BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig936

Length=1131
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|O49954.1|GCSP_SOLTU  RecName: Full=Glycine dehydrogenase (deca...    623   0.0      Solanum tuberosum [potatoes]
ref|XP_009620998.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    615   0.0      Nicotiana tomentosiformis
ref|XP_009797115.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    614   0.0      Nicotiana sylvestris
ref|XP_006361002.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    615   0.0      
ref|XP_004245101.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    612   0.0      Solanum lycopersicum
ref|XP_009361869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    601   0.0      Pyrus x bretschneideri [bai li]
ref|XP_010047334.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    601   0.0      Eucalyptus grandis [rose gum]
ref|XP_009361863.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    601   0.0      Pyrus x bretschneideri [bai li]
ref|NP_001289247.1|  glycine dehydrogenase (decarboxylating), mit...    601   0.0      Pyrus x bretschneideri [bai li]
gb|KCW81693.1|  hypothetical protein EUGRSUZ_C03047                     592   0.0      Eucalyptus grandis [rose gum]
gb|KJB65558.1|  hypothetical protein B456_010G101200                    593   0.0      Gossypium raimondii
gb|KJB65559.1|  hypothetical protein B456_010G101200                    593   0.0      Gossypium raimondii
ref|XP_008393646.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    594   0.0      Malus domestica [apple tree]
gb|KJB65560.1|  hypothetical protein B456_010G101200                    592   0.0      Gossypium raimondii
ref|XP_004291039.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    592   0.0      Fragaria vesca subsp. vesca
ref|XP_010049196.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    592   0.0      Eucalyptus grandis [rose gum]
gb|AAU94363.1|  glycine decarboxylase P-protein                         572   0.0      Moricandia nitens
gb|KJB54687.1|  hypothetical protein B456_009G045100                    591   0.0      Gossypium raimondii
gb|KJB54688.1|  hypothetical protein B456_009G045100                    591   0.0      Gossypium raimondii
gb|KHG06307.1|  Glycine dehydrogenase [decarboxylating], mitochon...    590   0.0      Gossypium arboreum [tree cotton]
ref|XP_011081684.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    587   0.0      Sesamum indicum [beniseed]
gb|KHG00684.1|  Glycine dehydrogenase [decarboxylating], mitochon...    586   0.0      Gossypium arboreum [tree cotton]
ref|XP_012077290.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    587   0.0      Jatropha curcas
ref|XP_006382015.1|  hypothetical protein POPTR_0006s24570g             574   0.0      
ref|XP_007012280.1|  Glycine decarboxylase P-protein 1                  586   0.0      
gb|AAN17423.1|  P-Protein - like protein                                582   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867212.1|  hypothetical protein ARALYDRAFT_491390             583   0.0      
ref|XP_006283054.1|  hypothetical protein CARUB_v10004049mg             583   0.0      Capsella rubella
ref|NP_001119106.1|  glycine dehydrogenase [decarboxylating] 2          581   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU29323.1|  hypothetical protein MIMGU_mgv1a000648mg                582   0.0      Erythranthe guttata [common monkey flower]
emb|CAN63089.1|  hypothetical protein VITISV_032016                     582   0.0      Vitis vinifera
ref|NP_195027.1|  glycine dehydrogenase [decarboxylating] 2             582   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAK68740.1|  P-Protein - like protein                                581   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAL57651.1|  AT4g33010/F26P21_130                                    581   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002516446.1|  glycine dehydrogenase, putative                    582   0.0      Ricinus communis
ref|XP_010648358.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    581   0.0      Vitis vinifera
ref|XP_006382016.1|  hypothetical protein POPTR_0006s24570g             573   0.0      
dbj|BAJ34193.1|  unnamed protein product                                571   0.0      Eutrema halophilum
gb|KFK32542.1|  hypothetical protein AALP_AA6G256500                    578   0.0      Arabis alpina [alpine rockcress]
ref|XP_010262151.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    578   0.0      Nelumbo nucifera [Indian lotus]
gb|ABO61734.1|  mitochondrial glycine decarboxylase complex P-pro...    578   0.0      Populus tremuloides
ref|XP_008220472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    577   0.0      Prunus mume [ume]
sp|P49361.1|GCSPA_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    576   0.0      Flaveria pringlei
ref|XP_010437818.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    575   0.0      Camelina sativa [gold-of-pleasure]
emb|CAA81076.1|  P protein                                              575   0.0      Flaveria pringlei
ref|XP_011019466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    575   0.0      Populus euphratica
gb|EPS70254.1|  precursor of carboxylase p-protein 1, glycine dec...    552   0.0      Genlisea aurea
dbj|BAJ33627.1|  unnamed protein product                                566   0.0      Eutrema halophilum
ref|XP_010526062.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    573   0.0      Tarenaya hassleriana [spider flower]
ref|XP_002308562.1|  P-protein subunit of glycine decarboxylase e...    572   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006408846.1|  hypothetical protein EUTSA_v10001891mg             572   0.0      Eutrema salsugineum [saltwater cress]
ref|XP_010519851.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    572   0.0      Tarenaya hassleriana [spider flower]
gb|KFK29912.1|  hypothetical protein AALP_AA7G194500                    570   0.0      Arabis alpina [alpine rockcress]
ref|XP_003544533.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    571   0.0      Glycine max [soybeans]
ref|XP_002880741.1|  hypothetical protein ARALYDRAFT_481465             570   0.0      
ref|XP_004498895.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    568   0.0      
ref|XP_006412401.1|  hypothetical protein EUTSA_v10024257mg             569   0.0      
sp|P49362.1|GCSPB_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    566   0.0      Flaveria pringlei
ref|XP_010097067.1|  Glycine cleavage system P protein 1                566   0.0      
ref|XP_004142925.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    565   0.0      Cucumis sativus [cucumbers]
ref|XP_011097886.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    566   0.0      Sesamum indicum [beniseed]
ref|XP_010432628.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    564   0.0      Camelina sativa [gold-of-pleasure]
gb|KDO80092.1|  hypothetical protein CISIN_1g001531mg                   561   0.0      Citrus sinensis [apfelsine]
ref|XP_003550270.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    563   0.0      Glycine max [soybeans]
gb|KDO80091.1|  hypothetical protein CISIN_1g001531mg                   561   0.0      Citrus sinensis [apfelsine]
dbj|BAE98954.1|  putative glycine dehydrogenase                         563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_180178.1|  glycine decarboxylase P-protein 2                     563   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU20359.1|  hypothetical protein MIMGU_mgv1a000655mg                561   0.0      Erythranthe guttata [common monkey flower]
sp|O49850.1|GCSP_FLAAN  RecName: Full=Glycine dehydrogenase (deca...    561   0.0      Flaveria anomala
gb|KDO80085.1|  hypothetical protein CISIN_1g001531mg                   561   0.0      Citrus sinensis [apfelsine]
ref|XP_008444466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    561   0.0      Cucumis melo [Oriental melon]
gb|KDO80090.1|  hypothetical protein CISIN_1g001531mg                   560   0.0      Citrus sinensis [apfelsine]
ref|XP_007227061.1|  hypothetical protein PRUPE_ppa000675mg             560   0.0      
gb|KDO80089.1|  hypothetical protein CISIN_1g001531mg                   560   0.0      Citrus sinensis [apfelsine]
ref|XP_006450834.1|  hypothetical protein CICLE_v10007310mg             560   0.0      Citrus clementina [clementine]
ref|XP_006475931.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    560   0.0      Citrus sinensis [apfelsine]
ref|XP_010667776.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    560   0.0      Beta vulgaris subsp. vulgaris [field beet]
sp|O49852.1|GCSP_FLATR  RecName: Full=Glycine dehydrogenase (deca...    559   0.0      Flaveria trinervia
ref|XP_010429623.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    556   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_007161011.1|  hypothetical protein PHAVU_001G035500g             555   0.0      Phaseolus vulgaris [French bean]
ref|XP_009125119.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    555   0.0      Brassica rapa
ref|XP_003589000.1|  Glycine dehydrogenase P protein                    554   0.0      Medicago truncatula
sp|P26969.1|GCSP_PEA  RecName: Full=Glycine dehydrogenase (decarb...    554   0.0      Pisum sativum [garden pea]
emb|CDX75316.1|  BnaA01g03860D                                          553   0.0      
emb|CDX68930.1|  BnaC01g05230D                                          553   0.0      
ref|XP_006296473.1|  hypothetical protein CARUB_v10025658mg             548   0.0      Capsella rubella
ref|XP_010942763.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    548   0.0      Elaeis guineensis
ref|XP_002282271.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    546   0.0      Vitis vinifera
ref|XP_010417387.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    546   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010925018.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    545   0.0      Elaeis guineensis
ref|XP_010472637.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    545   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_009392931.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    539   2e-179   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008797766.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    538   4e-179   Phoenix dactylifera
ref|XP_009401914.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    535   3e-178   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008808050.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    534   1e-177   Phoenix dactylifera
emb|CDP08258.1|  unnamed protein product                                525   2e-174   Coffea canephora [robusta coffee]
ref|XP_003523643.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    518   9e-172   Glycine max [soybeans]
gb|KHN29723.1|  Glycine dehydrogenase [decarboxylating], mitochon...    518   1e-171   Glycine soja [wild soybean]
emb|CBI27919.3|  unnamed protein product                                493   8e-162   Vitis vinifera
ref|XP_003526001.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    493   9e-162   Glycine max [soybeans]
gb|KHN32209.1|  Glycine dehydrogenase [decarboxylating], mitochon...    492   1e-161   Glycine soja [wild soybean]
ref|XP_006858311.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    487   2e-159   Amborella trichopoda
gb|AAA63798.1|  victorin binding protein                                481   3e-157   Avena sativa [cultivated oat]
gb|KDO80088.1|  hypothetical protein CISIN_1g001531mg                   474   3e-155   Citrus sinensis [apfelsine]
ref|XP_007136824.1|  hypothetical protein PHAVU_009G077400g             474   8e-155   Phaseolus vulgaris [French bean]
ref|XP_004969722.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    465   3e-151   
ref|XP_001754864.1|  predicted protein                                  463   3e-150   
ref|XP_001780310.1|  predicted protein                                  458   8e-149   
gb|EAY75571.1|  hypothetical protein OsI_03474                          456   1e-147   Oryza sativa Indica Group [Indian rice]
ref|NP_001058062.1|  Os06g0611900                                       451   4e-147   
ref|NP_001044046.1|  Os01g0711400                                       454   4e-147   
gb|AAS16361.1|  glycine dehydrogenase P protein                         451   5e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_003569669.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    454   6e-147   Brachypodium distachyon [annual false brome]
ref|NP_001292744.1|  glycine dehydrogenase (decarboxylating), mit...    454   1e-146   Zea mays [maize]
gb|AFW56071.1|  glycine cleavage complex P-protein                      454   3e-146   
gb|EAZ13293.1|  hypothetical protein OsJ_03218                          451   9e-146   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD35509.1|  putative glycine dehydrogenase                         450   2e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441849.1|  hypothetical protein SORBIDRAFT_08g003440          448   2e-144   Sorghum bicolor [broomcorn]
emb|CDM83805.1|  unnamed protein product                                446   5e-144   Triticum aestivum [Canadian hard winter wheat]
gb|AAB82711.1|  glycine decarboxylase P subunit                         443   8e-143   x Tritordeum sp.
gb|AFV46211.1|  hypothetical protein                                    416   9e-142   Scutellaria baicalensis [Baikal skullcap]
gb|AGH12216.1|  glycine decarboxylase P protein                         390   8e-132   Flaveria pringlei
ref|XP_001755004.1|  predicted protein                                  410   5e-131   
ref|XP_006644607.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    408   5e-130   Oryza brachyantha
gb|EAZ37623.1|  hypothetical protein OsJ_21958                          391   5e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001420206.1|  predicted protein                                  389   2e-122   Ostreococcus lucimarinus CCE9901
ref|XP_003081763.1|  GCSP_FLAAN Glycine dehydrogenase [decarboxyl...    384   2e-121   
emb|CEF99477.1|  Pyridoxal phosphate-dependent transferase, major...    384   2e-120   Ostreococcus tauri
ref|XP_002979861.1|  hypothetical protein SELMODRAFT_153563             380   3e-119   
ref|XP_007510359.1|  glycine dehydrogenase                              380   8e-119   Bathycoccus prasinos
ref|XP_002988429.1|  hypothetical protein SELMODRAFT_159459             378   1e-118   
ref|XP_002503477.1|  glycine cleavage system p-protein                  378   3e-118   Micromonas commoda
ref|XP_005850088.1|  hypothetical protein CHLNCDRAFT_16305              356   2e-117   Chlorella variabilis
ref|XP_003055654.1|  glycine cleavage system p-protein                  375   2e-116   Micromonas pusilla CCMP1545
ref|XP_001692993.1|  glycine cleavage system, P protein                 371   3e-115   Chlamydomonas reinhardtii
ref|XP_002956892.1|  hypothetical protein VOLCADRAFT_107448             352   2e-108   Volvox carteri f. nagariensis
ref|XP_005649750.1|  glycine dehydrogenase                              345   2e-105   Coccomyxa subellipsoidea C-169
ref|XP_005538536.1|  glycine dehydrogenase, mitochondrial precursor     333   1e-100   Cyanidioschyzon merolae strain 10D
ref|XP_011398598.1|  Glycine dehydrogenase [decarboxylating], mit...    334   2e-100   Auxenochlorella protothecoides
gb|KFH65627.1|  glycine dehydrogenase                                   330   6e-100   Mortierella verticillata NRRL 6337
ref|XP_005716298.1|  glycine dehydrogenase (decarboxylating), mit...    327   1e-98    Chondrus crispus [carageen]
ref|XP_005711074.1|  unnamed protein product                            304   5e-98    Chondrus crispus [carageen]
emb|CBJ30901.1|  Glycine dehydrogenase (decarboxylating)                324   7e-98    Ectocarpus siliculosus
ref|XP_009056743.1|  hypothetical protein LOTGIDRAFT_216694             323   3e-97    Lottia gigantea
ref|WP_009768707.1|  glycine dehydrogenase, decarboxylating             322   6e-97    Oscillatoriales cyanobacterium JSC-12
ref|WP_040728598.1|  glycine dehydrogenase                              319   5e-96    
emb|CDS12383.1|  hypothetical protein LRAMOSA04578                      317   2e-95    Lichtheimia ramosa
emb|CDH56548.1|  glycine dehydrogenase                                  317   3e-95    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_011435045.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    317   3e-95    
ref|XP_011435044.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    317   4e-95    
emb|CEI88334.1|  Putative Glycine dehydrogenase                         305   4e-95    Rhizopus microsporus
ref|WP_044171749.1|  glycine dehydrogenase                              315   1e-94    
gb|EKC42749.1|  Glycine dehydrogenase [decarboxylating], mitochon...    317   5e-94    
ref|XP_006681352.1|  hypothetical protein BATDEDRAFT_20549              314   6e-94    Batrachochytrium dendrobatidis JAM81
ref|WP_035493337.1|  glycine dehydrogenase                              313   7e-94    
dbj|GAL03183.1|  glycine dehydrogenase                                  297   9e-94    Photobacterium aphoticum
dbj|GAM17937.1|  hypothetical protein SAMD00019534_011120               313   1e-93    Acytostelium subglobosum LB1
ref|WP_019556676.1|  glycine dehydrogenase                              311   2e-93    Thiomicrorhabdus arctica
gb|EPB87900.1|  glycine dehydrogenase                                   312   2e-93    Mucor circinelloides f. circinelloides 1006PhL
ref|WP_039743276.1|  glycine dehydrogenase                              312   2e-93    
ref|WP_008684764.1|  glycine dehydrogenase                              311   2e-93    Rhodopirellula sallentina
emb|CEP11218.1|  hypothetical protein                                   312   2e-93    Parasitella parasitica
pdb|4LGL|A  Chain A, Crystal Structure Of Glycine Decarboxylase P...    311   2e-93    Synechocystis sp. PCC 6803 substr. Kazusa
ref|WP_010873139.1|  glycine dehydrogenase (decarboxylating)            311   3e-93    Synechocystis
pdb|4LHC|A  Chain A, Crystal Structure Of Synechocystis Sp. Pcc 6...    311   3e-93    Synechocystis sp. PCC 6803 substr. Kazusa
ref|XP_008606102.1|  glycine dehydrogenase                              311   4e-93    Saprolegnia diclina VS20
gb|EFA86802.1|  glycine dehydrogenase                                   311   4e-93    Heterostelium album PN500
ref|XP_005703180.1|  glycine dehydrogenase subunit 2                    294   4e-93    Galdieria sulphuraria
ref|WP_044451621.1|  glycine dehydrogenase                              306   5e-93    Mastigocladus laminosus
ref|WP_037223913.1|  glycine dehydrogenase                              303   8e-93    
ref|WP_007414923.1|  glycine dehydrogenase                              310   9e-93    Pedosphaera parvula
gb|EIE87692.1|  glycine dehydrogenase                                   310   1e-92    Rhizopus delemar RA 99-880
ref|WP_009094772.1|  glycine dehydrogenase                              310   1e-92    Rhodopirellula sp. SWK7
ref|WP_035986474.1|  glycine dehydrogenase                              309   2e-92    Leptolyngbya sp. KIOST-1
ref|WP_038329010.1|  glycine dehydrogenase                              295   2e-92    
ref|WP_044034863.1|  glycine dehydrogenase                              300   2e-92    Microcystis aeruginosa
gb|KDO30366.1|  glycine dehydrogenase                                   309   2e-92    Saprolegnia parasitica CBS 223.65
ref|WP_044179699.1|  glycine dehydrogenase                              308   2e-92    Photobacterium damselae
ref|WP_027846740.1|  glycine dehydrogenase                              308   5e-92    Mastigocoleus testarum
ref|WP_015130859.1|  glycine dehydrogenase                              308   5e-92    Calothrix sp. PCC 7507
ref|WP_015956701.1|  glycine dehydrogenase                              307   8e-92    Cyanothece sp. PCC 7424
dbj|GAN00874.1|  glycine dehydrogenase protein                          308   9e-92    Mucor ambiguus
ref|WP_044202817.1|  glycine dehydrogenase                              307   9e-92    Flammeovirga sp. OC4
ref|WP_015157279.1|  glycine dehydrogenase subunit alpha/beta           307   1e-91    Chroococcidiopsis thermalis
ref|WP_020531529.1|  glycine dehydrogenase                              307   1e-91    Flexithrix dorotheae
ref|WP_019487125.1|  glycine dehydrogenase                              307   2e-91    Kamptonema formosum
ref|XP_007270989.1|  glycine dehydrogenase                              307   2e-91    Fomitiporia mediterranea MF3/22
ref|XP_004991539.1|  glycine decarboxylase multi-enzyme complex P...    306   2e-91    Salpingoeca rosetta
ref|WP_044223259.1|  glycine dehydrogenase                              306   2e-91    Flammeovirga pacifica
ref|WP_009360452.1|  glycine dehydrogenase                              306   2e-91    alpha proteobacterium HIMB114
ref|WP_039713483.1|  glycine dehydrogenase                              306   2e-91    
ref|WP_036029761.1|  glycine dehydrogenase                              305   3e-91    
gb|ESA20942.1|  hypothetical protein GLOINDRAFT_343379                  306   4e-91    
gb|KIE11464.1|  glycine dehydrogenase                                   305   4e-91    
ref|WP_019497275.1|  glycine dehydrogenase                              305   5e-91    Calothrix sp. PCC 7103
ref|WP_026736448.1|  glycine dehydrogenase                              305   5e-91    Fischerella sp. PCC 9605
ref|WP_017309685.1|  glycine dehydrogenase                              305   5e-91    Fischerella sp. PCC 9339
ref|WP_008273963.1|  glycine dehydrogenase                              305   7e-91    Cyanothece sp. CCY0110
ref|WP_033335677.1|  glycine dehydrogenase                              305   1e-90    
ref|WP_012627655.1|  glycine dehydrogenase                              305   1e-90    Cyanothece sp. PCC 7425
ref|WP_006670601.1|  glycine dehydrogenase                              304   1e-90    Arthrospira
emb|CCE19870.1|  Glycine dehydrogenase (decarboxylating)                304   1e-90    Arthrospira sp. PCC 8005
ref|WP_006622636.1|  glycine dehydrogenase                              304   1e-90    Arthrospira platensis
ref|WP_028946840.1|  glycine dehydrogenase                              304   1e-90    Synechocystis sp. PCC 6714
ref|XP_008527904.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    290   2e-90    Equus przewalskii [Przewalski horse]
ref|WP_045872920.1|  glycine dehydrogenase                              304   2e-90    Nostocales
ref|WP_035999593.1|  glycine dehydrogenase                              304   2e-90    [Leptolyngbya] sp. JSC-1
ref|WP_017304511.1|  glycine dehydrogenase                              304   2e-90    Spirulina subsalsa
ref|WP_013030982.1|  glycine dehydrogenase                              303   2e-90    Sideroxydans lithotrophicus
ref|WP_009544701.1|  MULTISPECIES: glycine dehydrogenase                303   2e-90    Cyanothece
ref|XP_008334077.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    295   3e-90    Cynoglossus semilaevis [half-smooth tongue sole]
ref|WP_044206069.1|  glycine dehydrogenase                              303   3e-90    Coleofasciculus chthonoplastes
gb|EDX77003.1|  glycine dehydrogenase                                   303   3e-90    Coleofasciculus chthonoplastes PCC 7420
ref|WP_021833183.1|  Glycine dehydrogenase [decarboxylating] (gly...    300   3e-90    
ref|WP_006619236.1|  glycine dehydrogenase                              303   3e-90    Arthrospira platensis
ref|WP_010572852.1|  glycine dehydrogenase                              303   4e-90    Leptospira kmetyi
ref|WP_021830956.1|  Glycine dehydrogenase [decarboxylating] (gly...    303   6e-90    Crocosphaera watsonii
ref|WP_044034232.1|  glycine dehydrogenase                              302   6e-90    Microcystis aeruginosa
ref|XP_004343370.1|  glycine dehydrogenase                              303   6e-90    Capsaspora owczarzaki ATCC 30864
ref|WP_029407226.1|  glycine dehydrogenase                              302   7e-90    Thiomicrorhabdus sp. Milos-T2
ref|WP_006631620.1|  glycine dehydrogenase                              302   7e-90    Microcoleus vaginatus
ref|WP_004161677.1|  glycine dehydrogenase                              302   8e-90    Microcystis aeruginosa
ref|WP_006527089.1|  glycine dehydrogenase, decarboxylating             302   8e-90    Gloeocapsa sp. PCC 73106
emb|CCI24204.1|  Glycine cleavage system P-protein (glycine dehyd...    302   9e-90    Microcystis aeruginosa PCC 9808
ref|WP_017289075.1|  glycine dehydrogenase                              301   1e-89    Leptolyngbya boryana
ref|WP_008692424.1|  glycine dehydrogenase                              294   1e-89    
ref|WP_002777354.1|  glycine dehydrogenase                              301   1e-89    Microcystis aeruginosa
ref|WP_015784226.1|  glycine dehydrogenase                              301   1e-89    Cyanothece sp. PCC 8802
ref|WP_012410110.1|  glycine dehydrogenase (decarboxylating)            301   1e-89    Nostoc punctiforme
ref|WP_015175278.1|  Glycine dehydrogenase (decarboxylating)            301   2e-89    Oscillatoria nigro-viridis
ref|WP_029637128.1|  glycine dehydrogenase [                            301   2e-89    
ref|WP_015119530.1|  glycine dehydrogenase, decarboxylating             301   2e-89    Rivularia sp. PCC 7116
emb|CEG63023.1|  Putative Glycine dehydrogenase                         301   2e-89    Rhizopus microsporus
ref|XP_003749134.2|  PREDICTED: glycine dehydrogenase (decarboxyl...    293   2e-89    Rattus norvegicus [brown rat]
gb|EAW38056.1|  glycine dehydrogenase                                   301   2e-89    Lyngbya sp. PCC 8106
ref|WP_043997862.1|  glycine dehydrogenase                              301   2e-89    Microcystis aeruginosa
ref|WP_023065539.1|  glycine dehydrogenase                              301   2e-89    Lyngbya aestuarii
ref|WP_036401293.1|  glycine dehydrogenase                              301   2e-89    Microcystis aeruginosa
ref|WP_039895601.1|  glycine dehydrogenase                              300   2e-89    
emb|CCI35850.1|  Glycine cleavage system P-protein (glycine dehyd...    301   3e-89    Microcystis aeruginosa PCC 9701
emb|CCQ61793.1|  Glycine dehydrogenase [decarboxylating] (glycine...    301   3e-89    Crocosphaera watsonii WH 0401
ref|WP_043999313.1|  glycine dehydrogenase                              301   3e-89    Microcystis aeruginosa
ref|WP_040944225.1|  glycine dehydrogenase                              300   3e-89    
gb|KIJ83529.1|  glycine dehydrogenase                                   300   3e-89    
gb|ELS47332.1|  glycine dehydrogenase                                   301   4e-89    Microcystis aeruginosa DIANCHI905
ref|WP_011319516.1|  glycine dehydrogenase (decarboxylating)            300   4e-89    Trichormus variabilis
ref|WP_016874717.1|  glycine dehydrogenase                              300   4e-89    Chlorogloeopsis fritschii
emb|CCH98687.1|  Glycine cleavage system P-protein (glycine dehyd...    300   4e-89    Microcystis aeruginosa PCC 9717
ref|WP_016866657.1|  glycine dehydrogenase                              300   4e-89    Fischerella muscicola
ref|WP_015225454.1|  glycine dehydrogenase (decarboxylating) beta...    300   4e-89    Halothece sp. PCC 7418
ref|WP_043999766.1|  glycine dehydrogenase                              300   5e-89    Microcystis aeruginosa
ref|WP_039900125.1|  glycine dehydrogenase                              300   5e-89    Microcystis
ref|WP_016861897.1|  glycine dehydrogenase                              300   5e-89    Fischerella muscicola
ref|WP_006279051.1|  glycine dehydrogenase                              300   5e-89    Cylindrospermopsis raciborskii
emb|CCI32913.1|  Glycine cleavage system P-protein (glycine dehyd...    300   5e-89    Microcystis sp. T1-4
ref|WP_036395391.1|  glycine dehydrogenase                              300   6e-89    Microcystis aeruginosa
gb|EPF20262.1|  Glycine dehydrogenase [decarboxylating]                 300   6e-89    Microcystis aeruginosa SPC777
emb|CCI15528.1|  Glycine cleavage system P-protein (glycine dehyd...    300   6e-89    Microcystis aeruginosa PCC 9806
gb|KDD73559.1|  glycine cleavage system P-protein                       280   7e-89    Helicosporidium sp. ATCC 50920
ref|WP_036389802.1|  glycine dehydrogenase                              300   7e-89    Microcystis aeruginosa
ref|WP_018476108.1|  glycine dehydrogenase                              299   7e-89    Pontibacter roseus
ref|WP_012166094.1|  glycine dehydrogenase                              300   7e-89    Acaryochloris marina
emb|CCI02130.1|  Glycine cleavage system P-protein (glycine dehyd...    299   1e-88    Microcystis aeruginosa PCC 9443
ref|WP_043996308.1|  glycine dehydrogenase                              299   1e-88    Microcystis aeruginosa
ref|WP_015198875.1|  glycine dehydrogenase                              299   1e-88    Calothrix parietina
ref|WP_045357678.1|  glycine dehydrogenase                              299   1e-88    Microcystis aeruginosa
ref|WP_016870901.1|  glycine dehydrogenase                              299   1e-88    Fischerella thermalis
ref|WP_009457628.1|  glycine dehydrogenase                              299   1e-88    Fischerella thermalis
ref|WP_043998344.1|  glycine dehydrogenase                              299   1e-88    Microcystis aeruginosa
ref|WP_035827440.1|  glycine dehydrogenase                              299   1e-88    Crocosphaera watsonii
emb|CCH95022.1|  Glycine cleavage system P-protein (glycine dehyd...    299   1e-88    Microcystis aeruginosa PCC 9432
dbj|GAL92044.1|  glycine dehydrogenase [decarboxylating] (glycine...    299   1e-88    Microcystis aeruginosa NIES-44
ref|WP_017299875.1|  glycine dehydrogenase                              298   1e-88    Nodosilinea nodulosa
ref|WP_009342048.1|  glycine dehydrogenase                              298   2e-88    Raphidiopsis brookii
ref|WP_012266651.1|  glycine dehydrogenase                              298   2e-88    Microcystis aeruginosa
ref|WP_002732527.1|  glycine dehydrogenase                              298   2e-88    Microcystis aeruginosa
ref|WP_009285454.1|  glycine dehydrogenase                              298   2e-88    Fibrisoma limi
ref|WP_007306344.1|  glycine dehydrogenase                              298   2e-88    Crocosphaera watsonii
ref|WP_017652835.1|  glycine dehydrogenase                              298   3e-88    Fortiea contorta
ref|WP_015160591.1|  glycine dehydrogenase, decarboxylating             298   3e-88    
ref|XP_004653057.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    298   3e-88    
ref|WP_020596172.1|  glycine dehydrogenase                              297   3e-88    
ref|XP_002436237.1|  glycine dehydrogenase, putative                    296   4e-88    
ref|WP_015115551.1|  glycine dehydrogenase (decarboxylating) beta...    297   5e-88    
ref|WP_010472943.1|  glycine dehydrogenase                              297   5e-88    
ref|WP_027000783.1|  glycine dehydrogenase                              297   5e-88    
ref|WP_027250002.1|  glycine dehydrogenase                              296   6e-88    
ref|WP_042157536.1|  glycine dehydrogenase                              296   6e-88    
ref|WP_043938103.1|  glycine dehydrogenase                              296   6e-88    
ref|WP_039928551.1|  glycine dehydrogenase                              296   7e-88    
ref|WP_018618564.1|  glycine dehydrogenase                              296   7e-88    
ref|WP_026795376.1|  MULTISPECIES: glycine dehydrogenase                296   7e-88    
ref|WP_041770080.1|  glycine dehydrogenase                              296   8e-88    
gb|ERL84391.1|  hypothetical protein D910_01824                         285   8e-88    
ref|WP_035401444.1|  glycine dehydrogenase                              296   9e-88    
ref|XP_004359501.1|  glycine dehydrogenase                              297   9e-88    
ref|WP_026796741.1|  glycine dehydrogenase                              296   9e-88    
gb|EOQ89615.1|  glycine dehydrogenase                                   296   9e-88    
gb|ABZ95547.1|  Glycine dehydrogenase (decarboxylating), protein P      296   9e-88    
ref|WP_044145105.1|  glycine dehydrogenase                              288   1e-87    
ref|WP_017320159.1|  glycine dehydrogenase                              296   1e-87    
ref|XP_010875485.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    297   1e-87    
ref|WP_002988516.1|  glycine dehydrogenase                              296   1e-87    
ref|WP_044106198.1|  glycine dehydrogenase                              296   1e-87    
dbj|GAM71457.1|  glycine dehydrogenase                                  279   1e-87    
ref|WP_017059849.1|  glycine dehydrogenase                              296   1e-87    
gb|EEX32328.1|  glycine dehydrogenase [decarboxylating]                 295   2e-87    
ref|WP_015227846.1|  glycine dehydrogenase, decarboxylating             295   2e-87    
gb|AFZ12851.1|  Glycine dehydrogenase (decarboxylating)                 296   2e-87    
ref|XP_007763651.1|  glycine dehydrogenase                              296   2e-87    
ref|WP_027481826.1|  glycine dehydrogenase                              295   2e-87    
ref|WP_043893096.1|  hypothetical protein                               295   2e-87    
gb|EOQ96237.1|  glycine dehydrogenase                                   295   2e-87    
ref|WP_002972410.1|  glycine dehydrogenase                              295   2e-87    
ref|WP_010320324.1|  glycine dehydrogenase                              295   2e-87    
ref|WP_040507194.1|  glycine dehydrogenase                              295   2e-87    
ref|WP_015209784.1|  glycine dehydrogenase, decarboxylating             295   2e-87    
ref|WP_004738121.1|  glycine dehydrogenase                              295   2e-87    
sp|Q8YNF9.1|GCSP_NOSS1  RecName: Full=Glycine dehydrogenase (deca...    295   3e-87    
ref|WP_041226533.1|  glycine dehydrogenase                              295   3e-87    
ref|WP_011397655.1|  glycine dehydrogenase (decarboxylating)            295   3e-87    
emb|CDQ64607.1|  unnamed protein product                                296   3e-87    
ref|XP_005717294.1|  unnamed protein product                            275   3e-87    
ref|WP_016792003.1|  glycine dehydrogenase                              291   3e-87    
ref|WP_012596779.1|  glycine dehydrogenase                              295   3e-87    
ref|WP_015334445.1|  glycine dehydrogenase                              295   3e-87    
ref|WP_044523300.1|  glycine dehydrogenase                              295   3e-87    
ref|WP_040121887.1|  glycine dehydrogenase                              295   4e-87    
ref|WP_038159925.1|  glycine dehydrogenase                              295   4e-87    
ref|XP_007339769.1|  glycine dehydrogenase                              295   4e-87    
ref|WP_019275951.1|  glycine dehydrogenase                              294   4e-87    
dbj|GAL17115.1|  glycine dehydrogenase                                  277   4e-87    
ref|WP_026027623.1|  glycine dehydrogenase                              294   5e-87    
ref|WP_026028940.1|  glycine dehydrogenase                              294   5e-87    
ref|WP_043009965.1|  glycine dehydrogenase                              294   5e-87    
ref|WP_019508372.1|  glycine dehydrogenase                              295   5e-87    
ref|WP_004784745.1|  glycine dehydrogenase                              294   5e-87    
ref|WP_020776421.1|  glycine dehydrogenase                              294   5e-87    
ref|WP_017069878.1|  glycine dehydrogenase                              294   6e-87    
ref|WP_017048218.1|  glycine dehydrogenase                              294   6e-87    
ref|WP_008079962.1|  glycine dehydrogenase                              294   6e-87    
ref|WP_029388267.1|  glycine dehydrogenase                              294   6e-87    
ref|WP_017072177.1|  glycine dehydrogenase                              294   6e-87    
ref|WP_008216964.1|  glycine dehydrogenase                              294   7e-87    
ref|WP_014560840.1|  glycine dehydrogenase                              294   7e-87    
dbj|GAL33354.1|  glycine dehydrogenase                                  283   8e-87    
ref|WP_028083847.1|  glycine dehydrogenase                              294   8e-87    
ref|WP_038134901.1|  glycine dehydrogenase                              293   8e-87    
ref|WP_033093427.1|  glycine dehydrogenase                              293   8e-87    
ref|WP_020023624.1|  MULTISPECIES: glycine dehydrogenase                293   9e-87    
ref|WP_019822185.1|  glycine dehydrogenase                              293   9e-87    
ref|WP_042202353.1|  glycine dehydrogenase                              293   1e-86    
ref|XP_004546967.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    293   1e-86    
ref|WP_031780027.1|  glycine dehydrogenase                              282   1e-86    
ref|WP_013665365.1|  glycine dehydrogenase                              293   1e-86    
ref|WP_017319421.1|  glycine dehydrogenase                              293   1e-86    
ref|WP_039485771.1|  glycine dehydrogenase                              293   1e-86    
gb|EAW44901.1|  glycine dehydrogenase                                   294   1e-86    
ref|WP_036554706.1|  glycine dehydrogenase                              293   1e-86    
ref|XP_005063268.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    293   1e-86    
ref|WP_015145532.1|  glycine dehydrogenase, decarboxylating             293   1e-86    
ref|WP_017064655.1|  glycine dehydrogenase                              293   1e-86    
ref|WP_039477082.1|  glycine dehydrogenase                              293   2e-86    
ref|WP_017079170.1|  glycine dehydrogenase                              293   2e-86    
ref|XP_005738328.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    293   2e-86    
ref|WP_028867253.1|  glycine dehydrogenase                              293   2e-86    
ref|NP_613061.1|  glycine dehydrogenase (decarboxylating), mitoch...    293   2e-86    
ref|WP_026028606.1|  glycine dehydrogenase                              293   2e-86    
gb|EDL41701.1|  glycine decarboxylase, isoform CRA_d                    293   2e-86    
ref|WP_011770994.1|  glycine dehydrogenase (decarboxylating)            293   2e-86    
ref|WP_001089334.1|  glycine dehydrogenase                              293   2e-86    
ref|XP_006231273.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    291   2e-86    
ref|WP_041036217.1|  glycine dehydrogenase                              293   2e-86    
ref|XP_004341789.1|  glycine cleavage system Pprotein                   293   2e-86    
ref|XP_004072176.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    293   2e-86    
ref|XP_003745096.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    293   2e-86    
ref|WP_045974113.1|  glycine dehydrogenase                              292   3e-86    
ref|WP_039004456.1|  glycine dehydrogenase                              292   3e-86    
ref|WP_038187339.1|  glycine dehydrogenase                              292   3e-86    
ref|XP_010729182.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    293   3e-86    
ref|XP_008416250.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    293   3e-86    
ref|WP_038201543.1|  glycine dehydrogenase                              292   3e-86    
ref|WP_039623928.1|  glycine dehydrogenase                              292   4e-86    
ref|XP_002160817.2|  PREDICTED: glycine dehydrogenase [decarboxyl...    293   4e-86    
ref|WP_015212883.1|  Glycine dehydrogenase (decarboxylating)            292   4e-86    
ref|XP_008416249.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    293   4e-86    
ref|WP_017067509.1|  glycine dehydrogenase                              291   4e-86    
ref|WP_004744039.1|  glycine dehydrogenase                              291   4e-86    
ref|WP_039976795.1|  glycine dehydrogenase                              291   4e-86    
ref|XP_637330.1|  glycine dehydrogenase                                 292   5e-86    
gb|EMO25001.1|  glycine dehydrogenase (decarboxylating)                 279   5e-86    
ref|XP_005801071.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    293   5e-86    
ref|WP_028088591.1|  glycine dehydrogenase                              291   5e-86    
ref|WP_019281004.1|  glycine dehydrogenase                              291   5e-86    
gb|AEH35153.1|  Glycine dehydrogenase (decarboxylating)                 291   6e-86    
ref|WP_038877986.1|  glycine dehydrogenase                              291   7e-86    
ref|WP_011044594.1|  Glycine dehydrogenase (decarboxylating) 2          291   7e-86    
ref|WP_020402760.1|  glycine dehydrogenase                              291   7e-86    
ref|XP_001383214.1|  Glycine cleavage system protein                    292   7e-86    
ref|XP_003762187.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    292   8e-86    
ref|WP_031780093.1|  glycine dehydrogenase                              281   8e-86    
ref|WP_012486709.1|  glycine dehydrogenase                              291   8e-86    
ref|WP_012692452.1|  glycine dehydrogenase                              291   9e-86    
ref|WP_006878512.1|  glycine dehydrogenase                              291   9e-86    
ref|WP_045420525.1|  glycine dehydrogenase                              291   9e-86    
ref|WP_042602813.1|  glycine dehydrogenase                              291   9e-86    
ref|XP_007557910.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    292   9e-86    
ref|WP_042604164.1|  glycine dehydrogenase                              291   9e-86    
ref|WP_017053431.1|  glycine dehydrogenase                              291   1e-85    
ref|WP_045401953.1|  glycine dehydrogenase                              291   1e-85    
gb|EPX72727.1|  glycine cleavage complex subunit P                      291   1e-85    
ref|WP_012600698.1|  glycine dehydrogenase                              291   1e-85    
ref|WP_032555034.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_016789847.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_016768711.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_016788232.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_010429445.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_016793673.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_017111950.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_017097965.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_032552611.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_019351002.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_017092110.1|  glycine dehydrogenase                              290   1e-85    
ref|WP_004411308.1|  glycine dehydrogenase                              290   1e-85    
gb|EKV00929.1|  glycine dehydrogenase, decarboxylating                  290   2e-85    
gb|EAQ55079.1|  glycine cleavage system P protein                       290   2e-85    
gb|EAP96255.1|  glycine cleavage system P protein                       290   2e-85    
ref|WP_005304561.1|  glycine dehydrogenase                              290   2e-85    
emb|CCQ70811.1|  Glycine dehydrogenase [decarboxylating] (glycine...    286   2e-85    
ref|WP_029828132.1|  glycine dehydrogenase                              281   3e-85    
ref|WP_041430269.1|  glycine dehydrogenase                              289   3e-85    
gb|AFY75171.1|  glycine dehydrogenase, decarboxylating                  289   3e-85    
ref|WP_013322173.1|  glycine dehydrogenase                              290   3e-85    
ref|WP_017088914.1|  glycine dehydrogenase                              289   3e-85    
ref|XP_003287462.1|  glycine dehydrogenase                              290   4e-85    
ref|WP_017085551.1|  glycine dehydrogenase                              289   4e-85    
ref|WP_022942732.1|  glycine dehydrogenase                              289   4e-85    
ref|WP_017082301.1|  glycine dehydrogenase                              289   4e-85    
ref|WP_017094272.1|  glycine dehydrogenase                              289   5e-85    
ref|XP_002182636.1|  glycine decarboxylase p- protein                   289   8e-85    
ref|WP_028523771.1|  glycine dehydrogenase                              288   8e-85    
dbj|GAK83150.1|  glycine dehydrogenase                                  275   9e-85    
ref|WP_027251065.1|  glycine dehydrogenase                              288   1e-84    
ref|WP_036818445.1|  glycine dehydrogenase                              288   1e-84    
ref|WP_019989155.1|  glycine dehydrogenase                              287   2e-84    
ref|WP_037668021.1|  glycine dehydrogenase                              272   2e-84    
ref|WP_044621008.1|  glycine dehydrogenase                              287   2e-84    
ref|WP_015195100.1|  Glycine dehydrogenase (decarboxylating)            287   2e-84    
gb|EJK45128.1|  hypothetical protein THAOC_36273                        288   2e-84    
ref|WP_028667393.1|  glycine dehydrogenase                              287   2e-84    
ref|WP_013927143.1|  glycine dehydrogenase                              287   3e-84    
ref|WP_028981454.1|  glycine dehydrogenase                              286   4e-84    
ref|WP_015081132.1|  glycine dehydrogenase                              286   5e-84    
ref|WP_024850811.1|  glycine dehydrogenase                              286   5e-84    
ref|WP_045459859.1|  glycine dehydrogenase                              286   6e-84    
ref|WP_027401604.1|  glycine dehydrogenase                              286   6e-84    
ref|WP_039200768.1|  glycine dehydrogenase                              286   6e-84    
ref|WP_004419733.1|  glycine dehydrogenase                              286   6e-84    
ref|WP_017027692.1|  glycine dehydrogenase                              286   7e-84    
ref|WP_039465918.1|  glycine dehydrogenase                              285   8e-84    
ref|WP_026721410.1|  glycine dehydrogenase                              285   9e-84    
ref|WP_035151567.1|  glycine dehydrogenase                              285   1e-83    
ref|WP_040041318.1|  glycine dehydrogenase                              285   1e-83    
ref|WP_028490147.1|  glycine dehydrogenase                              285   1e-83    
ref|WP_008989114.1|  glycine dehydrogenase                              285   1e-83    
ref|WP_044171929.1|  glycine dehydrogenase                              285   1e-83    
ref|WP_029861334.1|  glycine dehydrogenase                              280   2e-83    
ref|WP_011140250.1|  glycine dehydrogenase                              285   2e-83    
ref|WP_025553125.1|  glycine dehydrogenase                              280   2e-83    
ref|WP_017031903.1|  glycine dehydrogenase                              285   2e-83    
ref|WP_017243124.1|  glycine dehydrogenase                              284   2e-83    
ref|WP_044095056.1|  glycine dehydrogenase                              284   3e-83    
gb|EMO61678.1|  glycine dehydrogenase                                   284   3e-83    
ref|WP_008749177.1|  glycine dehydrogenase subunit 1                    284   3e-83    
ref|WP_032851358.1|  glycine dehydrogenase                              283   4e-83    
gb|EKP12935.1|  glycine dehydrogenase                                   283   4e-83    
ref|WP_025639988.1|  glycine dehydrogenase                              279   4e-83    
gb|EMN16788.1|  glycine dehydrogenase                                   283   4e-83    
ref|WP_016749270.1|  glycine dehydrogenase                              283   4e-83    
gb|EKQ93699.1|  glycine dehydrogenase                                   283   4e-83    
ref|WP_032853776.1|  glycine dehydrogenase                              283   5e-83    
dbj|BAH37805.1|  glycine dehydrogenase                                  283   5e-83    
ref|WP_001089358.1|  glycine dehydrogenase                              280   5e-83    
gb|EMK13450.1|  glycine dehydrogenase                                   283   5e-83    
ref|WP_025621442.1|  glycine dehydrogenase                              279   5e-83    
ref|WP_039982227.1|  glycine dehydrogenase                              283   5e-83    
ref|WP_032853141.1|  glycine dehydrogenase                              283   5e-83    
ref|WP_025509358.1|  glycine dehydrogenase                              279   5e-83    
ref|WP_029807401.1|  glycine dehydrogenase                              279   5e-83    
ref|WP_016757906.1|  MULTISPECIES: glycine dehydrogenase                283   5e-83    
gb|EMJ78114.1|  glycine dehydrogenase                                   283   6e-83    
ref|WP_006643852.1|  glycine dehydrogenase                              283   6e-83    
gb|EKR00019.1|  glycine dehydrogenase                                   283   6e-83    
ref|WP_029840619.1|  glycine dehydrogenase                              279   6e-83    
ref|WP_045131132.1|  glycine dehydrogenase                              283   6e-83    
ref|WP_011669375.1|  glycine dehydrogenase (decarboxylating)            283   6e-83    
ref|WP_013615693.1|  glycine dehydrogenase                              283   6e-83    
ref|WP_029849396.1|  glycine dehydrogenase                              279   6e-83    
ref|WP_042778861.1|  glycine dehydrogenase                              266   6e-83    
ref|WP_041919296.1|  glycine dehydrogenase                              283   7e-83    



>sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Solanum 
tuberosum]
 emb|CAB16918.1| P-Protein precursor [Solanum tuberosum]
Length=1035

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/351 (85%), Positives = 323/351 (92%), Gaps = 8/351 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERARKLANRAIL+RLV ++KQ R+NE P+++L+RP+RYVSSL+P    Y  Q R +   
Sbjct  1     MERARKLANRAILKRLVSQSKQSRSNEIPSSSLYRPSRYVSSLSP----YTFQARNNAKS  56

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
                  + QQ RSISVEALKPSDTFPRRHNSATPE+Q+KMAEFCGF SLDALIDATVPQSI
Sbjct  57    F----NTQQARSISVEALKPSDTFPRRHNSATPEEQTKMAEFCGFQSLDALIDATVPQSI  112

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             R +SMK PKFD GLTE+QMIEHM+NLASKNKVFKSYIGMGYYNT+VPPVILRN++ENP W
Sbjct  113   RSESMKLPKFDSGLTESQMIEHMQNLASKNKVFKSYIGMGYYNTYVPPVILRNLLENPAW  172

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  173   YTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGK  232

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTIDICKTRADGF+LKVVT DLKDIDYKSGDVCGVLVQYPGTEGE+LD
Sbjct  233   KKTFLIASNCHPQTIDICKTRADGFDLKVVTVDLKDIDYKSGDVCGVLVQYPGTEGEILD  292

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  293   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  343



>ref|XP_009620998.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana tomentosiformis]
Length=1043

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/352 (84%), Positives = 318/352 (90%), Gaps = 3/352 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA-AALHRPARYVSSLAPCAAMYENQRRYSGA  253
             M+RARKLANRAIL+RLV E+KQ RAN+ P+ AAL+RP+RYVSSL+P      N +     
Sbjct  1     MDRARKLANRAILKRLVSESKQSRANDIPSSAALYRPSRYVSSLSPYIFQARNGKNMLHG  60

Query  254   GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  433
                F  + Q  RSISVEALKPSDTFPRRHNSATP++Q++MAEFCGF SLD+LIDATVPQS
Sbjct  61    NGNF--NKQHVRSISVEALKPSDTFPRRHNSATPQEQTQMAEFCGFSSLDSLIDATVPQS  118

Query  434   IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
             IR++SMKF KFD GLTEAQMIEHM  LAS NKVFKSYIGMGYYNTFVPPVILRNIMENP 
Sbjct  119   IRIESMKFSKFDEGLTEAQMIEHMSKLASMNKVFKSYIGMGYYNTFVPPVILRNIMENPA  178

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG
Sbjct  179   WYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  238

Query  794   KKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVL  973
             KKKTF+IASNCHPQTIDICKTRADGF +KV T DLKDIDYKSGDVCGVLVQYPGTEGE+L
Sbjct  239   KKKTFLIASNCHPQTIDICKTRADGFGIKVETVDLKDIDYKSGDVCGVLVQYPGTEGEIL  298

Query  974   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  299   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  350



>ref|XP_009797115.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana sylvestris]
Length=1046

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/353 (84%), Positives = 316/353 (90%), Gaps = 2/353 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA-AALHRPARYVSSLAPCAAMYEN-QRRYSG  250
             MERARKLANRAIL+RLV ++KQ RANE P+ AAL+RP+RYVSSL+P      N      G
Sbjct  1     MERARKLANRAILKRLVSDSKQSRANEIPSSAALYRPSRYVSSLSPYTFQARNGNNMLHG  60

Query  251   AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  430
                 F    Q  RSISVEALKPSDTFPRRHNSATP++Q++MAEFCGF SLD+LIDATVPQ
Sbjct  61    KVGNFNRQQQHVRSISVEALKPSDTFPRRHNSATPQEQTQMAEFCGFSSLDSLIDATVPQ  120

Query  431   SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             SIR++SMKF KFD GLTEAQMI+HM  LAS NKVFKSYIGMGYYNTFVPPVILRNIMENP
Sbjct  121   SIRIESMKFSKFDEGLTEAQMIDHMSKLASMNKVFKSYIGMGYYNTFVPPVILRNIMENP  180

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
              WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK
Sbjct  181   AWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  240

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEV  970
             GKKKTF+IASNCHPQTIDICKTRADGF +KV T DLKDIDYKSGDVCGVLVQYPGTEGE+
Sbjct  241   GKKKTFLIASNCHPQTIDICKTRADGFGIKVETVDLKDIDYKSGDVCGVLVQYPGTEGEI  300

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  301   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGEFGADIVVGSAQRFGVPMGY  353



>ref|XP_006361002.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Solanum tuberosum]
Length=1092

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/351 (84%), Positives = 321/351 (91%), Gaps = 8/351 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERARKLANRAIL+RLV ++KQ R+NE P+++L+ P+RYVSSL+P    Y  Q R +   
Sbjct  1     MERARKLANRAILKRLVSQSKQSRSNEIPSSSLYWPSRYVSSLSP----YTFQARNNAKS  56

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
                  + QQ RSISVEALKPSDTFPRRHNSATPE+Q+KMAEFCGF SLDALIDATVPQSI
Sbjct  57    F----NTQQARSISVEALKPSDTFPRRHNSATPEEQTKMAEFCGFQSLDALIDATVPQSI  112

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             R +SMK PKFD GLTE+QMI+HM+ LASKNKVFKSYIGMGYYNT+VPPVILRN++ENP W
Sbjct  113   RSESMKLPKFDGGLTESQMIDHMQKLASKNKVFKSYIGMGYYNTYVPPVILRNLLENPAW  172

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  173   YTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGK  232

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTIDICKTRADGF+LKVVT DLKDIDYKSGDVCGVLVQYPGTEGE+LD
Sbjct  233   KKTFLIASNCHPQTIDICKTRADGFDLKVVTVDLKDIDYKSGDVCGVLVQYPGTEGEILD  292

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  293   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  343



>ref|XP_004245101.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Solanum lycopersicum]
Length=1036

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/352 (84%), Positives = 322/352 (91%), Gaps = 9/352 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA-AALHRPARYVSSLAPCAAMYENQRRYSGA  253
             MERARKLANRAIL+RLV ++KQ R+NE P+ ++L+RP+RYVSSL+P    Y  Q R S  
Sbjct  1     MERARKLANRAILKRLVSQSKQSRSNEIPSPSSLYRPSRYVSSLSP----YTFQARNSVK  56

Query  254   GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  433
                   + QQ RSISVEALKPSDTFPRRHNSATPE+Q+KMAEFCGF SLDALIDATVPQS
Sbjct  57    SF----NTQQVRSISVEALKPSDTFPRRHNSATPEEQTKMAEFCGFQSLDALIDATVPQS  112

Query  434   IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
             IR +SMK PKFD GLTE+QMIEHM+ LASKNKVFKSYIGMGYYNT+VPPVILRN++ENP 
Sbjct  113   IRSESMKLPKFDGGLTESQMIEHMQKLASKNKVFKSYIGMGYYNTYVPPVILRNLLENPA  172

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KG
Sbjct  173   WYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKG  232

Query  794   KKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVL  973
             KKKTF+IA+NCHPQTI+ICKTRADGF+LKVVT DLKDIDYKSGDVCGVLVQYPGTEGE+L
Sbjct  233   KKKTFLIANNCHPQTIEICKTRADGFDLKVVTVDLKDIDYKSGDVCGVLVQYPGTEGEIL  292

Query  974   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  293   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  344



>ref|XP_009361869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X2 [Pyrus x bretschneideri]
Length=1049

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/363 (80%), Positives = 319/363 (88%), Gaps = 17/363 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETP------AAALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LANRA ++RLV EAKQ R NE+       +  L+ P+RYVSSL+PC+    + R
Sbjct  1     MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSSPR  60

Query  239   ------RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  400
                   R +   AGF     Q RSISV+ALK SDTFPRRHNSATPE+Q+KMAE CGF  L
Sbjct  61    SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCGFDGL  115

Query  401   DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  580
             D+LIDATVP+SIRL+SMKFPKFD GLTE+QMIEHMKNLASKNK+FKS+IGMGYYNT+VPP
Sbjct  116   DSLIDATVPKSIRLESMKFPKFDEGLTESQMIEHMKNLASKNKIFKSFIGMGYYNTYVPP  175

Query  581   VILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAE  760
             VILRNIMENP WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAE
Sbjct  176   VILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAAE  235

Query  761   AMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVL  940
             AMAMCNNI KGKKKTF+IA+NCHPQTIDICKTRADGF+LKVVTADLKD+DY SGDVCGVL
Sbjct  236   AMAMCNNIQKGKKKTFVIANNCHPQTIDICKTRADGFDLKVVTADLKDVDYSSGDVCGVL  295

Query  941   VQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVP  1120
             VQYPGTEGEVLDYGEFIKNAHA+GVKVVMASDLLALT+LKPPGE GADIVVGSAQRFGVP
Sbjct  296   VQYPGTEGEVLDYGEFIKNAHANGVKVVMASDLLALTVLKPPGEFGADIVVGSAQRFGVP  355

Query  1121  MGY  1129
             MGY
Sbjct  356   MGY  358



>ref|XP_010047334.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Eucalyptus grandis]
 gb|KCW79221.1| hypothetical protein EUGRSUZ_C00646 [Eucalyptus grandis]
Length=1053

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/360 (80%), Positives = 321/360 (89%), Gaps = 9/360 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET----PAAALHRPARYVSSLAPCAAMYENQRR-  241
             MERAR+LANRAIL+R+V E K  R  E+     ++AL+ P+RYVSSL+ C++M+++ R  
Sbjct  1     MERARRLANRAILKRIVSETKHHRRLESGLDSSSSALYTPSRYVSSLSACSSMHKSSRSE  60

Query  242   -YSGAGAGFPASH---QQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  409
                G    +   H    Q R+ISVEALKP+DTF RRHNSATPE+Q+KMAE CGF SLDAL
Sbjct  61    MLLGRNVSYNVGHGIGSQTRTISVEALKPNDTFARRHNSATPEEQTKMAESCGFGSLDAL  120

Query  410   IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  589
             IDATVP+SIR+DSMKF KFD GLTE+QMIEHMKNLASKNKVFK++IGMGYYNTFVPPVIL
Sbjct  121   IDATVPKSIRIDSMKFSKFDGGLTESQMIEHMKNLASKNKVFKTFIGMGYYNTFVPPVIL  180

Query  590   RNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA  769
             RNIMENP WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMA
Sbjct  181   RNIMENPAWYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMA  240

Query  770   MCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQY  949
             MCNNI KGKKKTF+IA+NCHPQTID+CKTRADGF+LKVVTADLKDIDYKSGDVCGVLVQY
Sbjct  241   MCNNILKGKKKTFVIANNCHPQTIDVCKTRADGFDLKVVTADLKDIDYKSGDVCGVLVQY  300

Query  950   PGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             PGTEGEVLDYGEF+KNAH+HGVKVVMA+DLLALTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  301   PGTEGEVLDYGEFVKNAHSHGVKVVMATDLLALTMLKPPGEFGADIVVGSAQRFGVPMGY  360



>ref|XP_009361863.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361876.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X3 [Pyrus x bretschneideri]
Length=1049

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/363 (80%), Positives = 319/363 (88%), Gaps = 17/363 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETP------AAALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LANRA ++RLV EAKQ R NE+       +  L+ P+RYVSSL+PC+    + R
Sbjct  1     MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSSPR  60

Query  239   ------RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  400
                   R +   AGF     Q RSISV+ALK SDTFPRRHNSATPE+Q+KMAE CGF  L
Sbjct  61    SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCGFDGL  115

Query  401   DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  580
             D+LIDATVP+SIRL+SMKFPKFD GLTE+QMIEHMKNLASKNK+FKS+IGMGYYNT+VPP
Sbjct  116   DSLIDATVPKSIRLESMKFPKFDEGLTESQMIEHMKNLASKNKIFKSFIGMGYYNTYVPP  175

Query  581   VILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAE  760
             VILRNIMENP WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAE
Sbjct  176   VILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAAE  235

Query  761   AMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVL  940
             AMAMCNNI KGKKKTF+IA+NCHPQTIDICKTRADGF+LKVVTADLKD+DY SGDVCGVL
Sbjct  236   AMAMCNNIQKGKKKTFVIANNCHPQTIDICKTRADGFDLKVVTADLKDVDYSSGDVCGVL  295

Query  941   VQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVP  1120
             VQYPGTEGEVLDYGEFIKNAHA+GVKVVMASDLLALT+LKPPGE GADIVVGSAQRFGVP
Sbjct  296   VQYPGTEGEVLDYGEFIKNAHANGVKVVMASDLLALTVLKPPGEFGADIVVGSAQRFGVP  355

Query  1121  MGY  1129
             MGY
Sbjct  356   MGY  358



>ref|NP_001289247.1| glycine dehydrogenase (decarboxylating), mitochondrial [Pyrus 
x bretschneideri]
 gb|AHM26626.1| glycine dehydrogenase decarboxylating protein [Pyrus x bretschneideri]
Length=1049

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/363 (80%), Positives = 319/363 (88%), Gaps = 17/363 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETP------AAALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LANRA ++RLV EAKQ R NE+       +  L+ P+RYVSSL+PC+    + R
Sbjct  1     MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSSPR  60

Query  239   ------RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  400
                   R +   AGF     Q RSISV+ALK SDTFPRRHNSATPE+Q+KMAE CGF  L
Sbjct  61    SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCGFDGL  115

Query  401   DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  580
             D+LIDATVP+SIRL+SMKFPKFD GLTE+QMIEHMKNLASKNK+FKS+IGMGYYNT+VPP
Sbjct  116   DSLIDATVPKSIRLESMKFPKFDEGLTESQMIEHMKNLASKNKIFKSFIGMGYYNTYVPP  175

Query  581   VILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAE  760
             VILRNIMENP WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAE
Sbjct  176   VILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAAE  235

Query  761   AMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVL  940
             AMAMCNNI KGKKKTF+IA+NCHPQTIDICKTRADGF+LKVVTADLKD+DY SGDVCGVL
Sbjct  236   AMAMCNNIQKGKKKTFVIANNCHPQTIDICKTRADGFDLKVVTADLKDVDYSSGDVCGVL  295

