPMSGQLPPIYKKPAMKNSGFT------------AENSQRTRTAAPYVDLTLDIHDDRV  72

Query  626  AVHSVKTAA---GADVED-PELALLARG-LEKKTTLGSSLVRNASSRIRQVSQELKRIAS  790
            +V+S+K+     G+ VE+ PEL LL R  LEKKTT+          R+  VS ELKR+ S
Sbjct  73   SVNSLKSPGSEGGSSVEENPELTLLKRNRLEKKTTV--------VKRLASVSHELKRLTS  124

Query  791  MTMGAGHPA---GRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLP  961
            ++ G   P     ++DR KSAAA ALKGLKFISKTDG +GW+AVEKRF+Q+TA + GLL 
Sbjct  125  VSGGTRKPGRGQAKLDRTKSAAAHALKGLKFISKTDGGAGWSAVEKRFNQITATTGGLLL  184

Query  962  RAXFGECIGMN  994
            R  FGECIGMN
Sbjct  185  RTKFGECIGMN  195



>ref|XP_010442849.1| PREDICTED: respiratory burst oxidase homolog protein C isoform 
X2 [Camelina sativa]
Length=922

 Score =   140 bits (353),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 17/144 (12%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNASSRIRQ  760
            YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+          R+  
Sbjct  59   YVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------VKRLAS  110

Query  761  VSQELKRIASMTMGAGHPAGR-------IDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            VS ELKR+ S++ G G   GR       +DR KSAAAQALKGLKFISKTDG +GW+AVEK
Sbjct  111  VSHELKRLTSVSGGGGGGGGRKPPRPAKLDRTKSAAAQALKGLKFISKTDGGAGWSAVEK  170

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            RF+Q+TA + GLL R  FGECIGM
Sbjct  171  RFNQITATTGGLLLRTKFGECIGM  194



>ref|XP_010442839.1| PREDICTED: respiratory burst oxidase homolog protein C isoform 
X1 [Camelina sativa]
Length=913

 Score =   140 bits (353),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 17/144 (12%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNASSRIRQ  760
            YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+          R+  
Sbjct  59   YVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------VKRLAS  110

Query  761  VSQELKRIASMTMGAGHPAGR-------IDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            VS ELKR+ S++ G G   GR       +DR KSAAAQALKGLKFISKTDG +GW+AVEK
Sbjct  111  VSHELKRLTSVSGGGGGGGGRKPPRPAKLDRTKSAAAQALKGLKFISKTDGGAGWSAVEK  170

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            RF+Q+TA + GLL R  FGECIGM
Sbjct  171  RFNQITATTGGLLLRTKFGECIGM  194



>emb|CDY38845.1| BnaA03g13340D [Brassica napus]
Length=910

 Score =   140 bits (352),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 103/145 (71%), Gaps = 17/145 (12%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAA---GADVED-PELALLARG-LEKKTTLGSSLVRNASSR  751
            YV+IT+DV +D V+V+S+K+     G+ VE+ PEL LL R  LEKKT    S+V+    R
Sbjct  56   YVDITVDVHDDRVSVNSLKSPGSEGGSSVEESPELTLLKRNRLEKKT----SVVK----R  107

Query  752  IRQVSQELKRIASM----TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            +  VS ELKRI S+    T  AG  A ++DR KSAAAQALKGLKFISK DG +GW+AVEK
Sbjct  108  LASVSHELKRITSVSSSSTRKAGRGAAKLDRTKSAAAQALKGLKFISKNDGGAGWSAVEK  167

Query  920  RFDQLTAASNGLLPRAXFGECIGMN  994
            RF+Q+TA + GLL R  FGECIGMN
Sbjct  168  RFNQITATTGGLLIRTKFGECIGMN  192



>ref|XP_009132634.1| PREDICTED: respiratory burst oxidase homolog protein C [Brassica 
rapa]
Length=910

 Score =   140 bits (352),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 103/145 (71%), Gaps = 17/145 (12%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAA---GADVED-PELALLARG-LEKKTTLGSSLVRNASSR  751
            YV+IT+DV +D V+V+S+K+     G+ VE+ PEL LL R  LEKKT    S+V+    R
Sbjct  56   YVDITVDVHDDRVSVNSLKSPGSEGGSSVEESPELTLLKRNRLEKKT----SVVK----R  107

Query  752  IRQVSQELKRIASM----TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            +  VS ELKRI S+    T  AG  A ++DR KSAAAQALKGLKFISK DG +GW+AVEK
Sbjct  108  LASVSHELKRITSVSSSSTRKAGRGAAKLDRTKSAAAQALKGLKFISKNDGGAGWSAVEK  167

Query  920  RFDQLTAASNGLLPRAXFGECIGMN  994
            RF+Q+TA + GLL R  FGECIGMN
Sbjct  168  RFNQITATTGGLLIRTKFGECIGMN  192



>ref|XP_010442586.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Camelina 
sativa]
Length=913

 Score =   140 bits (352),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 17/144 (12%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNASSRIRQ  760
            YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+          R+  
Sbjct  59   YVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------VKRLAS  110

Query  761  VSQELKRIASMTMGAGHPAGR-------IDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            VS ELKR+ S++ G G   GR       +DR KSAAAQALKGLKFISKTDG +GW+AVEK
Sbjct  111  VSHELKRLTSVSGGGGGGGGRKPPRPAKLDRTKSAAAQALKGLKFISKTDGGAGWSAVEK  170

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            RF+Q+TA + GLL R  FGECIGM
Sbjct  171  RFNQITATTGGLLLRTKFGECIGM  194



>emb|CDY32647.1| BnaC03g16150D [Brassica napus]
Length=910

 Score =   139 bits (351),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 101/145 (70%), Gaps = 17/145 (12%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAA---GADVED-PELALLARG-LEKKTTLGSSLVRNASSR  751
            YV+IT+DV +D V+V+S+K+     G+ VE+ PEL LL R  LEKKT++          R
Sbjct  56   YVDITVDVHDDRVSVNSLKSPGSEGGSSVEESPELTLLKRNRLEKKTSV--------VKR  107

Query  752  IRQVSQELKRIASM----TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            +  VS ELKRI S+    T  AG  A ++DR KSAAAQALKGLKFISK DG +GW+AVEK
Sbjct  108  LASVSHELKRITSVSSSSTRKAGRGAAKLDRTKSAAAQALKGLKFISKNDGGAGWSAVEK  167

Query  920  RFDQLTAASNGLLPRAXFGECIGMN  994
            RF+Q+TA + GLL R  FGECIGMN
Sbjct  168  RFNQITATTGGLLIRTKFGECIGMN  192



>ref|XP_012089018.1| PREDICTED: respiratory burst oxidase homolog protein B [Jatropha 
curcas]
 gb|KDP23484.1| hypothetical protein JCGZ_23317 [Jatropha curcas]
Length=891

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 108/188 (57%), Gaps = 35/188 (19%)
 Frame = +2

Query  440  KRKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVR  613
            +R  YSGP+SGPL  N +T KKSARF                      D  YVEITLDVR
Sbjct  23   RRAGYSGPMSGPLVSNNKTSKKSARFK--------------------EDQEYVEITLDVR  62

Query  614  EDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASM  793
            +D+V V ++K        D E   LA  LEKK     SL    S R+RQVSQELK+I S 
Sbjct  63   DDAVLVQNIKGG------DSETTFLASQLEKKHHHRPSLGSQLSFRLRQVSQELKKITS-  115

Query  794  TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXF  973
                 +   ++DR+KS AA+ALKGLKF++K  G  GW+ VE RFD+L+   +G LP+  F
Sbjct  116  ----SNAFDKVDRSKSGAARALKGLKFMTKNVGTEGWSEVEARFDKLSI--DGALPKTRF  169

Query  974  GECIGMNK  997
             +CIGMN+
Sbjct  170  AQCIGMNE  177



>gb|AFJ66221.1| hypothetical protein 34G24.26 [Capsella rubella]
Length=957

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 101/144 (70%), Gaps = 17/144 (12%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNASSRIRQ  760
            YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  L+KKTT+          R+  
Sbjct  89   YVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLDKKTTV--------VKRLAS  140

Query  761  VSQELKRIASMTMGAGHP-------AGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            VS ELKR+ S++ G G         A ++DR KSAAAQALKGLKFISKTDG +GW+AVEK
Sbjct  141  VSHELKRLTSVSGGGGGGGGRKPPRAAKLDRTKSAAAQALKGLKFISKTDGGAGWSAVEK  200

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            RF+Q+TA + GLL R  FGECIGM
Sbjct  201  RFNQITATTGGLLLRTKFGECIGM  224



>ref|XP_006282261.1| hypothetical protein CARUB_v10028541mg [Capsella rubella]
 gb|EOA15159.1| hypothetical protein CARUB_v10028541mg [Capsella rubella]
Length=916

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 101/144 (70%), Gaps = 17/144 (12%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNASSRIRQ  760
            YV++T+DV++D V+VHS+K   G+ VE+ PEL LL R  L+KKTT+          R+  
Sbjct  62   YVDLTVDVQDDRVSVHSLKMEGGSSVEESPELTLLKRNRLDKKTTV--------VKRLAS  113

Query  761  VSQELKRIASMTMGAGHP-------AGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            VS ELKR+ S++ G G         A ++DR KSAAAQALKGLKFISKTDG +GW+AVEK
Sbjct  114  VSHELKRLTSVSGGGGGGGGRKPPRAAKLDRTKSAAAQALKGLKFISKTDGGAGWSAVEK  173

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            RF+Q+TA + GLL R  FGECIGM
Sbjct  174  RFNQITATTGGLLLRTKFGECIGM  197



>ref|XP_008670768.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Zea 
mays]
Length=915

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 118/186 (63%), Gaps = 23/186 (12%)
 Frame = +2

Query  461  PLSGPLNKRT-GKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHS  637
            P SG L+K+   + SARF          +    +  SA NDD  VEITLDVR+ SVA+ S
Sbjct  20   PHSGTLSKKPRARNSARF----------VEVAPAPSSAANDD--VEITLDVRDGSVAMLS  67

Query  638  VKTA-AGADVEDPELALLARGLE----KKTTLGSSLVRNASSRIRQVSQELKRIASMTM-  799
            V+ A AG+  +DP + LL R LE    +  + G SL+RNASSRI Q SQEL+R+ S +  
Sbjct  68   VEPAHAGSAGDDPSVTLLPRPLENNHRRSPSYGHSLIRNASSRIMQASQELRRLGSSSRR  127

Query  800  GAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGE  979
            GA  P  R D +KSAAA ALKGLKFISK  G +GW AVE RF  L  A +GLL R+ FGE
Sbjct  128  GAAGP--RTDLSKSAAAHALKGLKFISKAQGTAGWEAVETRFHVL--AESGLLHRSKFGE  183

Query  980  CIGMNK  997
            CIGMN+
Sbjct  184  CIGMNE  189



>tpg|DAA42070.1| TPA: hypothetical protein ZEAMMB73_604696 [Zea mays]
Length=948

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 118/186 (63%), Gaps = 23/186 (12%)
 Frame = +2

Query  461  PLSGPLNKRT-GKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHS  637
            P SG L+K+   + SARF          +    +  SA NDD  VEITLDVR+ SVA+ S
Sbjct  20   PHSGTLSKKPRARNSARF----------VEVAPAPSSAANDD--VEITLDVRDGSVAMLS  67

Query  638  VKTA-AGADVEDPELALLARGLE----KKTTLGSSLVRNASSRIRQVSQELKRIASMTM-  799
            V+ A AG+  +DP + LL R LE    +  + G SL+RNASSRI Q SQEL+R+ S +  
Sbjct  68   VEPAHAGSAGDDPSVTLLPRPLENNHRRSPSYGHSLIRNASSRIMQASQELRRLGSSSRR  127

Query  800  GAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGE  979
            GA  P  R D +KSAAA ALKGLKFISK  G +GW AVE RF  L  A +GLL R+ FGE
Sbjct  128  GAAGP--RTDLSKSAAAHALKGLKFISKAQGTAGWEAVETRFHVL--AESGLLHRSKFGE  183

Query  980  CIGMNK  997
            CIGMN+
Sbjct  184  CIGMNE  189



>emb|CDX85316.1| BnaC07g26270D [Brassica napus]
Length=922

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 121/208 (58%), Gaps = 17/208 (8%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsA  571
            H   +SD E        R ++SGPL  P  KRT KK+ARF  A   + S   S       
Sbjct  19   HSDTNSDNES---NASDRSAFSGPLGRP--KRTSKKNARFA-ADLPTRSTSLSDGGVGRG  72

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLAR-GLEKKTTLGSSL--VR  736
              DD YVEITLD+R+DSVAVHSV+ A+  G   EDPEL LL +  LE      +SL   R
Sbjct  73   GEDDEYVEITLDIRDDSVAVHSVQQASPGGGTHEDPELTLLTKKTLESNLNNSASLSFFR  132

Query  737  NASSRIRQVSQELKRIASMTMGAGHPAGR-IDRNKSAAAQALKGLKFISKTDGASGWAAV  913
            + SSRI+  S+EL+R+ S       PA R  DR  SAA  ALKGLKFI+    A  W AV
Sbjct  133  STSSRIKNASRELRRVFSRR---STPAVRRFDRTSSAAVHALKGLKFIATKTAA--WPAV  187

Query  914  EKRFDQLTAASNGLLPRAXFGECIGMNK  997
            ++RFD+L+  SNGLL  + F EC+GMNK
Sbjct  188  DQRFDKLSLDSNGLLLSSKFWECLGMNK  215



>ref|XP_010438870.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Camelina 
sativa]
Length=924

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 121/205 (59%), Gaps = 23/205 (11%)
 Frame = +2

Query  404  HSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDD  583
            +SDTE +        ++SGPL  P  KR  KK+ARF      +     S S      +DD
Sbjct  25   NSDTESIA---SDHGAFSGPLGRP--KRASKKNARF-----AADLPKRSNSVTGGHGDDD  74

Query  584  AYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLAR-----GLEKKTTLGSSLVRNA  742
             YVEITLD+R+DSVAVHSV+ AA  G+ +EDPELALL +      L   T+L  S  R+ 
Sbjct  75   EYVEITLDIRDDSVAVHSVQQAAGGGSHLEDPELALLTKKTLESSLNNTTSL--SFFRST  132

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKR  922
            SSRI+  S+EL+R+ S          R D   SAA  ALKGLKFI+    A  W AV++R
Sbjct  133  SSRIKNASRELRRVFSRRPSPA--VRRFDCTSSAAIHALKGLKFIATKTAA--WPAVDQR  188

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+L+A SNGLL  + F EC+GMNK
Sbjct  189  FDKLSADSNGLLLSSQFWECLGMNK  213



>gb|KFK35232.1| hypothetical protein AALP_AA5G257400 [Arabis alpina]
Length=914

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 112/192 (58%), Gaps = 22/192 (11%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R ++SGPL  P  KRT KK+ARF               S      +D YVEITLD+R+DS
Sbjct  33   RTAFSGPLGRP--KRTSKKNARF---------AADLTKSMSGRGEEDEYVEITLDIRDDS  81

Query  623  VAVHSVKTAAGA----DVEDPELALLA-RGLE--KKTTLGSSLVRNASSRIRQVSQELKR  781
            VAVHSV+ AAG      +EDPELALL  R LE     +   S  R+ SSRI+  S+EL+R
Sbjct  82   VAVHSVQQAAGGGGVHQLEDPELALLTKRTLESSLNNSTSLSFFRSTSSRIKHASRELRR  141