Query  941   VQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVP  1120
             VQYPGTEGEVLDYGEFIKNAHA+GVKVVMASDLLALT+LKPPGE GADIVVGSAQRFGVP
Sbjct  296   VQYPGTEGEVLDYGEFIKNAHANGVKVVMASDLLALTVLKPPGEFGADIVVGSAQRFGVP  355

Query  1121  MGY  1129
             MGY
Sbjct  356   MGY  358



>gb|KCW81693.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=838

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/361 (81%), Positives = 313/361 (87%), Gaps = 10/361 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET----PAAALHRPARYVSSLAPCAAMYENQRRY  244
             MERAR+LANRAIL+RLV E+KQ R +E+     +  +  P+RYVSSL P  +M  + R  
Sbjct  1     MERARRLANRAILKRLVSESKQYRQDESLLSSSSPVIFTPSRYVSSLVPHGSMSRSSRSD  60

Query  245   SGAGAGFPASH------QQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  406
                G    +S        Q RSISVEALKP+DTFPRRHNSATPE+Q+KMAE+CGF +LD+
Sbjct  61    MSVGRHVSSSSTSYGVGSQARSISVEALKPNDTFPRRHNSATPEEQTKMAEYCGFDNLDS  120

Query  407   LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  586
             LIDATVP+SIRLDSMKF KFD GLTE+QMI HMKNL SKNKVFKSYIGMGYYNT VPPVI
Sbjct  121   LIDATVPKSIRLDSMKFSKFDEGLTESQMIAHMKNLESKNKVFKSYIGMGYYNTSVPPVI  180

Query  587   LRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM  766
             LRNIMENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM
Sbjct  181   LRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM  240

Query  767   AMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQ  946
             AMCNNI KGKKKTFIIASNCHPQT DICKTRADGF+LKVV ADLKDIDYKSGDVCGVLVQ
Sbjct  241   AMCNNIQKGKKKTFIIASNCHPQTFDICKTRADGFDLKVVAADLKDIDYKSGDVCGVLVQ  300

Query  947   YPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
             YPGTEGEVLDY EF+KNAHAHGVKVVMASDLLALTMLKPPGE GADIVVGSAQRFGVPMG
Sbjct  301   YPGTEGEVLDYAEFVKNAHAHGVKVVMASDLLALTMLKPPGEFGADIVVGSAQRFGVPMG  360

Query  1127  Y  1129
             Y
Sbjct  361   Y  361



>gb|KJB65558.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=945

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/355 (82%), Positives = 315/355 (89%), Gaps = 5/355 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMYENQRRYSG  250
             MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y ++    G
Sbjct  1     MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKYYSRSDLLG  60

Query  251   AGAGFPAS--HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  424
              G   P S   QQ RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLD+LIDATV
Sbjct  61    -GRNVPNSFGSQQVRSISVEALKSSDTFPRRHNSATPEEQAKMAESCGFDSLDSLIDATV  119

Query  425   PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  604
             P++IR+DSMKF KFD GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIME
Sbjct  120   PKAIRIDSMKFSKFDEGLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIME  179

Query  605   NPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  784
             NP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI
Sbjct  180   NPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  239

Query  785   FKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEG  964
              KGKKKTFIIA+NCHPQTIDICKTRADGF+LKVVTADLKDIDY SGDVCGVLVQYPGTEG
Sbjct  240   LKGKKKTFIIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYSSGDVCGVLVQYPGTEG  299

Query  965   EVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EVLDYGEFIKNAHAHGVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  300   EVLDYGEFIKNAHAHGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  354



>gb|KJB65559.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=973

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/355 (82%), Positives = 315/355 (89%), Gaps = 5/355 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMYENQRRYSG  250
             MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y ++    G
Sbjct  1     MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKYYSRSDLLG  60

Query  251   AGAGFPAS--HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  424
              G   P S   QQ RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLD+LIDATV
Sbjct  61    -GRNVPNSFGSQQVRSISVEALKSSDTFPRRHNSATPEEQAKMAESCGFDSLDSLIDATV  119

Query  425   PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  604
             P++IR+DSMKF KFD GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIME
Sbjct  120   PKAIRIDSMKFSKFDEGLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIME  179

Query  605   NPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  784
             NP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI
Sbjct  180   NPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  239

Query  785   FKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEG  964
              KGKKKTFIIA+NCHPQTIDICKTRADGF+LKVVTADLKDIDY SGDVCGVLVQYPGTEG
Sbjct  240   LKGKKKTFIIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYSSGDVCGVLVQYPGTEG  299

Query  965   EVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EVLDYGEFIKNAHAHGVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  300   EVLDYGEFIKNAHAHGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  354



>ref|XP_008393646.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Malus domestica]
Length=1049

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/363 (80%), Positives = 317/363 (87%), Gaps = 17/363 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETP------AAALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LANRA ++RLV EAKQ R NE+       +  L+ P+RYVSSL+PC+      R
Sbjct  1     MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSCPR  60

Query  239   ------RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  400
                   R +   AGF     Q RSISV+ALK SDTFPRRHNSATPE+Q+KMAE CGF +L
Sbjct  61    SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCGFDAL  115

Query  401   DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  580
             D+LIDATVP+SIRL+SMKF KFD GLTE+QMIEHMK LASKNK+FKS+IGMGYYNT+VPP
Sbjct  116   DSLIDATVPKSIRLESMKFQKFDEGLTESQMIEHMKKLASKNKIFKSFIGMGYYNTYVPP  175

Query  581   VILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAE  760
             VILRNIMENP WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAE
Sbjct  176   VILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAAE  235

Query  761   AMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVL  940
             AMAMCNNI KGKKKTF+IA+NCHPQTIDICKTRADGF+LKVVTADLKD+DY SGDVCGVL
Sbjct  236   AMAMCNNIQKGKKKTFVIANNCHPQTIDICKTRADGFDLKVVTADLKDVDYSSGDVCGVL  295

Query  941   VQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVP  1120
             VQYPGTEGEVLDYGEFIKNAHA+GVKVVMASDLLALT+LKPPGE GADIVVGSAQRFGVP
Sbjct  296   VQYPGTEGEVLDYGEFIKNAHANGVKVVMASDLLALTVLKPPGEFGADIVVGSAQRFGVP  355

Query  1121  MGY  1129
             MGY
Sbjct  356   MGY  358



>gb|KJB65560.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=1047

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/355 (82%), Positives = 315/355 (89%), Gaps = 5/355 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMYENQRRYSG  250
             MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y ++    G
Sbjct  1     MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKYYSRSDLLG  60

Query  251   AGAGFPAS--HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  424
              G   P S   QQ RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLD+LIDATV
Sbjct  61    -GRNVPNSFGSQQVRSISVEALKSSDTFPRRHNSATPEEQAKMAESCGFDSLDSLIDATV  119

Query  425   PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  604
             P++IR+DSMKF KFD GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIME
Sbjct  120   PKAIRIDSMKFSKFDEGLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIME  179

Query  605   NPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  784
             NP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI
Sbjct  180   NPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  239

Query  785   FKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEG  964
              KGKKKTFIIA+NCHPQTIDICKTRADGF+LKVVTADLKDIDY SGDVCGVLVQYPGTEG
Sbjct  240   LKGKKKTFIIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYSSGDVCGVLVQYPGTEG  299

Query  965   EVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EVLDYGEFIKNAHAHGVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  300   EVLDYGEFIKNAHAHGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  354



>ref|XP_004291039.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Fragaria vesca subsp. vesca]
Length=1048

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/358 (81%), Positives = 314/358 (88%), Gaps = 8/358 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAAL-------HRPARYVSSLAPCAAMYENQ  235
             MERAR+LANRA ++RLV EAKQ R NET +A L         P+RYVSSL+         
Sbjct  1     MERARRLANRAFVKRLVSEAKQFRQNETSSALLGSSSPVMFTPSRYVSSLSSFIRTNPRS  60

Query  236   RRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALID  415
                 G+ AG   S QQ RSI+VEALK SDTF RRHNSATPE+Q+KMA  CGF SLD+LID
Sbjct  61    DSLLGSKAGIAGS-QQTRSIAVEALKSSDTFARRHNSATPEEQTKMAGLCGFDSLDSLID  119

Query  416   ATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  595
             ATVP+SIRL+SMKF KFD GLTE+QM+EHMK LASKNK+FKSYIGMGYYNT+VPPVILRN
Sbjct  120   ATVPKSIRLESMKFSKFDEGLTESQMLEHMKVLASKNKLFKSYIGMGYYNTYVPPVILRN  179

Query  596   IMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMC  775
             IMENP WYTQYTPYQAEI+QGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMC
Sbjct  180   IMENPAWYTQYTPYQAEIAQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAAEAMAMC  239

Query  776   NNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPG  955
             NNI KGKKKTF+IA+NCHPQTIDICKTRADGF+LKVVTADLKDIDYKSGDVCGVLVQYPG
Sbjct  240   NNIQKGKKKTFVIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYKSGDVCGVLVQYPG  299

Query  956   TEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             TEGEVLDYGEFIKNAHA+GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  300   TEGEVLDYGEFIKNAHANGVKVVMASDLLALTLLKPPGELGADIVVGSAQRFGVPMGY  357



>ref|XP_010049196.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW81692.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=1053

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/361 (81%), Positives = 313/361 (87%), Gaps = 10/361 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET----PAAALHRPARYVSSLAPCAAMYENQRRY  244
             MERAR+LANRAIL+RLV E+KQ R +E+     +  +  P+RYVSSL P  +M  + R  
Sbjct  1     MERARRLANRAILKRLVSESKQYRQDESLLSSSSPVIFTPSRYVSSLVPHGSMSRSSRSD  60

Query  245   SGAGAGFPASH------QQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  406
                G    +S        Q RSISVEALKP+DTFPRRHNSATPE+Q+KMAE+CGF +LD+
Sbjct  61    MSVGRHVSSSSTSYGVGSQARSISVEALKPNDTFPRRHNSATPEEQTKMAEYCGFDNLDS  120

Query  407   LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  586
             LIDATVP+SIRLDSMKF KFD GLTE+QMI HMKNL SKNKVFKSYIGMGYYNT VPPVI
Sbjct  121   LIDATVPKSIRLDSMKFSKFDEGLTESQMIAHMKNLESKNKVFKSYIGMGYYNTSVPPVI  180

Query  587   LRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM  766
             LRNIMENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM
Sbjct  181   LRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM  240

Query  767   AMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQ  946
             AMCNNI KGKKKTFIIASNCHPQT DICKTRADGF+LKVV ADLKDIDYKSGDVCGVLVQ
Sbjct  241   AMCNNIQKGKKKTFIIASNCHPQTFDICKTRADGFDLKVVAADLKDIDYKSGDVCGVLVQ  300

Query  947   YPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
             YPGTEGEVLDY EF+KNAHAHGVKVVMASDLLALTMLKPPGE GADIVVGSAQRFGVPMG
Sbjct  301   YPGTEGEVLDYAEFVKNAHAHGVKVVMASDLLALTMLKPPGEFGADIVVGSAQRFGVPMG  360

Query  1127  Y  1129
             Y
Sbjct  361   Y  361



>gb|AAU94363.1| glycine decarboxylase P-protein [Moricandia nitens]
Length=497

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/356 (76%), Positives = 304/356 (85%), Gaps = 9/356 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LA R I+RRLV+E+K+ R  E      P+   H PARY+SSL+P    Y +  R
Sbjct  1     MERARRLAYRGIVRRLVNESKRHRKGEITPHHVPSVVPHAPARYISSLSP----YLSNHR  56

Query  242   YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  421
                 GA    +H Q RSISVEA+KP DTFPRRHNSATP++Q+ MA+ CG+  +D+L+DAT
Sbjct  57    SVNVGARHHHNHHQTRSISVEAVKPGDTFPRRHNSATPDEQAHMAKLCGYDHIDSLVDAT  116

Query  422   VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  601
             VP+ IR+DSMKF KFD GLTE+QMI HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+
Sbjct  117   VPKQIRIDSMKFSKFDEGLTESQMIAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNIL  176

Query  602   ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  781
             ENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN
Sbjct  177   ENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  236

Query  782   IFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTE  961
             I KGKKKTF+IASNCHPQTIDICK RADGF+LKVVT DLK+IDY  GDVCGVLVQYPGTE
Sbjct  237   IQKGKKKTFVIASNCHPQTIDICKARADGFDLKVVTKDLKEIDYSCGDVCGVLVQYPGTE  296

Query  962   GEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             GEVLDYGEF+KNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  297   GEVLDYGEFVKNAHANGVKVVMATDLLALTVLKPPGEFGADIVVGSAQRFGVPMGY  352



>gb|KJB54687.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1050

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/360 (81%), Positives = 316/360 (88%), Gaps = 12/360 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAPCAAMYENQRRYSG  250
             MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P  +  +N  R   
Sbjct  1     MERARKVANRAILKRLVNESKQSRNGEMSSRSPVSYTPSRYVSSLSPFGS--KNHSRSDS  58

Query  251   AGA-------GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  409
              GA       GF     Q RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLDAL
Sbjct  59    LGARNVSNNVGFGVG-SQIRSISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLDAL  117

Query  410   IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  589
             IDATVP++IR+DSMKFPKFD GLTE+QMIEHMK+L SKNK+FKS+IGMGYYNT VPPVIL
Sbjct  118   IDATVPKAIRIDSMKFPKFDGGLTESQMIEHMKDLESKNKIFKSFIGMGYYNTHVPPVIL  177

Query  590   RNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA  769
             RNIMENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA
Sbjct  178   RNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA  237

Query  770   MCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQY  949
             MCNNI KGKKKTFIIA+NCHPQTIDICKTRADGF+LKVVTADLKDIDY SGDVCGVLVQY
Sbjct  238   MCNNIVKGKKKTFIIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYSSGDVCGVLVQY  297

Query  950   PGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             PGTEGE+LDYGEF+KNAHA GVKVVMA+DLLAL MLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  298   PGTEGEILDYGEFVKNAHAQGVKVVMATDLLALIMLKPPGELGADIVVGSAQRFGVPMGY  357



>gb|KJB54688.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1053

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/360 (81%), Positives = 316/360 (88%), Gaps = 12/360 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANE--TPAAALHRPARYVSSLAPCAAMYENQRRYSG  250
             MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P  +  +N  R   
Sbjct  1     MERARKVANRAILKRLVNESKQSRNGEMSSRSPVSYTPSRYVSSLSPFGS--KNHSRSDS  58

Query  251   AGA-------GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  409
              GA       GF     Q RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLDAL
Sbjct  59    LGARNVSNNVGFGVG-SQIRSISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLDAL  117

Query  410   IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  589
             IDATVP++IR+DSMKFPKFD GLTE+QMIEHMK+L SKNK+FKS+IGMGYYNT VPPVIL
Sbjct  118   IDATVPKAIRIDSMKFPKFDGGLTESQMIEHMKDLESKNKIFKSFIGMGYYNTHVPPVIL  177

Query  590   RNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA  769
             RNIMENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA
Sbjct  178   RNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA  237

Query  770   MCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQY  949
             MCNNI KGKKKTFIIA+NCHPQTIDICKTRADGF+LKVVTADLKDIDY SGDVCGVLVQY
Sbjct  238   MCNNIVKGKKKTFIIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYSSGDVCGVLVQY  297

Query  950   PGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             PGTEGE+LDYGEF+KNAHA GVKVVMA+DLLAL MLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  298   PGTEGEILDYGEFVKNAHAQGVKVVMATDLLALIMLKPPGELGADIVVGSAQRFGVPMGY  357



>gb|KHG06307.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1028

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/360 (81%), Positives = 315/360 (88%), Gaps = 12/360 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  250
             MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P  +  +N  R   
Sbjct  1     MERARKVANRAILKRLVNESKQSRNGEISSRSPVSYTPSRYVSSLSPFGS--KNHSRSDS  58

Query  251   AGA-------GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  409
              GA       GF     Q RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLDAL
Sbjct  59    LGARNVSNNVGFGVG-SQIRSISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLDAL  117

Query  410   IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  589
             IDATVP++IR+DSMKF KFD GLTE+QMIEHMK+L SKNK+FKS+IGMGYYNT VPPVIL
Sbjct  118   IDATVPKAIRIDSMKFSKFDGGLTESQMIEHMKDLESKNKIFKSFIGMGYYNTHVPPVIL  177

Query  590   RNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA  769
             RNIMENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA
Sbjct  178   RNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA  237

Query  770   MCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQY  949
             MCNNI KGKKKTFIIA+NCHPQTIDICKTRADGF+LKVVTADLKDIDY SGDVCGVLVQY
Sbjct  238   MCNNIVKGKKKTFIIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYSSGDVCGVLVQY  297

Query  950   PGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             PGTEGE+LDYGEFIKNAHA GVKVVMA+DLLAL MLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  298   PGTEGEILDYGEFIKNAHAQGVKVVMATDLLALIMLKPPGELGADIVVGSAQRFGVPMGY  357



>ref|XP_011081684.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1037

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/356 (81%), Positives = 313/356 (88%), Gaps = 17/356 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAA-----MYENQRR  241
             MERARKLANRAILRRLV E+KQ          L++ +RY+SSL+P        + +    
Sbjct  1     MERARKLANRAILRRLVSESKQ--------QPLYQSSRYISSLSPSVVHGGSNVVKAHSF  52

Query  242   YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  421
              S + A F  S    RSISVEALKPSDTFPRRHNSATPE+QSKMAEF GF SLD+LIDAT
Sbjct  53    NSTSLAQFVGS----RSISVEALKPSDTFPRRHNSATPEEQSKMAEFVGFNSLDSLIDAT  108

Query  422   VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  601
             VP+SIR++ M+FP FD GLTEAQM+EHMK+LASKNK+FKSYIGMGYYNTFVPPVILRNIM
Sbjct  109   VPKSIRIEKMEFPIFDEGLTEAQMLEHMKDLASKNKIFKSYIGMGYYNTFVPPVILRNIM  168

Query  602   ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  781
             ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN
Sbjct  169   ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  228

Query  782   IFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTE  961
             I KGKKKTF+IASNCHPQTIDIC+TRADGF+LKVV +D+KDIDYKSGDVCGVLVQYPGTE
Sbjct  229   ILKGKKKTFVIASNCHPQTIDICQTRADGFDLKVVVSDVKDIDYKSGDVCGVLVQYPGTE  288

Query  962   GEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             GE+LDY EFIKNAHA+GVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  289   GEILDYAEFIKNAHANGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  344



>gb|KHG00684.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1047

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/355 (81%), Positives = 313/355 (88%), Gaps = 5/355 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETP--AAALHRPARYVSSLAPCAAMYENQRRYSG  250
             MERAR+LA+RAILRRLV+E KQ    +    +  L+ P+RYVSSL+P  +   ++    G
Sbjct  1     MERARRLASRAILRRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKCYSRSDLLG  60

Query  251   AGAGFPAS--HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  424
              G   P S   QQ RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SL +LIDATV
Sbjct  61    -GRNVPNSFGSQQLRSISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLYSLIDATV  119

Query  425   PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  604
             P++IR+DSMKF KFD GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIME
Sbjct  120   PKAIRIDSMKFSKFDEGLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIME  179

Query  605   NPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  784
             NP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI
Sbjct  180   NPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  239

Query  785   FKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEG  964
              KGKKKTFIIA+NCHPQTIDICKTRADGF+LKVVTADLKDIDY SGDVCGVLVQYPGTEG
Sbjct  240   LKGKKKTFIIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYSSGDVCGVLVQYPGTEG  299

Query  965   EVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EVLDYGEFIKNAHAHGVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  300   EVLDYGEFIKNAHAHGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  354



>ref|XP_012077290.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Jatropha curcas]
 gb|KDP34101.1| hypothetical protein JCGZ_07672 [Jatropha curcas]
Length=1059

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/366 (77%), Positives = 319/366 (87%), Gaps = 15/366 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLR---ANETPA------AALHRPARYVSSLA------P  211
             MERAR+LANRAIL+RLV+E++Q      NE+ A        L+ P+RYVSSL+      P
Sbjct  1     MERARRLANRAILKRLVNESRQCSHQGRNESSALLNSSSPVLYSPSRYVSSLSSFASRNP  60

Query  212   CAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGF  391
              +  ++  +  + + AG+     Q RSISVE+LKPSDTFPRRHNSATPE+Q+KMAE CGF
Sbjct  61    RSGFFQGGKNVAASAAGYYGVGSQVRSISVESLKPSDTFPRRHNSATPEEQTKMAEVCGF  120

Query  392   PSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTF  571
              +LD+LIDATVP+SI++DSMKFPKFD GLTE+QM+EHMK LASKNKVFKSYIGMGYYNT 
Sbjct  121   DNLDSLIDATVPKSIKIDSMKFPKFDEGLTESQMVEHMKKLASKNKVFKSYIGMGYYNTH  180

Query  572   VPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTA  751
             VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTA
Sbjct  181   VPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTA  240

Query  752   AAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVC  931
             AAEAMAMCNNI KGKKKTFIIA+NCHPQTIDICKTRADGF++KVVT DLK+I+YK GDVC
Sbjct  241   AAEAMAMCNNILKGKKKTFIIANNCHPQTIDICKTRADGFDIKVVTMDLKEINYKCGDVC  300

Query  932   GVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRF  1111
             GVLVQYPGTEGE+LDY EFIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGSAQRF
Sbjct  301   GVLVQYPGTEGEILDYEEFIKNAHANGVKVVMATDLLALTVLKPPGELGADIVVGSAQRF  360

Query  1112  GVPMGY  1129
             GVPMGY
Sbjct  361   GVPMGY  366



>ref|XP_006382015.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
 gb|ERP59812.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
Length=677

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/367 (79%), Positives = 311/367 (85%), Gaps = 16/367 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYVSSLA------PC  214
             MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYVSSL+      P 
Sbjct  1     MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  215   AAMYENQRRY--SGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCG  388
             + +    +        AG      Q RSISVE+LKPSDTFPRRHNSATPE+Q+KMAE CG
Sbjct  61    SGLLPGTKNIVSHNVPAGSYGIGSQIRSISVESLKPSDTFPRRHNSATPEEQTKMAELCG  120

Query  389   FPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  568
             F +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHM  LASKNKVFKSYIGMGYYNT
Sbjct  121   FDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMNYLASKNKVFKSYIGMGYYNT  180

Query  569   FVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGT  748
              VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGT
Sbjct  181   HVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGT  240

Query  749   AAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDV  928
             AAAEAMAMCNNI KGKKKTFIIA+NCHPQTIDIC TRA GF+LKVVTADLKDIDYKSGDV
Sbjct  241   AAAEAMAMCNNIQKGKKKTFIIANNCHPQTIDICDTRAGGFDLKVVTADLKDIDYKSGDV  300

Query  929   CGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR  1108
             CGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR
Sbjct  301   CGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR  360

Query  1109  FGVPMGY  1129
             FGVPMGY
Sbjct  361   FGVPMGY  367



>ref|XP_007012280.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
 gb|EOY29899.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
Length=1050

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/358 (80%), Positives = 317/358 (89%), Gaps = 8/358 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  250
             MERAR++ANRAIL+RLV+ AKQ R  E  + +  L+ P+RYVSSL+P  +   ++    G
Sbjct  1     MERARRVANRAILKRLVNAAKQSRNGEISSRSPVLYTPSRYVSSLSPFGSKSYSRSDLLG  60

Query  251   A-----GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALID  415
             A      AGF     Q RSISVEALK SDTFPRRHNSATPE+Q KMA+ CGF +LD+LID
Sbjct  61    ARNVSNNAGFGVG-SQIRSISVEALKSSDTFPRRHNSATPEEQIKMAQSCGFDNLDSLID  119

Query  416   ATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  595
             ATVP++IR+DSMKF KFD GLTE+QMIEHM+NLASKNK+FKS+IGMGYYNT+VPPVILRN
Sbjct  120   ATVPKAIRIDSMKFSKFDGGLTESQMIEHMQNLASKNKIFKSFIGMGYYNTYVPPVILRN  179

Query  596   IMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMC  775
             IMENP WYTQYTPYQAE+SQGRLESLLNFQTMI+DLTGLPMSNASLLDEGTAAAEAMAMC
Sbjct  180   IMENPAWYTQYTPYQAEVSQGRLESLLNFQTMISDLTGLPMSNASLLDEGTAAAEAMAMC  239

Query  776   NNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPG  955
             NNI KGKKKTFIIA+NCHPQTIDICKTRA GF+LKVVTADLKDIDY SGDVCGVLVQYPG
Sbjct  240   NNILKGKKKTFIIANNCHPQTIDICKTRAGGFDLKVVTADLKDIDYSSGDVCGVLVQYPG  299

Query  956   TEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             TEGE+LDYGEF+KNAHA+GVKVVMA+DLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  300   TEGEILDYGEFVKNAHANGVKVVMATDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  357



>gb|AAN17423.1| P-Protein - like protein [Arabidopsis thaliana]
Length=956

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/351 (79%), Positives = 310/351 (88%), Gaps = 5/351 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1     MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57    AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116   RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  176   YTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGK  235

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTID+CKTRADGF+LKVVT+DLKDIDY SGDVCGVLVQYPGTEGEVLD
Sbjct  236   KKTFVIASNCHPQTIDVCKTRADGFDLKVVTSDLKDIDYSSGDVCGVLVQYPGTEGEVLD  295

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             Y EF+KNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  296   YAEFVKNAHANGVKVVMATDLLALTVLKPPGEFGADIVVGSAQRFGVPMGY  346



>ref|XP_002867212.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43471.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
Length=1037

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/351 (80%), Positives = 308/351 (88%), Gaps = 5/351 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1     MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FLSTHRSVNPA  56

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A F   HQQ RSISV+ALKP DTFPRRHNSATP++QS MA+FCGF  +D+LIDATVP+SI
Sbjct  57    AAF-GRHQQTRSISVDALKPGDTFPRRHNSATPDEQSHMAKFCGFDHIDSLIDATVPKSI  115

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             RLDSMKF KFD GLTE+QMIEHM +LASKNKV KS+IGMGYYNT VP VILRNIMENP W
Sbjct  116   RLDSMKFSKFDGGLTESQMIEHMVDLASKNKVLKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  176   YTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGK  235

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTID+CKTRA+GF+LKVVTADLKDIDY SGDVCGVLVQYPGTEGEVLD
Sbjct  236   KKTFVIASNCHPQTIDVCKTRAEGFDLKVVTADLKDIDYSSGDVCGVLVQYPGTEGEVLD  295

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             Y EF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  296   YAEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSAQRFGVPMGY  346



>ref|XP_006283054.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
 gb|EOA15952.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
Length=1038

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/352 (80%), Positives = 312/352 (89%), Gaps = 6/352 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYENQRRYSGA  253
             MERAR+LA R I++RLV+EAK+ R  ETP   + H PARYVSSL+P  + +      S A
Sbjct  1     MERARRLAYRGIVKRLVNEAKRHRNPETPHLVVPHAPARYVSSLSPFVSTHR-----SPA  55

Query  254   GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  433
               G   SHQQ R ISVEAL+P DTFPRRHNSATP++QS MA+FCGF  +D+L+DATVP+S
Sbjct  56    SFGRHHSHQQTRPISVEALQPGDTFPRRHNSATPDEQSHMAKFCGFDHIDSLVDATVPKS  115

Query  434   IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
             IRLDSMKF KFD GLTE+QMIEHM +LASKNK+FKS+IGMGYYNT+VPPVILRNIMENP 
Sbjct  116   IRLDSMKFSKFDGGLTESQMIEHMVDLASKNKIFKSFIGMGYYNTYVPPVILRNIMENPA  175

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KG
Sbjct  176   WYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKG  235

Query  794   KKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVL  973
             KKKTF+IASNCHPQTIDICKTRA GF+LKV++ADLKDIDY SGDVCGVLVQYPGTEGEVL
Sbjct  236   KKKTFLIASNCHPQTIDICKTRAGGFDLKVLSADLKDIDYSSGDVCGVLVQYPGTEGEVL  295

Query  974   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DY EF+K AHA+GVKVVMA+DLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  296   DYAEFVKTAHANGVKVVMATDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  347



>ref|NP_001119106.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 gb|AEE86160.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=976

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/351 (79%), Positives = 310/351 (88%), Gaps = 5/351 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1     MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57    AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116   RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  176   YTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGK  235

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTID+CKTRADGF+LKVVT+DLKDIDY SGDVCGVLVQYPGTEGEVLD
Sbjct  236   KKTFVIASNCHPQTIDVCKTRADGFDLKVVTSDLKDIDYSSGDVCGVLVQYPGTEGEVLD  295

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             Y EF+KNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  296   YAEFVKNAHANGVKVVMATDLLALTVLKPPGEFGADIVVGSAQRFGVPMGY  346



>gb|EYU29323.1| hypothetical protein MIMGU_mgv1a000648mg [Erythranthe guttata]
Length=1032

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/351 (81%), Positives = 305/351 (87%), Gaps = 12/351 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERARKLANRAILRRL  E+KQ          L++ +RYVSSL+P A   + +   S   
Sbjct  1     MERARKLANRAILRRLFSESKQ--------QPLYKSSRYVSSLSPSAVQQQGRTTNSKTL  52

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             + F  +    RSISV ALKPSDTFPRRHNSATPEDQSKMAEF GF +LD LIDATVP+SI
Sbjct  53    SQFLGA----RSISVAALKPSDTFPRRHNSATPEDQSKMAEFVGFKTLDELIDATVPKSI  108

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             R+D M  P F  GLTEAQM+ HM +LASKNKVFKSYIGMGYYNT+VPPVILRNIMENPGW
Sbjct  109   RIDKMDLPIFGEGLTEAQMLSHMSDLASKNKVFKSYIGMGYYNTYVPPVILRNIMENPGW  168

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLN+QTMITDLT LPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  169   YTQYTPYQAEISQGRLESLLNYQTMITDLTALPMSNASLLDEGTAAAEAMAMCNNILKGK  228

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTFIIASNCHPQTIDICKTRADGF+LKVV +D+KDIDYKSGDVCGVLVQYPGTEGEVLD
Sbjct  229   KKTFIIASNCHPQTIDICKTRADGFDLKVVVSDVKDIDYKSGDVCGVLVQYPGTEGEVLD  288

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEFIKNAHA+GVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  289   YGEFIKNAHANGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  339



>emb|CAN63089.1| hypothetical protein VITISV_032016 [Vitis vinifera]
Length=1036

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/362 (80%), Positives = 312/362 (86%), Gaps = 12/362 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLR-----ANETPAAALHRPARYVSSLAPCAAMYENQR-  238
             MERAR++ANRAILRRLV E+KQ R      NE    +     RYVSSL  CA   +  R 
Sbjct  1     MERARRIANRAILRRLVSESKQQRPCPRPQNEGLVNSSFSGWRYVSSLPTCAFPNKTVRS  60

Query  239   -----RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  403
                  R   +  GF     Q RSISVEALKPSDTFPRRHNSATPE+Q+KMAE CG+ SLD
Sbjct  61    DVLLGRNVMSSVGF-GMGCQTRSISVEALKPSDTFPRRHNSATPEEQTKMAESCGYESLD  119

Query  404   ALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  583
             +L+DATVP+SIRL+S+KF KFD GLTE+QMIEHM  LA+KNKVFKSYIGMGYYNTFVPPV
Sbjct  120   SLVDATVPKSIRLESLKFSKFDEGLTESQMIEHMMQLAAKNKVFKSYIGMGYYNTFVPPV  179

Query  584   ILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEA  763
             ILRNIMENPGWYTQYTPYQAEI+QGRLESLLN+QT+I+DLTGLPMSNASLLDEGTAAAEA
Sbjct  180   ILRNIMENPGWYTQYTPYQAEIAQGRLESLLNYQTLISDLTGLPMSNASLLDEGTAAAEA  239

Query  764   MAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLV  943
             MAMCNNI KGKKKTFIIASNCHPQTIDICKTRA+GF+LKVVTADLKDIDYKSGDVCGVLV
Sbjct  240   MAMCNNIMKGKKKTFIIASNCHPQTIDICKTRAEGFDLKVVTADLKDIDYKSGDVCGVLV  299

Query  944   QYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPM  1123
             QYP TEGEVLDYGEFIKNAHA+GVKVVMASDLLALTMLKPPGE GADIVVGSAQRFGVPM
Sbjct  300   QYPDTEGEVLDYGEFIKNAHANGVKVVMASDLLALTMLKPPGEFGADIVVGSAQRFGVPM  359

Query  1124  GY  1129
             GY
Sbjct  360   GY  361



>ref|NP_195027.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 sp|Q94B78.2|GCSP1_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 1, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 1; 
AltName: Full=Glycine decarboxylase 1; AltName: Full=Glycine 
decarboxylase P-protein 1; Short=AtGLDP1; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA21210.1| P-Protein-like protein [Arabidopsis thaliana]
 emb|CAB80018.1| P-Protein-like protein [Arabidopsis thaliana]
 gb|AAL36259.1| putative P-Protein [Arabidopsis thaliana]
 gb|AAM14125.1| putative P-protein [Arabidopsis thaliana]
 gb|AEE86159.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=1037

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/351 (79%), Positives = 310/351 (88%), Gaps = 5/351 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1     MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57    AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116   RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  176   YTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGK  235

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTID+CKTRADGF+LKVVT+DLKDIDY SGDVCGVLVQYPGTEGEVLD
Sbjct  236   KKTFVIASNCHPQTIDVCKTRADGFDLKVVTSDLKDIDYSSGDVCGVLVQYPGTEGEVLD  295

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             Y EF+KNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  296   YAEFVKNAHANGVKVVMATDLLALTVLKPPGEFGADIVVGSAQRFGVPMGY  346



>gb|AAK68740.1| P-Protein - like protein [Arabidopsis thaliana]
 gb|AAM91322.1| P-protein-like protein [Arabidopsis thaliana]
Length=1037

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/351 (79%), Positives = 310/351 (88%), Gaps = 5/351 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1     MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57    AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116   RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  176   YTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGK  235

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTID+CKTRADGF+LKVVT+DLKDIDY SGDVCGVLVQYPGTEGEVLD
Sbjct  236   KKTFVIASNCHPQTIDVCKTRADGFDLKVVTSDLKDIDYSSGDVCGVLVQYPGTEGEVLD  295

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             Y EF+KNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  296   YAEFVKNAHANGVKVVMATDLLALTVLKPPGEFGADIVVGSAQRFGVPMGY  346



>gb|AAL57651.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
 gb|AAN64523.1| At4g33010/F26P21_130 [Arabidopsis thaliana]
Length=1037

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/351 (79%), Positives = 310/351 (88%), Gaps = 5/351 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1     MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57    AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116   RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  176   YTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGK  235

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTID+CKTRADGF+LKVVT+DLKDIDY SGDVCGVLVQYPGTEGEVLD
Sbjct  236   KKTFVIASNCHPQTIDVCKTRADGFDLKVVTSDLKDIDYSSGDVCGVLVQYPGTEGEVLD  295

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             Y EF+KNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  296   YAEFVKNAHANGVKVVMATDLLALTVLKPPGEFGADIVVGSAQRFGVPMGY  346



>ref|XP_002516446.1| glycine dehydrogenase, putative [Ricinus communis]
 gb|EEF45787.1| glycine dehydrogenase, putative [Ricinus communis]
Length=1057

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/366 (79%), Positives = 317/366 (87%), Gaps = 17/366 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLR------------ANETPAAALHRPARYVSSLAPCAA  220
             MERARKLANRAIL+RLV+E+K  +             N + +  L+ P+RYVSSL+  A+
Sbjct  1     MERARKLANRAILKRLVNESKPHKHHSRNESSATTLLNSSSSPILYTPSRYVSSLSSFAS  60

Query  221   MYENQRRYSGAGA---GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGF  391
                N R  S  G    G+     Q RSISVE+LKPSDTFPRRHNSAT E+QSKMAE CGF
Sbjct  61    --RNPRSGSLPGTKSIGYYGIGSQVRSISVESLKPSDTFPRRHNSATAEEQSKMAELCGF  118

Query  392   PSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTF  571
              +LD+LIDATVP+SIR+DSMKF KFD+GLTE+QMIEHM++LASKNKVFKSYIGMGYYNT 
Sbjct  119   DNLDSLIDATVPKSIRIDSMKFSKFDNGLTESQMIEHMQDLASKNKVFKSYIGMGYYNTH  178

Query  572   VPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTA  751
             VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTA
Sbjct  179   VPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTA  238

Query  752   AAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVC  931
             AAEAMAMCNNI KGKKKTFIIA+NCHPQTIDICKTRADGF++KVVT DLKDI+YKSGDVC
Sbjct  239   AAEAMAMCNNILKGKKKTFIIANNCHPQTIDICKTRADGFDIKVVTMDLKDINYKSGDVC  298

Query  932   GVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRF  1111
             GVL+QYPGTEGEVLDY EFIKNAHA+GVKVVMASDLLALTMLKPPGELGADIVVGSAQRF
Sbjct  299   GVLLQYPGTEGEVLDYEEFIKNAHANGVKVVMASDLLALTMLKPPGELGADIVVGSAQRF  358

Query  1112  GVPMGY  1129
             GVPMGY
Sbjct  359   GVPMGY  364



>ref|XP_010648358.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1053

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/362 (80%), Positives = 312/362 (86%), Gaps = 12/362 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLR-----ANETPAAALHRPARYVSSLAPCAAMYENQR-  238
             MERAR++ANRAILRRLV E+KQ R      NE    +     RYVSSL  CA   +  R 
Sbjct  1     MERARRIANRAILRRLVSESKQQRPCPRPQNEGLVNSSFSGWRYVSSLPTCAFPNKTVRS  60

Query  239   -----RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  403
                  R   +  GF     Q RSISVEALKPSDTFPRRHNSATPE+Q+KMAE CG+ SLD
Sbjct  61    DVLLGRNVMSSVGF-GMGCQTRSISVEALKPSDTFPRRHNSATPEEQTKMAESCGYESLD  119

Query  404   ALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  583
             +L+DATVP+SIRL+S+KF KFD GLTE+QMIEHM  LA+KNKVFKSYIGMGYYNTFVPPV
Sbjct  120   SLVDATVPKSIRLESLKFSKFDEGLTESQMIEHMMQLAAKNKVFKSYIGMGYYNTFVPPV  179

Query  584   ILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEA  763
             ILRNIMENPGWYTQYTPYQAEI+QGRLESLLN+QT+I+DLTGLPMSNASLLDEGTAAAEA
Sbjct  180   ILRNIMENPGWYTQYTPYQAEIAQGRLESLLNYQTLISDLTGLPMSNASLLDEGTAAAEA  239

Query  764   MAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLV  943
             MAMCNNI KGKKKTFIIASNCHPQTIDICKTRA+GF+LKVVTADLKDIDYKSGDVCGVLV
Sbjct  240   MAMCNNIMKGKKKTFIIASNCHPQTIDICKTRAEGFDLKVVTADLKDIDYKSGDVCGVLV  299

Query  944   QYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPM  1123
             QYP TEGEVLDYGEFIKNAHA+GVKVVMASDLLALTMLKPPGE GADIVVGSAQRFGVPM
Sbjct  300   QYPDTEGEVLDYGEFIKNAHANGVKVVMASDLLALTMLKPPGEFGADIVVGSAQRFGVPM  359

Query  1124  GY  1129
             GY
Sbjct  360   GY  361



>ref|XP_006382016.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
 gb|ERP59813.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
Length=806

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/372 (78%), Positives = 310/372 (83%), Gaps = 26/372 (7%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYV------------  196
             MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYV            
Sbjct  1     MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  197   SSLAPCAAMYENQRRYSGA-GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKM  373
             S L P      +    +G+ G G      Q RSISVE+LKPSDTFPRRHNSATPE+Q+KM
Sbjct  61    SGLLPGTKNIVSHNVPAGSYGIG-----SQIRSISVESLKPSDTFPRRHNSATPEEQTKM  115

Query  374   AEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGM  553
             AE CGF +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHM  LASKNKVFKSYIGM
Sbjct  116   AELCGFDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMNYLASKNKVFKSYIGM  175

Query  554   GYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASL  733
             GYYNT VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASL
Sbjct  176   GYYNTHVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASL  235

Query  734   LDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDY  913
             LDEGTAAAEAMAMCNNI KGKKKTFIIA+NCHPQTIDIC TRA GF+LKVVTADLKDIDY
Sbjct  236   LDEGTAAAEAMAMCNNIQKGKKKTFIIANNCHPQTIDICDTRAGGFDLKVVTADLKDIDY  295

Query  914   KSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVV  1093
             KSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVV
Sbjct  296   KSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVV  355

Query  1094  GSAQRFGVPMGY  1129
             GSAQRFGVPMGY
Sbjct  356   GSAQRFGVPMGY  367



>dbj|BAJ34193.1| unnamed protein product [Thellungiella halophila]
Length=756

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/355 (79%), Positives = 310/355 (87%), Gaps = 7/355 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETP---AAALHRPA-RYVSSLAPCAAMYENQRRY  244
             MERAR++A R I+RRLV++AK+ R  ETP   +A  H PA RY+SSL+P       +   
Sbjct  1     MERARRIAYRGIVRRLVNDAKRHRNVETPHVPSAVPHAPATRYLSSLSP---FLSTRGSI  57

Query  245   SGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  424
             + +  G  A  QQ R ISVEALKP DTFPRRHNSATP++Q+ MA++CGF  +D+LIDATV
Sbjct  58    NPSTFGNLARQQQTRPISVEALKPGDTFPRRHNSATPDEQTHMAKYCGFDHIDSLIDATV  117

Query  425   PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  604
             P+SIRLDSMKF KFD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VP VILRNIME
Sbjct  118   PKSIRLDSMKFSKFDGGLTESQMIEHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIME  177

Query  605   NPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  784
             NP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI
Sbjct  178   NPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  237

Query  785   FKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEG  964
              KGKKKTF+IASNCHPQTID+CKTRADGF+LKVVTA+LK+IDY SGDVCGVLVQYPGTEG
Sbjct  238   QKGKKKTFLIASNCHPQTIDVCKTRADGFDLKVVTAELKEIDYSSGDVCGVLVQYPGTEG  297

Query  965   EVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EVLDY EF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  298   EVLDYAEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSAQRFGVPMGY  352



>gb|KFK32542.1| hypothetical protein AALP_AA6G256500 [Arabis alpina]
Length=1041

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/353 (78%), Positives = 316/353 (90%), Gaps = 6/353 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYENQRRYS-G  250
             MERAR+LA+R I+RRL++E K+ R  E+ +++  H P R+VSS++     + ++R +S G
Sbjct  1     MERARRLASRGIIRRLINETKRHRNGESSSSSSSHIPTRHVSSVS----TFLHRRDFSPG  56

Query  251   AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  430
             AG+ F    QQ RSISV+ALKPSDTFPRRHNSATPE+Q++MA +CGF  LD LID+TVP+
Sbjct  57    AGSSFGRQQQQSRSISVDALKPSDTFPRRHNSATPEEQTQMANYCGFDKLDTLIDSTVPK  116

Query  431   SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             SIRLDSMKF KFD GLTE++M+ HM +LASKNKVFKSYIGMGYYNT VPPVILRNIMENP
Sbjct  117   SIRLDSMKFSKFDGGLTESEMMNHMSDLASKNKVFKSYIGMGYYNTHVPPVILRNIMENP  176

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
              WYTQYTPYQAEISQGRLESLLN+QT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI K
Sbjct  177   AWYTQYTPYQAEISQGRLESLLNYQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQK  236

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEV  970
             GKKKTF+IASNCHPQT+D+CKTRADGF+LK+VTAD+KD+DY SGDVCGVLVQYPGTEGEV
Sbjct  237   GKKKTFVIASNCHPQTVDVCKTRADGFDLKIVTADVKDVDYSSGDVCGVLVQYPGTEGEV  296

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LDYGEF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  297   LDYGEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSAQRFGVPMGY  349



>ref|XP_010262151.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nelumbo nucifera]
Length=1043

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/357 (79%), Positives = 310/357 (87%), Gaps = 13/357 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET-----PAAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LANRAILRRLVHE++Q + + T     PA+ +  PARY SSL+P        R 
Sbjct  1     MERARRLANRAILRRLVHESRQQQRHATSSYSSPASFI--PARYFSSLSPSVFPSTASRS  58

Query  242   YS-GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  418
                G G G+     Q RSISVEALKPSDTFPRRHNSATP++QS+MAE CG+ +LD+LIDA
Sbjct  59    ADIGFGLGY-----QTRSISVEALKPSDTFPRRHNSATPDEQSRMAESCGYSTLDSLIDA  113

Query  419   TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  598
             TVP+SIR+  MK PKFD GLTE+QMIEHMK LASKNK+ KS+IGMGYYNT+VP VILRNI
Sbjct  114   TVPKSIRIQPMKLPKFDEGLTESQMIEHMKKLASKNKILKSFIGMGYYNTYVPSVILRNI  173

Query  599   MENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCN  778
             MENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCN
Sbjct  174   MENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCN  233

Query  779   NIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGT  958
             NI KG KKTF+IASNCHPQTID+CKTRA GF+L VVTADLKD DYKSGDVCGVLVQYPGT
Sbjct  234   NIQKGNKKTFVIASNCHPQTIDVCKTRAGGFDLNVVTADLKDFDYKSGDVCGVLVQYPGT  293

Query  959   EGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EGEVLDYGEF+KNAHAHGVKVV+A+DLL+LTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  294   EGEVLDYGEFVKNAHAHGVKVVVATDLLSLTMLKPPGEFGADIVVGSAQRFGVPMGY  350



>gb|ABO61734.1| mitochondrial glycine decarboxylase complex P-protein [Populus 
tremuloides]
Length=1060

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/367 (79%), Positives = 314/367 (86%), Gaps = 16/367 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYVSSLA------PC  214
             MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYVSSL+      P 
Sbjct  1     MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  215   AAMYENQRRY--SGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCG  388
             + +    +        AG+     Q RSISVE+LKPSDTFPRRHNSATPE+Q+KMAE CG
Sbjct  61    SGLLPGTKNIVSRNVPAGYYGIGSQIRSISVESLKPSDTFPRRHNSATPEEQTKMAELCG  120

Query  389   FPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  568
             F +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHMK LASKNKVFKSYIGMGYYNT
Sbjct  121   FDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMKYLASKNKVFKSYIGMGYYNT  180

Query  569   FVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGT  748
             +VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGT
Sbjct  181   YVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGT  240

Query  749   AAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDV  928
             AAAEAMAMCNNI KGKKKTFIIA+NCHPQTIDIC TRA GF+LKVVTADLKDIDYKSGDV
Sbjct  241   AAAEAMAMCNNIQKGKKKTFIIANNCHPQTIDICDTRAGGFDLKVVTADLKDIDYKSGDV  300

Query  929   CGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR  1108
             CGVLVQYPGTEGEVLDYGEF+KNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR
Sbjct  301   CGVLVQYPGTEGEVLDYGEFVKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR  360

Query  1109  FGVPMGY  1129
             FGVPMGY
Sbjct  361   FGVPMGY  367



>ref|XP_008220472.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Prunus mume]
Length=1054

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/363 (80%), Positives = 320/363 (88%), Gaps = 14/363 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET-----PAAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LANRA ++RLV +AKQ R NET      +  L+ P+RYVSSL+PC+ M  + R 
Sbjct  1     MERARRLANRAFVKRLVSDAKQFRQNETVFSSSTSPVLYTPSRYVSSLSPCSFMRTSSRS  60

Query  242   YSGAGAGFPASHQ-------QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  400
              S AG     SH        Q RSISV+ALK SDTFPRRHNSATP++Q+KMAE CGF SL
Sbjct  61    DSLAGKN--VSHNVGYRTGTQTRSISVDALKNSDTFPRRHNSATPDEQTKMAELCGFGSL  118

Query  401   DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  580
             D+LIDATVP+SIRL+SMKF KFD GLTE+QM+EHM+ LASKNK+FKS+IGMGYYNT+VPP
Sbjct  119   DSLIDATVPKSIRLESMKFTKFDEGLTESQMLEHMQYLASKNKIFKSFIGMGYYNTYVPP  178

Query  581   VILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAE  760
             VILRNIMENP WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAE
Sbjct  179   VILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAAE  238

Query  761   AMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVL  940
             AMAMCNNI KGKKKTF+IA+NCHPQTIDICKTRADGF+LKVVTADLKDIDYKSGDVCGVL
Sbjct  239   AMAMCNNIQKGKKKTFVIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYKSGDVCGVL  298

Query  941   VQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVP  1120
             VQYPGTEGEVLDYGEFIKNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVP
Sbjct  299   VQYPGTEGEVLDYGEFIKNAHANGVKVVMATDLLALTLLKPPGEFGADIVVGSAQRFGVP  358

Query  1121  MGY  1129
             MGY
Sbjct  359   MGY  361



>sp|P49361.1|GCSPA_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) A, mitochondrial; 
AltName: Full=Glycine cleavage system P protein A; 
AltName: Full=Glycine decarboxylase A; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) A; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA85353.1| P-protein of the glycine cleavage system [Flaveria pringlei]
Length=1037

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/354 (80%), Positives = 313/354 (88%), Gaps = 12/354 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  247
             MERAR+LAN+AIL RLV + K   +  +PA  L  P+RYVSSL+P  C+     + R  +
Sbjct  1     MERARRLANKAILGRLVSQTKHNPSISSPA--LCSPSRYVSSLSPYVCSGTNVRSDRNLN  58

Query  248   GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
             G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GFP+LD+LIDATVP
Sbjct  59    GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVP  111

Query  428   QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  607
             +SIRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  112   KSIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  171

Query  608   PGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIF  787
             PGWYTQYTPYQAEI+QGRLESLLNFQTM+TDLTGLPMSNASLLDEGTAAAEAMAMCNNI 
Sbjct  172   PGWYTQYTPYQAEIAQGRLESLLNFQTMVTDLTGLPMSNASLLDEGTAAAEAMAMCNNIQ  231

Query  788   KGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGE  967
             KGKKKTFIIASNCHPQTIDICKTRADGF+LKVVT+DLKD DY SGDVCGVLVQYPGTEGE
Sbjct  232   KGKKKTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGE  291

Query  968   VLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +LDY EFIKNAHA+GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  292   LLDYSEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGY  345



>ref|XP_010437818.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Camelina sativa]
Length=1040

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/352 (78%), Positives = 310/352 (88%), Gaps = 4/352 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYENQRRYSGA  253
             MERAR+LA R I++RLV++AK+ R  +TP   + H PARYVSSL+P  + + +    S A
Sbjct  1     MERARRLAYRGIVKRLVNDAKRHRNPDTPHLVVPHAPARYVSSLSPFVSTHRSVNPTSAA  60

Query  254   GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  433
               G    HQQ RSISV+ALKP DTFPRRHNSATP++QS MA+FCG+  +D+L+DATVP+S
Sbjct  61    AFG---RHQQTRSISVDALKPGDTFPRRHNSATPDEQSYMAKFCGYDHIDSLVDATVPKS  117

Query  434   IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
             IRL SMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VI+RNI+ENP 
Sbjct  118   IRLGSMKFSKFDDGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVIIRNILENPA  177

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KG
Sbjct  178   WYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKG  237

Query  794   KKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVL  973
             KKKTF+IASNCHPQTIDICKTRA GFEL +VTADLKD+DY SGDVCGVLVQYPGTEGEVL
Sbjct  238   KKKTFVIASNCHPQTIDICKTRAGGFELNLVTADLKDVDYSSGDVCGVLVQYPGTEGEVL  297

Query  974   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DY EF+KNAHAHGVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  298   DYAEFVKNAHAHGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  349



>emb|CAA81076.1| P protein [Flaveria pringlei]
Length=1037

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/354 (80%), Positives = 313/354 (88%), Gaps = 12/354 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  247
             M+RAR+LAN+AIL RLV + K   +  +PA  L  P+RYVSSL+P  C+     + R  +
Sbjct  1     MDRARRLANKAILGRLVSQTKHNPSISSPA--LCSPSRYVSSLSPYVCSGTNVRSDRNLN  58

Query  248   GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
             G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GFP+LD+LIDATVP
Sbjct  59    GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVP  111

Query  428   QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  607
             +SIRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  112   KSIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  171

Query  608   PGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIF  787
             PGWYTQYTPYQAEI+QGRLESLLNFQTM+TDLTGLPMSNASLLDEGTAAAEAMAMCNNI 
Sbjct  172   PGWYTQYTPYQAEIAQGRLESLLNFQTMVTDLTGLPMSNASLLDEGTAAAEAMAMCNNIQ  231

Query  788   KGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGE  967
             KGKKKTFIIASNCHPQTIDICKTRADGF+LKVVT+DLKD DY SGDVCGVLVQYPGTEGE
Sbjct  232   KGKKKTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGE  291

Query  968   VLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +LDY EFIKNAHA+GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  292   LLDYSEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGY  345



>ref|XP_011019466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Populus euphratica]
Length=1060

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/367 (79%), Positives = 313/367 (85%), Gaps = 16/367 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYVSSLA------PC  214
             MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYVSSL+      P 
Sbjct  1     MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  215   AAMYENQRRYSGAG--AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCG  388
             + +    +  +     AG      Q RSISVE+LKPSDTFPRRHNSATPE+Q+KMAE CG
Sbjct  61    SGILPGTKNIASHNVPAGSYGIGSQIRSISVESLKPSDTFPRRHNSATPEEQTKMAELCG  120

Query  389   FPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  568
             F +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHMK LASKNKVFKSYIGMGYYNT
Sbjct  121   FDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMKYLASKNKVFKSYIGMGYYNT  180

Query  569   FVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGT  748
              VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGT
Sbjct  181   HVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGT  240

Query  749   AAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDV  928
             AAAEAMAMCNNI KGKKKTFIIASNCHPQTIDIC TRA GF+LKVVTADLKDIDYKSGDV
Sbjct  241   AAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICDTRAGGFDLKVVTADLKDIDYKSGDV  300

Query  929   CGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR  1108
             CGVLVQYPGTEGEVLDYGEF+KNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR
Sbjct  301   CGVLVQYPGTEGEVLDYGEFVKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR  360

Query  1109  FGVPMGY  1129
             FGVPMGY
Sbjct  361   FGVPMGY  367



>gb|EPS70254.1| precursor of carboxylase p-protein 1, glycine decarboxylase complex, 
partial [Genlisea aurea]
Length=408

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/351 (78%), Positives = 296/351 (84%), Gaps = 12/351 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERARKLANRAILRRLV  +KQ          L++P+RY SS    + ++      S   
Sbjct  1     MERARKLANRAILRRLVSASKQ--------PPLYKPSRYYSSSLSPSVVHGGVGNASRNF  52

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A F  S    RSISVEALKPSDTFPRRHNSA+P +QSKM E  GF +LD+LIDATVP+SI
Sbjct  53    ARFVGS----RSISVEALKPSDTFPRRHNSASPVEQSKMVEALGFETLDSLIDATVPRSI  108

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             R+D MK P FD GLTE+QM EHMK LASKNKVFKS+IGMGYYNTFVPPVILRNIMENP W
Sbjct  109   RIDEMKLPIFDRGLTESQMAEHMKELASKNKVFKSFIGMGYYNTFVPPVILRNIMENPAW  168

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  169   YTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGK  228

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTID+C TRA GF+LKVV + + +IDYKSGDVCGVLVQYPGTEGEVLD
Sbjct  229   KKTFVIASNCHPQTIDVCVTRAGGFDLKVVVSHVSEIDYKSGDVCGVLVQYPGTEGEVLD  288

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             Y EFIK AHA GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  289   YEEFIKKAHAEGVKVVMASDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  339



>dbj|BAJ33627.1| unnamed protein product [Thellungiella halophila]
Length=822

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/353 (78%), Positives = 310/353 (88%), Gaps = 9/353 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RLV+E K+ R  E+ ++ +  P+RYVSS++         RR S A 
Sbjct  1     MERARRLAYRGIVKRLVNETKRHRNVESSSSHI-VPSRYVSSVSTFL-----HRRESTAY  54

Query  257   AGFPASHQ--QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  430
              G    HQ  Q RSISV+ALKPSDTFPRRHNSATPE+Q++MA +CGF SL+ LID+TVP+
Sbjct  55    PGGFGRHQLQQTRSISVDALKPSDTFPRRHNSATPEEQTQMANYCGFDSLNTLIDSTVPK  114

Query  431   SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             SIRLDSMKF KFD GLTE+QMIEHM +LA+KNKVFKS+IGMGYYNT VPPVILRNIMENP
Sbjct  115   SIRLDSMKFSKFDGGLTESQMIEHMSDLATKNKVFKSFIGMGYYNTHVPPVILRNIMENP  174

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
              WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI K
Sbjct  175   AWYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQK  234

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEV  970
             GKKKTF+IASNCHPQTID+CKTRADGF+L +VTADLKD+DY SGDVCGVLVQYPGTEGEV
Sbjct  235   GKKKTFVIASNCHPQTIDVCKTRADGFDLIIVTADLKDVDYSSGDVCGVLVQYPGTEGEV  294

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LDYGE +KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  295   LDYGE-LKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSAQRFGVPMGY  346



>ref|XP_010526062.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Tarenaya hassleriana]
Length=1051

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/362 (80%), Positives = 311/362 (86%), Gaps = 15/362 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAP-----CAAM  223
             MERAR+LA++ I+RRLV+EAK+ R  E PA       A + P RYVSS++P     C   
Sbjct  1     MERARRLAHKGIVRRLVNEAKRHRNGE-PALTPAPAIAPYAPVRYVSSISPSVPRRCTTG  59

Query  224   YENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  403
               N    +  G GF    QQRR ISVEALKPSDTFPRRHNSATPE+Q++MA  CGF +LD
Sbjct  60    SINPAAAAACG-GF--GSQQRRWISVEALKPSDTFPRRHNSATPEEQTQMATSCGFDNLD  116

Query  404   ALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  583
             ALIDATVP+SIRLDSM F KFD GLTE+QMIEHM +LASKNKVFKSYIGMGYYNT VPPV
Sbjct  117   ALIDATVPKSIRLDSMSFSKFDGGLTESQMIEHMNDLASKNKVFKSYIGMGYYNTHVPPV  176

Query  584   ILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEA  763
             ILRNIMENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEA
Sbjct  177   ILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEA  236

Query  764   MAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLV  943
             MAMCNNI KGKKKTF+IASNCHPQTID+CKTRADGF+LKVVTADLKDIDY SGDVCGVLV
Sbjct  237   MAMCNNIQKGKKKTFVIASNCHPQTIDVCKTRADGFDLKVVTADLKDIDYSSGDVCGVLV  296

Query  944   QYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPM  1123
             QYPGTEGEVLDY EF+KNAHA+GVKVVMASDLLALT LKPPGE GADIVVGSAQRFGVPM
Sbjct  297   QYPGTEGEVLDYAEFVKNAHANGVKVVMASDLLALTTLKPPGEFGADIVVGSAQRFGVPM  356

Query  1124  GY  1129
             GY
Sbjct  357   GY  358



>ref|XP_002308562.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
 gb|EEE92085.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
Length=1060

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/367 (79%), Positives = 311/367 (85%), Gaps = 16/367 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYVSSLA------PC  214
             MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYVSSL+      P 
Sbjct  1     MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  215   AAMYENQRRY--SGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCG  388
             + +    +        AG      Q RSISVE+LKPSDTFPRRHNSATPE+Q+KMAE CG
Sbjct  61    SGLLPGTKNIVSHNVPAGSYGIGSQIRSISVESLKPSDTFPRRHNSATPEEQTKMAELCG  120

Query  389   FPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  568
             F +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHM  LASKNKVFKSYIGMGYYNT
Sbjct  121   FDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMNYLASKNKVFKSYIGMGYYNT  180