Query  782  IASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLP  961
            + S          R DR  SAA  ALKGLKFI+    A  W AV++RFD+L+  +NGLL 
Sbjct  142  VFSRRPSPA--VRRFDRTSSAAIHALKGLKFIATKTAA--WPAVDQRFDKLSLGTNGLLL  197

Query  962  RAXFGECIGMNK  997
             + F EC+GMNK
Sbjct  198  SSNFWECLGMNK  209



>ref|XP_003630437.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AET04913.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=898

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 99/143 (69%), Gaps = 9/143 (6%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGADV---EDPELALLARGLEKKTTLGSSLVRNASS  748
            D  YVE+T+D++ DSVA+HSVKT   +D+   E  + +L    LEKK + G+S+V+NA+ 
Sbjct  44   DADYVEVTMDIQGDSVALHSVKTVTESDMGEGEHEKQSLTGNKLEKKKSFGASVVQNATI  103

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            RI+Q    LKR+AS +     PA R++R KSA A AL GLKFISKTD  +GW+ VEK FD
Sbjct  104  RIKQ----LKRLASFS--KPEPAKRLERTKSAVAHALTGLKFISKTDVGAGWSEVEKVFD  157

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +LT  ++G LPR  F +CIG+N+
Sbjct  158  KLTVTTDGYLPRTLFAKCIGLNE  180



>gb|AAW78863.1| respiratory burst oxidase 1 [Medicago truncatula]
Length=932

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 99/143 (69%), Gaps = 9/143 (6%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGADV---EDPELALLARGLEKKTTLGSSLVRNASS  748
            D  YVE+T+D++ DSVA+HSVKT   +D+   E  + +L    LEKK + G+S+V+NA+ 
Sbjct  44   DADYVEVTMDIQGDSVALHSVKTVTESDMGEGEHEKQSLTGNKLEKKKSFGASVVQNATI  103

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            RI+Q    LKR+AS +     PA R++R KSA A AL GLKFISKTD  +GW+ VEK FD
Sbjct  104  RIKQ----LKRLASFS--KPEPAKRLERTKSAVAHALTGLKFISKTDVGAGWSEVEKVFD  157

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +LT  ++G LPR  F +CIG+N+
Sbjct  158  KLTVTTDGYLPRTLFAKCIGLNE  180



>ref|XP_010482435.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Camelina 
sativa]
Length=913

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 117/194 (60%), Gaps = 36/194 (19%)
 Frame = +2

Query  455  SGPLSG-----PLNKRTGKKS-ARFNLAggdssselgspssarsANNDDAYVEITLDVRE  616
            SGP+SG     P+NK+    + +RF              +          YV++T+DV++
Sbjct  22   SGPMSGGGQLPPINKKPATNTNSRF-------------AAENSQRTRTAPYVDLTVDVQD  68

Query  617  DSVAVHSVKTAAGADVED-PELALLARG-LEKKTTLGSSLVRNASSRIRQVSQELKRIAS  790
            D V+VHS+K   G+ VE+ PEL LL R  LEKKTT+          R+  VS ELKR+ S
Sbjct  69   DRVSVHSLKMEGGSSVEESPELTLLKRNRLEKKTTV--------VKRLASVSHELKRLTS  120

Query  791  MTMGAGHPAGR-------IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASN  949
            ++ G G   GR       +DR KSAAAQALKGLKFISKTDG +GW+AVEKRF+Q+TA + 
Sbjct  121  VSGGGGGVGGRKPPRPAKLDRTKSAAAQALKGLKFISKTDGGAGWSAVEKRFNQITATTG  180

Query  950  GLLPRAXFGECIGM  991
            GLL R  FGECIGM
Sbjct  181  GLLLRTKFGECIGM  194



>gb|KHN43296.1| Respiratory burst oxidase like protein B [Glycine soja]
Length=866

 Score =   137 bits (344),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 112/189 (59%), Gaps = 42/189 (22%)
 Frame = +2

Query  443  RKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDV  610
            R  +SGP+SGPL    NK++ KKSARF                      ++ +VEITLDV
Sbjct  24   RVGFSGPMSGPLVTPNNKKSSKKSARFK------------------DQEEEDFVEITLDV  65

Query  611  REDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIAS  790
            R+D+V+V +++        DPE ALLA  LEK+    SSL    S+R+RQVSQELKR   
Sbjct  66   RDDTVSVQNIRGG------DPETALLASRLEKRP---SSL----SARLRQVSQELKR---  109

Query  791  MTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAX  970
              M +     R+DR KS AA+ALKGLKF++K  G  GW+ VEKRF +L  A  G LP+  
Sbjct  110  --MTSSKKFDRVDRTKSGAARALKGLKFMTKNVGTEGWSQVEKRFHEL--AVEGKLPKTR  165

Query  971  FGECIGMNK  997
            F +CIGMN+
Sbjct  166  FSQCIGMNE  174



>ref|XP_009151593.1| PREDICTED: respiratory burst oxidase homolog protein D [Brassica 
rapa]
Length=922

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 120/207 (58%), Gaps = 15/207 (7%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsA  571
            H   +SD E        R ++SGPL  P  KRT KK+ARF  A   + S   S       
Sbjct  19   HSDTNSDNES---NASDRSAFSGPLGRP--KRTSKKNARFA-ADLPTRSTSLSDGGGGRG  72

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLAR-GLEKKTTLGSSL--VR  736
              DD YVEITLD+R+DSVAVHSV+ A+  G   EDPEL LL +  LE      +SL   R
Sbjct  73   GEDDEYVEITLDIRDDSVAVHSVQQASPGGGTHEDPELTLLTKKTLESNLNNSASLSFFR  132

Query  737  NASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVE  916
            + SSRI+  S+EL+R+ S        A R DR  SAA  ALKGLKFI+    A  W AV+
Sbjct  133  STSSRIKNASRELRRVFSRRSAPA--ARRFDRTSSAAVHALKGLKFIATKTAA--WPAVD  188

Query  917  KRFDQLTAASNGLLPRAXFGECIGMNK  997
            +RFD+L+  SNGLL  + F EC+GMNK
Sbjct  189  QRFDKLSLDSNGLLLSSKFWECLGMNK  215



>emb|CDX86335.1| BnaA06g30520D [Brassica napus]
Length=922

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 120/207 (58%), Gaps = 15/207 (7%)
 Frame = +2

Query  392  HQHHHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsA  571
            H   +SD E        R ++SGPL  P  KRT KK+ARF  A   + S   S       
Sbjct  19   HSDTNSDNES---NASDRSAFSGPLGRP--KRTSKKNARFA-ADLPTRSTSLSDGGGGRG  72

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAA--GADVEDPELALLAR-GLEKKTTLGSSL--VR  736
              DD YVEITLD+R+DSVAVHSV+ A+  G   EDPEL LL +  LE      +SL   R
Sbjct  73   GEDDEYVEITLDIRDDSVAVHSVQQASPGGGTHEDPELTLLTKKTLESNLNNSASLSFFR  132

Query  737  NASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVE  916
            + SSRI+  S+EL+R+ S        A R DR  SAA  ALKGLKFI+    A  W AV+
Sbjct  133  STSSRIKNASRELRRVFSRRSAPA--ARRFDRTSSAAVHALKGLKFIATKTAA--WPAVD  188

Query  917  KRFDQLTAASNGLLPRAXFGECIGMNK  997
            +RFD+L+  SNGLL  + F EC+GMNK
Sbjct  189  QRFDKLSLDSNGLLLSSKFWECLGMNK  215



>ref|XP_010523349.1| PREDICTED: respiratory burst oxidase homolog protein A isoform 
X2 [Tarenaya hassleriana]
Length=867

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 94/145 (65%), Gaps = 14/145 (10%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTA---AGADVEDPELALL-ARGLEKKTTLGSSLVRNAS  745
            D  +VEI+LD  +D V+VHSV ++        E+PE +LL    LEK++++         
Sbjct  40   DQPFVEISLDFHDDFVSVHSVTSSDQFGKYGYENPERSLLNPNRLEKRSSV--------M  91

Query  746  SRIRQVSQELKRIASMTMG--AGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
             RI  VSQELKR AS++       P  RI R+ SAA QALKGLKFISKTDG +GW  VEK
Sbjct  92   KRIASVSQELKRFASVSTARKPPRPPARIGRSMSAAEQALKGLKFISKTDGVTGWPDVEK  151

Query  920  RFDQLTAASNGLLPRAXFGECIGMN  994
            RFDQ+T  SNGLL R+ FGECIGMN
Sbjct  152  RFDQITTTSNGLLHRSKFGECIGMN  176



>ref|XP_010523340.1| PREDICTED: respiratory burst oxidase homolog protein A isoform 
X1 [Tarenaya hassleriana]
Length=895

 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 94/145 (65%), Gaps = 14/145 (10%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTA---AGADVEDPELALL-ARGLEKKTTLGSSLVRNAS  745
            D  +VEI+LD  +D V+VHSV ++        E+PE +LL    LEK++++         
Sbjct  40   DQPFVEISLDFHDDFVSVHSVTSSDQFGKYGYENPERSLLNPNRLEKRSSV--------M  91

Query  746  SRIRQVSQELKRIASMTMG--AGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
             RI  VSQELKR AS++       P  RI R+ SAA QALKGLKFISKTDG +GW  VEK
Sbjct  92   KRIASVSQELKRFASVSTARKPPRPPARIGRSMSAAEQALKGLKFISKTDGVTGWPDVEK  151

Query  920  RFDQLTAASNGLLPRAXFGECIGMN  994
            RFDQ+T  SNGLL R+ FGECIGMN
Sbjct  152  RFDQITTTSNGLLHRSKFGECIGMN  176



>gb|KDO56233.1| hypothetical protein CISIN_1g002711mg [Citrus sinensis]
Length=889

 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 114/190 (60%), Gaps = 41/190 (22%)
 Frame = +2

Query  443  RKSYSGPLSGPL-----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLD  607
            R  YSGPLSGPL      K + +KSARF                    + D+ YVEITLD
Sbjct  21   RVGYSGPLSGPLVTTTNKKNSSRKSARFK-------------------DQDECYVEITLD  61

Query  608  VREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIA  787
            VR+DSV+V +++        D E A LA  LE+K +  S+     S+R+RQVSQELKR+A
Sbjct  62   VRDDSVSVQNIRGG------DSETAFLASRLERKPSSSSA----LSARLRQVSQELKRMA  111

Query  788  SMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRA  967
            S          ++DR KS AA+ALKGLKFI+K  G  GW  VEKRFD+L  A +G+LP++
Sbjct  112  S-----SKRFDKVDRTKSGAARALKGLKFITKNVGTEGWGEVEKRFDEL--AVDGMLPKS  164

Query  968  XFGECIGMNK  997
             FG+CIGMN+
Sbjct  165  SFGQCIGMNE  174



>ref|XP_006433403.1| hypothetical protein CICLE_v10000227mg [Citrus clementina]
 ref|XP_006472080.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Citrus 
sinensis]
 gb|ESR46643.1| hypothetical protein CICLE_v10000227mg [Citrus clementina]
Length=889

 Score =   134 bits (338),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 114/190 (60%), Gaps = 41/190 (22%)
 Frame = +2

Query  443  RKSYSGPLSGPL-----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLD  607
            R  YSGPLSGPL      K + +KSARF                    + D+ YVEITLD
Sbjct  21   RVGYSGPLSGPLVTTTNKKNSSRKSARFK-------------------DQDECYVEITLD  61

Query  608  VREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIA  787
            VR+DSV+V +++        D E A LA  LE+K +  S+     S+R+RQVSQELKR+A
Sbjct  62   VRDDSVSVQNIRGG------DSETAFLASRLERKPSSSSA----LSARLRQVSQELKRMA  111

Query  788  SMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRA  967
            S          ++DR KS AA+ALKGLKFI+K  G  GW  VEKRFD+L  A +G+LP++
Sbjct  112  S-----SKRFDKVDRTKSGAARALKGLKFITKNVGTEGWGEVEKRFDEL--AVDGMLPKS  164

Query  968  XFGECIGMNK  997
             FG+CIGMN+
Sbjct  165  SFGQCIGMNE  174



>ref|XP_007147029.1| hypothetical protein PHAVU_006G090200g [Phaseolus vulgaris]
 gb|AEX56132.1| NADPH oxidase [Phaseolus vulgaris]
 gb|ESW19023.1| hypothetical protein PHAVU_006G090200g [Phaseolus vulgaris]
Length=881

 Score =   134 bits (338),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 109/187 (58%), Gaps = 42/187 (22%)
 Frame = +2

Query  443  RKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRE  616
            R  +SGP+SGPL  NK+T KKSARF                     +D+  VEITLDVR+
Sbjct  23   RVGFSGPMSGPLVTNKKTSKKSARFK--------------------DDEELVEITLDVRD  62

Query  617  DSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMT  796
            D V+V +++        DPE ALLA  LEK+    SSL    S R+RQVSQELKR     
Sbjct  63   DVVSVQNIRGG------DPETALLASRLEKRP---SSL----SVRLRQVSQELKR-----  104

Query  797  MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFG  976
            M +     R+DR KS AA+AL+G KF++K  G+ GW+ VEKRF  L  A  G LP+  FG
Sbjct  105  MTSSKKFDRVDRTKSGAARALRGFKFMTKNVGSEGWSQVEKRF--LDLAVEGKLPKTRFG  162

Query  977  ECIGMNK  997
            +CIGM +
Sbjct  163  QCIGMQE  169



>ref|XP_003554649.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
1 [Glycine max]
Length=887

 Score =   134 bits (338),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 110/189 (58%), Gaps = 42/189 (22%)
 Frame = +2

Query  443  RKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDV  610
            R  +SGP+SGPL    NK++ KKS RF                      ++ +VEITLDV
Sbjct  24   RVGFSGPMSGPLVTPNNKKSSKKSTRFK------------------DQEEEDFVEITLDV  65

Query  611  REDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIAS  790
            R+D+V+V +++        DPE ALLA  LEK+    SSL    S R+RQVSQELKR   
Sbjct  66   RDDTVSVQNIRGG------DPETALLASRLEKRP---SSL----SVRLRQVSQELKR---  109

Query  791  MTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAX  970
              M +     R+DR KS AA+ALKGLKF++K  G  GW+ VEKRF +L  A  G LP+  
Sbjct  110  --MTSSKKFDRVDRTKSGAARALKGLKFMTKNVGTEGWSQVEKRFHEL--AVEGKLPKTR  165

Query  971  FGECIGMNK  997
            F +CIGMN+
Sbjct  166  FSQCIGMNE  174



>ref|XP_003532261.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
1 [Glycine max]
Length=888

 Score =   134 bits (337),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 101/147 (69%), Gaps = 18/147 (12%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVE--------DPELALLARG-LEKKTTLGSSLVRN  739
            YVE+T+D+  DSVA+HSVKT A  DV+          +L L+ +  LEKKT+ G+S+V++
Sbjct  45   YVEVTMDIHRDSVALHSVKTVAADDVDMVEEEEEEGDKLGLMGKKRLEKKTSFGASVVQS  104

Query  740  ASSRIRQVSQELKRIASMTMGAGHPAGR-IDRNKSAAAQALKGLKFISKTDGASGWAAVE  916
            A++R++Q    LKR+AS +     PA +  +R KSA   AL GLKFISKTDG +GW  VE
Sbjct  105  AANRMKQ----LKRLASFS----KPAPKHFERTKSAVGHALTGLKFISKTDGGAGWVEVE  156

Query  917  KRFDQLTAASNGLLPRAXFGECIGMNK  997
            KRF +LTA ++G LPRA F +C+G+NK
Sbjct  157  KRFHKLTATTDGYLPRALFAQCLGLNK  183



>ref|XP_010112007.1| Respiratory burst oxidase-like protein D [Morus notabilis]
 gb|EXC32352.1| Respiratory burst oxidase-like protein D [Morus notabilis]
Length=924

 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 103/170 (61%), Gaps = 34/170 (20%)
 Frame = +2

Query  572  NNDDA--YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTL---------  718
            NNDD   YVEITLD+R+DSVAVHSV+ A+G+D ED ELALL      KTTL         
Sbjct  77   NNDDNSNYVEITLDIRDDSVAVHSVQAASGSD-EDQELALLT-----KTTLQEAAGAANN  130

Query  719  -----GSSLVRNASSRI-RQVSQELKRIAS------MTMGAGHPAGRIDRNKSAAAQALK  862
                  S+  R+ SSR+   VSQELKR+AS      M   +     R DR+KSAAA ALK
Sbjct  131  NNNNSRSASFRSTSSRVLNHVSQELKRLASATSKQLMRPNSSSTPRRFDRSKSAAAHALK  190

Query  863  GLKFISKTDG-----ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            G KFI+   G      S W  VEKRF+ LTA SNGLL  + FGECIGMNK
Sbjct  191  GFKFIAAKKGGSSAAVSAWPEVEKRFNDLTANSNGLLHSSLFGECIGMNK  240



>ref|XP_009402525.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Musa 
acuminata subsp. malaccensis]
Length=891

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 116/183 (63%), Gaps = 39/183 (21%)
 Frame = +2

Query  452  YSGPLSGPL-NKRTGKK-SARFNLAggdssselgspssarsANNDDAYVEITLDVREDSV  625
            +SGPL GPL +K+ GKK SARF                      DD YVEITLDVR+D++
Sbjct  30   HSGPLGGPLASKKAGKKRSARFK--------------------GDDNYVEITLDVRDDAI  69

Query  626  AVHSVKTAAGADVEDPELALLARGLEKKTTL-GSSLVRNASSRIRQVSQELKRIASMTMG  802
            A+ S+++       DPE ALLA+ LE+++ + G+SL    SS+++QV  E +R+ S    
Sbjct  70   AIQSIQSG------DPEAALLAKNLERRSPMVGASL----SSKLKQVGHEFRRMTS----  115

Query  803  AGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGEC  982
            +   A R+DR KS+AAQA+KGL+F++K   + GW  VE+RFD+L  A +G+L R+ FG+C
Sbjct  116  SSRRAERLDRTKSSAAQAIKGLQFVAKNVASEGWPQVERRFDEL--AVDGVLLRSRFGKC  173

Query  983  IGM  991
            IGM
Sbjct  174  IGM  176



>ref|XP_009778242.1| PREDICTED: respiratory burst oxidase homolog protein B [Nicotiana 
sylvestris]
Length=872

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 114/187 (61%), Gaps = 44/187 (24%)
 Frame = +2

Query  440  KRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRED  619
            +R  +SGPL       +GK+S+RFN                    +D++YVEITLDVR+D
Sbjct  16   RRVGFSGPLV------SGKRSSRFN--------------------DDESYVEITLDVRDD  49

Query  620  SVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQELKRIASMT  796
            SV V ++K A      D E ALLA  LEK+  TLGS L    S  +RQVS+ELKR     
Sbjct  50   SVLVQNIKGA------DQESALLASRLEKRPNTLGSQL----SFHLRQVSKELKR-----  94

Query  797  MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFG  976
            M + +   ++DR+KS AA+AL+GL+F++K  G  GW+ +E RFDQL  A NG+LP++ FG
Sbjct  95   MTSSNKFHKMDRSKSGAARALRGLQFMNKNVGTEGWSEIETRFDQL--AVNGMLPKSLFG  152

Query  977  ECIGMNK  997
            +CIGM +
Sbjct  153  QCIGMKE  159



>ref|XP_009129697.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Brassica 
rapa]
Length=921

 Score =   132 bits (332),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 109/191 (57%), Gaps = 16/191 (8%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R ++SGPL  P  KR  KK+ARF            +  S      DD YVEITLD+R+DS
Sbjct  33   RSAFSGPLGRP--KRASKKNARF----AADLPRRSNSISGVGGREDDEYVEITLDIRDDS  86

Query  623  VAVHSVKTAAGA---DVEDPELALLAR---GLEKKTTLGSSLVRNASSRIRQVSQELKRI  784
            VAVHSV+ A+     ++EDPEL LL +         +   S  R+ SSRI+  S+EL+R+
Sbjct  87   VAVHSVQQASPGGPQNLEDPELTLLTKKTLESSLNKSSSLSFFRSTSSRIKNASRELRRV  146

Query  785  ASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPR  964
             S          R DR  SAA  ALKGLKFI+    A  W AVE+RFD+L+  SNGLL  
Sbjct  147  FSRRPSPA--VRRFDRTSSAAIHALKGLKFIATKTAA--WPAVEERFDKLSLDSNGLLLS  202

Query  965  AXFGECIGMNK  997
            + F EC+GMNK
Sbjct  203  SKFWECLGMNK  213



>emb|CDY45918.1| BnaAnng07990D [Brassica napus]
Length=921

 Score =   132 bits (332),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 109/191 (57%), Gaps = 16/191 (8%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R ++SGPL  P  KR  KK+ARF            +  S      DD YVEITLD+R+DS
Sbjct  33   RSAFSGPLGRP--KRASKKNARF----AADLPRRSNSISGVGGREDDEYVEITLDIRDDS  86

Query  623  VAVHSVKTAAGA---DVEDPELALLAR---GLEKKTTLGSSLVRNASSRIRQVSQELKRI  784
            VAVHSV+ A+     ++EDPEL LL +         +   S  R+ SSRI+  S+EL+R+
Sbjct  87   VAVHSVQQASPGGPQNLEDPELTLLTKKTLESSLNKSSSLSFFRSTSSRIKNASRELRRV  146

Query  785  ASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPR  964
             S          R DR  SAA  ALKGLKFI+    A  W AVE+RFD+L+  SNGLL  
Sbjct  147  FSRRPSPA--VRRFDRTSSAAIHALKGLKFIATKTAA--WPAVEERFDKLSLDSNGLLLS  202

Query  965  AXFGECIGMNK  997
            + F EC+GMNK
Sbjct  203  SKFWECLGMNK  213



>ref|XP_008450638.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X2 [Cucumis melo]
Length=695

 Score =   130 bits (328),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 117/200 (59%), Gaps = 36/200 (18%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGP--LNKRTGKKSARFNLAggdssselgspssarsANND  580
            SDTE   +G  KR  +SGPL+GP    KRT   S+              S  S     +D
Sbjct  13   SDTES--IGSSKRVGFSGPLTGPSVAYKRTNSYSS--------------STRSTMRIKDD  56

Query  581  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNASSRIR  757
            D YVEITLDVR+D+V+V +++        D E A+LA  LE K+ TLGS L    S +++
Sbjct  57   DQYVEITLDVRDDTVSVQNIRGG------DSETAMLASRLETKRPTLGSQL----SFKLK  106

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            QVSQEL+R     M +     RIDR KS A++AL GL+F++K+ G+  W+ +E RFD+L 
Sbjct  107  QVSQELRR-----MTSSKSFNRIDRTKSGASRALNGLRFMTKSVGSEAWSEIENRFDKL-  160

Query  938  AASNGLLPRAXFGECIGMNK  997
             A NG LP++ F  CIGMN+
Sbjct  161  -AINGELPKSLFARCIGMNE  179



>ref|XP_008246413.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Prunus mume]
Length=894

 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 119/201 (59%), Gaps = 41/201 (20%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGPL--NKR--TGKKSARFNLAggdssselgspssarsAN  574
            S+TE   VG      +SGPLSGPL  NKR  + K+SARF                  +++
Sbjct  12   SETESTGVG------HSGPLSGPLVTNKRNNSSKRSARFK-----------------ASD  48

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
             ++ YVEITLDVR+D+V VH+++        D E A+LA  +E++ +  S      S R+
Sbjct  49   QEECYVEITLDVRDDTVLVHNIRGG------DSETAMLASKIERRPSSLSL-GSQLSFRL  101

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            RQVSQELKR     M +     R+DR KS AA+ALKGLKF++K  G+ GW+ +E RFD+L
Sbjct  102  RQVSQELKR-----MTSSKSFKRVDRTKSGAARALKGLKFMTKNVGSEGWSEIETRFDEL  156

Query  935  TAASNGLLPRAXFGECIGMNK  997
              A +G LP+  F +CIGMN+
Sbjct  157  --AVDGTLPKLKFAQCIGMNE  175



>ref|XP_008246416.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X2 [Prunus mume]
Length=893

 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 119/201 (59%), Gaps = 41/201 (20%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGPL--NKR--TGKKSARFNLAggdssselgspssarsAN  574
            S+TE   VG      +SGPLSGPL  NKR  + K+SARF                  +++
Sbjct  12   SETESTGVG------HSGPLSGPLVTNKRNNSSKRSARFK-----------------ASD  48

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRI  754
             ++ YVEITLDVR+D+V VH+++        D E A+LA  +E++ +  S      S R+
Sbjct  49   QEECYVEITLDVRDDTVLVHNIRGG------DSETAMLASKIERRPSSLSL-GSQLSFRL  101

Query  755  RQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            RQVSQELKR     M +     R+DR KS AA+ALKGLKF++K  G+ GW+ +E RFD+L
Sbjct  102  RQVSQELKR-----MTSSKSFKRVDRTKSGAARALKGLKFMTKNVGSEGWSEIETRFDEL  156

Query  935  TAASNGLLPRAXFGECIGMNK  997
              A +G LP+  F +CIGMN+
Sbjct  157  --AVDGTLPKLKFAQCIGMNE  175



>ref|XP_008450637.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Cucumis melo]
Length=889

 Score =   130 bits (327),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 117/200 (59%), Gaps = 36/200 (18%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGP--LNKRTGKKSARFNLAggdssselgspssarsANND  580
            SDTE   +G  KR  +SGPL+GP    KRT   S+              S  S     +D
Sbjct  13   SDTES--IGSSKRVGFSGPLTGPSVAYKRTNSYSS--------------STRSTMRIKDD  56

Query  581  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNASSRIR  757
            D YVEITLDVR+D+V+V +++        D E A+LA  LE K+ TLGS L    S +++
Sbjct  57   DQYVEITLDVRDDTVSVQNIRGG------DSETAMLASRLETKRPTLGSQL----SFKLK  106

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            QVSQEL+R     M +     RIDR KS A++AL GL+F++K+ G+  W+ +E RFD+L 
Sbjct  107  QVSQELRR-----MTSSKSFNRIDRTKSGASRALNGLRFMTKSVGSEAWSEIENRFDKL-  160

Query  938  AASNGLLPRAXFGECIGMNK  997
             A NG LP++ F  CIGMN+
Sbjct  161  -AINGELPKSLFARCIGMNE  179



>ref|XP_011659890.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X2 [Cucumis sativus]
Length=695

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 116/200 (58%), Gaps = 36/200 (18%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGP--LNKRTGKKSARFNLAggdssselgspssarsANND  580
            SDTE   +G  KR  +SGPL+G     KRT   S+              S  S     +D
Sbjct  13   SDTES--IGSSKRVGFSGPLTGASVAYKRTNSYSS--------------STRSTMRIKDD  56

Query  581  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNASSRIR  757
            D YVEITLDVR+D+V+V +++        D E A+LA  LE K+ TLGS L    S +++
Sbjct  57   DQYVEITLDVRDDTVSVQNIRGG------DSETAMLASRLETKRPTLGSQL----SFKLK  106

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            QVSQEL+R     M +     RIDR KS A++AL GL+F++K+ G+  W+ +E RFDQL 
Sbjct  107  QVSQELRR-----MTSSKSFNRIDRTKSGASRALNGLRFMTKSVGSEAWSEIENRFDQL-  160

Query  938  AASNGLLPRAXFGECIGMNK  997
             A NG LP++ F  CIGMN+
Sbjct  161  -AINGELPKSLFARCIGMNE  179



>gb|EYU24549.1| hypothetical protein MIMGU_mgv1a001003mg [Erythranthe guttata]
Length=916

 Score =   129 bits (323),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 107/153 (70%), Gaps = 14/153 (9%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAG-----ADVEDPELALL-ARGLEKKTTLGSS-LVR  736
            DD+ V+ITLDVREDSVAV SVKT A       +V+D EL +L A+G+EKK++   S   R
Sbjct  38   DDSVVDITLDVREDSVAVQSVKTVAAAAAAAGEVQDSELNILPAKGMEKKSSSSGSSFAR  97

Query  737  NASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAA--  910
            NASS IRQVS  +KR+AS+T     P+ R+ R +SAA  AL GLKFI+KT G  G AA  
Sbjct  98   NASSTIRQVSLGMKRLASVTRRR-QPSRRLHRTESAATHALNGLKFINKTGGGGGGAAAA  156

Query  911  ----VEKRFDQLTAASNGLLPRAXFGECIGMNK  997
                VE+RF ++T+ +NGLLPR+ FGECIGMN+
Sbjct  157  AWAGVEQRFKKITSTTNGLLPRSHFGECIGMNE  189



>ref|XP_006382490.1| respiratory burst oxidase protein B [Populus trichocarpa]
 gb|ERP60287.1| respiratory burst oxidase protein B [Populus trichocarpa]
Length=876

 Score =   129 bits (323),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 109/190 (57%), Gaps = 43/190 (23%)
 Frame = +2

Query  443  RKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDV  610
            R  YSGPLSGPL     K + KKSARF                      D+ YVEITLDV
Sbjct  22   RIGYSGPLSGPLVTTTKKNSSKKSARFK---------------------DEEYVEITLDV  60

Query  611  REDSVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQELKRIA  787
            R+DSV+V ++K        D E A LA  L +K  +LGS L    S ++RQVS ELKR  
Sbjct  61   RDDSVSVQNIKGG------DSETAYLASQLGRKHPSLGSQL----SIKLRQVSHELKR--  108

Query  788  SMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRA  967
               M +     + DR+KS AA+ALKGLKF++K  G+ GW+ +E RF +L  A NG LP++
Sbjct  109  ---MTSSKRFDKYDRSKSGAARALKGLKFMTKNVGSEGWSEIEARFHEL--AVNGSLPKS  163

Query  968  XFGECIGMNK  997
             FG+CIGM +
Sbjct  164  KFGQCIGMKE  173



>ref|XP_011036858.1| PREDICTED: respiratory burst oxidase homolog protein B [Populus 
euphratica]
 ref|XP_011036859.1| PREDICTED: respiratory burst oxidase homolog protein B [Populus 
euphratica]
Length=886

 Score =   128 bits (321),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 110/190 (58%), Gaps = 43/190 (23%)
 Frame = +2

Query  443  RKSYSGPLSGPL----NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDV  610
            R  YSGPLSGPL     K + KKSARF                      D+ YVEITLDV
Sbjct  22   RIGYSGPLSGPLVTTTKKNSSKKSARFK---------------------DEEYVEITLDV  60

Query  611  REDSVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQELKRIA  787
            R+DSV+V ++K        D E A LA  L +K  +LGS L    S ++RQVS ELKR  
Sbjct  61   RDDSVSVQNIKGG------DSETAFLASQLGRKHPSLGSQL----SIKLRQVSHELKR--  108