Query  569   FVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGT  748
              VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGT
Sbjct  181   HVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGT  240

Query  749   AAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDV  928
             AAAEAMAMCNNI KGKKKTFIIA+NCHPQTIDIC TRA GF+LKVVTADLKDIDYKSGDV
Sbjct  241   AAAEAMAMCNNIQKGKKKTFIIANNCHPQTIDICDTRAGGFDLKVVTADLKDIDYKSGDV  300

Query  929   CGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR  1108
             CGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR
Sbjct  301   CGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQR  360

Query  1109  FGVPMGY  1129
             FGVPMGY
Sbjct  361   FGVPMGY  367



>ref|XP_006408846.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
 gb|ESQ50299.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
Length=1041

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/353 (79%), Positives = 311/353 (88%), Gaps = 8/353 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RLV+E K+ R  E+ ++ +  P+RYVSS++         RR S A 
Sbjct  1     MERARRLAYRGIVKRLVNETKRHRNVESSSSHI-VPSRYVSSVSTFL-----HRRESTAY  54

Query  257   AGFPASHQ--QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  430
              G    HQ  Q RSISV+ALKPSDTFPRRHNSATPE+Q++MA +CGF SL+ LID+TVP+
Sbjct  55    PGGFGRHQLQQTRSISVDALKPSDTFPRRHNSATPEEQTQMANYCGFDSLNTLIDSTVPK  114

Query  431   SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             SIRLDSMKF KFD GLTE+QMIEHM +LA+KNKVFKS+IGMGYYNT VPPVILRNIMENP
Sbjct  115   SIRLDSMKFSKFDGGLTESQMIEHMSDLATKNKVFKSFIGMGYYNTHVPPVILRNIMENP  174

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
              WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI K
Sbjct  175   AWYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQK  234

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEV  970
             GKKKTF+IASNCHPQTID+CKTRADGF+L +VTADLKD+DY SGDVCGVLVQYPGTEGEV
Sbjct  235   GKKKTFVIASNCHPQTIDVCKTRADGFDLIIVTADLKDVDYSSGDVCGVLVQYPGTEGEV  294

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LDYGEF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  295   LDYGEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSAQRFGVPMGY  347



>ref|XP_010519851.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=1054

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/361 (77%), Positives = 310/361 (86%), Gaps = 10/361 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLR-------ANETPAAALHRPARYVSSLAPCAAMYENQ  235
             MERAR+LANRAIL+RLV  +K+ R       +    + AL+ PARYVSSL+P A+   N 
Sbjct  1     MERARRLANRAILKRLVDSSKRHRTAREASLSGGASSPALYSPARYVSSLSPFASSASNI  60

Query  236   RRYSGAGAGFPASHQ---QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  406
             R    +     AS     Q R ISVEALKP+DTFPRRHNSATPE+Q+ MA  CGF SLD+
Sbjct  61    RSEMASSNNRKASSHFGSQIRRISVEALKPTDTFPRRHNSATPEEQTVMANSCGFDSLDS  120

Query  407   LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  586
             LIDATVP++IR+DSMKF KFD GLTE+QMI+HMK+LASKNKVFKSYIGMGYYNT +PPVI
Sbjct  121   LIDATVPKAIRIDSMKFSKFDEGLTESQMIDHMKDLASKNKVFKSYIGMGYYNTHIPPVI  180

Query  587   LRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM  766
             LRNI ENP WYTQYTPYQAEISQGRLESLLN+QTMI +LTGLPMSNASLLDEGTAAAEAM
Sbjct  181   LRNITENPAWYTQYTPYQAEISQGRLESLLNYQTMIAELTGLPMSNASLLDEGTAAAEAM  240

Query  767   AMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQ  946
             AMCNNI KGKKKTF+IASNCHPQTIDICKTRADGF++KVVT+DLKDIDY SGDVCGVLVQ
Sbjct  241   AMCNNIQKGKKKTFVIASNCHPQTIDICKTRADGFDIKVVTSDLKDIDYSSGDVCGVLVQ  300

Query  947   YPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
             YPGTEGE+LDYGEF+K AHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMG
Sbjct  301   YPGTEGEILDYGEFVKKAHANGVKVVMATDLLALTILKPPGEFGADIVVGSAQRFGVPMG  360

Query  1127  Y  1129
             Y
Sbjct  361   Y  361



>gb|KFK29912.1| hypothetical protein AALP_AA7G194500 [Arabis alpina]
Length=1042

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/352 (79%), Positives = 308/352 (88%), Gaps = 2/352 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET-PAAALHRPARYVSSLAPCAAMYENQRRYSGA  253
             MERAR+LA R I+RRLV++ K+ R N+T P+   H P RYVSSL+P    + +    +  
Sbjct  1     MERARRLAYRGIVRRLVNDTKRHRNNQTSPSIVPHTPTRYVSSLSPFLPTHGSINP-TIH  59

Query  254   GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  433
                   +HQQ RSISV+ALKPSDTFPRRHNSATPE+Q+ MA+ CGF  LD+LIDATVP+S
Sbjct  60    RHNHHHNHQQTRSISVDALKPSDTFPRRHNSATPEEQTHMAKHCGFDHLDSLIDATVPKS  119

Query  434   IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
             IRLDSMKF KFD GLTE+QMI HM +LASKNKVFKS+IGMGYYNT VP VILRNI+ENP 
Sbjct  120   IRLDSMKFSKFDGGLTESQMISHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNILENPA  179

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KG
Sbjct  180   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKG  239

Query  794   KKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVL  973
             KKKTF+IASNCHPQTID+CKTRADGF+LKVVTA+LKDIDY SGDVCGVLVQYPGTEGEVL
Sbjct  240   KKKTFVIASNCHPQTIDVCKTRADGFDLKVVTAELKDIDYSSGDVCGVLVQYPGTEGEVL  299

Query  974   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DY EF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  300   DYAEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSAQRFGVPMGY  351



>ref|XP_003544533.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1059

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/366 (79%), Positives = 307/366 (84%), Gaps = 15/366 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANE------TPAAALHRPARYVSS-LAPCAAMYEN-  232
             MERAR+LANRAILRRLV EAKQ + NE      T    L+  +R +SS L    +  E  
Sbjct  1     MERARRLANRAILRRLVSEAKQHQKNESVLHSSTTPMLLYSSSRCMSSVLRSRGSKTETL  60

Query  233   -------QRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGF  391
                     R    A AG        RSISVEAL+PSDTFPRRHNSATPE+QSKMAE CGF
Sbjct  61    LGRNINMSRGVVVAAAGGFLGVGSARSISVEALRPSDTFPRRHNSATPEEQSKMAESCGF  120

Query  392   PSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTF  571
              SLD+L+DATVP+SIRL  MKF KFD GLTE QMIEHMK+LASKNKVFKSYIGMGYYNT 
Sbjct  121   GSLDSLVDATVPKSIRLKDMKFGKFDAGLTENQMIEHMKDLASKNKVFKSYIGMGYYNTH  180

Query  572   VPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTA  751
             VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTA
Sbjct  181   VPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTA  240

Query  752   AAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVC  931
             AAEAM+MCNNI KGKKKTFIIASNCHPQTIDICKTRADGF+LKVVTADLKDIDYKSGDVC
Sbjct  241   AAEAMSMCNNIQKGKKKTFIIASNCHPQTIDICKTRADGFDLKVVTADLKDIDYKSGDVC  300

Query  932   GVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRF  1111
             GVLVQYPGTEGEVLDYGEF+K AHAH VKVVMASDLLALT+LKPPGE GADIVVGSAQRF
Sbjct  301   GVLVQYPGTEGEVLDYGEFVKKAHAHEVKVVMASDLLALTVLKPPGEFGADIVVGSAQRF  360

Query  1112  GVPMGY  1129
             GVPMGY
Sbjct  361   GVPMGY  366



>ref|XP_002880741.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57000.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
Length=1043

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/355 (77%), Positives = 311/355 (88%), Gaps = 8/355 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET---PAAALHRPARYVSSLAPCAAMYENQRRYS  247
             MERAR+LA R I++RLV+E K+ R  ++   PA  +  P+RYVSS++   +   ++R  S
Sbjct  1     MERARRLAYRGIVKRLVNETKRHRNGQSSSLPATTV-TPSRYVSSVS---SFLHHRRDVS  56

Query  248   GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
             G+       +QQ RSIS++ALKPSDTFPRRHNSATPE+Q++MA +CGF  L+ LID+TVP
Sbjct  57    GSTFTTSCRNQQTRSISIDALKPSDTFPRRHNSATPEEQTQMANYCGFDHLNTLIDSTVP  116

Query  428   QSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  604
             +SIRLDSMKF  KFD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VPPVILRNIME
Sbjct  117   KSIRLDSMKFSGKFDEGLTESQMIEHMSDLASKNKVFKSFIGMGYYNTHVPPVILRNIME  176

Query  605   NPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  784
             NP WYTQYTPYQAEISQGRLESLLN+QT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI
Sbjct  177   NPAWYTQYTPYQAEISQGRLESLLNYQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  236

Query  785   FKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEG  964
              KGKKKTF+IASNCHPQTID+CKTRADGF+LKVVT DLKD+DY SGDVCGVLVQYPGTEG
Sbjct  237   LKGKKKTFVIASNCHPQTIDVCKTRADGFDLKVVTVDLKDVDYSSGDVCGVLVQYPGTEG  296

Query  965   EVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EVLDYGEF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGS QRFGVPMGY
Sbjct  297   EVLDYGEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSGQRFGVPMGY  351



>ref|XP_004498895.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X1 [Cicer arietinum]
 ref|XP_004498896.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=1114

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/368 (77%), Positives = 306/368 (83%), Gaps = 20/368 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRP---ARYVSSLAPCAAMYENQRR--  241
             MERAR+LANRA L+RL+ EAKQ R NET       P   +RYVSS++         ++  
Sbjct  57    MERARRLANRATLKRLLSEAKQNRNNETIWNTSTTPIPSSRYVSSVSNSVHRTRGSKQDN  116

Query  242   ------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFC  385
                             G G+P+   Q RSISVEALKPSDTFPRRHNSATPE+Q+KMAE C
Sbjct  117   IFTRKPNVPRSVVGFLGIGYPS---QSRSISVEALKPSDTFPRRHNSATPEEQTKMAESC  173

Query  386   GFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYN  565
             GF +LD+L+DATVP+SIRL  MKF KFD GLTE QMIEHMK LASKNK+FKS+IGMGYYN
Sbjct  174   GFNTLDSLVDATVPKSIRLKEMKFNKFDGGLTEGQMIEHMKYLASKNKIFKSFIGMGYYN  233

Query  566   TFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEG  745
             T VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEG
Sbjct  234   THVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEG  293

Query  746   TAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGD  925
             TAAAEAM+MCNNI KGKKKTFIIASNCHPQTIDICKTRADGFELKVV  D+KDIDYKSGD
Sbjct  294   TAAAEAMSMCNNIQKGKKKTFIIASNCHPQTIDICKTRADGFELKVVVKDVKDIDYKSGD  353

Query  926   VCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQ  1105
             VCGVLVQYPGTEGEVLDYG+FIK AHA+ VKVVMASDLLALT+LKPPGE GADIVVGSAQ
Sbjct  354   VCGVLVQYPGTEGEVLDYGDFIKKAHANEVKVVMASDLLALTVLKPPGEFGADIVVGSAQ  413

Query  1106  RFGVPMGY  1129
             RFGVPMGY
Sbjct  414   RFGVPMGY  421



>ref|XP_006412401.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
 gb|ESQ53854.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
Length=1146

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/362 (78%), Positives = 314/362 (87%), Gaps = 8/362 (2%)
 Frame = +2

Query  59    FLEF-PAMERARKLANRAILRRLVHEAKQLRANETP---AAALHRPA-RYVSSLAPCAAM  223
             FL F  +MERAR++A R I+RRLV++AK+ R  ETP   +A  H PA RY+SSL+P    
Sbjct  97    FLPFYISMERARRIAYRGIVRRLVNDAKRHRNVETPHVPSAVPHAPATRYLSSLSP---F  153

Query  224   YENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  403
                +   + +  G  A  QQ R ISVEALKP DTFPRRHNSATP++Q+ MA++CGF  +D
Sbjct  154   LSTRGSINPSTFGNLARQQQTRPISVEALKPGDTFPRRHNSATPDEQTHMAKYCGFDHID  213

Query  404   ALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  583
             +LIDATVP+SIRLDSMKF KFD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VP V
Sbjct  214   SLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMVDLASKNKVFKSFIGMGYYNTHVPTV  273

Query  584   ILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEA  763
             ILRNIMENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEA
Sbjct  274   ILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEA  333

Query  764   MAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLV  943
             MAMCNNI KGKKKTF+IASNCHPQTID+CKTRADGF+LKVVTA+LK+IDY SGDVCGVLV
Sbjct  334   MAMCNNIQKGKKKTFLIASNCHPQTIDVCKTRADGFDLKVVTAELKEIDYSSGDVCGVLV  393

Query  944   QYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPM  1123
             QYPGTEGEVLDY EF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGSAQRFGVPM
Sbjct  394   QYPGTEGEVLDYAEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSAQRFGVPM  453

Query  1124  GY  1129
             GY
Sbjct  454   GY  455



>sp|P49362.1|GCSPB_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) B, mitochondrial; 
AltName: Full=Glycine cleavage system P protein B; 
AltName: Full=Glycine decarboxylase B; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) B; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA91000.1| P-protein precursor of glycine cleavage system [Flaveria pringlei]
Length=1034

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/354 (80%), Positives = 310/354 (88%), Gaps = 15/354 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  247
             MERAR+LA   IL RLV + K   +  +PA  L  P+RYVSSL+P  C+     + R  +
Sbjct  1     MERARRLA---ILGRLVSQTKHNPSISSPA--LCSPSRYVSSLSPYVCSGTNVRSDRNLN  55

Query  248   GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
             G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GFP+LD+LIDATVP
Sbjct  56    GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVP  108

Query  428   QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  607
             +SIRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  109   KSIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  168

Query  608   PGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIF  787
             PGWYTQYTPYQAEI+QGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI 
Sbjct  169   PGWYTQYTPYQAEIAQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQ  228

Query  788   KGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGE  967
             KGKKKTFIIASNCHPQTIDICKTRADGF+LKVVT+DLKD DY SGDVCGVLVQYPGTEGE
Sbjct  229   KGKKKTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGE  288

Query  968   VLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +LDY EFIKNAHA+GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  289   LLDYSEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGY  342



>ref|XP_010097067.1| Glycine cleavage system P protein 1 [Morus notabilis]
 gb|EXB66868.1| Glycine cleavage system P protein 1 [Morus notabilis]
Length=1059

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/361 (80%), Positives = 316/361 (88%), Gaps = 10/361 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAK-QLRANETPAAAL-------HRPARYVSSLAPCAAMYEN  232
             MERAR++ANRA L+RLV EAK Q R NE+PAA         + P+RYVSSL+PC+   + 
Sbjct  1     MERARRVANRAFLKRLVSEAKKQYRQNESPAALQNASSPMSYTPSRYVSSLSPCSRTRKG  60

Query  233   QRRYSGA--GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  406
               R   A    G+     Q RSISVEALKPSDTF RRHNSATPE+QSKMAE  GF SLDA
Sbjct  61    IPRSETASYNVGYRGIGSQTRSISVEALKPSDTFARRHNSATPEEQSKMAELVGFESLDA  120

Query  407   LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  586
             LID+TVP+SIRL+SMKF KFD GLTE+QMIEHMK+LASKNKVFKS+IGMGYYNT VPPVI
Sbjct  121   LIDSTVPKSIRLESMKFSKFDEGLTESQMIEHMKDLASKNKVFKSFIGMGYYNTHVPPVI  180

Query  587   LRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM  766
             LRN++ENP WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAM
Sbjct  181   LRNVLENPAWYTQYTPYQAEISQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAAEAM  240

Query  767   AMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQ  946
             AMCNNI KGKKKTFIIA+NCHPQTIDICKTRA+GF+LKVVT+DL DIDYKSGDVCGVLVQ
Sbjct  241   AMCNNIQKGKKKTFIIATNCHPQTIDICKTRAEGFDLKVVTSDLMDIDYKSGDVCGVLVQ  300

Query  947   YPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
             YPGTEGEVLDYGEFIKN+HA+GVKVVMASDLLALT+L PPGELGADIVVGSAQRFGVPMG
Sbjct  301   YPGTEGEVLDYGEFIKNSHANGVKVVMASDLLALTLLTPPGELGADIVVGSAQRFGVPMG  360

Query  1127  Y  1129
             Y
Sbjct  361   Y  361



>ref|XP_004142925.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Cucumis sativus]
 gb|KGN62389.1| hypothetical protein Csa_2G351700 [Cucumis sativus]
Length=1046

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/361 (78%), Positives = 310/361 (86%), Gaps = 18/361 (5%)
 Frame = +2

Query  77    MERARKLA-NRAILRRLVHEAKQLRANETP----AAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LA N++ LRRLV  +   R  + P    +     P+RYVSSL+  + ++ + R 
Sbjct  1     MERARRLAANKSALRRLVSASNHHRQIDPPFFNSSPVSFTPSRYVSSLS-NSFLFRSVRS  59

Query  242   YS-----GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  406
              S     G G G        RSISVEALKPSDTFPRRHNSATPE+QSKMAE CGF SLD+
Sbjct  60    DSFLHRNGIGIG-------SRSISVEALKPSDTFPRRHNSATPEEQSKMAEVCGFDSLDS  112

Query  407   LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  586
             L+DATVP+SIRL SMKF KFD GLTE+QMIEHM+NLA+KNK+FKSYIGMGYYNTFVPPVI
Sbjct  113   LVDATVPKSIRLQSMKFSKFDEGLTESQMIEHMQNLAAKNKIFKSYIGMGYYNTFVPPVI  172

Query  587   LRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM  766
             LRNIMENP WYTQYTPYQAEISQGRLESLLN+QT+ITDLTGLPMSNASLLDEGTAAAEAM
Sbjct  173   LRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTLITDLTGLPMSNASLLDEGTAAAEAM  232

Query  767   AMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQ  946
             AMCNNI KGKKKTF+I++NCHPQTIDIC TRA GF+LKVVTADLKDIDYKSGDVCGVLVQ
Sbjct  233   AMCNNILKGKKKTFVISNNCHPQTIDICVTRAAGFDLKVVTADLKDIDYKSGDVCGVLVQ  292

Query  947   YPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
             YPGTEGEVLDYGEFIKNAHA+GVKVVMA+DLLALT LKPPGELGADIVVGSAQRFGVPMG
Sbjct  293   YPGTEGEVLDYGEFIKNAHANGVKVVMATDLLALTALKPPGELGADIVVGSAQRFGVPMG  352

Query  1127  Y  1129
             Y
Sbjct  353   Y  353



>ref|XP_011097886.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1071

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/351 (79%), Positives = 306/351 (87%), Gaps = 5/351 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERARKLANRAIL+RL+  +KQ    ++ +  L   +  V     C +   +  +     
Sbjct  1     MERARKLANRAILKRLLSSSKQQPLYKSSSRCLSSLSPSVVQ---CGSNVVS--KVHSFN  55

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             +  P      RSISVEALKPSDTFPRRHNSATPE+Q+KMAEF G+ SLDALIDATVP+SI
Sbjct  56    SRNPVQFVGTRSISVEALKPSDTFPRRHNSATPEEQAKMAEFVGYNSLDALIDATVPKSI  115

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             R+D M+FP FD GLTEAQMI+HM++LASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW
Sbjct  116   RIDKMEFPIFDEGLTEAQMIQHMQDLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  175

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  176   YTQYTPYQAEISQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAAEAMAMCNNILKGK  235

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTIDIC+TRADGF+LKVV +D+KDIDYKSGDVCGVLVQYPGTEGE+LD
Sbjct  236   KKTFVIASNCHPQTIDICQTRADGFDLKVVVSDIKDIDYKSGDVCGVLVQYPGTEGEILD  295

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEFIKNAHA+GVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  296   YGEFIKNAHANGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  346



>ref|XP_010432628.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Camelina sativa]
Length=1045

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/354 (77%), Positives = 306/354 (86%), Gaps = 3/354 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYE--NQRRYS  247
             MERAR+LA R I++RLV++AK+ R  +TP   + H PARYVSSL+P  + +   N    +
Sbjct  1     MERARRLAYRGIVKRLVNDAKRHRNPDTPHVVVPHAPARYVSSLSPFVSTHRSVNPNAAA  60

Query  248   GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
                        Q RSISV+ALKP DTFPRRHNSATP++QS MA+FCG+  +D+L+DATVP
Sbjct  61    AFARHHHHQQHQTRSISVDALKPGDTFPRRHNSATPDEQSFMAKFCGYDHIDSLVDATVP  120

Query  428   QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  607
             +SIRL SMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VI+RNI+EN
Sbjct  121   KSIRLGSMKFSKFDDGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVIIRNILEN  180

Query  608   PGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIF  787
             P WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI 
Sbjct  181   PAWYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQ  240

Query  788   KGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGE  967
             KGKKKTF+IASNCHPQTIDICKTRA GFEL +VTADLKD+DY SGDVCGVLVQYPGTEGE
Sbjct  241   KGKKKTFVIASNCHPQTIDICKTRAGGFELNLVTADLKDVDYSSGDVCGVLVQYPGTEGE  300

Query  968   VLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             VLDY EF+KNAHAHGVKVVMA+DLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  301   VLDYAEFVKNAHAHGVKVVMATDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  354



>gb|KDO80092.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=985

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/370 (75%), Positives = 309/370 (84%), Gaps = 24/370 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1     MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  239   R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  379
             R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61    RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  380   FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  559
               G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116   LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  560   YNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLD  739
             YNT VPPVILRNIMENP WYTQYTPYQAEI+QGRLESLLNFQTMI DLTGLPMSNASLLD
Sbjct  176   YNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLD  235

Query  740   EGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS  919
             EGTAAAEAMAMCNNI KGKKKTFIIASNCHPQTIDIC TRADGF++KVV +DLKDIDYKS
Sbjct  236   EGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKS  295

Query  920   GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGS  1099
             GDVCGVLVQYPGTEGEVLDYG+FIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGS
Sbjct  296   GDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGS  355

Query  1100  AQRFGVPMGY  1129
             AQRFGVPMGY
Sbjct  356   AQRFGVPMGY  365



>ref|XP_003550270.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
 gb|KHN37032.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1056

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/372 (77%), Positives = 302/372 (81%), Gaps = 30/372 (8%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYV--------------------  196
             MERAR+LANRAILRRLV EAKQ + NE+    LH     +                    
Sbjct  1     MERARRLANRAILRRLVSEAKQHQKNES---VLHSSTTPILLYSSSRCMSSVSSPVLRSR  57

Query  197   -SSLAPCAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKM  373
              S          N  R   AGAG        RSISVEAL+PSDTFPRRHNSATPE+QSKM
Sbjct  58    GSKTETLLGRNMNISRSVVAGAG------SARSISVEALQPSDTFPRRHNSATPEEQSKM  111

Query  374   AEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGM  553
             AE  GF SLD+L+DATVP+SIRL  M F KFD GLTE+QMIEHMK+LASKNKVFKSYIGM
Sbjct  112   AESIGFESLDSLVDATVPKSIRLKEMTFGKFDAGLTESQMIEHMKDLASKNKVFKSYIGM  171

Query  554   GYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASL  733
             GYYNT VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASL
Sbjct  172   GYYNTHVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASL  231

Query  734   LDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDY  913
             LDEGTAAAEAM+MCNNI KGKKKTFIIASNCHPQTIDICKTRADGF+LKVVTADLKDIDY
Sbjct  232   LDEGTAAAEAMSMCNNIQKGKKKTFIIASNCHPQTIDICKTRADGFDLKVVTADLKDIDY  291

Query  914   KSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVV  1093
             KSGDVCGVLVQYPGTEGEVLDYGEF+K AHAH VKVVMASDLLALT+LKPPGE GADIVV
Sbjct  292   KSGDVCGVLVQYPGTEGEVLDYGEFVKKAHAHEVKVVMASDLLALTVLKPPGEFGADIVV  351

Query  1094  GSAQRFGVPMGY  1129
             GSAQRFGVPMGY
Sbjct  352   GSAQRFGVPMGY  363



>gb|KDO80091.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=985

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/370 (75%), Positives = 309/370 (84%), Gaps = 24/370 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1     MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  239   R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  379
             R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61    RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  380   FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  559
               G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116   LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  560   YNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLD  739
             YNT VPPVILRNIMENP WYTQYTPYQAEI+QGRLESLLNFQTMI DLTGLPMSNASLLD
Sbjct  176   YNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLD  235

Query  740   EGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS  919
             EGTAAAEAMAMCNNI KGKKKTFIIASNCHPQTIDIC TRADGF++KVV +DLKDIDYKS
Sbjct  236   EGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKS  295

Query  920   GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGS  1099
             GDVCGVLVQYPGTEGEVLDYG+FIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGS
Sbjct  296   GDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGS  355

Query  1100  AQRFGVPMGY  1129
             AQRFGVPMGY
Sbjct  356   AQRFGVPMGY  365



>dbj|BAE98954.1| putative glycine dehydrogenase [Arabidopsis thaliana]
Length=1044

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/358 (76%), Positives = 308/358 (86%), Gaps = 13/358 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET---PAAALHRPARYVSSLAPCAAMYENQRRYS  247
             MERAR+LA R I++RLV+E K+ R  E+   P   +  P+RYVSS++         RR  
Sbjct  1     MERARRLAYRGIVKRLVNETKRHRNGESSLLPTTTV-TPSRYVSSVSSFL-----HRRRD  54

Query  248   GAGAGFPAS---HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  418
              +G+ F  S     Q RSISV+ALKPSDTFPRRHNSATP++Q++MA +CGF +L+ LID+
Sbjct  55    VSGSAFTTSGRNQHQTRSISVDALKPSDTFPRRHNSATPDEQAQMANYCGFDNLNTLIDS  114

Query  419   TVPQSIRLDSMKFPK-FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  595
             TVP+SIRLDSMKF   FD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VPPVILRN
Sbjct  115   TVPKSIRLDSMKFSGIFDEGLTESQMIEHMSDLASKNKVFKSFIGMGYYNTHVPPVILRN  174

Query  596   IMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMC  775
             IMENP WYTQYTPYQAEISQGRLESLLN+QT+ITDLTGLPMSNASLLDEGTAAAEAMAMC
Sbjct  175   IMENPAWYTQYTPYQAEISQGRLESLLNYQTVITDLTGLPMSNASLLDEGTAAAEAMAMC  234

Query  776   NNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPG  955
             NNI KGKKKTF+IASNCHPQTID+CKTRADGF+LKVVT D+KD+DY SGDVCGVLVQYPG
Sbjct  235   NNILKGKKKTFVIASNCHPQTIDVCKTRADGFDLKVVTVDIKDVDYSSGDVCGVLVQYPG  294

Query  956   TEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             TEGEVLDYGEF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGS QRFGVPMGY
Sbjct  295   TEGEVLDYGEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSGQRFGVPMGY  352



>ref|NP_180178.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
 sp|O80988.1|GCSP2_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 2, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 2; 
AltName: Full=Glycine decarboxylase 2; AltName: Full=Glycine 
decarboxylase P-protein 2; Short=AtGLDP2; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC31228.1| putative glycine dehydrogenase [Arabidopsis thaliana]
 gb|AEC07793.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
Length=1044

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/358 (76%), Positives = 308/358 (86%), Gaps = 13/358 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET---PAAALHRPARYVSSLAPCAAMYENQRRYS  247
             MERAR+LA R I++RLV+E K+ R  E+   P   +  P+RYVSS++         RR  
Sbjct  1     MERARRLAYRGIVKRLVNETKRHRNGESSLLPTTTV-TPSRYVSSVSSFL-----HRRRD  54

Query  248   GAGAGFPAS---HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  418
              +G+ F  S     Q RSISV+ALKPSDTFPRRHNSATP++Q++MA +CGF +L+ LID+
Sbjct  55    VSGSAFTTSGRNQHQTRSISVDALKPSDTFPRRHNSATPDEQAQMANYCGFDNLNTLIDS  114

Query  419   TVPQSIRLDSMKFPK-FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  595
             TVP+SIRLDSMKF   FD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VPPVILRN
Sbjct  115   TVPKSIRLDSMKFSGIFDEGLTESQMIEHMSDLASKNKVFKSFIGMGYYNTHVPPVILRN  174

Query  596   IMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMC  775
             IMENP WYTQYTPYQAEISQGRLESLLN+QT+ITDLTGLPMSNASLLDEGTAAAEAMAMC
Sbjct  175   IMENPAWYTQYTPYQAEISQGRLESLLNYQTVITDLTGLPMSNASLLDEGTAAAEAMAMC  234

Query  776   NNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPG  955
             NNI KGKKKTF+IASNCHPQTID+CKTRADGF+LKVVT D+KD+DY SGDVCGVLVQYPG
Sbjct  235   NNILKGKKKTFVIASNCHPQTIDVCKTRADGFDLKVVTVDIKDVDYSSGDVCGVLVQYPG  294

Query  956   TEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             TEGEVLDYGEF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGS QRFGVPMGY
Sbjct  295   TEGEVLDYGEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSGQRFGVPMGY  352



>gb|EYU20359.1| hypothetical protein MIMGU_mgv1a000655mg [Erythranthe guttata]
Length=1030

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/351 (79%), Positives = 301/351 (86%), Gaps = 14/351 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERARKL NRAILRRLV  +KQ          L+R +RYVSSL P  A+           
Sbjct  1     MERARKLVNRAILRRLVSASKQ--------QPLYRSSRYVSSLPP--ALVPRGSNVVRKA  50

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
               F  +    RSISV+ALKPSDTF RRHNSATPEDQS+MA F GF +LD+LIDATVP+SI
Sbjct  51    HSFTFT----RSISVDALKPSDTFARRHNSATPEDQSRMAGFAGFETLDSLIDATVPKSI  106