Query  788  SMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRA  967
               M +     + DR+KS A++AL+GLKF++K  G+ GW+ +E RF++L  A NG LP++
Sbjct  109  ---MTSSKRFDKYDRSKSGASRALQGLKFMTKNVGSEGWSEIEARFNEL--AVNGSLPKS  163

Query  968  XFGECIGMNK  997
             FG+CIGM +
Sbjct  164  KFGQCIGMKE  173



>ref|XP_004135613.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Cucumis sativus]
 gb|KGN66068.1| hypothetical protein Csa_1G569450 [Cucumis sativus]
Length=889

 Score =   128 bits (321),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 116/200 (58%), Gaps = 36/200 (18%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGP--LNKRTGKKSARFNLAggdssselgspssarsANND  580
            SDTE   +G  KR  +SGPL+G     KRT   S+              S  S     +D
Sbjct  13   SDTES--IGSSKRVGFSGPLTGASVAYKRTNSYSS--------------STRSTMRIKDD  56

Query  581  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLE-KKTTLGSSLVRNASSRIR  757
            D YVEITLDVR+D+V+V +++        D E A+LA  LE K+ TLGS L    S +++
Sbjct  57   DQYVEITLDVRDDTVSVQNIRGG------DSETAMLASRLETKRPTLGSQL----SFKLK  106

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            QVSQEL+R     M +     RIDR KS A++AL GL+F++K+ G+  W+ +E RFDQL 
Sbjct  107  QVSQELRR-----MTSSKSFNRIDRTKSGASRALNGLRFMTKSVGSEAWSEIENRFDQL-  160

Query  938  AASNGLLPRAXFGECIGMNK  997
             A NG LP++ F  CIGMN+
Sbjct  161  -AINGELPKSLFARCIGMNE  179



>ref|XP_010931626.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Elaeis 
guineensis]
Length=885

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 118/201 (59%), Gaps = 41/201 (20%)
 Frame = +2

Query  401  HHSDTEVMVVGVDKRKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgspssarsAN  574
            HH DT            +SGPLSGPL   K + K+SARF                     
Sbjct  12   HHVDTSSESEDAGSGVGFSGPLSGPLGTKKASNKRSARFK--------------------  51

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTT-LGSSLVRNASSR  751
            ++  YVEITLDVR+DSVA+ ++++      +D E ALLA+ L +++  +G       +S+
Sbjct  52   DEQTYVEITLDVRDDSVAIQNIES------QDQEAALLAKALGRRSPPIG------ITSK  99

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            ++QVSQEL+R+AS +     PAG IDR KS A +ALKGL+F++K  G+ GW  +E+RF+ 
Sbjct  100  LKQVSQELRRMASFS---KKPAG-IDRTKSGATRALKGLQFVTKNVGSDGWPEIERRFNA  155

Query  932  LTAASNGLLPRAXFGECIGMN  994
            L  A +G+L R  FG+CIGM+
Sbjct  156  L--AVDGVLLRTRFGQCIGMD  174



>gb|AEP25512.1| putative respiratory burst oxidase-like protein A [Vicia faba]
Length=894

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 120/215 (56%), Gaps = 52/215 (24%)
 Frame = +2

Query  392  HQHHHSDTEVMVVG--------VDKRKSYSGPLSGPL----NKRTGKKSARFNLAggdss  535
            + HH + +E   +G        V    S SGPLSGPL     KR+ KKSARF        
Sbjct  6    NHHHETWSETESIGSRSTRSARVGFSGSLSGPLSGPLVSNNKKRSSKKSARF--------  57

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTT  715
                       +++ + +VEITLDVR+D+V+V +++        D E ALLA  LEK+ +
Sbjct  58   -----------SDDVEDFVEITLDVRDDTVSVQNIRGG------DSETALLASRLEKRPS  100

Query  716  LGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGA  895
                     S +++QVSQELKR     M +     R+DR KS AA+ALKGLKF++KT G+
Sbjct  101  -------TLSVKLKQVSQELKR-----MTSSKKFDRVDRAKSGAARALKGLKFMTKTVGS  148

Query  896  S-GWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
              GW+ VEKRFD+L    +G LP+  F +CIGMN+
Sbjct  149  DRGWSQVEKRFDELEV--DGKLPKTRFSQCIGMNE  181



>ref|XP_004309557.1| PREDICTED: respiratory burst oxidase homolog protein C [Fragaria 
vesca subsp. vesca]
 ref|XP_011470839.1| PREDICTED: respiratory burst oxidase homolog protein C [Fragaria 
vesca subsp. vesca]
Length=917

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 110/205 (54%), Gaps = 34/205 (17%)
 Frame = +2

Query  398  HHHSDTEVMVVGVDKRKSYSGPLS--GPLNKRTGKKSARFNLAggdssselgspssarsA  571
             +HSD E+          Y+ PLS  G LNKRTG K                        
Sbjct  24   QYHSDNELPAPEKMSGAGYTAPLSLSGTLNKRTGSKRTN--------------------N  63

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEK---KTTLGSSLVRNA  742
            + ++ YVE   DV   SV V SVK     D  + + +L   G +K   K+    S VR A
Sbjct  64   HEEEPYVE---DV---SVDVSSVKPLPRGDANNTDDSLTLLGGDKPPQKSNNDQSFVRTA  117

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKR  922
            S RI+Q   ELK++ S +        R DR +SAAA ALKGLKFISKTDG + W AVEKR
Sbjct  118  SVRIKQ---ELKKLTSFSKQQLPQRRRFDRMQSAAAPALKGLKFISKTDGNAEWPAVEKR  174

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+LT ++NG+LPRA FGECIGMNK
Sbjct  175  FDKLTGSTNGMLPRAAFGECIGMNK  199



>ref|XP_003521697.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
1 [Glycine max]
Length=885

 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 113/188 (60%), Gaps = 41/188 (22%)
 Frame = +2

Query  443  RKSYSGPLSGPL---NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVR  613
            R  +SGP+SGPL   NK++ KKSARF                      D+ +VEITLDVR
Sbjct  24   RVGFSGPMSGPLVTSNKKSSKKSARFK------------------DQEDEDFVEITLDVR  65

Query  614  EDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASM  793
            +D+V+V +++        DPE ALLA  LEK+    SSL    S R+RQVSQELKR    
Sbjct  66   DDTVSVQNIRGG------DPETALLASRLEKRP---SSL----SVRLRQVSQELKR----  108

Query  794  TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXF  973
             M +     R+DR KS AA+ALKGLKF++K  G  GW+ V+KRFD+L  A +G LP+  F
Sbjct  109  -MTSSKKFDRVDRAKSGAARALKGLKFMTKNVGTEGWSQVDKRFDEL--AVDGKLPKTRF  165

Query  974  GECIGMNK  997
             +CIGMN+
Sbjct  166  SQCIGMNE  173



>ref|NP_001274981.1| respiratory burst oxidase homolog protein B [Solanum tuberosum]
 sp|Q948T9.1|RBOHB_SOLTU RecName: Full=Respiratory burst oxidase homolog protein B; AltName: 
Full=NADPH oxidase RBOHB; AltName: Full=StRBOHB [Solanum 
tuberosum]
 dbj|BAB70751.1| respiratory burst oxidase homolog [Solanum tuberosum]
Length=867

 Score =   126 bits (317),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 111/187 (59%), Gaps = 45/187 (24%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R  +SG L       +GKKSARF                     +D++YVEITLDVR+DS
Sbjct  16   RVGFSGSLV------SGKKSARFK--------------------DDESYVEITLDVRDDS  49

Query  623  VAVHSVKTAAGADVEDPELALLARGLEKK--TTLGSSLVRNASSRIRQVSQELKRIASMT  796
            V+V ++K A      D E ALLA  LEK+   TLGS L    S  +RQVS+ELKR     
Sbjct  50   VSVQNIKGA------DHEAALLASRLEKRPNNTLGSQL----SFHLRQVSKELKR-----  94

Query  797  MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFG  976
            M + +   +IDR+KS AA+AL+GL+F++K  G  GW+ VE RFDQL  A NG+L ++ FG
Sbjct  95   MTSSNKFQKIDRSKSGAARALRGLQFMNKNVGTEGWSEVESRFDQL--AVNGMLTKSLFG  152

Query  977  ECIGMNK  997
            +CIGM +
Sbjct  153  QCIGMKE  159



>ref|XP_002283888.1| PREDICTED: respiratory burst oxidase homolog protein B [Vitis 
vinifera]
Length=894

 Score =   125 bits (315),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 106/172 (62%), Gaps = 37/172 (22%)
 Frame = +2

Query  479  NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGA  658
            NK+  KKSARF                       + YVEITLDVR+DSV+V +++   G 
Sbjct  43   NKKGSKKSARFK---------------------SEEYVEITLDVRDDSVSVQNIR---GG  78

Query  659  DVEDPELALLARGLEK-KTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRN  835
            D+E    ++LA  LE+ + +LGS L    S RIRQVSQELKRI S    +     + DR+
Sbjct  79   DLET---SMLASRLERQRPSLGSQL----SFRIRQVSQELKRITS---SSSKRFNKDDRS  128

Query  836  KSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
            KS+A +ALKGL+F++K  G  GW+A+EKRFDQL+   NG LP++ FG+CIGM
Sbjct  129  KSSATRALKGLQFMTKNVGNEGWSAIEKRFDQLSV--NGALPKSSFGQCIGM  178



>emb|CAN64415.1| hypothetical protein VITISV_013316 [Vitis vinifera]
Length=894

 Score =   125 bits (315),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 106/172 (62%), Gaps = 37/172 (22%)
 Frame = +2

Query  479  NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGA  658
            NK+  KKSARF                       + YVEITLDVR+DSV+V +++   G 
Sbjct  43   NKKGSKKSARFK---------------------SEEYVEITLDVRDDSVSVQNIR---GG  78

Query  659  DVEDPELALLARGLEK-KTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRN  835
            D+E    ++LA  LE+ + +LGS L    S RIRQVSQELKRI S    +     + DR+
Sbjct  79   DLET---SMLASRLERQRPSLGSQL----SFRIRQVSQELKRITS---SSSKRFNKDDRS  128

Query  836  KSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
            KS+A +ALKGL+F++K  G  GW+A+EKRFDQL+   NG LP++ FG+CIGM
Sbjct  129  KSSATRALKGLQFMTKNVGNEGWSAIEKRFDQLSV--NGALPKSSFGQCIGM  178



>ref|XP_006395230.1| hypothetical protein EUTSA_v10003619mg [Eutrema salsugineum]
 gb|ESQ32516.1| hypothetical protein EUTSA_v10003619mg [Eutrema salsugineum]
Length=928

 Score =   125 bits (315),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 115/196 (59%), Gaps = 17/196 (9%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARF--NLAg-gdssselgspssarsANNDDAYVEITLDVR  613
            R ++SGPL  P  KR  KK+ARF  NL    +S S  GS         DD YVEITLD+R
Sbjct  33   RTAFSGPLGRP--KRASKKNARFAENLPRRSNSVSGGGSGGGRGRGGEDDEYVEITLDIR  90

Query  614  EDSVAVHSVKTAAGAD-----VEDPELALLA-RGLE--KKTTLGSSLVRNASSRIRQVSQ  769
            +DSVAVHSV+ A G       +EDPEL LL  + LE     +   S  R+ SSRI+  S+
Sbjct  91   DDSVAVHSVQQAGGGGGGAQHLEDPELTLLTKKTLESSLNNSTSLSFFRSTSSRIKNASR  150

Query  770  ELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASN  949
            EL+R+ S          R DR  SAA  ALKGLKFI+    A  W AV++RF++L+  SN
Sbjct  151  ELRRVFSRRPSPA--VRRFDRTSSAAIHALKGLKFIATKTAA--WPAVDERFEKLSLDSN  206

Query  950  GLLPRAXFGECIGMNK  997
            GLL  + F EC+GMNK
Sbjct  207  GLLLSSKFWECLGMNK  222



>ref|XP_008800853.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Phoenix 
dactylifera]
Length=880

 Score =   125 bits (314),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 106/180 (59%), Gaps = 40/180 (22%)
 Frame = +2

Query  452  YSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAV  631
            +SGPLSGP     G + ARF                     ++  YVEITLDVR+DSVA+
Sbjct  29   FSGPLSGP----PGTRKARFK--------------------DEQTYVEITLDVRDDSVAI  64

Query  632  HSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGH  811
              ++       +D E A+LAR  E++     S     +S++RQVSQEL+R+AS +     
Sbjct  65   QDIRG------QDQEAAMLARAFERQ-----SPSTGITSKLRQVSQELRRMASFS--RSR  111

Query  812  PAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
            PA  IDR KS AA+ALKGL+F++K  G+ GW  VE+RFD+L  A +G+L R  FG+C+GM
Sbjct  112  PAS-IDRTKSGAARALKGLQFVTKNVGSGGWPEVERRFDKL--AVDGVLLRTRFGQCVGM  168



>ref|XP_004503856.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer 
arietinum]
Length=933

 Score =   125 bits (314),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 95/138 (69%), Gaps = 11/138 (8%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVS  766
            YVE+T+D++ DSVA+HSVKT    D+ D +  L      KKT+ G+S+V+NA+ RI++  
Sbjct  88   YVEVTMDIKGDSVALHSVKTVTETDMGDEKQCLTG----KKTSFGASVVQNATIRIKK--  141

Query  767  QELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS-KTDGASGWAAVEKRFDQLTAA  943
              LKR+AS +     PA +++R KSA A AL GLKFIS K D A+GW+ VEK+F  LTA 
Sbjct  142  --LKRLASFS--KPEPAEQLERTKSAMAHALTGLKFISSKADVAAGWSEVEKQFHSLTAT  197

Query  944  SNGLLPRAXFGECIGMNK  997
            ++G LPR  F +CIG+N+
Sbjct  198  TDGYLPRHLFAKCIGLNE  215



>gb|KCW61821.1| hypothetical protein EUGRSUZ_H04514 [Eucalyptus grandis]
Length=682

 Score =   124 bits (311),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 118/205 (58%), Gaps = 40/205 (20%)
 Frame = +2

Query  392  HQH-HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  568
            HQH   SDTE        R  YSGPLS    K   + +ARF                   
Sbjct  7    HQHAQWSDTES---NCSSRLGYSGPLSSTSTKI--RSNARFR-----------------D  44

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL-EKKTTLGSSLVRNAS  745
              +++ YVEITLDV EDSV+VH++K        DPE AL    L  + ++LG+ L    S
Sbjct  45   DQDEECYVEITLDVGEDSVSVHNIKGGG-----DPETALFTSRLGLRPSSLGAQL----S  95

Query  746  SRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISK-TDGASGWAAVEKR  922
             R+RQVSQEL+RI S T G  +   +IDR +S AA+AL+GL+F++K  +   GW+ VE R
Sbjct  96   FRLRQVSQELRRITS-TKGRNN---QIDRTRSGAARALRGLQFMTKNVEIDQGWSEVEAR  151

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+L  A NG+LP++ FG+CIGMN+
Sbjct  152  FDEL--ALNGVLPKSLFGQCIGMNE  174



>ref|XP_010269487.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
Length=908

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 111/189 (59%), Gaps = 41/189 (22%)
 Frame = +2

Query  455  SGPLSGPL---NKRTG-KKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            SGPLSGPL    K++G ++SARF                     + D YVEITLDVREDS
Sbjct  34   SGPLSGPLVTSTKKSGNRRSARFK--------------------DGDDYVEITLDVREDS  73

Query  623  VAVHSVKTAAGADVEDPELALLARGLEKKT----TLGSSLVRNASSRIRQVSQELKRIAS  790
            V+V +VK        D E A+LA  LE  T    +LGS L    S +I+QVS+ELKR+AS
Sbjct  74   VSVQNVKGG------DHETAVLASRLETTTTTRTSLGSLLGSQFSMKIKQVSKELKRMAS  127

Query  791  MTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAX  970
                  +   R+DR KS A +AL+GL+FI++  G  GWA VE RF +L    +G LPR+ 
Sbjct  128  -----SNRFNRLDRTKSTATRALRGLQFITENVGTDGWAEVESRFSELQV--DGSLPRSR  180

Query  971  FGECIGMNK  997
            FG+CIGM++
Sbjct  181  FGKCIGMSE  189



>gb|KHN16903.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=816

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 96/142 (68%), Gaps = 18/142 (13%)
 Frame = +2

Query  602  LDVREDSVAVHSVKTAAGADVE--------DPELALLARG-LEKKTTLGSSLVRNASSRI  754
            +D+  DSVA+HSVKT A  DV+          +L L+ +  LEKKT+ G+S+V++A++R+
Sbjct  1    MDIHRDSVALHSVKTVAADDVDMVEEEEEEGDKLGLMGKKRLEKKTSFGASVVQSAANRM  60

Query  755  RQVSQELKRIASMTMGAGHPAGR-IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            +Q    LKR+AS +     PA +  +R KSA   AL GLKFISKTDG +GW  VEKRF +
Sbjct  61   KQ----LKRLASFS----KPAPKHFERTKSAVGHALTGLKFISKTDGGAGWVEVEKRFHK  112

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            LTA ++G LPRA F +C+G+NK
Sbjct  113  LTATTDGYLPRALFAQCLGLNK  134



>ref|XP_010025215.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Eucalyptus 
grandis]
 gb|KCW61820.1| hypothetical protein EUGRSUZ_H04514 [Eucalyptus grandis]
Length=889

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 118/205 (58%), Gaps = 40/205 (20%)
 Frame = +2

Query  392  HQH-HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  568
            HQH   SDTE        R  YSGPLS    K   + +ARF                   
Sbjct  7    HQHAQWSDTES---NCSSRLGYSGPLSSTSTKI--RSNARFR-----------------D  44

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL-EKKTTLGSSLVRNAS  745
              +++ YVEITLDV EDSV+VH++K        DPE AL    L  + ++LG+ L    S
Sbjct  45   DQDEECYVEITLDVGEDSVSVHNIKGGG-----DPETALFTSRLGLRPSSLGAQL----S  95

Query  746  SRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISK-TDGASGWAAVEKR  922
             R+RQVSQEL+RI S T G  +   +IDR +S AA+AL+GL+F++K  +   GW+ VE R
Sbjct  96   FRLRQVSQELRRITS-TKGRNN---QIDRTRSGAARALRGLQFMTKNVEIDQGWSEVEAR  151

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+L  A NG+LP++ FG+CIGMN+
Sbjct  152  FDEL--ALNGVLPKSLFGQCIGMNE  174



>emb|CDY35764.1| BnaC02g38300D [Brassica napus]
Length=899

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 91/146 (62%), Gaps = 10/146 (7%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGA---DVEDPELALLAR---GLEKKTTLGSSLVRN  739
            DD YVEITLD+R+DSVAVHSV+ A+     ++EDPEL LL +         +   S  R+
Sbjct  50   DDEYVEITLDIRDDSVAVHSVQQASPGGPQNLEDPELTLLTKKTLESSLNKSSSLSFFRS  109

Query  740  ASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
             SSRI+  S+EL+R+ S          R DR  SAA  ALKGLKFI+    A  W AVE+
Sbjct  110  TSSRIKNASRELRRVFSRRPSPA--VRRFDRTSSAAIHALKGLKFIATKTAA--WPAVEE  165

Query  920  RFDQLTAASNGLLPRAXFGECIGMNK  997
            RFD+L+  SNGLL  + F EC+GMNK
Sbjct  166  RFDKLSLESNGLLLSSKFWECLGMNK  191



>ref|XP_010041041.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Eucalyptus 
grandis]
Length=889

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 117/205 (57%), Gaps = 40/205 (20%)
 Frame = +2

Query  392  HQH-HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  568
            HQH   SDTE        R  YSGPLS    K   + +ARF                   
Sbjct  7    HQHAQWSDTES---NCSSRLGYSGPLSSTSTKI--RSNARFR-----------------D  44

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL-EKKTTLGSSLVRNAS  745
              +++ YVEITLDV EDSV+VH +K        DPE AL    L  + ++LG+ L    S
Sbjct  45   DQDEECYVEITLDVGEDSVSVHDIKGGG-----DPETALFTSRLGLRPSSLGAQL----S  95

Query  746  SRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISK-TDGASGWAAVEKR  922
             R+RQVSQEL+RI S T G  +   +IDR +S AA+AL+GL+F++K  +   GW+ VE R
Sbjct  96   FRLRQVSQELRRITS-TKGRNN---QIDRTRSGAARALRGLQFMTKNVEIDQGWSEVEAR  151

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+L  A NG+LP++ FG+CIGMN+
Sbjct  152  FDEL--ALNGVLPKSLFGQCIGMNE  174



>gb|KCW44695.1| hypothetical protein EUGRSUZ_L017712, partial [Eucalyptus grandis]
Length=853

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 117/205 (57%), Gaps = 40/205 (20%)
 Frame = +2

Query  392  HQH-HHSDTEVMVVGVDKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssars  568
            HQH   SDTE        R  YSGPLS    K   + +ARF                   
Sbjct  7    HQHAQWSDTES---NCSSRLGYSGPLSSTSTKI--RSNARFR-----------------D  44

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL-EKKTTLGSSLVRNAS  745
              +++ YVEITLDV EDSV+VH +K        DPE AL    L  + ++LG+ L    S
Sbjct  45   DQDEECYVEITLDVGEDSVSVHDIKGGG-----DPETALFTSRLGLRPSSLGAQL----S  95

Query  746  SRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISK-TDGASGWAAVEKR  922
             R+RQVSQEL+RI S T G  +   +IDR +S AA+AL+GL+F++K  +   GW+ VE R
Sbjct  96   FRLRQVSQELRRITS-TKGRNN---QIDRTRSGAARALRGLQFMTKNVEIDQGWSEVEAR  151

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            FD+L  A NG+LP++ FG+CIGMN+
Sbjct  152  FDEL--ALNGVLPKSLFGQCIGMNE  174



>ref|XP_009611315.1| PREDICTED: respiratory burst oxidase homolog protein B [Nicotiana 
tomentosiformis]
Length=866

 Score =   123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 113/187 (60%), Gaps = 44/187 (24%)
 Frame = +2

Query  440  KRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRED  619
            +R  +SGPL       +GK+S+RFN                    ++++YVEITLDVR+D
Sbjct  13   RRVGFSGPLV------SGKRSSRFN--------------------DNESYVEITLDVRDD  46

Query  620  SVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSRIRQVSQELKRIASMT  796
            SV V ++K A      D E ALLA  LEK+  TLGS L    S  +RQVS+ELKR+ S+ 
Sbjct  47   SVLVQNIKGA------DQESALLASRLEKRPNTLGSQL----SFHLRQVSKELKRMTSL-  95

Query  797  MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFG  976
                +   ++DR+KS AA+AL+GL+F++K     GW+ +E RFD+L  A N +LP++ FG
Sbjct  96   ----NKFHKMDRSKSGAARALRGLQFMNKNVRTEGWSEIETRFDKL--AVNEMLPKSLFG  149

Query  977  ECIGMNK  997
            +CIGM +
Sbjct  150  QCIGMKE  156



>gb|KDP44025.1| hypothetical protein JCGZ_05492 [Jatropha curcas]
Length=268

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 100/169 (59%), Gaps = 19/169 (11%)
 Frame = +2

Query  437  DKRKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRE  616
            D RK++    +  +     +KSARFN+    ++            ++  +YVEITLD+R+
Sbjct  92   DDRKTFIYKRTENVFFHRSQKSARFNIPPEATA-----------VDDPSSYVEITLDIRD  140

Query  617  DSVAVHSVKTAAGADVEDPELALLAR-GLEKKTTLGSSLVRNASSRIRQVSQELKRIASM  793
            DSV  HSV  A     EDPELALLA+  LE K++   SL RN SS I+QVS ELKR+AS+
Sbjct  141  DSVVFHSVHPAN----EDPELALLAKKTLENKSSSFQSLFRNTSSHIKQVSHELKRLASL  196

Query  794  TMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGAS--GWAAVEKRFDQL  934
            +  +   AGR DR KSA   ALKGL+FI+   G +  GW  VEKRF  L
Sbjct  197  SRKS-FAAGRFDRTKSATRNALKGLQFITTKIGVAGNGWPTVEKRFMNL  244



>gb|ADR70881.1| respiratory burst oxidase B [Manihot esculenta]
Length=885

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 19/138 (14%)
 Frame = +2

Query  590  VEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKT--TLGSSLVRNASSRIRQV  763
            VEITLDVR+DSV+V +++        D E A LA  LE+K   +LGS L    S R+RQV
Sbjct  51   VEITLDVRDDSVSVQNIRGG------DSETAFLASQLERKNHPSLGSQL----SLRLRQV  100

Query  764  SQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAA  943
            SQELKRI S      +   ++DR+KS AA+ALKGLKF++K  G  GW+ VE RFD+L  A
Sbjct  101  SQELKRITS-----SNTFDKVDRSKSGAARALKGLKFMTKNVGTEGWSEVEARFDKL--A  153

Query  944  SNGLLPRAXFGECIGMNK  997
             +GLLP+  FG+CIGMN+
Sbjct  154  VDGLLPKNRFGQCIGMNE  171



>ref|XP_010674039.1| PREDICTED: respiratory burst oxidase homolog protein B [Beta 
vulgaris subsp. vulgaris]
Length=887

 Score =   122 bits (306),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 97/145 (67%), Gaps = 14/145 (10%)
 Frame = +2

Query  569  ANNDDA--YVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNA  742
            +N DD   YVEITLDVR+DSV+V  +K A G    D E ALL   LEK+     +L    
Sbjct  44   SNKDDENEYVEITLDVRDDSVSVQDIKGAVG----DQEAALLTSHLEKQRP--QTLTSQF  97

Query  743  SSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKR  922
            S++I+QVS+ELKR+ S   G      ++DR+K+ A +ALKGL+F++K+ G  GWA VEKR
Sbjct  98   SAKIKQVSRELKRVTSSNRGFK----QLDRSKTTAGRALKGLQFLTKSVGNEGWAQVEKR  153

Query  923  FDQLTAASNGLLPRAXFGECIGMNK  997
            F+ L  A +GLL R+ FG+CIGMN+
Sbjct  154  FEDL--AVDGLLLRSRFGKCIGMNE  176



>ref|XP_010644201.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Vitis 
vinifera]
 emb|CBI20311.3| unnamed protein product [Vitis vinifera]
Length=840

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 87/135 (64%), Gaps = 8/135 (6%)
 Frame = +2

Query  593  EITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQE  772
            +I LDV +DS AVH VKT      ED + AL A G E + +   +LVR AS+RIR VS E
Sbjct  15   DIKLDVPDDSDAVHGVKTTG----EDAQSALHAEGEENRFSF-RALVRGASARIRSVSDE  69

Query  773  LKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNG  952
            LK   S+T     P+ R +   SAA  AL GLKFI +TDG++GW  VEK F QLT ++NG
Sbjct  70   LK---SLTSWKSTPSSRYEPPNSAALHALTGLKFIRQTDGSAGWPDVEKSFQQLTDSTNG  126

Query  953  LLPRAXFGECIGMNK  997
            LLPR+ F ECIGM +
Sbjct  127  LLPRSRFAECIGMGQ  141



>ref|XP_007206556.1| hypothetical protein PRUPE_ppa019730mg [Prunus persica]
 gb|EMJ07755.1| hypothetical protein PRUPE_ppa019730mg [Prunus persica]
Length=893

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 115/199 (58%), Gaps = 37/199 (19%)
 Frame = +2

Query  407  SDTEVMVVGVDKRKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgspssarsANND  580
            S+TE   VG      +SGPLSGPL  NKR                      + ++S++ +
Sbjct  12   SETESTGVG------HSGPLSGPLVTNKRNNSSKRS---------------ARSKSSDQE  50

Query  581  DAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQ  760
            + YVEITLDVR+D+V VH+++        D E A+LA  LE++ +  S      S R+RQ
Sbjct  51   ECYVEITLDVRDDTVLVHNIRGG------DSETAMLASKLERRASSLSL-GSQLSFRLRQ  103

Query  761  VSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTA  940
            VSQELKR     M +     R+DR KS AA+ALKGLKF++K  G+ GW+ +E RFD+L  
Sbjct  104  VSQELKR-----MTSSKSFKRVDRTKSGAARALKGLKFMTKNVGSEGWSEIETRFDEL--  156

Query  941  ASNGLLPRAXFGECIGMNK  997
            A +G LP+  F +CIGM++
Sbjct  157  AVDGTLPKLRFAQCIGMDE  175



>ref|XP_004230232.1| PREDICTED: respiratory burst oxidase homolog protein B [Solanum 
lycopersicum]
Length=865

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 109/187 (58%), Gaps = 45/187 (24%)
 Frame = +2

Query  443  RKSYSGPLSGPLNKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDS  622
            R  +SG L       +GKKSARF                     +D++YVEITLDVR+DS
Sbjct  14   RVGFSGSLV------SGKKSARFK--------------------DDESYVEITLDVRDDS  47

Query  623  VAVHSVKTAAGADVEDPELALLARGLEKKT--TLGSSLVRNASSRIRQVSQELKRIASMT  796
            V V ++K A      D E ALLA  LEK+   TLGS L    S  ++QVS+ELKR     
Sbjct  48   VLVQNIKGA------DHEAALLASKLEKRPNHTLGSQL----SFHLKQVSKELKR-----  92

Query  797  MGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFG  976
            M + +   +IDR+KS AA+AL+GL+F+++  G  GW+ VE RFDQL  A +G+L +  FG
Sbjct  93   MTSSNKFQKIDRSKSGAARALRGLQFMNRNVGTEGWSEVESRFDQL--AVDGMLAKTLFG  150

Query  977  ECIGMNK  997
            +CIGM +
Sbjct  151  QCIGMKE  157



>ref|XP_003602723.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES72974.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=917

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 87/143 (61%), Gaps = 3/143 (2%)
 Frame = +2

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVE-DPELALLARGLEKKTTLGSSLVRNASS  748
            N +   V++TLD++   VA+H        + E D +L LL +G+EKK + G S VR AS+
Sbjct  37   NKEGDLVDVTLDIQGKKVALHFTPVTGNNNYEEDEKLDLLGKGMEKKRSFGDSFVRTASN  96

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
             +R+VSQEL R+ S +   G    +  R  S A+ AL+  +FI+K DG +GW  VEK+FD
Sbjct  97   HLRKVSQELTRLTSFSKQVGVEKVKHARTDSVASHALREFRFITKNDGDAGWETVEKKFD  156

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +L  A NGLL R  F ECIGM K
Sbjct  157  KL--ADNGLLHRDNFAECIGMKK  177



>ref|XP_008670770.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Zea 
mays]
Length=930

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 116/193 (60%), Gaps = 26/193 (13%)
 Frame = +2

Query  461  PLSGPLNKRTGKKSARF-------NLAggdssselgspssarsANNDDAYVEITLDVRED  619
            P SG L+K++ ++S RF                   S ++    ++D+ YVEITLD+R+D
Sbjct  19   PHSGTLSKKSTRRSLRFVEPVTAAAPLPAPPLGASPSSAANDDDDDDNDYVEITLDMRDD  78