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             R D M+ P FD GLTE+QM+EHMK+LASKNKVFKSYIGMGYY TFVPPVILRNIMENPGW
Sbjct  107   RADKMELPIFDKGLTESQMLEHMKHLASKNKVFKSYIGMGYYGTFVPPVILRNIMENPGW  166

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLN+QTMITDLT LPMSNASLLDE TAAAEAMAMCNNIFKGK
Sbjct  167   YTQYTPYQAEISQGRLESLLNYQTMITDLTALPMSNASLLDESTAAAEAMAMCNNIFKGK  226

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTFIIASNCHPQTID+C+TRADGF+LK+V  +++D+DYKSGDVCGVLVQYPGTEGEVLD
Sbjct  227   KKTFIIASNCHPQTIDVCRTRADGFDLKIVVCNVEDVDYKSGDVCGVLVQYPGTEGEVLD  286

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEFIKNAHA+GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  287   YGEFIKNAHANGVKVVMASDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  337



>sp|O49850.1|GCSP_FLAAN RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
anomala]
 emb|CAB16911.1| P-protein [Flaveria anomala]
Length=1034

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/354 (79%), Positives = 308/354 (87%), Gaps = 15/354 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  247
             MERAR+LA   +L RLV + K   +  +PA  L  P+RYVSSL+P  C      + R  +
Sbjct  1     MERARRLA---MLGRLVSQTKHNPSISSPA--LCSPSRYVSSLSPYVCGGTNVRSDRNLN  55

Query  248   GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
             G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GF +LD+LIDATVP
Sbjct  56    GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFSNLDSLIDATVP  108

Query  428   QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  607
             +SIRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  109   KSIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  168

Query  608   PGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIF  787
             PGWYTQYTPYQAEI+QGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI 
Sbjct  169   PGWYTQYTPYQAEIAQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQ  228

Query  788   KGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGE  967
             KGKKKTFIIASNCHPQTIDICKTRADGF+LKVVT+DLKD DY SGDVCGVLVQYPGTEGE
Sbjct  229   KGKKKTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGE  288

Query  968   VLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +LDY EFIKNAHA+GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  289   LLDYSEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGY  342



>gb|KDO80085.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1016

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/370 (75%), Positives = 309/370 (84%), Gaps = 24/370 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1     MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  239   R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  379
             R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61    RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  380   FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  559
               G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116   LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  560   YNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLD  739
             YNT VPPVILRNIMENP WYTQYTPYQAEI+QGRLESLLNFQTMI DLTGLPMSNASLLD
Sbjct  176   YNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLD  235

Query  740   EGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS  919
             EGTAAAEAMAMCNNI KGKKKTFIIASNCHPQTIDIC TRADGF++KVV +DLKDIDYKS
Sbjct  236   EGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKS  295

Query  920   GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGS  1099
             GDVCGVLVQYPGTEGEVLDYG+FIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGS
Sbjct  296   GDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGS  355

Query  1100  AQRFGVPMGY  1129
             AQRFGVPMGY
Sbjct  356   AQRFGVPMGY  365



>ref|XP_008444466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Cucumis melo]
Length=1047

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/361 (78%), Positives = 311/361 (86%), Gaps = 17/361 (5%)
 Frame = +2

Query  77    MERARKLA-NRAILRRLVHEAKQLRANETP----AAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LA N++ LRRLV  +   R  + P    +     P+RYVSSL+  + ++ + R 
Sbjct  1     MERARRLAANKSALRRLVSASNHHRQIDPPFFNSSPVSFTPSRYVSSLSSNSFLFRSVRS  60

Query  242   YS-----GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  406
              S     G G G        RSISVEALKPSDTFPRRHNSATPE+QSKMAE CGF SLD+
Sbjct  61    DSFLHRNGIGIG-------ARSISVEALKPSDTFPRRHNSATPEEQSKMAEVCGFDSLDS  113

Query  407   LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  586
             L+DATVP+SIRL SMKF KFD GLTE+QMIEHM+NLA+KNK+FKSYIGMGYYNTFVPPVI
Sbjct  114   LVDATVPKSIRLQSMKFSKFDEGLTESQMIEHMQNLAAKNKIFKSYIGMGYYNTFVPPVI  173

Query  587   LRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM  766
             LRNIMENP WYTQYTPYQAEISQGRLESLLN+QT+ITDLTGLPMSNASLLDEGTAAAEAM
Sbjct  174   LRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTLITDLTGLPMSNASLLDEGTAAAEAM  233

Query  767   AMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQ  946
             AMCNNI KGKKKTF+I++NCHPQTIDIC TRA GF+LKVVTADLKDIDYKSGDVCGVLVQ
Sbjct  234   AMCNNILKGKKKTFVISNNCHPQTIDICITRAAGFDLKVVTADLKDIDYKSGDVCGVLVQ  293

Query  947   YPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
             YPGTEGEVLDYGEFIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMG
Sbjct  294   YPGTEGEVLDYGEFIKNAHANGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMG  353

Query  1127  Y  1129
             Y
Sbjct  354   Y  354



>gb|KDO80090.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1049

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/370 (75%), Positives = 309/370 (84%), Gaps = 24/370 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1     MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  239   R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  379
             R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61    RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  380   FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  559
               G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116   LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  560   YNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLD  739
             YNT VPPVILRNIMENP WYTQYTPYQAEI+QGRLESLLNFQTMI DLTGLPMSNASLLD
Sbjct  176   YNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLD  235

Query  740   EGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS  919
             EGTAAAEAMAMCNNI KGKKKTFIIASNCHPQTIDIC TRADGF++KVV +DLKDIDYKS
Sbjct  236   EGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKS  295

Query  920   GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGS  1099
             GDVCGVLVQYPGTEGEVLDYG+FIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGS
Sbjct  296   GDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGS  355

Query  1100  AQRFGVPMGY  1129
             AQRFGVPMGY
Sbjct  356   AQRFGVPMGY  365



>ref|XP_007227061.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
 gb|EMJ28260.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
Length=1039

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/351 (80%), Positives = 308/351 (88%), Gaps = 5/351 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LAN+A ++RLV EAKQ R NET  ++   P  Y  S    +   +N     G G
Sbjct  1     MERARRLANQAFVKRLVSEAKQFRQNETVLSSSTSPVLYTPSSRSDSLAGKNVSHNVGYG  60

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
              G      Q RSISV+ALK SDTFPRRHNSATP++Q+KMAE CGF SLD+LIDATVP+SI
Sbjct  61    TG-----TQTRSISVDALKNSDTFPRRHNSATPDEQTKMAELCGFGSLDSLIDATVPKSI  115

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             RL+SMKF KFD GLTE+QM+EHM+ LASKNK+FKS+IGMGYYNT+VPPVILRNIMENP W
Sbjct  116   RLESMKFAKFDEGLTESQMLEHMQYLASKNKIFKSFIGMGYYNTYVPPVILRNIMENPAW  175

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  176   YTQYTPYQAEISQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGK  235

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IA+NCHPQTIDICKTRADGF+LKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD
Sbjct  236   KKTFVIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  295

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEFIKNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  296   YGEFIKNAHANGVKVVMATDLLALTLLKPPGEFGADIVVGSAQRFGVPMGY  346



>gb|KDO80089.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1050

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/370 (75%), Positives = 309/370 (84%), Gaps = 24/370 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1     MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  239   R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  379
             R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61    RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  380   FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  559
               G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116   LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  560   YNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLD  739
             YNT VPPVILRNIMENP WYTQYTPYQAEI+QGRLESLLNFQTMI DLTGLPMSNASLLD
Sbjct  176   YNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLD  235

Query  740   EGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS  919
             EGTAAAEAMAMCNNI KGKKKTFIIASNCHPQTIDIC TRADGF++KVV +DLKDIDYKS
Sbjct  236   EGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKS  295

Query  920   GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGS  1099
             GDVCGVLVQYPGTEGEVLDYG+FIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGS
Sbjct  296   GDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGS  355

Query  1100  AQRFGVPMGY  1129
             AQRFGVPMGY
Sbjct  356   AQRFGVPMGY  365



>ref|XP_006450834.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
 gb|ESR64074.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
Length=1058

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/370 (75%), Positives = 309/370 (84%), Gaps = 24/370 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1     MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  239   R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  379
             R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61    RSDLLQSRNMSHHNVNGYGIG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  380   FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  559
               G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116   LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  560   YNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLD  739
             YNT VPPVILRNIMENP WYTQYTPYQAEI+QGRLESLLNFQTMI DLTGLPMSNASLLD
Sbjct  176   YNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLD  235

Query  740   EGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS  919
             EGTAAAEAMAMCNNI KGKKKTFIIASNCHPQTIDIC TRADGF++KVV +DLKDIDYKS
Sbjct  236   EGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKS  295

Query  920   GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGS  1099
             GDVCGVLVQYPGTEGEVLDYG+FIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGS
Sbjct  296   GDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGS  355

Query  1100  AQRFGVPMGY  1129
             AQRFGVPMGY
Sbjct  356   AQRFGVPMGY  365



>ref|XP_006475931.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Citrus sinensis]
 gb|KDO80086.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
 gb|KDO80087.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1058

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/370 (75%), Positives = 309/370 (84%), Gaps = 24/370 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  238
             MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1     MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  239   R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  379
             R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61    RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  380   FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  559
               G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116   LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  560   YNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLD  739
             YNT VPPVILRNIMENP WYTQYTPYQAEI+QGRLESLLNFQTMI DLTGLPMSNASLLD
Sbjct  176   YNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNASLLD  235

Query  740   EGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS  919
             EGTAAAEAMAMCNNI KGKKKTFIIASNCHPQTIDIC TRADGF++KVV +DLKDIDYKS
Sbjct  236   EGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDIDYKS  295

Query  920   GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGS  1099
             GDVCGVLVQYPGTEGEVLDYG+FIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIVVGS
Sbjct  296   GDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIVVGS  355

Query  1100  AQRFGVPMGY  1129
             AQRFGVPMGY
Sbjct  356   AQRFGVPMGY  365



>ref|XP_010667776.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=1042

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/353 (77%), Positives = 305/353 (86%), Gaps = 5/353 (1%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAA--ALHRPARYVSSLAPCAAMYENQRRYSG  250
             MERAR++A+RA+L+RL H  +    N       +L   +RYVS++A  +    + +  SG
Sbjct  1     MERARRIASRALLKRLQHHNRPNNNNGGKKIFDSLSSNSRYVSTMASSSRF--SWKNESG  58

Query  251   AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  430
                GF  +  Q RSISV+ALKPSDTF RRHNS  PE++ KMA++CGF + +ALIDATVP+
Sbjct  59    NNVGFGKT-PQNRSISVDALKPSDTFARRHNSINPEEEIKMAQYCGFDNTNALIDATVPK  117

Query  431   SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             SIR+ SMKF KFD GLTEAQMIEHMKNLASKNK+FKS+IGMGYY+T+VPPVILRNIMENP
Sbjct  118   SIRIQSMKFSKFDEGLTEAQMIEHMKNLASKNKIFKSFIGMGYYDTYVPPVILRNIMENP  177

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
              WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI K
Sbjct  178   AWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNILK  237

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEV  970
             GK+KTFIIA+NCHPQTIDICKTRADGF+LKVVTADLKDIDY SGDVCGVLVQYPGTEGEV
Sbjct  238   GKRKTFIIANNCHPQTIDICKTRADGFDLKVVTADLKDIDYSSGDVCGVLVQYPGTEGEV  297

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LDYGEFIK AHA GVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  298   LDYGEFIKKAHASGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  350



>sp|O49852.1|GCSP_FLATR RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
trinervia]
 emb|CAB16916.1| P-Protein precursor [Flaveria trinervia]
Length=1034

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/354 (79%), Positives = 308/354 (87%), Gaps = 15/354 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  247
             MERAR+LA   +L RLV + K        ++AL  P+RYVSSL+P  C+     + R  +
Sbjct  1     MERARRLA---MLGRLVSQTKH--NPSISSSALCSPSRYVSSLSPYVCSGTNVRSDRNLN  55

Query  248   GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
             G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GF +LD+LIDATVP
Sbjct  56    GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFSNLDSLIDATVP  108

Query  428   QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  607
             ++IRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  109   KAIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  168

Query  608   PGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIF  787
             PGWYTQYTPYQAEI+QGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI 
Sbjct  169   PGWYTQYTPYQAEIAQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQ  228

Query  788   KGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGE  967
             KGKKKTFIIASNCHPQTIDICKTRADGF+LKVVT+DLKD DY SGDVCGVLVQYPGTEGE
Sbjct  229   KGKKKTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGE  288

Query  968   VLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +LDY EFIKNAHA+GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  289   LLDYSEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGY  342



>ref|XP_010429623.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial 
[Camelina sativa]
Length=1044

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/355 (76%), Positives = 306/355 (86%), Gaps = 7/355 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANET---PAAALHRPARYVSSLAPCAAMYENQRRYS  247
             MERAR+LA R I++RLV+E K+ R NE+   P+  +  P+RYVSS        +N     
Sbjct  1     MERARRLAYRGIVKRLVNETKRHRNNESSLLPSTTV-TPSRYVSSF--LHRRLDNNTVSV  57

Query  248   GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
               GA    +  Q RSISV+ALKPSDTFPRRHNSATPE+Q++MA++CGF  L+ LID+TVP
Sbjct  58    VGGAVSGKNQHQTRSISVDALKPSDTFPRRHNSATPEEQTQMAKYCGFDDLNKLIDSTVP  117

Query  428   QSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  604
             +SIRLDSMKF  KFD GLTE++MI+HM  LASKN+VFKS+IGMGYYNT VP VILRNIME
Sbjct  118   KSIRLDSMKFSGKFDEGLTESEMIKHMSELASKNRVFKSFIGMGYYNTHVPTVILRNIME  177

Query  605   NPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  784
             NPGWYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI
Sbjct  178   NPGWYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNI  237

Query  785   FKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEG  964
              KGKKKTF++A+NCHPQTIDICKTRADGF+L+VVT+DLKD+DY SGDVCGVLVQYPGTEG
Sbjct  238   LKGKKKTFLVANNCHPQTIDICKTRADGFDLRVVTSDLKDVDYSSGDVCGVLVQYPGTEG  297

Query  965   EVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EV DYGEF++NAHA+GVKVVMA+DLLALTMLKPPGE G DIVVGSAQRFGVPMGY
Sbjct  298   EVFDYGEFVRNAHANGVKVVMATDLLALTMLKPPGEFGVDIVVGSAQRFGVPMGY  352



>ref|XP_007161011.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
 gb|ESW33005.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
Length=1062

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/369 (76%), Positives = 304/369 (82%), Gaps = 18/369 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGA-  253
             MERAR+LANRAIL+RLV EAKQ + NE+   +   P    SS    +++     R  G+ 
Sbjct  1     MERARRLANRAILKRLVSEAKQHQKNESVLHSSTTPMLLYSSSRCMSSVSSPALRNRGSK  60

Query  254   -----GAGFPASHQQR------------RSISVEALKPSDTFPRRHNSATPEDQSKMAEF  382
                  G     +   R            RSISVEAL+ SDTFPRRHNSATPE+QSKMAE 
Sbjct  61    TDTLLGRSMNIATMSRGVVGGFLGVGSTRSISVEALQASDTFPRRHNSATPEEQSKMAES  120

Query  383   CGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYY  562
             CGF S+D+L+DATVP+SIRL  MKF KFD GLTE+QMIEHMK LASKNKVFKSYIGMGYY
Sbjct  121   CGFESIDSLVDATVPKSIRLKEMKFGKFDGGLTESQMIEHMKELASKNKVFKSYIGMGYY  180

Query  563   NTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDE  742
             NT VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDE
Sbjct  181   NTHVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDE  240

Query  743   GTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSG  922
             GTAAAEAM+MCN+I KGKKKTFIIASNCHPQTIDICKTRA GF+LKVVTADLKDIDYKSG
Sbjct  241   GTAAAEAMSMCNHIQKGKKKTFIIASNCHPQTIDICKTRAAGFDLKVVTADLKDIDYKSG  300

Query  923   DVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSA  1102
             DVCGVLVQYPGTEGEVLDYGEFIK AHAH VKVVMASDLLALT+LKPPGE GADIVVGSA
Sbjct  301   DVCGVLVQYPGTEGEVLDYGEFIKKAHAHEVKVVMASDLLALTVLKPPGEFGADIVVGSA  360

Query  1103  QRFGVPMGY  1129
             QRFGVPMGY
Sbjct  361   QRFGVPMGY  369



>ref|XP_009125119.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Brassica rapa]
Length=1045

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/356 (74%), Positives = 302/356 (85%), Gaps = 7/356 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LA R I+RRLV+E+K+ R  E      P+   H P+RY+SSL+P   +  N  R
Sbjct  1     MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPSRYISSLSPF--LSNNHHR  58

Query  242   YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  421
                       +H Q RSISV+A+K  DTFPRRHNSATP++Q+ MA++CG+  +D+L+D T
Sbjct  59    SVNLPKHHHHNHNQTRSISVDAVKAGDTFPRRHNSATPDEQAHMAKYCGYDHIDSLVDDT  118

Query  422   VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  601
             VP+ IR+DSMKF KFD GLTE++MI HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+
Sbjct  119   VPKQIRIDSMKFSKFDGGLTESEMIAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNIL  178

Query  602   ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  781
             ENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN
Sbjct  179   ENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  238

Query  782   IFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTE  961
             I KGKKKTF+IASNCHPQTI+ICKTRADGF+LKVVT DLK+IDY  GDVCGVLVQYPGTE
Sbjct  239   IQKGKKKTFVIASNCHPQTIEICKTRADGFDLKVVTKDLKEIDYSCGDVCGVLVQYPGTE  298

Query  962   GEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             GEVLDYGEF+KNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  299   GEVLDYGEFVKNAHANGVKVVMATDLLALTVLKPPGEFGADIVVGSAQRFGVPMGY  354



>ref|XP_003589000.1| Glycine dehydrogenase P protein [Medicago truncatula]
 gb|AES59251.1| glycine dehydrogenase [decarboxylating] protein [Medicago truncatula]
Length=1056

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/364 (77%), Positives = 299/364 (82%), Gaps = 14/364 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYS---  247
             MERAR+LANRA L+RL+ EAKQ   NE+       P    S      +    + R S   
Sbjct  1     MERARRLANRATLKRLLSEAKQNCKNESTTTTAPLPFSSSSRYVSSVSNSVFRNRGSNVF  60

Query  248   --------GAGAGF--PASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPS  397
                     G G GF    S  Q RSI+VEALKPSDTF RRHNSATPE+Q+KMAE CGF  
Sbjct  61    GRNNNVSRGVG-GFHGSGSSTQSRSITVEALKPSDTFARRHNSATPEEQTKMAESCGFDH  119

Query  398   LDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVP  577
             LD+L+DATVP+SIRL  MKF KFD GLTE QMIEHMK+LASKNKVFKS+IGMGYYNT VP
Sbjct  120   LDSLVDATVPKSIRLKEMKFNKFDEGLTEGQMIEHMKDLASKNKVFKSFIGMGYYNTHVP  179

Query  578   PVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAA  757
             PVILRNI+ENP WYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAA
Sbjct  180   PVILRNILENPAWYTQYTPYQAEISQGRLESLLNFQTLITDLTGLPMSNASLLDEGTAAA  239

Query  758   EAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGV  937
             EAM+MCNNI KGKKKTFIIASNCHPQTIDICKTRADGFELKVV  DLKDIDYKSGDVCGV
Sbjct  240   EAMSMCNNIQKGKKKTFIIASNCHPQTIDICKTRADGFELKVVVKDLKDIDYKSGDVCGV  299

Query  938   LVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGV  1117
             LVQYPGTEGEVLDYGEFIK AHA+ VKVVMASDLLALT+LKPPGE GADIVVGSAQRFGV
Sbjct  300   LVQYPGTEGEVLDYGEFIKKAHANEVKVVMASDLLALTVLKPPGEFGADIVVGSAQRFGV  359

Query  1118  PMGY  1129
             PMGY
Sbjct  360   PMGY  363



>sp|P26969.1|GCSP_PEA RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Pisum 
sativum]
 emb|CAA42443.1| P protein [Pisum sativum]
Length=1057

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/368 (77%), Positives = 305/368 (83%), Gaps = 20/368 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARY--------------VSSLAPC  214
             MERAR+LANRA L+RL+ EAKQ R  E+ +     P  +               S L   
Sbjct  1     MERARRLANRATLKRLLSEAKQNRKTESTSTTTTTPLPFSLSGSSSRYVSSVSNSILRGR  60

Query  215   AAMYENQ--RRYSG-AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFC  385
              +  +N   RR  G  G G+P+   Q RSISVEALKPSDTFPRRHNSATP++Q+KMAE  
Sbjct  61    GSKPDNNVSRRVGGFLGVGYPS---QSRSISVEALKPSDTFPRRHNSATPDEQTKMAESV  117

Query  386   GFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYN  565
             GF +LD+L+DATVP+SIRL  MKF KFD GLTE QMIEHMK+LASKNKVFKS+IGMGYYN
Sbjct  118   GFDTLDSLVDATVPKSIRLKEMKFNKFDGGLTEGQMIEHMKDLASKNKVFKSFIGMGYYN  177

Query  566   TFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEG  745
             T VPPVILRNIMENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEG
Sbjct  178   THVPPVILRNIMENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEG  237

Query  746   TAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGD  925
             TAAAEAM+MCNNI KGKKKTFIIASNCHPQTIDIC+TRADGFELKVV  DLKDIDYKSGD
Sbjct  238   TAAAEAMSMCNNIQKGKKKTFIIASNCHPQTIDICQTRADGFELKVVVKDLKDIDYKSGD  297

Query  926   VCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQ  1105
             VCGVLVQYPGTEGEVLDYGEFIK AHA+ VKVVMASDLLALT+LKPPGE GADIVVGSAQ
Sbjct  298   VCGVLVQYPGTEGEVLDYGEFIKKAHANEVKVVMASDLLALTVLKPPGEFGADIVVGSAQ  357

Query  1106  RFGVPMGY  1129
             RFGVPMGY
Sbjct  358   RFGVPMGY  365



>emb|CDX75316.1| BnaA01g03860D [Brassica napus]
Length=1044

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/358 (74%), Positives = 303/358 (85%), Gaps = 12/358 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LA R I+RRLV+E+K+ R  E      P+   H P+RY+SSL+P  +   + R 
Sbjct  1     MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPSRYISSLSPFLSNNHHNR-  59

Query  242   YSGAGAGFPA--SHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALID  415
                     P   +H Q RSISV+A+K  DTFPRRHNSATP++Q+ MA++CG+  +D+L+D
Sbjct  60    ----SVNLPKHHNHNQTRSISVDAVKAGDTFPRRHNSATPDEQAHMAKYCGYDHIDSLVD  115

Query  416   ATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  595
              TVP+ IR+DSMKF KFD GLTE++MI HM  LASKNKVFKS+IGMGYYNT VP VI+RN
Sbjct  116   DTVPKQIRIDSMKFSKFDGGLTESEMIAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRN  175

Query  596   IMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMC  775
             I+ENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMC
Sbjct  176   ILENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMC  235

Query  776   NNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPG  955
             NNI KGKKKTF+IASNCHPQTI+ICKTRADGF+LKVVT DLK+IDY  GDVCGVLVQYPG
Sbjct  236   NNIQKGKKKTFVIASNCHPQTIEICKTRADGFDLKVVTKDLKEIDYSCGDVCGVLVQYPG  295

Query  956   TEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             TEGEVLDYGEF+KNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  296   TEGEVLDYGEFVKNAHANGVKVVMATDLLALTVLKPPGEFGADIVVGSAQRFGVPMGY  353



>emb|CDX68930.1| BnaC01g05230D [Brassica napus]
Length=1045

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/356 (75%), Positives = 301/356 (85%), Gaps = 7/356 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LA R I+RRLV+E+K+ R  E      P+   H PARY+SSL+P   +  N  R
Sbjct  1     MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPARYISSLSPF--LSNNHHR  58

Query  242   YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  421
                        H Q RSISV+A+K  DTFPRRHNSATP++Q+ MA++CG+  +D+L+D T
Sbjct  59    SVNLPKHHHHHHNQTRSISVDAVKAGDTFPRRHNSATPDEQAHMAKYCGYDHIDSLVDDT  118

Query  422   VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  601
             VP+ IR+DSMKF KFD GLTE++M+ HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+
Sbjct  119   VPKQIRIDSMKFSKFDGGLTESEMMAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNIL  178

Query  602   ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  781
             ENP WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN
Sbjct  179   ENPAWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  238

Query  782   IFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTE  961
             I KGKKKTF+IASNCHPQTI+ICKTRADGFELKVVT DLK+IDY  GDVCGVLVQYPGTE
Sbjct  239   IQKGKKKTFVIASNCHPQTIEICKTRADGFELKVVTKDLKEIDYSCGDVCGVLVQYPGTE  298

Query  962   GEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             GEVLDYGEF+KNAHA+GVKVVMA+DLLALT+LKPPGE GADIVVGSAQRFGVPMGY
Sbjct  299   GEVLDYGEFVKNAHANGVKVVMATDLLALTVLKPPGEFGADIVVGSAQRFGVPMGY  354



>ref|XP_006296473.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
 gb|EOA29371.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
Length=1040

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/360 (74%), Positives = 301/360 (84%), Gaps = 21/360 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RL+ E K+ R NE+            SSL P +    +   +    
Sbjct  1     MERARRLAYRGIVKRLITETKRHRINES------------SSLLPSSRYVSSVSSFLHRR  48

Query  257   AGFPAS--------HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALI  412
             + F A+          Q RSISV+ALKPSDTFPRRHNSA+PE+Q++MA++CGF  L  LI
Sbjct  49    SDFTATSGMNQQQLQNQTRSISVDALKPSDTFPRRHNSASPEEQAQMAKYCGFDDLGTLI  108

Query  413   DATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  589
             D+TVP+SIRL SMKF  KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VPPVIL
Sbjct  109   DSTVPKSIRLGSMKFSEKFDEGLTESQMIKHMSDLASKNKVFKSFIGMGYYNTHVPPVIL  168

Query  590   RNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA  769
             RNIMENPGWYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMA
Sbjct  169   RNIMENPGWYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMA  228

Query  770   MCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQY  949
             MCNNI KGKKKTF++ASNCHPQTID+CKTRA GF+L+VVT DLKDIDY SGDVCGVLVQY
Sbjct  229   MCNNILKGKKKTFLVASNCHPQTIDVCKTRASGFDLRVVTMDLKDIDYSSGDVCGVLVQY  288

Query  950   PGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             PGTEGEVLDYGEF+KNAHA+GVKVVMA+DLLALTMLKPPGE GADIVVGSAQRFGVPMGY
Sbjct  289   PGTEGEVLDYGEFVKNAHANGVKVVMATDLLALTMLKPPGEFGADIVVGSAQRFGVPMGY  348



>ref|XP_010942763.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Elaeis guineensis]
Length=1042

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/356 (76%), Positives = 300/356 (84%), Gaps = 12/356 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             M+RARKLA RAILRRL+ ++K    ++ PAA      R++SSLAP      +  R   A 
Sbjct  1     MDRARKLACRAILRRLISQSK---PSQPPAA---NAPRHLSSLAPSIFPANSATRRHAAA  54

Query  257   AGFP-----ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  421
                P     ASHQ  R ISVE+L+PSDTFPRRHNSA+P+DQ++MAE CGFPSLD LID T
Sbjct  55    DYSPSPFRNASHQ-FRWISVESLRPSDTFPRRHNSASPDDQARMAELCGFPSLDTLIDTT  113

Query  422   VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  601
             VP+SIR+  M  PKFD GLTE+QM+ HMK LAS NKVFKS+IGMGYYNTFVP VILRNIM
Sbjct  114   VPKSIRIAPMTLPKFDAGLTESQMLAHMKRLASMNKVFKSFIGMGYYNTFVPAVILRNIM  173

Query  602   ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  781
             ENPGWYTQYTPYQAEI+QGRLESLLNFQTMITDLT LPMSNASLLDEGTAAAEAMAMCNN
Sbjct  174   ENPGWYTQYTPYQAEIAQGRLESLLNFQTMITDLTALPMSNASLLDEGTAAAEAMAMCNN  233

Query  782   IFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTE  961
             I +GKKKTF+IASNCHPQTID+CKTRA GF+L VV ADLKD DY+S DVCGVL+QYPGTE
Sbjct  234   IQRGKKKTFLIASNCHPQTIDVCKTRAGGFDLNVVVADLKDFDYRSNDVCGVLIQYPGTE  293

Query  962   GEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             GE+LDYGEF+KNAHA GVKVVMA+DLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  294   GEILDYGEFVKNAHASGVKVVMATDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  349



>ref|XP_002282271.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1046

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/357 (76%), Positives = 301/357 (84%), Gaps = 11/357 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAAL------HRPARYVSSLAPCAAMYENQR  238
             MERAR+LANRAILRR+V E+K+     + + AL       R    +S L     +  N R
Sbjct  1     MERARRLANRAILRRVVAESKRHLHISSSSPALVDSSSSFRSVSSMSLLRSHLILGSNVR  60

Query  239   RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  418
               +G+G G      Q RSISVE+L+PSDTFPRRHNSATP+++S MAE CGF SLDALIDA
Sbjct  61    NATGSGVG-----SQLRSISVESLRPSDTFPRRHNSATPQEESSMAETCGFSSLDALIDA  115

Query  419   TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  598
             TVP+SIR+ SMKF K D GLTE+QMIEHM  LA+KNKV+KS+IGMGYY T VP VILRNI
Sbjct  116   TVPKSIRIGSMKFSKLDEGLTESQMIEHMNQLAAKNKVYKSFIGMGYYGTLVPHVILRNI  175

Query  599   MENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCN  778
             MENPGWYTQYTPYQAEISQGRLESLLN+QTM++DLTGLPMSNASLLDEGTAAAEAMAMCN
Sbjct  176   MENPGWYTQYTPYQAEISQGRLESLLNYQTMVSDLTGLPMSNASLLDEGTAAAEAMAMCN  235