Query  620  SVAV---HSVKTAAGADVEDPELA-LLARGLE---KKTTLGSSLVRNASSRIR--QVSQE  772
            SVAV   H V+ A     +DP +  ++AR LE   + ++ G SL RNASSR +  QVSQE
Sbjct  79   SVAVAVVHGVEPAHAGPGDDPNVTQVVARPLENHRRSSSYGHSLTRNASSRFKFKQVSQE  138

Query  773  LKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNG  952
            ++R+A      G P  R D + SAAA AL GL+FISK +G++GW AV+ RF +L  A NG
Sbjct  139  IRRVA------GGP--RTDLSTSAAAHALMGLRFISKAEGSAGWEAVKMRFRKL--AING  188

Query  953  LLPRAXFGECIGM  991
            LL R+ F ECIGM
Sbjct  189  LLHRSMFAECIGM  201



>ref|XP_004494602.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Cicer 
arietinum]
Length=891

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 118/209 (56%), Gaps = 46/209 (22%)
 Frame = +2

Query  392  HQHHHSDTEVM---VVGVDKRKSYSGPLSGPL--NKRTGKKSARFNLAggdssselgsps  556
            HQ   S+TE        V    S SGPLSGPL  NK++ KKSARF               
Sbjct  9    HQESWSETESTGSRSTRVGFSGSLSGPLSGPLVSNKKSSKKSARFK--------------  54

Query  557  sarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVR  736
                 + ++ +VEITLDVR+D+V+V +++        D E ALLA  LEK+ +       
Sbjct  55   -----DEEEDFVEITLDVRDDTVSVQNIRGG------DSETALLASRLEKRPS-------  96

Query  737  NASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGAS--GWAA  910
              S +++QVSQELKR     M +     R+DR KS AA+ALKGLKF+SKT G +  GW  
Sbjct  97   TLSVKLKQVSQELKR-----MTSSKKFDRVDRAKSGAARALKGLKFMSKTVGTAEQGWFQ  151

Query  911  VEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            VEKRFD+L  A +G LP+  F +CIGMN+
Sbjct  152  VEKRFDEL--AVDGKLPKTRFSQCIGMNE  178



>tpg|DAA42073.1| TPA: hypothetical protein ZEAMMB73_696625 [Zea mays]
Length=976

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 116/193 (60%), Gaps = 26/193 (13%)
 Frame = +2

Query  461  PLSGPLNKRTGKKSARF-------NLAggdssselgspssarsANNDDAYVEITLDVRED  619
            P SG L+K++ ++S RF                   S ++    ++D+ YVEITLD+R+D
Sbjct  35   PHSGTLSKKSTRRSLRFVEPVTAAAPLPAPPLGASPSSAANDDDDDDNDYVEITLDMRDD  94

Query  620  SVAV---HSVKTAAGADVEDPELA-LLARGLE---KKTTLGSSLVRNASSRIR--QVSQE  772
            SVAV   H V+ A     +DP +  ++AR LE   + ++ G SL RNASSR +  QVSQE
Sbjct  95   SVAVAVVHGVEPAHAGPGDDPNVTQVVARPLENHRRSSSYGHSLTRNASSRFKFKQVSQE  154

Query  773  LKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNG  952
            ++R+A      G P  R D + SAAA AL GL+FISK +G++GW AV+ RF +L  A NG
Sbjct  155  IRRVA------GGP--RTDLSTSAAAHALMGLRFISKAEGSAGWEAVKMRFRKL--AING  204

Query  953  LLPRAXFGECIGM  991
            LL R+ F ECIGM
Sbjct  205  LLHRSMFAECIGM  217



>ref|XP_007159934.1| hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris]
 gb|ESW31928.1| hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris]
Length=899

 Score =   115 bits (289),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 88/141 (62%), Gaps = 13/141 (9%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVEDPE---LALLARGLEKKTTLGSSLVRNASSRIR  757
            +VE+T+D+  DSVA+HSVK   G DV + E   L L  +  EKK +  +S+V++A+ R++
Sbjct  54   FVEVTMDIHGDSVALHSVKAFGGVDVVEEEGEKLGLTGKRFEKKKSFSASVVQSAAIRMK  113

Query  758  QVSQELKRIASMTMGAGHPAGR-IDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQL  934
            Q    LKR+ S +     PA +  +R KSA A AL GLKFIS TDG  GW   E RF + 
Sbjct  114  Q----LKRLTSFS----KPAPKHFERTKSAVAHALTGLKFISTTDGGEGWIKAEGRFKKF  165

Query  935  TAASNGLLPRAXFGECIGMNK  997
              A +G LPRA F EC+G+NK
Sbjct  166  VGA-DGYLPRARFAECLGLNK  185



>ref|XP_003626254.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES82472.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=702

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 118/220 (54%), Gaps = 46/220 (21%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEV---MVVGVDKRKSYSGPLSGPL----NKRTGKKSARFNLA  520
            M  S ++   HQ   S+TE        V    S SGPLSGPL     K++ KKSARF+  
Sbjct  1    MEISQERENHHQEIWSETESNGSRSTRVGFSGSLSGPLSGPLVSNNKKKSSKKSARFS--  58

Query  521  ggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL  700
                               D  YVEITLDVR+D+V+V +++        D E ALLA  L
Sbjct  59   ----------------DEVDQDYVEITLDVRDDTVSVQNIRGG------DSETALLASRL  96

Query  701  EKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS  880
            EK+ +         S +++QVSQELKR     M +     R+DR KS AA+ALKGLKF++
Sbjct  97   EKRPS-------TLSVKLKQVSQELKR-----MTSSKKFDRVDRAKSGAARALKGLKFMT  144

Query  881  KTDGAS-GWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            K  G   GW+ VEKRFD+L    +G LP+  F +CIGMN+
Sbjct  145  KNVGTDRGWSQVEKRFDELEV--DGKLPKTRFSQCIGMNE  182



>ref|XP_003536070.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Glycine 
max]
Length=888

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 113/214 (53%), Gaps = 55/214 (26%)
 Frame = +2

Query  398  HHHSDTEVMVVGVDKRK-SYSGPLSGPL-----------NKR--TGKKSARFNLAggdss  535
             H S +E    G   R+  +SGPLSGPL           NKR  +  KSARF        
Sbjct  7    QHESWSETESTGSRSRRVGFSGPLSGPLSGPLSGPLVSSNKRNSSKNKSARFK-------  59

Query  536  selgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTT  715
                         +D+  VEITLDVR+D+V+V +++        D E A LA  LE + +
Sbjct  60   -------------DDEEMVEITLDVRDDAVSVQNIRGG------DSETAFLASRLEMRPS  100

Query  716  LGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGA  895
                   + S R+RQVS+ELKR     M +     R+DR+KS AA+AL GLKF++K  G 
Sbjct  101  -------SFSDRLRQVSRELKR-----MTSNKAFDRVDRSKSGAARALGGLKFMTKA-GT  147

Query  896  SGWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
             GW+ VEKRFD+L  A +  LP+  F +CIGMN+
Sbjct  148  EGWSQVEKRFDEL--AIDAKLPKTRFSQCIGMNE  179



>ref|XP_003626253.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AAW78864.1| respiratory burst oxidase 2 [Medicago truncatula]
 gb|ABN08032.1| Calcium-binding EF-hand; Ferric reductase-like transmembrane 
component [Medicago truncatula]
 gb|AES82471.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=895

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 118/220 (54%), Gaps = 46/220 (21%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEV---MVVGVDKRKSYSGPLSGPL----NKRTGKKSARFNLA  520
            M  S ++   HQ   S+TE        V    S SGPLSGPL     K++ KKSARF+  
Sbjct  1    MEISQERENHHQEIWSETESNGSRSTRVGFSGSLSGPLSGPLVSNNKKKSSKKSARFS--  58

Query  521  ggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL  700
                               D  YVEITLDVR+D+V+V +++        D E ALLA  L
Sbjct  59   ----------------DEVDQDYVEITLDVRDDTVSVQNIRGG------DSETALLASRL  96

Query  701  EKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS  880
            EK+ +         S +++QVSQELKR     M +     R+DR KS AA+ALKGLKF++
Sbjct  97   EKRPS-------TLSVKLKQVSQELKR-----MTSSKKFDRVDRAKSGAARALKGLKFMT  144

Query  881  KTDGAS-GWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            K  G   GW+ VEKRFD+L    +G LP+  F +CIGMN+
Sbjct  145  KNVGTDRGWSQVEKRFDELEV--DGKLPKTRFSQCIGMNE  182



>ref|XP_003626255.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES82473.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=864

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 118/220 (54%), Gaps = 46/220 (21%)
 Frame = +2

Query  362  MSSSDQQSFRHQHHHSDTEV---MVVGVDKRKSYSGPLSGPL----NKRTGKKSARFNLA  520
            M  S ++   HQ   S+TE        V    S SGPLSGPL     K++ KKSARF+  
Sbjct  1    MEISQERENHHQEIWSETESNGSRSTRVGFSGSLSGPLSGPLVSNNKKKSSKKSARFS--  58

Query  521  ggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGL  700
                               D  YVEITLDVR+D+V+V +++        D E ALLA  L
Sbjct  59   ----------------DEVDQDYVEITLDVRDDTVSVQNIRGG------DSETALLASRL  96

Query  701  EKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFIS  880
            EK+ +         S +++QVSQELKR     M +     R+DR KS AA+ALKGLKF++
Sbjct  97   EKRPS-------TLSVKLKQVSQELKR-----MTSSKKFDRVDRAKSGAARALKGLKFMT  144

Query  881  KTDGAS-GWAAVEKRFDQLTAASNGLLPRAXFGECIGMNK  997
            K  G   GW+ VEKRFD+L    +G LP+  F +CIGMN+
Sbjct  145  KNVGTDRGWSQVEKRFDELEV--DGKLPKTRFSQCIGMNE  182



>ref|XP_003556516.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Glycine 
max]
Length=889

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 105/186 (56%), Gaps = 46/186 (25%)
 Frame = +2

Query  455  SGPLSGPL---NKR--TGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVRED  619
            SGPLSGPL   NKR  +  KSARF                     +D+  VEITLDVR+D
Sbjct  35   SGPLSGPLVSSNKRNSSKNKSARFK--------------------DDEEMVEITLDVRDD  74

Query  620  SVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTM  799
            +V+V +++        D E A LA  LE + +       + S R+RQVS+ELKR     M
Sbjct  75   AVSVQNIRGG------DSETAFLASRLEMRPS-------SFSDRLRQVSRELKR-----M  116

Query  800  GAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGE  979
             +     R+DR+KS AA+AL+GLKF++K  G  GW+ VEKRFD+L  A +  LP+  F +
Sbjct  117  TSNKAFDRVDRSKSGAARALRGLKFMTKA-GTEGWSQVEKRFDEL--AIDAKLPKTRFSQ  173

Query  980  CIGMNK  997
            CIGM +
Sbjct  174  CIGMTE  179



>ref|XP_003591142.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES61393.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=885

 Score =   113 bits (283),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 110/203 (54%), Gaps = 56/203 (28%)
 Frame = +2

Query  437  DKRKSYSGP-----------LSGPL-----NKRTGKKSARFNLAggdssselgspssars  568
            +K +S+S P           LSGPL       R+  KSA F                   
Sbjct  7    NKHESWSEPESTGSRSSGVGLSGPLASKKQRNRSKNKSASFK------------------  48

Query  569  ANNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASS  748
              +D   VEITL+VR+DSV+V +++        D E A LA  LEK+    SSL    S+
Sbjct  49   --DDGEMVEITLNVRDDSVSVQNIRGG------DTETAFLASQLEKRP---SSL----SA  93

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            ++RQVSQELKR+ S          ++DR+KS AA+AL+GLKF++K  G+ GW+ VEKRFD
Sbjct  94   KLRQVSQELKRMTSFK-----AFDKVDRSKSGAARALQGLKFMTKNVGSEGWSQVEKRFD  148

Query  929  QLTAASNGLLPRAXFGECIGMNK  997
            +L  A  G LP+  F +CIGMN+
Sbjct  149  EL--AVEGKLPKTRFSQCIGMNE  169



>ref|XP_006399223.1| hypothetical protein EUTSA_v10012617mg [Eutrema salsugineum]
 gb|ESQ40676.1| hypothetical protein EUTSA_v10012617mg [Eutrema salsugineum]
Length=907

 Score =   113 bits (283),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 93/148 (63%), Gaps = 16/148 (11%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTA----AGADVEDPELALLARGLEKKTTLGSSLVRNAS  745
            +  YVEITLD+ EDSV+V+ +K+     AG+  EDP  +LL  G   K+   S L R AS
Sbjct  42   NQPYVEITLDIHEDSVSVYGLKSPDHNGAGSKYEDPGKSLLRPGRSGKS--NSVLKRIAS  99

Query  746  SRIRQVSQELKRIASMTMGAGH------PAGRIDRNKSAAAQALKGLKFISKTDGASGWA  907
            S    VS ELKR+AS    +        P  R  R+KS A  ALKGLKFI+KTDG +GW 
Sbjct  100  S----VSTELKRVASSVSSSSARKPPRPPLVRFRRSKSRAELALKGLKFITKTDGVAGWP  155

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGM  991
             VEKRF ++T +SNGLL R+ FGECIGM
Sbjct  156  GVEKRFHEITESSNGLLHRSRFGECIGM  183



>ref|XP_010452698.1| PREDICTED: respiratory burst oxidase homolog protein A [Camelina 
sativa]
Length=891

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 93/144 (65%), Gaps = 17/144 (12%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTA----AGADVEDPELALLARGLEKKTTLGSSLVRNAS  745
            D  YVEITLD+ +DSV+V+ +K+     AG+D      +LL  G   K+   S L R AS
Sbjct  38   DQPYVEITLDIHDDSVSVYGLKSPDHRGAGSDQ-----SLLRPGRSSKS--NSVLKRIAS  90

Query  746  SRIRQVSQELKRIAS-MTMGAGHPA-GRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            S    VS ELKR+AS ++     P   ++ R+KS A  ALKGLKFI+KTDG +GW  VEK
Sbjct  91   S----VSSELKRVASSVSRKPPRPQEAKLRRSKSRAELALKGLKFITKTDGVTGWFEVEK  146

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            +F+++T  SNGLL R+ FGECIGM
Sbjct  147  QFNEITKTSNGLLHRSKFGECIGM  170



>ref|XP_010423214.1| PREDICTED: respiratory burst oxidase homolog protein A-like isoform 
X1 [Camelina sativa]
 ref|XP_010423215.1| PREDICTED: respiratory burst oxidase homolog protein A-like isoform 
X2 [Camelina sativa]
 ref|XP_010423216.1| PREDICTED: respiratory burst oxidase homolog protein A-like isoform 
X3 [Camelina sativa]
Length=891

 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 92/145 (63%), Gaps = 18/145 (12%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTA----AGADVEDPELALLARGLEKKTTLGSSLVRNAS  745
            D  YVEITLD+ +DSV+V+ +K+     AG+D      +LL  G   +++  S L R AS
Sbjct  37   DQPYVEITLDIHDDSVSVYGLKSPDHRGAGSDQ-----SLLRPGRSSRSS--SVLKRIAS  89