Query  779   NIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGT  958
             NI KG KKTF+IA+NCHPQTID+CKTRADGF LKVVT DLKD DYKSGDVCGVLVQYPGT
Sbjct  236   NIQKGMKKTFLIANNCHPQTIDVCKTRADGFGLKVVTLDLKDFDYKSGDVCGVLVQYPGT  295

Query  959   EGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EGEVLDYGEFIK AHA+GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  296   EGEVLDYGEFIKKAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGY  352



>ref|XP_010417387.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1041

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/353 (76%), Positives = 300/353 (85%), Gaps = 6/353 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA R I++RLV+E K+ R N  P+  +  P+RYVSS        +N     G  
Sbjct  1     MERARRLAYRGIVKRLVNETKRHR-NNNPSTTV-TPSRYVSSF--LHRRLDNTVSVVGGS  56

Query  257   AGFPASHQ-QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  433
                   +Q Q R ISV+ALKPSDTFPRRHNSATPE+Q++MA++CGF  L  LID+TVP+S
Sbjct  57    VSGTGRNQHQTRPISVDALKPSDTFPRRHNSATPEEQTQMAKYCGFDDLSKLIDSTVPKS  116

Query  434   IRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             IRLDSMKF  KFD GLTE+QM++HM  LASKN+VFKS+IGMGYYNT VP VILRNIMENP
Sbjct  117   IRLDSMKFSGKFDEGLTESQMVKHMSELASKNRVFKSFIGMGYYNTHVPTVILRNIMENP  176

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
             GWYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEAMAMCNNI K
Sbjct  177   GWYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEAMAMCNNISK  236

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEV  970
             GKKK F+IASNCHPQTID+CKTRADGF+LKVVT DLKD+DY SGDVCGVLVQYPGTEGEV
Sbjct  237   GKKKKFLIASNCHPQTIDVCKTRADGFDLKVVTWDLKDVDYSSGDVCGVLVQYPGTEGEV  296

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LDYGEF+KNAHA+GVKVVMA+DLLALTM KPPGE G DIVVGSAQRFGVPMGY
Sbjct  297   LDYGEFVKNAHANGVKVVMATDLLALTMFKPPGEFGVDIVVGSAQRFGVPMGY  349



>ref|XP_010925018.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Elaeis guineensis]
Length=1040

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/353 (76%), Positives = 301/353 (85%), Gaps = 8/353 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPC--AAMYENQRRYSG  250
             MERAR+LA+RAILRRL+ ++K    ++ PA      +R +SSLAP    A    +R  + 
Sbjct  1     MERARRLASRAILRRLISQSK---PSQPPAP---NASRQLSSLAPAIFPANPAVRRPPAT  54

Query  251   AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  430
               + F  + +Q RSISVE+L+PSDTFPRRHNSA+P+DQ  MAE CGFPSLDALIDATVP 
Sbjct  55    DYSPFRNAGRQSRSISVESLRPSDTFPRRHNSASPDDQVHMAELCGFPSLDALIDATVPN  114

Query  431   SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             SIR+ +M  PKFD GLTE+QM+ HMK LAS NKVFKS+IGMGYYNTFVP VILRNIMENP
Sbjct  115   SIRIPTMALPKFDAGLTESQMLAHMKRLASMNKVFKSFIGMGYYNTFVPAVILRNIMENP  174

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
             GWYTQYTPYQAEI+QGRLESLLNFQTMITDLT LPMSNASLLDEGTAAAEAMAMCNNI K
Sbjct  175   GWYTQYTPYQAEIAQGRLESLLNFQTMITDLTALPMSNASLLDEGTAAAEAMAMCNNIQK  234

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEV  970
             GK+KTF+IASNCHPQTID+CKTRADGF LKVV A LKD+DY S DVCGVL+QYPGTEGE+
Sbjct  235   GKRKTFLIASNCHPQTIDVCKTRADGFGLKVVVAGLKDLDYLSKDVCGVLIQYPGTEGEI  294

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LDYGEF+KNAHA GVKVVMA+DLLALT LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  295   LDYGEFVKNAHASGVKVVMATDLLALTTLKPPGELGADIVVGSAQRFGVPMGY  347



>ref|XP_010472637.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1046

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/362 (74%), Positives = 299/362 (83%), Gaps = 19/362 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAA---ALHRPARYVSSLAPCAAMYENQRRY-  244
             MERAR+LA R I++RLV+E K+ R N   +        P+RYVSS           RR  
Sbjct  1     MERARRLAYRGIVKRLVNETKRHRNNNESSILPPTTVTPSRYVSSFL--------HRRLD  52

Query  245   ---SGAGAGFPAS---HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  406
                S  G   P +     Q R ISV+ALKPSDTFPRRHNSATPE+Q++MA++CGF  L  
Sbjct  53    NTVSVVGGSVPGTGMNQHQTRPISVDALKPSDTFPRRHNSATPEEQTQMAKYCGFDDLSK  112

Query  407   LIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  583
             LID+TVP+SIRL SMKF  KFD GLTE+QMI+HM  LASKN+VFKS+IGMGYYNT VP V
Sbjct  113   LIDSTVPKSIRLGSMKFSGKFDEGLTESQMIKHMSELASKNRVFKSFIGMGYYNTHVPTV  172

Query  584   ILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEA  763
             ILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQT+ITDLTGLPMSNASLLDEGTAAAEA
Sbjct  173   ILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTVITDLTGLPMSNASLLDEGTAAAEA  232

Query  764   MAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLV  943
             MAMCNNI KGKKK F+IASNCHPQTID+CKTRADGF+LKVVT+DLKD+DY SGDVCGVLV
Sbjct  233   MAMCNNILKGKKKKFLIASNCHPQTIDVCKTRADGFDLKVVTSDLKDVDYTSGDVCGVLV  292

Query  944   QYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPM  1123
             QYPGTEGEVLDYGEF+K AHA+GVKVVMA+DLLALT+LKPPGE G DIVVGSAQRFGVPM
Sbjct  293   QYPGTEGEVLDYGEFVKTAHANGVKVVMATDLLALTILKPPGEFGVDIVVGSAQRFGVPM  352

Query  1124  GY  1129
             GY
Sbjct  353   GY  354



>ref|XP_009392931.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1038

 Score =   539 bits (1388),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 266/351 (76%), Positives = 291/351 (83%), Gaps = 6/351 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERARKLA+R ILRRL+ +     +  TPA   H  +   SS+ P      N      A 
Sbjct  1     MERARKLASRGILRRLISQTNS--SAPTPATTRHLSSLASSSVFPTG----NSLLRPPAA  54

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A     + Q RSISV+AL+PSDTFPRRHNSATP+DQS MA  CGF SLDALIDATVP+SI
Sbjct  55    ADSLLRNGQYRSISVDALRPSDTFPRRHNSATPDDQSTMAASCGFGSLDALIDATVPKSI  114

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             R+  MKF KFD GLTE++MI HM  LA+KNKVFKS+IGMGYY+T VP VILRNIMENP W
Sbjct  115   RIPDMKFAKFDGGLTESEMIAHMSRLAAKNKVFKSFIGMGYYDTLVPAVILRNIMENPAW  174

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESLLNFQTMI+DLT LPMSNASLLDEGTAAAEAMAMCNNI KGK
Sbjct  175   YTQYTPYQAEISQGRLESLLNFQTMISDLTALPMSNASLLDEGTAAAEAMAMCNNIQKGK  234

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF IASNCHPQTIDICKTRA+GF++KV  A+LKD DY S DVCGVLVQYPGTEGE+LD
Sbjct  235   KKTFFIASNCHPQTIDICKTRAEGFDIKVAVANLKDFDYTSNDVCGVLVQYPGTEGEILD  294

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEFIKNAHAHGVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  295   YGEFIKNAHAHGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  345



>ref|XP_008797766.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   538 bits (1385),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 263/353 (75%), Positives = 298/353 (84%), Gaps = 8/353 (2%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA RAILRRL+ ++K    ++ PAA      R++SSLAP     +   R   A 
Sbjct  1     MERARRLACRAILRRLISQSK---PSQPPAA---NAPRHLSSLAPSIFPAKPAARLPAAA  54

Query  257   --AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  430
               + F  + +Q R ISVE+L+PSDTF RRHNSA+P+DQ +MAE CGFPSLDALIDATVP+
Sbjct  55    DYSSFRNAGRQSRWISVESLRPSDTFARRHNSASPDDQVRMAEVCGFPSLDALIDATVPK  114

Query  431   SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             SIR+  M  PKFD GLTE+QM+ HM  LAS NK FKS+IGMGYYNTFVP VILRNIMENP
Sbjct  115   SIRIPPMTLPKFDAGLTESQMLGHMNRLASMNKAFKSFIGMGYYNTFVPAVILRNIMENP  174

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
             GWYTQYTPYQAEI+QGRLESLLNFQTMI DLT LPMSNASLLDEGTAAAEAMAMC+NI +
Sbjct  175   GWYTQYTPYQAEIAQGRLESLLNFQTMIADLTALPMSNASLLDEGTAAAEAMAMCSNIQR  234

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEV  970
             GKKKTF+IASNCHPQTID+CKTRA GF++KVV ADLK+ DY+S DVCGVL+QYPGTEGE+
Sbjct  235   GKKKTFLIASNCHPQTIDVCKTRAGGFDIKVVVADLKEFDYRSNDVCGVLIQYPGTEGEI  294

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LDYGEFIKNAHA GVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  295   LDYGEFIKNAHASGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  347



>ref|XP_009401914.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1033

 Score =   535 bits (1379),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 261/351 (74%), Positives = 292/351 (83%), Gaps = 11/351 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERARKLA++AILRRL+ + +       P+  +    R VSSL P      N        
Sbjct  1     MERARKLASQAILRRLISQTR-------PSPPMPAATRRVSSLFPAT----NSLFRPSVL  49

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A     + Q RSISV+AL+PSDTFPRRHNSATPE+Q  MA  CGF SLDALIDATVP++I
Sbjct  50    AESMLRNGQTRSISVDALRPSDTFPRRHNSATPEEQFTMAASCGFSSLDALIDATVPKTI  109

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             R+  ++ PKFD GLTE++MI HM  LA+KNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  110   RISDIRLPKFDAGLTESEMIAHMSRLAAKNKVFKSFIGMGYYNTLVPGVILRNIMENPAW  169

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEI+QGRLESLLNFQTMI+DLT LPMSNASLLDEGTAAAEAM MCNNI KGK
Sbjct  170   YTQYTPYQAEIAQGRLESLLNFQTMISDLTALPMSNASLLDEGTAAAEAMTMCNNIQKGK  229

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF++ASNCHPQTID+CKTRADGF++KVV ADLKD DYKS DVCGVLVQYPGT+GE+LD
Sbjct  230   KKTFLVASNCHPQTIDVCKTRADGFDIKVVVADLKDFDYKSNDVCGVLVQYPGTDGEILD  289

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEFIKNAHAHGVKVVMA+DLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  290   YGEFIKNAHAHGVKVVMATDLLALTVLKPPGELGADIVVGSAQRFGVPMGY  340



>ref|XP_008808050.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   534 bits (1376),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 261/354 (74%), Positives = 300/354 (85%), Gaps = 10/354 (3%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA+RAILRR+++++K     +TPA +    +R++SSLAP +    N        
Sbjct  1     MERARRLASRAILRRVMYQSKP---PQTPAPSA---SRHLSSLAP-SVFPANPAVRRPPA  53

Query  257   AGFPA---SHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
             A +P    +  Q RSISVE+++PSDTF RRHNSA+P+DQ +MAE CGFPSLDALIDATVP
Sbjct  54    ADYPPFRNAGWQSRSISVESMRPSDTFSRRHNSASPDDQVRMAELCGFPSLDALIDATVP  113

Query  428   QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  607
             +SIR+  M  PKFD GLTE+QM+ HMK LAS N+VFKS+IGMGYYNTFVP VILRNIMEN
Sbjct  114   KSIRIPPMALPKFDAGLTESQMLAHMKRLASMNRVFKSFIGMGYYNTFVPAVILRNIMEN  173

Query  608   PGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIF  787
             PGWYTQYTPYQAEI+QGRLESLLNFQTMI DLT LPMSNASLLDEGTAAAEAMAMCNNI 
Sbjct  174   PGWYTQYTPYQAEIAQGRLESLLNFQTMIADLTALPMSNASLLDEGTAAAEAMAMCNNIQ  233

Query  788   KGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGE  967
             KG++KTF+IASNCHPQTI++CKTRADGF LKVV A LKD+DY   DVCGVL+QYPGTEGE
Sbjct  234   KGRRKTFLIASNCHPQTIEVCKTRADGFGLKVVVAGLKDLDYLLNDVCGVLIQYPGTEGE  293

Query  968   VLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +LDYG+F+K AHA GVKVVMA+DLLALTMLKPPGELGADIVVGSAQRFGVPMGY
Sbjct  294   ILDYGDFVKKAHASGVKVVMATDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  347



>emb|CDP08258.1| unnamed protein product [Coffea canephora]
Length=1031

 Score =   525 bits (1353),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 265/359 (74%), Positives = 292/359 (81%), Gaps = 29/359 (8%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLR----ANETPAAA--LHRPARYVSSLAPCAAMYENQR  238
             M+RARKLANRAIL+RLV EAKQ R    ANE  +A    +RP+RYVSSL+PC+   + QR
Sbjct  1     MDRARKLANRAILKRLVSEAKQRRGNGEANELLSAPSPFYRPSRYVSSLSPCSFRGQYQR  60

Query  239   RYSG--AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALI  412
              Y      A   +   Q R +SVEALKPSDTFPRRHNSATPE+Q KM E CGFPSLD+LI
Sbjct  61    TYVNPKKNAFLHSGIGQVRFVSVEALKPSDTFPRRHNSATPEEQIKMVENCGFPSLDSLI  120

Query  413   DATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILR  592
             DATVP+SIRLD M F KFD GLTEAQMI+HM+ LASKNKVFKSYIGMGYYNTFVPPVILR
Sbjct  121   DATVPKSIRLDGMTFSKFDEGLTEAQMIDHMQKLASKNKVFKSYIGMGYYNTFVPPVILR  180

Query  593   NIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAM  772
             N++ENP WYTQYTPYQAEISQGRLESLLN+QTMI DLTGLPMSNASLLDEGTAAAEAMAM
Sbjct  181   NLLENPAWYTQYTPYQAEISQGRLESLLNYQTMIADLTGLPMSNASLLDEGTAAAEAMAM  240

Query  773   CNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYP  952
             CNNI KGKKKTFIIA+NCHPQTID+CKTRA+GF+LK+                     YP
Sbjct  241   CNNIQKGKKKTFIIATNCHPQTIDVCKTRAEGFDLKL---------------------YP  279

Query  953   GTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             GTEGEV+DY  F+KNAHA+GVKVVMASDLLALT+LKPPGE  ADIVVGSAQRFGVPMGY
Sbjct  280   GTEGEVVDYEGFVKNAHANGVKVVMASDLLALTVLKPPGEFDADIVVGSAQRFGVPMGY  338



>ref|XP_003523643.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1031

 Score =   518 bits (1335),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 252/356 (71%), Positives = 292/356 (82%), Gaps = 23/356 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAK-----QLRANETPAAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LAN+AIL+RL+  AK     +  ++ + + +L +P   +           N R+
Sbjct  1     MERARRLANKAILKRLISSAKVNSHSRSLSSISHSFSLPKPENPIG----------NNRK  50

Query  242   YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  421
              S         +   R IS++ALKPSDTFPRRHNSAT E+QSKMA+ CGF SLD+LIDAT
Sbjct  51    LS--------HNVPSRFISLDALKPSDTFPRRHNSATSEEQSKMAQTCGFDSLDSLIDAT  102

Query  422   VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  601
             VP+SIRL+ M F  F+ GLTE++M  HM +LASKNK FKSYIGMGYYNT VPPVILRNIM
Sbjct  103   VPKSIRLNDMSFSVFNEGLTESEMSSHMNSLASKNKCFKSYIGMGYYNTHVPPVILRNIM  162

Query  602   ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  781
             ENP WYTQYTPYQAEISQGRLESL+NFQTMI+DLT LPMSNASLLDEGTAAAEAM+MCNN
Sbjct  163   ENPAWYTQYTPYQAEISQGRLESLMNFQTMISDLTALPMSNASLLDEGTAAAEAMSMCNN  222

Query  782   IFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTE  961
             I KGK+KTFIIASNCHPQT+D+C TRA GF +KVVTAD+KD+DYKSGDVCGVLVQYPGTE
Sbjct  223   IHKGKRKTFIIASNCHPQTVDVCITRASGFGIKVVTADVKDVDYKSGDVCGVLVQYPGTE  282

Query  962   GEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             GE+LDYGEF++ AHAHGVKVVM +DLLALT+LKPPGE+G DIVVGSAQRFGVPMGY
Sbjct  283   GEILDYGEFVEEAHAHGVKVVMGTDLLALTVLKPPGEMGVDIVVGSAQRFGVPMGY  338



>gb|KHN29723.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1031

 Score =   518 bits (1335),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 252/356 (71%), Positives = 292/356 (82%), Gaps = 23/356 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAK-----QLRANETPAAALHRPARYVSSLAPCAAMYENQRR  241
             MERAR+LAN+AIL+RL+  AK     +  ++ + + +L +P   +           N R+
Sbjct  1     MERARRLANKAILKRLISSAKVNSHSRSLSSISHSFSLPKPENPIG----------NNRK  50

Query  242   YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  421
              S         +   R IS++ALKPSDTFPRRHNSAT E+QSKMA+ CGF SLD+LIDAT
Sbjct  51    LS--------HNVPSRFISLDALKPSDTFPRRHNSATSEEQSKMAQTCGFDSLDSLIDAT  102

Query  422   VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  601
             VP+SIRL+ M F  F+ GLTE++M  HM +LASKNK FKSYIGMGYYNT VPPVILRNIM
Sbjct  103   VPKSIRLNDMSFSVFNEGLTESEMSSHMNSLASKNKCFKSYIGMGYYNTHVPPVILRNIM  162

Query  602   ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  781
             ENP WYTQYTPYQAEISQGRLESL+NFQTMI+DLT LPMSNASLLDEGTAAAEAM+MCNN
Sbjct  163   ENPAWYTQYTPYQAEISQGRLESLMNFQTMISDLTALPMSNASLLDEGTAAAEAMSMCNN  222

Query  782   IFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTE  961
             I KGK+KTFIIASNCHPQT+D+C TRA GF +KVVTAD+KD+DYKSGDVCGVLVQYPGTE
Sbjct  223   IHKGKRKTFIIASNCHPQTVDVCITRASGFGIKVVTADVKDVDYKSGDVCGVLVQYPGTE  282

Query  962   GEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             GE+LDYGEF++ AHAHGVKVVM +DLLALT+LKPPGE+G DIVVGSAQRFGVPMGY
Sbjct  283   GEILDYGEFVEEAHAHGVKVVMGTDLLALTVLKPPGEMGVDIVVGSAQRFGVPMGY  338



>emb|CBI27919.3| unnamed protein product [Vitis vinifera]
Length=1024

 Score =   493 bits (1268),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 252/357 (71%), Positives = 281/357 (79%), Gaps = 33/357 (9%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAAL------HRPARYVSSLAPCAAMYENQR  238
             MERAR+LANRAILRR+V E+K+     + + AL       R    +S L     +  N R
Sbjct  1     MERARRLANRAILRRVVAESKRHLHISSSSPALVDSSSSFRSVSSMSLLRSHLILGSNVR  60

Query  239   RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  418
               +G+G G      Q RSISVE+L+PSDTFPRRHNSATP+++S MAE CGF SLDALIDA
Sbjct  61    NATGSGVG-----SQLRSISVESLRPSDTFPRRHNSATPQEESSMAETCGFSSLDALIDA  115

Query  419   TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  598
             TVP+SIR+ SMKF K D GLTE+QMIEHM  LA+KNKV+KS+IGMGYY T VP VILRNI
Sbjct  116   TVPKSIRIGSMKFSKLDEGLTESQMIEHMNQLAAKNKVYKSFIGMGYYGTLVPHVILRNI  175

Query  599   MENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCN  778
             MENPGWYTQYTPYQAEISQGRLESLLN+QTM++DLTGLPMSNASLLDEGTAAAEAMAMCN
Sbjct  176   MENPGWYTQYTPYQAEISQGRLESLLNYQTMVSDLTGLPMSNASLLDEGTAAAEAMAMCN  235

Query  779   NIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGT  958
             NI KG KKTF+IA+NCHPQTID+CKTRADGF LK                      YPGT
Sbjct  236   NIQKGMKKTFLIANNCHPQTIDVCKTRADGFGLK----------------------YPGT  273

Query  959   EGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EGEVLDYGEFIK AHA+GVKVVMASDLLALT+LKPPGELGADIVVGSAQRFGVPMGY
Sbjct  274   EGEVLDYGEFIKKAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGY  330



>ref|XP_003526001.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1023

 Score =   493 bits (1268),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 249/351 (71%), Positives = 289/351 (82%), Gaps = 21/351 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LANRAIL+RL+  A         + +L RP        P  ++  + R+ S   
Sbjct  1     MERARRLANRAILKRLISTAGD------NSHSLLRPK-------PENSILGSNRKLS---  44

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
                   +   RSIS+ ALKPSD+FPRRHNSAT E+Q+KMA+ CGF +LD+LIDATVP+SI
Sbjct  45    -----HYVPSRSISLAALKPSDSFPRRHNSATSEEQTKMAQTCGFDTLDSLIDATVPKSI  99

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             RL  M F  F+ GLTE++M+ HM +LASKNK FKSYIGMGYYNT VPPVILRNIMENP W
Sbjct  100   RLSDMSFSVFNEGLTESEMMSHMNSLASKNKCFKSYIGMGYYNTHVPPVILRNIMENPAW  159

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESL+NFQT+I+DL+ LPMSNASLLDEGTAAAEAM+MCNNI KGK
Sbjct  160   YTQYTPYQAEISQGRLESLMNFQTVISDLSALPMSNASLLDEGTAAAEAMSMCNNIHKGK  219

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             +KTFIIA+NCHPQT+D+C TRA GF +KVVT D+KD+DYKSGDVCGVLVQYPGTEGEVLD
Sbjct  220   RKTFIIANNCHPQTVDVCVTRAAGFGIKVVTVDVKDVDYKSGDVCGVLVQYPGTEGEVLD  279

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEF+K AHA+GVKVVMA+DLLALT+LKPPGE+G DIVVGSAQRFGVPMGY
Sbjct  280   YGEFVKEAHAYGVKVVMATDLLALTVLKPPGEMGVDIVVGSAQRFGVPMGY  330



>gb|KHN32209.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1023

 Score =   492 bits (1267),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 249/351 (71%), Positives = 289/351 (82%), Gaps = 21/351 (6%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LANRAIL+RL+  A         + +L RP        P  ++  + R+ S   
Sbjct  1     MERARRLANRAILKRLISTAGD------NSHSLLRPK-------PENSILGSNRKLS---  44

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
                   +   RSIS+ ALKPSD+FPRRHNSAT E+Q+KMA+ CGF +LD+LIDATVP+SI
Sbjct  45    -----HYVPSRSISLAALKPSDSFPRRHNSATSEEQTKMAQTCGFDTLDSLIDATVPKSI  99

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
             RL  M F  F+ GLTE++M+ HM +LASKNK FKSYIGMGYYNT VPPVILRNIMENP W
Sbjct  100   RLSDMSFSVFNEGLTESEMMSHMNSLASKNKCFKSYIGMGYYNTHVPPVILRNIMENPAW  159

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEISQGRLESL+NFQT+I+DL+ LPMSNASLLDEGTAAAEAM+MCNNI KGK
Sbjct  160   YTQYTPYQAEISQGRLESLMNFQTVISDLSALPMSNASLLDEGTAAAEAMSMCNNIHKGK  219

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             +KTFIIA+NCHPQT+D+C TRA GF +KVVT D+KD+DYKSGDVCGVLVQYPGTEGEVLD
Sbjct  220   RKTFIIANNCHPQTVDVCVTRAAGFGIKVVTVDVKDVDYKSGDVCGVLVQYPGTEGEVLD  279

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             YGEF+K AHA+GVKVVMA+DLLALT+LKPPGE+G DIVVGSAQRFGVPMGY
Sbjct  280   YGEFVKEAHAYGVKVVMATDLLALTVLKPPGEMGVDIVVGSAQRFGVPMGY  330



>ref|XP_006858311.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Amborella trichopoda]
 gb|ERN19778.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
Length=1044

 Score =   487 bits (1254),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 248/360 (69%), Positives = 281/360 (78%), Gaps = 18/360 (5%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LA+ AILRRL+HE+K++     P       AR +SSL     ++ +    S   
Sbjct  1     MERARRLASGAILRRLLHESKRVAPQSRPGPG---GARTISSL-----LHPHSPDKSKRS  52

Query  257   AGFPASHQQR-------RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALID  415
               +   H +R       RSIS EALKPSDTFPRRHNSATPE+Q+KMA+ CGFPSLD+LID
Sbjct  53    DNWLLLHSKRHQHFQYGRSISTEALKPSDTFPRRHNSATPEEQAKMAKTCGFPSLDSLID  112

Query  416   ATVPQSIRLDSMKF--PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  589
             ATVP SIR   M F  P+FD G TE+QM+EHMK L++KNKVFKSYIGMGYYNTFVPPVI+
Sbjct  113   ATVPVSIRGPPMHFSDPRFDAGFTESQMVEHMKRLSAKNKVFKSYIGMGYYNTFVPPVIV  172

Query  590   RNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMA  769
             RNIMENPGWYTQYTPYQAEI+QGRLE+LLNFQT++TDLT LPMSNASLLDEGTAAAEAMA
Sbjct  173   RNIMENPGWYTQYTPYQAEIAQGRLEALLNFQTLVTDLTALPMSNASLLDEGTAAAEAMA  232

Query  770   MCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQY  949
             MC  I KG +K F+IAS+CHPQTIDIC+TRA GF L V        DY   DVCGVLVQY
Sbjct  233   MCGAINKG-RKVFLIASDCHPQTIDICQTRAAGFGLDVRVGPAGSFDYSKKDVCGVLVQY  291

Query  950   PGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             P T G V DY EF+K AHA GVKVVMASDLLALT+LKPPGE+GADIVVGSAQRFGVPMGY
Sbjct  292   PTTLGHVNDYEEFVKAAHASGVKVVMASDLLALTVLKPPGEMGADIVVGSAQRFGVPMGY  351



>gb|AAA63798.1| victorin binding protein [Avena sativa]
Length=1032

 Score =   481 bits (1238),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 245/352 (70%), Positives = 282/352 (80%), Gaps = 14/352 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
             MERAR+LANRA+LRRL+  +    +  TP+     P+R +S+L P  A     RR   A 
Sbjct  1     MERARRLANRALLRRLLAGSA---STTTPS-----PSRGISTLVPSPAAGSRPRRARPA-  51

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
                   H   R +SV AL+PSDTFPRRHNSA+P +Q+ MA  CGF +LD+LIDATVP +I
Sbjct  52    ----HQHTPSRPVSVSALQPSDTFPRRHNSASPAEQTVMASTCGFNTLDSLIDATVPAAI  107

Query  437   RLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
             R   M+F  KFD G TE+QM+EHM +LAS NKV+KS+IGMGYYNT +P VILRN+MENP 
Sbjct  108   RAPPMQFTGKFDAGFTESQMLEHMAHLASMNKVYKSFIGMGYYNTHIPAVILRNLMENPA  167

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYTQYTPYQAEI+QGRLESLLN+QTM+ DLTGLPMSNASLLDE TAAAEAMAMCN I K 
Sbjct  168   WYTQYTPYQAEIAQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGILKA  227

Query  794   KKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVL  973
             KKKTF+IASNCHPQTIDIC+TRA GF+L VV +D KD DY SGDVCGVLVQYPGTEGEVL
Sbjct  228   KKKTFLIASNCHPQTIDICQTRAAGFDLNVVVSDAKDFDYSSGDVCGVLVQYPGTEGEVL  287

Query  974   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DY EF+K+AH HGVKVVMA+DLLALT L+PPGE+GADI VGSAQRFGVPMGY
Sbjct  288   DYAEFVKDAHKHGVKVVMATDLLALTTLRPPGEIGADIAVGSAQRFGVPMGY  339



>gb|KDO80088.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=946

 Score =   474 bits (1219),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 222/253 (88%), Positives = 239/253 (94%), Gaps = 0/253 (0%)
 Frame = +2

Query  371   MAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIG  550
             M+E  G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IG
Sbjct  1     MSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIG  60

Query  551   MGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNAS  730
             MGYYNT VPPVILRNIMENP WYTQYTPYQAEI+QGRLESLLNFQTMI DLTGLPMSNAS
Sbjct  61    MGYYNTHVPPVILRNIMENPAWYTQYTPYQAEIAQGRLESLLNFQTMIADLTGLPMSNAS  120

Query  731   LLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDID  910
             LLDEGTAAAEAMAMCNNI KGKKKTFIIASNCHPQTIDIC TRADGF++KVV +DLKDID
Sbjct  121   LLDEGTAAAEAMAMCNNIQKGKKKTFIIASNCHPQTIDICITRADGFDIKVVVSDLKDID  180

Query  911   YKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIV  1090
             YKSGDVCGVLVQYPGTEGEVLDYG+FIKNAHA+GVKVVMA+DLLALT+LKPPGELGADIV
Sbjct  181   YKSGDVCGVLVQYPGTEGEVLDYGDFIKNAHANGVKVVMATDLLALTILKPPGELGADIV  240

Query  1091  VGSAQRFGVPMGY  1129
             VGSAQRFGVPMGY
Sbjct  241   VGSAQRFGVPMGY  253



>ref|XP_007136824.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
 gb|ESW08818.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
Length=1018