Query  746  SRIRQVSQELKRIASMTMGAGHP---AGRIDRNKSAAAQALKGLKFISKTDGASGWAAVE  916
            S    VS ELKR+AS       P     R+ R+KS A  ALKGLKFI+KTDG +GW  VE
Sbjct  90   S----VSSELKRVASSVSSRKPPRPQQARLRRSKSRAELALKGLKFITKTDGVTGWFEVE  145

Query  917  KRFDQLTAASNGLLPRAXFGECIGM  991
            K+F+++T  SNGLL R+ FGECIGM
Sbjct  146  KQFNEITKTSNGLLHRSKFGECIGM  170



>gb|EMT26659.1| hypothetical protein F775_52502 [Aegilops tauschii]
Length=1176

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 91/140 (65%), Gaps = 13/140 (9%)
 Frame = +2

Query  590  VEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQ  769
            VEITLDV +DSV V SVK  AG   ED  + L  R     ++ G  ++RNAS+R++QVSQ
Sbjct  57   VEITLDVLDDSVVVRSVKPVAGG--EDSAVTLEKRS----SSHGRGVLRNASARVKQVSQ  110

Query  770  ELKRIASMTMGAGHPAGRIDR--NKSAAAQALKGLKFISKTDGASGWAA--VEKRFDQLT  937
             L+RIAS  +  G P+ RIDR  +K  A  AL+GLKFIS T+G++ W A   E+ FD+  
Sbjct  111  GLRRIASFNLRGGGPS-RIDRSNSKPVATHALEGLKFISGTNGSAEWTAADAERVFDR--  167

Query  938  AASNGLLPRAXFGECIGMNK  997
             A NG L R+ FGECIGM +
Sbjct  168  KAKNGRLSRSKFGECIGMKE  187



>ref|XP_010491345.1| PREDICTED: respiratory burst oxidase homolog protein A-like [Camelina 
sativa]
Length=891

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 17/144 (12%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKT----AAGADVEDPELALLARGLEKKTTLGSSLVRNAS  745
            D  YVEITLD+ +DSV+V+ +K+     AG+D      +LL  G   ++   S L R AS
Sbjct  38   DQPYVEITLDIHDDSVSVYGLKSPDHRVAGSDQ-----SLLRPGRSSRS--NSVLKRIAS  90

Query  746  SRIRQVSQELKRIAS-MTMGAGHPA-GRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            S    VS ELKR+AS ++     P   ++ R+KS A  ALKGLKFI+KTDG +GW  VEK
Sbjct  91   S----VSSELKRVASSVSRKPPRPQKAKLRRSKSRAELALKGLKFITKTDGVTGWFEVEK  146

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            +F+++T  S+GLL R+ FGECIGM
Sbjct  147  QFNEITKTSSGLLHRSKFGECIGM  170



>emb|CBI39505.3| unnamed protein product [Vitis vinifera]
Length=873

 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 91/171 (53%), Gaps = 56/171 (33%)
 Frame = +2

Query  479  NKRTGKKSARFNLAggdssselgspssarsANNDDAYVEITLDVREDSVAVHSVKTAAGA  658
            NK+  KKSARF                       + YVEITLDVR+DSV+          
Sbjct  43   NKKGSKKSARFK---------------------SEEYVEITLDVRDDSVS----------  71

Query  659  DVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNK  838
                            + +LGS L    S RIRQVSQELKRI S    +     + DR+K
Sbjct  72   ----------------RPSLGSQL----SFRIRQVSQELKRITS---SSSKRFNKDDRSK  108

Query  839  SAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
            S+A +ALKGL+F++K  G  GW+A+EKRFDQL+   NG LP++ FG+CIGM
Sbjct  109  SSATRALKGLQFMTKNVGNEGWSAIEKRFDQLSV--NGALPKSSFGQCIGM  157



>emb|CDP15485.1| unnamed protein product [Coffea canephora]
Length=879

 Score =   107 bits (268),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 93/142 (65%), Gaps = 17/142 (12%)
 Frame = +2

Query  575  NDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKK-TTLGSSLVRNASSR  751
            ++D+YVEITLDVR+D++++ +++        D +   LA  LEK+ ++ GS L    S  
Sbjct  41   DEDSYVEITLDVRDDAISLQNIRGTT-----DQKATSLASQLEKRNSSFGSQL----SFN  91

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQ  931
            +R VSQEL+RI S          ++DR KS AA+AL+GL+FI+K     GW+ VE RF +
Sbjct  92   LRNVSQELRRITS-----SKSFNKVDRTKSGAARALRGLQFINKNVRNEGWSEVESRFHE  146

Query  932  LTAASNGLLPRAXFGECIGMNK  997
            L  A+NG+LP++ FG+CIGM++
Sbjct  147  L--AANGMLPKSQFGKCIGMHE  166



>ref|XP_007144946.1| hypothetical protein PHAVU_007G196800g [Phaseolus vulgaris]
 gb|ESW16940.1| hypothetical protein PHAVU_007G196800g [Phaseolus vulgaris]
Length=890

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 103/187 (55%), Gaps = 46/187 (25%)
 Frame = +2

Query  455  SGPLSGPL---NKRTG--KKSARFNLAggdssselgspssarsANNDDAYVEITLDVRED  619
            SGP SGPL   +KR G   KSARF                     +D+  VEITLDVR+D
Sbjct  31   SGPFSGPLLTSHKRNGSKNKSARFK--------------------DDEEMVEITLDVRDD  70

Query  620  SVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTM  799
            +V+V +++        D E A LA  LE + +       + S R+RQVS+ELKR     M
Sbjct  71   AVSVQNIRGG------DSETAFLASRLEMRPS-------SFSGRLRQVSRELKR-----M  112

Query  800  GAGHPAGRIDRNKSAAAQALKGLKFISKT-DGASGWAAVEKRFDQLTAASNGLLPRAXFG  976
             +     ++DR+KS AA+AL+GL+F++K   G  GW+ VEKRFD+   A +  LP+  F 
Sbjct  113  TSNKTFDKVDRSKSGAARALRGLEFMTKNAAGPEGWSLVEKRFDEF--AIDAKLPKTRFS  170

Query  977  ECIGMNK  997
            +CIGM +
Sbjct  171  QCIGMTE  177



>ref|XP_002873307.1| respiratory burst oxidase protein A [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49566.1| respiratory burst oxidase protein A [Arabidopsis lyrata subsp. 
lyrata]
Length=897

 Score =   107 bits (267),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 93/148 (63%), Gaps = 18/148 (12%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTA----AGADVEDPELALLARGLEKKTTLGSSLVRNAS  745
            D+ YVEITLD+ EDSV+V+ +K+     AG+  ED   +LL +G   ++   S L R AS
Sbjct  37   DEPYVEITLDIHEDSVSVYGMKSPDHRGAGSIYEDQ--SLLRQGRSGRS--NSVLKRLAS  92

Query  746  SRIRQVSQELKRIASMTMGAGHPA------GRIDRNKSAAAQALKGLKFISKTDGASGWA  907
            S    VS ELKR+AS    +           R+ R+KS A QALKGLKFI+KTDG +GW 
Sbjct  93   S----VSTELKRVASSVSSSSARKPPRPQIARLRRSKSRAEQALKGLKFITKTDGVTGWP  148

Query  908  AVEKRFDQLTAASNGLLPRAXFGECIGM  991
             VEKRF  +T  +NGLL R+ FGECIGM
Sbjct  149  EVEKRFYVITMTTNGLLHRSKFGECIGM  176



>gb|EEC69442.1| hypothetical protein OsI_38619 [Oryza sativa Indica Group]
Length=866

 Score =   107 bits (266),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 97/153 (63%), Gaps = 21/153 (14%)
 Frame = +2

Query  578  DDAYVEITLDVR-EDSVAVHSVKTAAGADVEDPELALLARGL-EKKTTLGSSLVRNASSR  751
            D+ YVEITLDV+ +D+VA+ S++   GAD+  PE+ALLARGL ++     +      SSR
Sbjct  39   DNEYVEITLDVKGDDTVAIQSIRN--GADM--PEVALLARGLAQQPPPSAAPGPGGLSSR  94

Query  752  IRQVSQELKRIASMTMGAGHPAG-------------RIDRNKSAAAQALKGLKFISKTDG  892
            ++ V  EL+RIAS    +G  +G             R+DR+ + AA+AL+GL+F++ +  
Sbjct  95   LKAVRTELRRIASWKFPSGVLSGGGDAPGNGNDRRPRLDRSMTGAARALRGLQFLNSSAV  154

Query  893  ASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
             +GW  VEKRF++L  A +G L R+ FG+CIGM
Sbjct  155  TNGWPEVEKRFERL--AVDGFLLRSRFGQCIGM  185



>ref|XP_004495711.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Cicer 
arietinum]
Length=879

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 22/144 (15%)
 Frame = +2

Query  572  NNDDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSR  751
            ++D   VEITLDVR+DSV+V +++        D E   LA  LEKK T       + S+R
Sbjct  42   DDDGEMVEITLDVRDDSVSVQNIRGG------DSETVFLASRLEKKPT-------SLSAR  88

Query  752  IRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGA--SGWAAVEKRF  925
            +RQVS ELKR+ S          ++DR+KS AA+AL+G KF++KT G    GW+ VE RF
Sbjct  89   LRQVSMELKRMTSFKT-----FDKVDRSKSGAARALQGFKFMTKTVGTDHEGWSQVENRF  143

Query  926  DQLTAASNGLLPRAXFGECIGMNK  997
             QL  A +G LP+  F  CIGMN+
Sbjct  144  HQL--ALDGKLPKTRFSHCIGMNE  165



>ref|XP_010549734.1| PREDICTED: respiratory burst oxidase homolog protein B [Tarenaya 
hassleriana]
Length=899

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 108/192 (56%), Gaps = 40/192 (21%)
 Frame = +2

Query  440  KRKSY--SGPLSGPLNKR--TGKKSARFNLAggdssselgspssarsANNDDAYVEITLD  607
            K  SY  SGPLSGPL+++  TGKK+ARFN+ G  +S+          + + D YVEITLD
Sbjct  24   KTPSYYGSGPLSGPLSRKPVTGKKTARFNVTGSTTSNA---------SGSADEYVEITLD  74

Query  608  VREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQELKRIA  787
            +R+D+V +H++       V++  L+          ++GS L    S R+R + +     +
Sbjct  75   IRDDAVLMHNMD----GTVQEKRLS----------SIGSVLSGRISGRLRTMVKSSSFSS  120

Query  788  SMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTD----GASGWAAVEKRFDQLTAASNGL  955
                       R+DR+KS AA A+KGLKFI+K D    G  GW  V+KRF +L  A  G 
Sbjct  121  RR-------FDRLDRSKSGAAFAMKGLKFITKNDAVGNGCGGWEEVDKRFGEL--AVEGK  171

Query  956  LPRAXFGECIGM  991
            LP++ FG+CIG+
Sbjct  172  LPKSKFGQCIGI  183



>gb|ABA99454.2| respiratory burst oxidase, putative, expressed [Oryza sativa 
Japonica Group]
Length=892

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 97/156 (62%), Gaps = 24/156 (15%)
 Frame = +2

Query  578  DDAYVEITLDVR-EDSVAVHSVKTAAGADVEDPELALLARGL-EKKTTLGSSLVRNASSR  751
            D+ YVEITLDV+ +D+VA+ S++   GAD+  PE+ALLARGL ++     +      SSR
Sbjct  39   DNEYVEITLDVKGDDTVAIQSIRN--GADM--PEVALLARGLAQQPPPSAAPGPGGLSSR  94

Query  752  IRQVSQELKRIASMTMGAGHPAG----------------RIDRNKSAAAQALKGLKFISK  883
            ++ V  EL+RIAS    +G  +G                R+DR+ + AA+AL+GL+F++ 
Sbjct  95   LKAVRTELRRIASWKFPSGVLSGGGGGGDAPGNGNDRRPRLDRSMTGAARALRGLQFLNS  154

Query  884  TDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
            +   +GW  VEKRF++L  A +G L R+ FG+CIGM
Sbjct  155  SAVTNGWPEVEKRFERL--AVDGFLLRSRFGQCIGM  188



>gb|ABA99453.1| respiratory burst oxidase, putative, expressed [Oryza sativa 
Japonica Group]
Length=909

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 97/156 (62%), Gaps = 24/156 (15%)
 Frame = +2

Query  578  DDAYVEITLDVR-EDSVAVHSVKTAAGADVEDPELALLARGL-EKKTTLGSSLVRNASSR  751
            D+ YVEITLDV+ +D+VA+ S++   GAD+  PE+ALLARGL ++     +      SSR
Sbjct  39   DNEYVEITLDVKGDDTVAIQSIRN--GADM--PEVALLARGLAQQPPPSAAPGPGGLSSR  94

Query  752  IRQVSQELKRIASMTMGAGHPAG----------------RIDRNKSAAAQALKGLKFISK  883
            ++ V  EL+RIAS    +G  +G                R+DR+ + AA+AL+GL+F++ 
Sbjct  95   LKAVRTELRRIASWKFPSGVLSGGGGGGDAPGNGNDRRPRLDRSMTGAARALRGLQFLNS  154

Query  884  TDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
            +   +GW  VEKRF++L  A +G L R+ FG+CIGM
Sbjct  155  SAVTNGWPEVEKRFERL--AVDGFLLRSRFGQCIGM  188



>ref|XP_010445141.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G [Camelina sativa]
Length=488

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            +++ +LKR+ S   G   P G +DR+KS A +ALKGLKFISKTDG +GW+AVEKRF ++T
Sbjct  71   KLTNKLKRLKSSVFGESKPTG-LDRSKSTAGRALKGLKFISKTDGDAGWSAVEKRFLKIT  129

Query  938  AASNGLLPRAXFGECIGMN  994
            A + GLL R+ FGECIGMN
Sbjct  130  ATTGGLLLRSKFGECIGMN  148



>gb|EAZ20766.1| hypothetical protein OsJ_36390 [Oryza sativa Japonica Group]
Length=893

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 97/156 (62%), Gaps = 24/156 (15%)
 Frame = +2

Query  578  DDAYVEITLDVR-EDSVAVHSVKTAAGADVEDPELALLARGL-EKKTTLGSSLVRNASSR  751
            D+ YVEITLDV+ +D+VA+ S++   GAD+  PE+ALLARGL ++     +      SSR
Sbjct  39   DNEYVEITLDVKGDDTVAIQSIRN--GADM--PEVALLARGLAQQPPPSAAPGPGGLSSR  94

Query  752  IRQVSQELKRIASMTMGAGHPAG----------------RIDRNKSAAAQALKGLKFISK  883
            ++ V  EL+RIAS    +G  +G                R+DR+ + AA+AL+GL+F++ 
Sbjct  95   LKAVRTELRRIASWKFPSGVLSGGGGGGDAPGNGNDRRPRLDRSMTGAARALRGLQFLNS  154

Query  884  TDGASGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
            +   +GW  VEKRF++L  A +G L R+ FG+CIGM
Sbjct  155  SAVTNGWPEVEKRFERL--AVDGFLLRSRFGQCIGM  188



>emb|CDX98976.1| BnaC09g48590D [Brassica napus]
Length=908

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 89/146 (61%), Gaps = 16/146 (11%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIR  757
            D  YVEI+LD+ +D V+V+S+K+    D      +LL +G   K+   S L R ASS   
Sbjct  48   DQPYVEISLDIHDDYVSVYSLKSP---DHIGGTGSLLRQGRPGKS--NSVLKRVASS---  99

Query  758  QVSQELKRIASMTMGAGH-------PAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVE  916
              S ELKR+AS ++ +         P  +  R+KS A QALKGLKFI+KTDG +GW  VE
Sbjct  100  -FSTELKRVASSSVSSSSARKPPRPPLAKFRRSKSRAEQALKGLKFITKTDGVAGWPGVE  158

Query  917  KRFDQLTAASNGLLPRAXFGECIGMN  994
            KRF  +T  + GLL R+ FGECIG+N
Sbjct  159  KRFHDITENTYGLLHRSKFGECIGIN  184



>ref|NP_001190250.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
 gb|AED91152.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
Length=840

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 10/144 (7%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTA----AGADVEDPELALLARGLEKKTTLGSSLVRNAS  745
            D+ YVEITLD+ +DSV+V+ +K+     AG++ ED   +LL +G   ++   S L R AS
Sbjct  42   DEPYVEITLDIHDDSVSVYGLKSPNHRGAGSNYEDQ--SLLRQGRSGRS--NSVLKRLAS  97

Query  746  SRIRQVSQELKRIASMTMG-AGHPA-GRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            S    +++    ++S +      P   ++ R+KS A  ALKGLKFI+KTDG +GW  VEK
Sbjct  98   SVSTGITRVASSVSSSSARKPPRPQLAKLRRSKSRAELALKGLKFITKTDGVTGWPEVEK  157

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            RF  +T  +NGLL R+ FGECIGM
Sbjct  158  RFYVMTMTTNGLLHRSRFGECIGM  181



>ref|NP_196356.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
 sp|O81209.2|RBOHA_ARATH RecName: Full=Respiratory burst oxidase homolog protein A; AltName: 
Full=NADPH oxidase RBOHA; Short=AtRBOHA [Arabidopsis 
thaliana]
 emb|CAB87928.1| respiratory burst oxidase protein A [Arabidopsis thaliana]
 gb|AAO41907.1| putative respiratory burst oxidase protein A [Arabidopsis thaliana]
 gb|AED91151.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
Length=902

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 10/144 (7%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTA----AGADVEDPELALLARGLEKKTTLGSSLVRNAS  745
            D+ YVEITLD+ +DSV+V+ +K+     AG++ ED   +LL +G   ++   S L R AS
Sbjct  42   DEPYVEITLDIHDDSVSVYGLKSPNHRGAGSNYEDQ--SLLRQGRSGRS--NSVLKRLAS  97

Query  746  SRIRQVSQELKRIASMTMG-AGHPA-GRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            S    +++    ++S +      P   ++ R+KS A  ALKGLKFI+KTDG +GW  VEK
Sbjct  98   SVSTGITRVASSVSSSSARKPPRPQLAKLRRSKSRAELALKGLKFITKTDGVTGWPEVEK  157

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            RF  +T  +NGLL R+ FGECIGM
Sbjct  158  RFYVMTMTTNGLLHRSRFGECIGM  181



>ref|XP_009122345.1| PREDICTED: respiratory burst oxidase homolog protein A [Brassica 
rapa]
Length=902

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 89/146 (61%), Gaps = 16/146 (11%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIR  757
            D  YVEI+LD+ +D V+V+ +K+    D      +LL +G   K+   S L R ASS   
Sbjct  42   DQPYVEISLDIHDDYVSVYGLKSP---DHIGGTGSLLRQGRPGKS--NSVLKRVASS---  93

Query  758  QVSQELKRIASMTMGAGH-------PAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVE  916
              S ELKR+AS ++ +         P  +  R+KS A QALKGLKFI+KTDG +GW  VE
Sbjct  94   -FSTELKRVASSSVSSSSARKPPRPPLAKFRRSKSRAEQALKGLKFITKTDGVAGWPGVE  152

Query  917  KRFDQLTAASNGLLPRAXFGECIGMN  994
            KRF ++T  + GLL R+ FGECIG+N
Sbjct  153  KRFHEITENTYGLLHRSRFGECIGIN  178



>emb|CDX70035.1| BnaA10g23840D [Brassica napus]
Length=886

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 89/146 (61%), Gaps = 16/146 (11%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIR  757
            D  YVEI+LD+ +D V+V+ +K+    D      +LL +G   K+   S L R ASS   
Sbjct  42   DQPYVEISLDIHDDYVSVYGLKSP---DHIGGTGSLLRQGRPGKS--NSVLKRVASS---  93

Query  758  QVSQELKRIASMTMGAGH-------PAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVE  916
              S ELKR+AS ++ +         P  +  R+KS A QALKGLKFI+KTDG +GW  VE
Sbjct  94   -FSTELKRVASSSVSSSSARKPPRPPLAKFRRSKSRAEQALKGLKFITKTDGVAGWPGVE  152

Query  917  KRFDQLTAASNGLLPRAXFGECIGMN  994
            KRF ++T  + GLL R+ FGECIG+N
Sbjct  153  KRFHEITENTYGLLHRSRFGECIGIN  178



>gb|AAC39475.1| respiratory burst oxidase protein A [Arabidopsis thaliana]
Length=902

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 10/144 (7%)
 Frame = +2

Query  578  DDAYVEITLDVREDSVAVHSVKTA----AGADVEDPELALLARGLEKKTTLGSSLVRNAS  745
            D+ YVEITLD+ +DSV+V+ +K+     AG++ ED   +LL +G   ++   S L R AS
Sbjct  42   DEPYVEITLDIHDDSVSVYGLKSPNHRGAGSNYEDQ--SLLRQGRSGRS--NSVLKRLAS  97

Query  746  SRIRQVSQELKRIASMTMG-AGHPA-GRIDRNKSAAAQALKGLKFISKTDGASGWAAVEK  919
            S    +++    ++S +      P   ++ R+KS A  ALKGLKFI+KTDG +GW  VEK
Sbjct  98   SVSTGITRVASSVSSSSARKPPRPQLAKLRRSKSRAELALKGLKFITKTDGVTGWPEVEK  157

Query  920  RFDQLTAASNGLLPRAXFGECIGM  991
            RF  +T  +NGLL R+ FGECIGM
Sbjct  158  RFYVMTMTNNGLLHRSRFGECIGM  181



>ref|XP_010448480.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G [Camelina sativa]
Length=858

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            +++ +LKR+ S   G   P G +DR+KS A +ALKGLKFISKTDG +GW+AVEKRF ++T
Sbjct  71   KLTNKLKRLKSSVFGESKPTG-LDRSKSTAGRALKGLKFISKTDGDAGWSAVEKRFLKIT  129

Query  938  AASNGLLPRAXFGECIGMN  994
            A + GLL R+ FGECIGMN
Sbjct  130  ATTGGLLLRSKFGECIGMN  148



>ref|XP_006285093.1| hypothetical protein CARUB_v10006425mg [Capsella rubella]
 gb|EOA17991.1| hypothetical protein CARUB_v10006425mg [Capsella rubella]
Length=864

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +2

Query  761  VSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTA  940
            VS +LKR+     G   P G +DR+KS A +ALKGLKFISKTDG +GW+AVEKRF ++TA
Sbjct  78   VSNKLKRLKPSVFGESKPTG-LDRSKSTAGRALKGLKFISKTDGDAGWSAVEKRFLKITA  136

Query  941  ASNGLLPRAXFGECIGMN  994
             + GLL R+ FGECIGMN
Sbjct  137  TTGGLLLRSKFGECIGMN  154



>ref|XP_010433689.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G isoform X1 [Camelina sativa]
Length=851

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            +++ +LKR+ S   G   P G +DR+KS A +ALKGLKFISKTDG +GW+AVEKRF ++T
Sbjct  64   KLTNKLKRLKSSVFGESKPTG-LDRSKSTAGRALKGLKFISKTDGDAGWSAVEKRFLKIT  122

Query  938  AASNGLLPRAXFGECIGMN  994
            A + GLL R+ FGECIGMN
Sbjct  123  ATTGGLLLRSKFGECIGMN  141



>ref|XP_010433690.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G isoform X2 [Camelina sativa]
Length=841

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            +++ +LKR+ S   G   P G +DR+KS A +ALKGLKFISKTDG +GW+AVEKRF ++T
Sbjct  64   KLTNKLKRLKSSVFGESKPTG-LDRSKSTAGRALKGLKFISKTDGDAGWSAVEKRFLKIT  122

Query  938  AASNGLLPRAXFGECIGMN  994
            A + GLL R+ FGECIGMN
Sbjct  123  ATTGGLLLRSKFGECIGMN  141



>ref|XP_009137496.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G [Brassica rapa]
Length=829

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 7/92 (8%)
 Frame = +2

Query  716  LGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGA  895
            +GSS+  N  +R   +  E+KR A      G PA R+DR+KS   QAL+GLKFISK DGA
Sbjct  29   VGSSVRENPETRQNGLMNEIKRFA------GKPA-RLDRSKSTTGQALRGLKFISKADGA  81

Query  896  SGWAAVEKRFDQLTAASNGLLPRAXFGECIGM  991
             GW AVE+RF+ +T  + GLL R+ FGECIGM
Sbjct  82   DGWTAVEERFETITKTTEGLLIRSKFGECIGM  113



>ref|XP_006283129.1| hypothetical protein CARUB_v10004156mg [Capsella rubella]
 gb|EOA16027.1| hypothetical protein CARUB_v10004156mg [Capsella rubella]
Length=813

 Score = 94.7 bits (234),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 7/82 (9%)
 Frame = +2

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            R+  VS +LKR+ S   G       +DR+KS A QALKGLKFI KTD  +GW A+EKRFD
Sbjct  28   RLASVSNQLKRLTSKPRG-------LDRSKSTAGQALKGLKFICKTDCGAGWTALEKRFD  80

Query  929  QLTAASNGLLPRAXFGECIGMN  994
            ++TA + GLL ++ FGECIGMN
Sbjct  81   KITATTGGLLHKSKFGECIGMN  102



>ref|XP_006413344.1| hypothetical protein EUTSA_v10024426mg [Eutrema salsugineum]
 gb|ESQ54797.1| hypothetical protein EUTSA_v10024426mg [Eutrema salsugineum]
Length=818

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = +2

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            R+  VS +LKR+ S++  A     R+DR+KS A QALKGLKFISK D  +GW AVEKRF 
Sbjct  29   RLASVSNQLKRMTSVSKPA-----RLDRSKSTAGQALKGLKFISKADRGAGWTAVEKRFA  83

Query  929  QLTAASNGLLPRAXFGECIGMN  994
            ++T  + GLL R+ FGECIGMN
Sbjct  84   KITKTTEGLLLRSKFGECIGMN  105



>dbj|BAJ99162.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=929

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 81/135 (60%), Gaps = 15/135 (11%)
 Frame = +2

Query  596  ITLDVREDSVAVHSVKTAAGADVEDPELALLARGLEKKTTLGSSLVRNASSRIRQVSQEL  775
            ITLD+R+ + AVH V+  A    E+ ++ LLA      ++ G   ++NA +RI QV QEL
Sbjct  58   ITLDMRDGTKAVHRVRPVARG--EESDVKLLA------SSSGHGALKNARTRIEQVRQEL  109

Query  776  KRIASMTMGAGHPAGRIDRN-KSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNG  952
            +R AS++   G      DR+  SA A AL+GL+FIS TD + GWA  E  F     A NG
Sbjct  110  RRAASISRRGGG----FDRSMPSAPAHALEGLRFISGTDASEGWAKAEWFFKN--NAENG  163

Query  953  LLPRAXFGECIGMNK  997
             LPR+ FGECIGM +
Sbjct  164  RLPRSKFGECIGMKE  178



>gb|AEX56131.1| NADPH oxidase [Phaseolus vulgaris]
Length=876

 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 73/140 (52%), Gaps = 34/140 (24%)
 Frame = +2

Query  587  YVEITLDVREDSVAVHSVKTAAGADVEDPE---LALLARGLEKKTTLGSSLVRNASSRIR  757
            +VE+T+D+  DSVA+HSVK   G DV + E   L L  +  EKK +  +S+V++A+ R++
Sbjct  54   FVEVTMDIHGDSVALHSVKAFGGVDVVEEEGEKLGLTGKRFEKKKSFSASVVQSAAIRMK  113

Query  758  QVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLT  937
            Q+                               L GLKFIS TDG  GW   E RF +  
Sbjct  114  QLK------------------------------LTGLKFISTTDGGEGWIKAEGRFKKFV  143

Query  938  AASNGLLPRAXFGECIGMNK  997
             A +G LPRA F EC+G+NK
Sbjct  144  GA-DGYLPRARFAECLGLNK  162



>emb|CDX81049.1| BnaC03g03030D [Brassica napus]
Length=857

 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 19/136 (14%)
 Frame = +2

Query  590  VEITLDVREDSVAVHSVKTAAGADVEDPELALL--ARGLEKKTTLGSSLVRNASSRIRQV  763
            VEITLD++EDS++V++ K +     EDP  + L  +R ++K + L           +  V
Sbjct  29   VEITLDIKEDSISVYNSKPSKD---EDPGKSRLGQSRSMKKISVL---------KHLESV  76

Query  764  SQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAA  943
            S EL+R+ S       P     +    A  ALKGLKFI+K DG +GW  VEK F +LT  
Sbjct  77   SNELRRLTSSV-----PLTSETKPPRRAELALKGLKFITKADGVAGWPGVEKEFARLTEK  131

Query  944  SNGLLPRAXFGECIGM  991
            + GLLPR+ FGECIG+
Sbjct  132  TGGLLPRSNFGECIGI  147



>emb|CDX92675.1| BnaC07g39330D [Brassica napus]
Length=386

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  803  AGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFDQLTAASNGLLPRAXFGEC  982
            AG PA R+DR+KS   QAL GLKFISK DGA GW AVEKRF+++T  + GLL R+ FGEC
Sbjct  31   AGKPA-RLDRSKSTTGQALSGLKFISKADGADGWTAVEKRFEKITKTTEGLLIRSKFGEC  89

Query  983  IGM  991
            IGM
Sbjct  90   IGM  92



>ref|XP_006413343.1| hypothetical protein EUTSA_v10024427mg [Eutrema salsugineum]
 gb|ESQ54796.1| hypothetical protein EUTSA_v10024427mg [Eutrema salsugineum]
Length=818

 Score = 91.7 bits (226),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 5/82 (6%)
 Frame = +2

Query  749  RIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQALKGLKFISKTDGASGWAAVEKRFD  928
            R+  VS +LKR+ S++  A     R+DR+KS A QAL GLKFISK D  +GW AVEKRF 
Sbjct  29   RLASVSNQLKRMTSVSKPA-----RLDRSKSTAGQALNGLKFISKADRGAGWTAVEKRFA  83

Query  929  QLTAASNGLLPRAXFGECIGMN  994
            ++T  + GLL R  FGECIGMN
Sbjct  84   KITKTNEGLLLRCNFGECIGMN  105



>gb|EYU24552.1| hypothetical protein MIMGU_mgv1a001077mg [Erythranthe guttata]
Length=894

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 10/103 (10%)
 Frame = +2

Query  695  GLEKKTTLGSSLVRNASSRIRQVSQELKRIASMTMGAGHPAGRIDRNKSAAAQ-ALKGLK  871
            G +K ++  SSL R+ASSRI+QVS+E+KR+A++T        R    KSAAA+ AL GLK
Sbjct  71   GEKKYSSFPSSLARSASSRIKQVSKEVKRLATLT--------RRPPEKSAAARYALNGLK  122

Query  872  FISKTDGASGWAAVEKRFDQLTAASN-GLLPRAXFGECIGMNK  997
            FISKT+G + WA VE+RFD+LT+ ++ GLLPR+ FGECIGM+K
Sbjct  123  FISKTEGEAAWATVEQRFDELTSTTDRGLLPRSLFGECIGMSK  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2488971634053