 Score =   474 bits (1220),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 244/357 (68%), Positives = 278/357 (78%), Gaps = 25/357 (7%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAA------MYENQR  238
             MERAR+LANRAIL+RLV   K            H  +R +S ++   A      +  N R
Sbjct  1     MERARRLANRAILQRLVSSTKD-----------HSHSRRLSRVSDSFARAKQEKLIGNNR  49

Query  239   RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  418
              +        A + + RSISVEALKPSDTFPRRHNSAT ++   MA+ CGF  L++LIDA
Sbjct  50    HH--------ACNVRSRSISVEALKPSDTFPRRHNSATSDELINMAQTCGFSDLNSLIDA  101

Query  419   TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  598
             T+P SIR   M F  FD GLTEA+M+ HMK+L +KNK FKSYIGMGYY+  VP VILRNI
Sbjct  102   TIPISIRRKEMSFNTFDEGLTEAEMMLHMKSLEAKNKCFKSYIGMGYYDMHVPTVILRNI  161

Query  599   MENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCN  778
             MENP WYTQYTPYQAEISQGRLESL+N+QTM+ DLT LPMSNASLLDEGTAAAEAM MC+
Sbjct  162   MENPAWYTQYTPYQAEISQGRLESLMNYQTMVADLTALPMSNASLLDEGTAAAEAMWMCS  221

Query  779   NIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGT  958
             NI KGK+KTF+IA+NCHPQTIDIC TRA GF +KVV  D+KD+DY SGDVCGVLVQYPGT
Sbjct  222   NIHKGKRKTFVIANNCHPQTIDICMTRATGFGIKVVAVDVKDVDYGSGDVCGVLVQYPGT  281

Query  959   EGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EGEVLDYGEF+K AH+HGVKVVMA+DLLALTMLKPPGEL  DIVVGS QRFGVPMGY
Sbjct  282   EGEVLDYGEFVKEAHSHGVKVVMATDLLALTMLKPPGELEVDIVVGSTQRFGVPMGY  338



>ref|XP_004969722.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Setaria italica]
Length=1033

 Score =   465 bits (1197),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 234/319 (73%), Positives = 266/319 (83%), Gaps = 9/319 (3%)
 Frame = +2

Query  182   PARYVSSLAPCAAMYENQRRYSGAGAGFPASHQ--QRRSISVEALKPSDTFPRRHNSATP  355
             P+R +S+LAP  A    +RR    GA     HQ  Q R +SV AL+PSDTFPRRHNSATP
Sbjct  28    PSRGISTLAPAPAA-AGKRRPRARGA-----HQYAQGRPVSVSALQPSDTFPRRHNSATP  81

Query  356   EDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKV  532
              +Q+ MA  CGF ++DALIDATVP +IR  +M F  KFD G TE+QMI+HM+ LAS NK 
Sbjct  82    AEQAAMASTCGFDTVDALIDATVPAAIRAPTMHFAGKFDEGFTESQMIDHMQRLASMNKA  141

Query  533   FKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGL  712
             +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQAEI+QGRLESLLN+QTMI DLTGL
Sbjct  142   YKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQAEIAQGRLESLLNYQTMIADLTGL  201

Query  713   PMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTA  892
             PMSNASLLDE TAAAEAMAMCN I + KKKTF+IASNCHPQTID+C+TRA GF++KV+ A
Sbjct  202   PMSNASLLDEATAAAEAMAMCNGILRXKKKTFLIASNCHPQTIDVCETRAAGFDIKVIVA  261

Query  893   DLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGE  1072
             D KD DY SGDVCGVLVQYPGTEGEVLDY EF+K+AHAHGVKVVMA+DLLALT L+PPGE
Sbjct  262   DAKDFDYSSGDVCGVLVQYPGTEGEVLDYAEFVKDAHAHGVKVVMATDLLALTTLRPPGE  321

Query  1073  LGADIVVGSAQRFGVPMGY  1129
             +GADI VGSAQRFGVPMGY
Sbjct  322   IGADIAVGSAQRFGVPMGY  340



>ref|XP_001754864.1| predicted protein [Physcomitrella patens]
 gb|EDQ80318.1| predicted protein [Physcomitrella patens]
Length=1038

 Score =   463 bits (1191),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 231/356 (65%), Positives = 277/356 (78%), Gaps = 16/356 (4%)
 Frame = +2

Query  77    MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYS---  247
             MERA++     +++RLV +A  +R    P+A    P R  ++L   AA  E +R +    
Sbjct  1     MERAKQ----QVVKRLVQQA--VRRAAAPSA----PVRSGAALR-AAAGNETRRGFGASL  49

Query  248   --GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  421
               G+G G        R+ISVEALKPSDTF RRHNSAT E+Q  MA  CGF  +DA+IDAT
Sbjct  50    LRGSGNGVVQLPLGVRAISVEALKPSDTFQRRHNSATLEEQKAMAGMCGFEDMDAMIDAT  109

Query  422   VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  601
             VP+SIR   +K  K+  GLTE++++ H K+LASKNKV +S+IGMGY++T VP VILRNI+
Sbjct  110   VPKSIRRPDLKLSKYAEGLTESELLAHFKSLASKNKVMRSFIGMGYHDTHVPTVILRNIL  169

Query  602   ENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNN  781
             ENPGWYTQYTPYQAEI+QGRLESLLNFQTMITDLTG+PMSNASLLDEGTAAAEAM MC+N
Sbjct  170   ENPGWYTQYTPYQAEIAQGRLESLLNFQTMITDLTGMPMSNASLLDEGTAAAEAMTMCSN  229

Query  782   IFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTE  961
             I +G+KKTF++A NCHPQTI++CKTRADG  L VV AD K  DY S DV GVLVQYP T+
Sbjct  230   IARGRKKTFLVADNCHPQTIEVCKTRADGLGLNVVVADYKKFDYSSKDVSGVLVQYPATD  289

Query  962   GEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             G V DY +F+KNAHAHGVKVVMA+DLL+LT+L PPGELGAD+VVGSAQRFGVPMGY
Sbjct  290   GSVNDYSDFVKNAHAHGVKVVMATDLLSLTVLTPPGELGADMVVGSAQRFGVPMGY  345



>ref|XP_001780310.1| predicted protein [Physcomitrella patens]
 gb|EDQ54869.1| predicted protein [Physcomitrella patens]
Length=995

 Score =   458 bits (1178),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 212/281 (75%), Positives = 242/281 (86%), Gaps = 0/281 (0%)
 Frame = +2

Query  287   RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKF  466
             R+IS+EALKPSDTF RRHNS T E+Q  MA+ CGF S+DA+IDATVP+SIR   +   K+
Sbjct  22    RTISIEALKPSDTFQRRHNSPTLEEQKMMAQACGFDSMDAMIDATVPKSIRRPDLNLSKY  81

Query  467   DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAE  646
               GLTE+Q++ H K +ASKNKV KSYIGMGYY+T VP VILRNI+ENPGWYTQYTPYQAE
Sbjct  82    GEGLTESQLLAHFKAMASKNKVMKSYIGMGYYDTHVPTVILRNILENPGWYTQYTPYQAE  141

Query  647   ISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNC  826
             I+QGRLESLLNFQTMITDLTG+PMSNASLLDEGTAAAEAM MC+NI +G+KKTF++A NC
Sbjct  142   IAQGRLESLLNFQTMITDLTGMPMSNASLLDEGTAAAEAMTMCSNIARGRKKTFLVADNC  201

Query  827   HPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHA  1006
             HPQTI++CKTRADG  L VV AD K  DY S DV GVLVQYP T+G V DY +F+KNAHA
Sbjct  202   HPQTIEVCKTRADGLGLNVVVADYKKFDYSSKDVSGVLVQYPATDGSVNDYSDFVKNAHA  261

Query  1007  HGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             HGVKVVMA+DLL+LTML PPGELGAD+VVGSAQRFGVPMGY
Sbjct  262   HGVKVVMATDLLSLTMLTPPGELGADMVVGSAQRFGVPMGY  302



>gb|EAY75571.1| hypothetical protein OsI_03474 [Oryza sativa Indica Group]
Length=1033

 Score =   456 bits (1173),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 232/323 (72%), Positives = 263/323 (81%), Gaps = 17/323 (5%)
 Frame = +2

Query  182   PARYVSSLAPCAAMYENQRRYSGAG----AGFPASHQQR--RSISVEALKPSDTFPRRHN  343
             P+R +S+LA          +  GAG    A  PA HQ    R +S  AL+PSDTFPRRHN
Sbjct  28    PSRGISTLA----------KAPGAGSRPRAPRPAPHQYTTGRPVSASALQPSDTFPRRHN  77

Query  344   SATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLAS  520
             SATP +Q+ MA  CGF +LDALIDATVP +IR  +M F  KFD G TE+QMI+HM+ LA+
Sbjct  78    SATPAEQAAMASECGFNTLDALIDATVPAAIRAPTMHFSGKFDAGFTESQMIDHMQRLAA  137

Query  521   KNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITD  700
              NK +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQAEI+QGRLESLLN+QTM+ D
Sbjct  138   MNKAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQAEIAQGRLESLLNYQTMVAD  197

Query  701   LTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELK  880
             LTGLPMSNASLLDE TAAAEAMAMCN I K KKKTF+IASNCHPQTID+C+TRA GF+L 
Sbjct  198   LTGLPMSNASLLDEATAAAEAMAMCNGILKSKKKTFLIASNCHPQTIDVCQTRAAGFDLN  257

Query  881   VVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLK  1060
             V+ AD KD DY SGDVCGVLVQYPGTEGEVLDY EF+K+AHAHGVKVVMA+DLLALT L+
Sbjct  258   VIVADAKDFDYSSGDVCGVLVQYPGTEGEVLDYAEFVKDAHAHGVKVVMATDLLALTSLR  317

Query  1061  PPGELGADIVVGSAQRFGVPMGY  1129
             PPGE+GADI VGSAQRFGVPMGY
Sbjct  318   PPGEIGADIAVGSAQRFGVPMGY  340



>ref|NP_001058062.1| Os06g0611900 [Oryza sativa Japonica Group]
 dbj|BAF19976.1| Os06g0611900 [Oryza sativa Japonica Group]
Length=892

 Score =   451 bits (1160),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 217/283 (77%), Positives = 247/283 (87%), Gaps = 1/283 (0%)
 Frame = +2

Query  284   RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  460
             RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  56    RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  115

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
             +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  116   RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  175

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AEI+QGRLESLLN+QTM+ DLTGLPMSNASLLDE TAAAEAMAMCN I K KKKTF+IAS
Sbjct  176   AEIAQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGILKSKKKTFLIAS  235

Query  821   NCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
             NCHPQTID+C+TRA GF+L VV AD KD DY SGDVCGVLVQYPGTEGEVLDY EF+++A
Sbjct  236   NCHPQTIDVCQTRAAGFDLNVVVADAKDFDYGSGDVCGVLVQYPGTEGEVLDYAEFVRDA  295

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             HAHGVKVVMA+DLLALT L+PPGE+GADI VGSAQRFGVPMGY
Sbjct  296   HAHGVKVVMATDLLALTSLRPPGEIGADIAVGSAQRFGVPMGY  338



>ref|NP_001044046.1| Os01g0711400 [Oryza sativa Japonica Group]
 gb|AAQ24377.1| glycine dehydrogenase P protein [Oryza sativa Japonica Group]
 dbj|BAF05960.1| Os01g0711400 [Oryza sativa Japonica Group]
Length=1033

 Score =   454 bits (1169),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 223/291 (77%), Positives = 250/291 (86%), Gaps = 3/291 (1%)
 Frame = +2

Query  266   PASHQQR--RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR  439
             PA HQ    R +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR
Sbjct  50    PAPHQYTTGRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFNTLDALIDATVPAAIR  109

Query  440   LDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
               +M F  KFD G TE+QMI+HM+ LA+ NK +KS+IGMGYYNT VP VILRN+MENP W
Sbjct  110   APTMHFSGKFDAGFTESQMIDHMQRLAAMNKAYKSFIGMGYYNTHVPAVILRNLMENPAW  169

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQAEI+QGRLESLLN+QTM+ DLTGLPMSNASLLDE TAAAEAMAMCN I K K
Sbjct  170   YTQYTPYQAEIAQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGILKSK  229

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLD  976
             KKTF+IASNCHPQTID+C+TRA GF+L V+ AD KD DY SGDVCGVLVQYPGTEGEVLD
Sbjct  230   KKTFLIASNCHPQTIDVCQTRAAGFDLNVIVADAKDFDYSSGDVCGVLVQYPGTEGEVLD  289

Query  977   YGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             Y EF+K+AHAHGVKVVMA+DLLALT L+PPGE+GADI VGSAQRFGVPMGY
Sbjct  290   YAEFVKDAHAHGVKVVMATDLLALTSLRPPGEIGADIAVGSAQRFGVPMGY  340



>gb|AAS16361.1| glycine dehydrogenase P protein [Oryza sativa Indica Group]
Length=892

 Score =   451 bits (1159),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 217/283 (77%), Positives = 247/283 (87%), Gaps = 1/283 (0%)
 Frame = +2

Query  284   RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  460
             RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  56    RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  115

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
             +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  116   RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  175

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AEI+QGRLESLLN+QTM+ DLTGLPMSNASLLDE TAAAEAMAMCN I K KKKTF+IAS
Sbjct  176   AEIAQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGILKSKKKTFLIAS  235

Query  821   NCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
             NCHPQTID+C+TRA GF+L VV AD KD DY SGDVCGVLVQYPGTEGEVLDY EF+++A
Sbjct  236   NCHPQTIDVCQTRAAGFDLNVVVADAKDFDYGSGDVCGVLVQYPGTEGEVLDYAEFVRDA  295

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             HAHGVKVVMA+DLLALT L+PPGE+GADI VGSAQRFGVPMGY
Sbjct  296   HAHGVKVVMATDLLALTSLRPPGEIGADIAVGSAQRFGVPMGY  338



>ref|XP_003569669.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Brachypodium distachyon]
Length=1033

 Score =   454 bits (1168),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 229/317 (72%), Positives = 258/317 (81%), Gaps = 11/317 (3%)
 Frame = +2

Query  188   RYVSSL--APCAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPED  361
             R +S+L  AP A    + RR           H Q R +SV AL+PSDTFPRRHNSATP +
Sbjct  30    RGISTLVPAPAAGSRPHTRRAH--------QHTQGRPVSVSALQPSDTFPRRHNSATPAE  81

Query  362   QSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFK  538
             Q+ MA  CGF +LDALIDATVP +IR   M+F  KFD G TE+QM+EHM  L+S NK +K
Sbjct  82    QAVMASACGFNTLDALIDATVPAAIRAPPMQFSGKFDAGFTESQMLEHMARLSSMNKAYK  141

Query  539   SYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPM  718
             S+IGMGYYNT +P VILRN+MENP WYTQYTPYQAEI+QGRLESLLN+QTM+ DLTGLPM
Sbjct  142   SFIGMGYYNTHIPAVILRNLMENPAWYTQYTPYQAEIAQGRLESLLNYQTMVADLTGLPM  201

Query  719   SNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADL  898
             SNASLLDE TAAAEAMAMCN I K KKKTF+IASNCHPQTIDIC+TRA GF+L VV +  
Sbjct  202   SNASLLDEATAAAEAMAMCNGILKSKKKTFLIASNCHPQTIDICQTRAAGFDLNVVVSAA  261

Query  899   KDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELG  1078
             KD DY SGDVCGVLVQYPGTEGEVLDY EF+K+AHAHGVKVVMA+DLLALT L+PPGE+G
Sbjct  262   KDFDYSSGDVCGVLVQYPGTEGEVLDYAEFVKDAHAHGVKVVMATDLLALTTLRPPGEIG  321

Query  1079  ADIVVGSAQRFGVPMGY  1129
             ADI VGSAQRFGVPMGY
Sbjct  322   ADIAVGSAQRFGVPMGY  338



>ref|NP_001292744.1| glycine dehydrogenase (decarboxylating), mitochondrial precursor 
[Zea mays]
 gb|AFW56070.1| glycine cleavage complex P-protein [Zea mays]
Length=1042

 Score =   454 bits (1167),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 220/316 (70%), Positives = 261/316 (83%), Gaps = 1/316 (0%)
 Frame = +2

Query  185   ARYVSSLAPCAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQ  364
             +R +S+L+P       Q+R           H Q R++SV AL+PSDTFPRRHNSATP +Q
Sbjct  32    SRGISTLSPPPPAAGKQQRRCCPPPRGAHQHAQARAVSVSALQPSDTFPRRHNSATPAEQ  91

Query  365   SKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKS  541
               MA  CGF  +DAL+DATVP +IR   M+FP +FD G TE+QM++HM+ LAS N+ FKS
Sbjct  92    EAMASACGFGGVDALVDATVPPAIRAPPMRFPGRFDAGFTESQMLDHMRRLASMNRDFKS  151

Query  542   YIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMS  721
             +IGMGYY T VP V+LRN+MENP WYTQYTPYQAEI+QGRLESLLN+QTM+ DLTGLPMS
Sbjct  152   FIGMGYYGTHVPAVVLRNLMENPAWYTQYTPYQAEIAQGRLESLLNYQTMVADLTGLPMS  211

Query  722   NASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLK  901
             NASLLDE TAAAEAMAMC+ I +GKK+TF+IASNCHPQTID+C+TR+DGF ++VV AD K
Sbjct  212   NASLLDEATAAAEAMAMCSAILRGKKRTFLIASNCHPQTIDVCRTRSDGFGIRVVVADAK  271

Query  902   DIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGA  1081
             D+DY  GDVCGVLVQYPGTEGEVLDY EF+++AHAHGVKVVMA+DLLALT L+PPGE+GA
Sbjct  272   DLDYGGGDVCGVLVQYPGTEGEVLDYAEFVRDAHAHGVKVVMATDLLALTALRPPGEIGA  331

Query  1082  DIVVGSAQRFGVPMGY  1129
             DI VGSAQRFGVPMGY
Sbjct  332   DIAVGSAQRFGVPMGY  347



>gb|AFW56071.1| glycine cleavage complex P-protein [Zea mays]
Length=1097

 Score =   454 bits (1168),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 220/316 (70%), Positives = 261/316 (83%), Gaps = 1/316 (0%)
 Frame = +2

Query  185   ARYVSSLAPCAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQ  364
             +R +S+L+P       Q+R           H Q R++SV AL+PSDTFPRRHNSATP +Q
Sbjct  32    SRGISTLSPPPPAAGKQQRRCCPPPRGAHQHAQARAVSVSALQPSDTFPRRHNSATPAEQ  91

Query  365   SKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKS  541
               MA  CGF  +DAL+DATVP +IR   M+FP +FD G TE+QM++HM+ LAS N+ FKS
Sbjct  92    EAMASACGFGGVDALVDATVPPAIRAPPMRFPGRFDAGFTESQMLDHMRRLASMNRDFKS  151

Query  542   YIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMS  721
             +IGMGYY T VP V+LRN+MENP WYTQYTPYQAEI+QGRLESLLN+QTM+ DLTGLPMS
Sbjct  152   FIGMGYYGTHVPAVVLRNLMENPAWYTQYTPYQAEIAQGRLESLLNYQTMVADLTGLPMS  211

Query  722   NASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLK  901
             NASLLDE TAAAEAMAMC+ I +GKK+TF+IASNCHPQTID+C+TR+DGF ++VV AD K
Sbjct  212   NASLLDEATAAAEAMAMCSAILRGKKRTFLIASNCHPQTIDVCRTRSDGFGIRVVVADAK  271

Query  902   DIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGA  1081
             D+DY  GDVCGVLVQYPGTEGEVLDY EF+++AHAHGVKVVMA+DLLALT L+PPGE+GA
Sbjct  272   DLDYGGGDVCGVLVQYPGTEGEVLDYAEFVRDAHAHGVKVVMATDLLALTALRPPGEIGA  331

Query  1082  DIVVGSAQRFGVPMGY  1129
             DI VGSAQRFGVPMGY
Sbjct  332   DIAVGSAQRFGVPMGY  347



>gb|EAZ13293.1| hypothetical protein OsJ_03218 [Oryza sativa Japonica Group]
Length=1035

 Score =   451 bits (1161),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 217/283 (77%), Positives = 247/283 (87%), Gaps = 1/283 (0%)
 Frame = +2

Query  284   RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  460
             RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  60    RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  119

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
             +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  120   RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  179

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AEI+QGRLESLLN+QTM+ DLTGLPMSNASLLDE TAAAEAMAMCN I K KKKTF+IAS
Sbjct  180   AEIAQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGILKSKKKTFLIAS  239

Query  821   NCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
             NCHPQTID+C+TRA GF+L V+ AD KD DY SGDVCGVLVQYPGTEGEVLDY EF+K+A
Sbjct  240   NCHPQTIDVCQTRAAGFDLNVIVADAKDFDYSSGDVCGVLVQYPGTEGEVLDYAEFVKDA  299

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             HAHGVKVVMA+DLLALT L+PPGE+GADI VGSAQRFGVPMGY
Sbjct  300   HAHGVKVVMATDLLALTSLRPPGEIGADIAVGSAQRFGVPMGY  342



>dbj|BAD35509.1| putative glycine dehydrogenase [Oryza sativa Japonica Group]
 gb|EAZ01651.1| hypothetical protein OsI_23687 [Oryza sativa Indica Group]
Length=1031

 Score =   450 bits (1157),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 217/283 (77%), Positives = 247/283 (87%), Gaps = 1/283 (0%)
 Frame = +2

Query  284   RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  460
             RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  56    RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  115

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
             +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  116   RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  175

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AEI+QGRLESLLN+QTM+ DLTGLPMSNASLLDE TAAAEAMAMCN I K KKKTF+IAS
Sbjct  176   AEIAQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGILKSKKKTFLIAS  235

Query  821   NCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
             NCHPQTID+C+TRA GF+L VV AD KD DY SGDVCGVLVQYPGTEGEVLDY EF+++A
Sbjct  236   NCHPQTIDVCQTRAAGFDLNVVVADAKDFDYGSGDVCGVLVQYPGTEGEVLDYAEFVRDA  295

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             HAHGVKVVMA+DLLALT L+PPGE+GADI VGSAQRFGVPMGY
Sbjct  296   HAHGVKVVMATDLLALTSLRPPGEIGADIAVGSAQRFGVPMGY  338



>ref|XP_002441849.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
 gb|EES15687.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
Length=1042

 Score =   448 bits (1152),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/285 (76%), Positives = 248/285 (87%), Gaps = 2/285 (1%)
 Frame = +2

Query  281   QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPS-LDALIDATVPQSIRLDSMKF  457
             Q R +SV AL+PSDTFPRRHNSATP +Q+ MA  CGF   LDALIDATVP +IR   M+F
Sbjct  64    QGRPVSVSALQPSDTFPRRHNSATPAEQAAMATTCGFDGGLDALIDATVPAAIRAPPMRF  123

Query  458   P-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTP  634
               +FD GLTE+QM++HM+ LAS NK +KS+IGMGYY T VP V+LRN+MENP WYTQYTP
Sbjct  124   SGRFDAGLTESQMLDHMQRLASMNKAYKSFIGMGYYGTHVPGVVLRNLMENPAWYTQYTP  183

Query  635   YQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFII  814
             YQAEI+QGRLESLLN+QTM+ DLTGLPMSNASLLDE TAAAEAMAMCN I +GKKKTF+I
Sbjct  184   YQAEIAQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGIVRGKKKTFLI  243

Query  815   ASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIK  994
             ASNCHPQTID+C+TRADGF++ VV AD KD DY  GDVCGVLVQYPGTEGEVLDY +F++
Sbjct  244   ASNCHPQTIDVCRTRADGFDISVVVADAKDFDYSGGDVCGVLVQYPGTEGEVLDYAQFVR  303

Query  995   NAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +AHAHGVKVVMA+DLLALT L+PPGE+GADI VGSAQRFGVPMGY
Sbjct  304   DAHAHGVKVVMATDLLALTTLRPPGEIGADIAVGSAQRFGVPMGY  348



>emb|CDM83805.1| unnamed protein product [Triticum aestivum]
Length=1031

 Score =   446 bits (1148),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 230/317 (73%), Positives = 258/317 (81%), Gaps = 11/317 (3%)
 Frame = +2

Query  188   RYVSSLAPCAAMYENQRRYSGAGAGFPASHQQR--RSISVEALKPSDTFPRRHNSATPED  361
             R VS+LAP  A     R         PA HQ    R +SV AL+PSDTFPRRHNSATP +
Sbjct  30    RGVSTLAPKPAAGSRPR-------ARPA-HQYTPGRPVSVSALQPSDTFPRRHNSATPAE  81

Query  362   QSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFK  538
             Q+ MA  CGF +LDALIDATVP +IR   M+F  KFD G TE+QM+EHM +LAS NK +K
Sbjct  82    QAVMASECGFNTLDALIDATVPAAIRAPPMQFTGKFDAGFTESQMLEHMAHLASMNKTYK  141

Query  539   SYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPM  718
             S+IGMGYYNT +P VILRN+MENP WYTQYTPYQAEI+QGRLESLLN+QTM+ DLTGLPM
Sbjct  142   SFIGMGYYNTHIPAVILRNLMENPAWYTQYTPYQAEIAQGRLESLLNYQTMVADLTGLPM  201

Query  719   SNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADL  898
             SNASLLDE TAAAEAMAMC  I K KKKTF+IASNCHPQTIDIC+TRA GF++ VV +  
Sbjct  202   SNASLLDEATAAAEAMAMCLGIVKSKKKTFLIASNCHPQTIDICQTRATGFDINVVVSAA  261

Query  899   KDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELG  1078
             KD DY SGDVCGVLVQYPGTEGEVLDY EF+K+AHAHGVKVVMA+DLLALT L+PPGE+G
Sbjct  262   KDFDYSSGDVCGVLVQYPGTEGEVLDYAEFVKDAHAHGVKVVMATDLLALTTLRPPGEIG  321

Query  1079  ADIVVGSAQRFGVPMGY  1129
             ADI VGSAQRFGVPMGY
Sbjct  322   ADIAVGSAQRFGVPMGY  338



>gb|AAB82711.1| glycine decarboxylase P subunit [x Tritordeum sp.]
Length=1031

 Score =   443 bits (1140),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 217/280 (78%), Positives = 244/280 (87%), Gaps = 1/280 (0%)
 Frame = +2

Query  293   ISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFD  469
             +SV AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR   M+F  KFD
Sbjct  59    VSVSALQPSDTFPRRHNSATPAEQAVMASECGFNTLDALIDATVPAAIRAPPMQFTGKFD  118

Query  470   HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEI  649
              G TE+QM+EHM +LAS NK +KS+IGMGYYNT +P VILRN+MENP WYTQYTPYQAEI
Sbjct  119   AGFTESQMLEHMAHLASMNKTYKSFIGMGYYNTHIPAVILRNLMENPAWYTQYTPYQAEI  178

Query  650   SQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCH  829
             +QGRLESLLN+QTM+ DLTGLPMSNASLLDE TAAAEAMAMC  I K KKKTF+IASNCH
Sbjct  179   AQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCLGIVKSKKKTFLIASNCH  238

Query  830   PQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAH  1009
             PQTIDIC+TRA GF++ VV +  KD DY SGDVCGVLVQYPGTEGEVLDY EF+K+AHAH
Sbjct  239   PQTIDICQTRATGFDINVVVSAAKDFDYSSGDVCGVLVQYPGTEGEVLDYAEFVKDAHAH  298

Query  1010  GVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             GVKVVMA+DLLALT L+PPGE+GADI VGSAQRFGVPMGY
Sbjct  299   GVKVVMATDLLALTTLRPPGEIGADIAVGSAQRFGVPMGY  338



>gb|AFV46211.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=266

 Score =   416 bits (1069),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 207/282 (73%), Positives = 228/282 (81%), Gaps = 26/282 (9%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  256
            MERARKL +RAILRRLV E KQ          L++ +RYVSSL+   A+   QR     G
Sbjct  1    MERARKLGSRAILRRLVSEQKQ--------QPLYKSSRYVSSLSASVAV---QR-----G  44

Query  257  AGFPASHQ----------QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  406
            +    SH             RSISV+ALKPSD+FPRRHNSA PE+QSKMAEF GF SLD+
Sbjct  45   SNVVNSHSFNSRSLVQFVGSRSISVDALKPSDSFPRRHNSAAPENQSKMAEFVGFDSLDS  104

Query  407  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  586
            LIDATVP+SIR+D M+ P F  GLTEAQM+EHM++LASKNKVFKSYIGMGYYNTFVPPVI
Sbjct  105  LIDATVPKSIRIDKMELPVFSEGLTEAQMLEHMQDLASKNKVFKSYIGMGYYNTFVPPVI  164

Query  587  LRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAM  766
            LRNIMENPGWYTQYTPYQAEISQGRLESLLN+QTMITDLTGLPMSNASLLDEGTAAAEAM
Sbjct  165  LRNIMENPGWYTQYTPYQAEISQGRLESLLNYQTMITDLTGLPMSNASLLDEGTAAAEAM  224

Query  767  AMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTA  892
            AMCNNI KGKKKTF+IASNCHPQTID+C TRADGF LKVV +
Sbjct  225  AMCNNILKGKKKTFVIASNCHPQTIDVCVTRADGFGLKVVIS  266



>gb|AGH12216.1| glycine decarboxylase P protein, partial [Flaveria pringlei]
Length=250

 Score =   390 bits (1001),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 219/261 (84%), Gaps = 16/261 (6%)
 Frame = +2

Query  77   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYEN---QRRYS  247
            MERAR+LAN+AILRRLV + K     +    AL+ P+RYVSSL+P      N    R  +
Sbjct  1    MERARRLANKAILRRLVSKTK----TQPITPALYSPSRYVSSLSPYICSGTNVRFDRNVN  56

Query  248  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  427
            G G+       Q R+ISVEALKPSDTFP RHNSATPE+Q+KMAEF G+P+LD+LIDATVP
Sbjct  57   GFGS-------QARTISVEALKPSDTFPHRHNSATPEEQTKMAEFVGYPNLDSLIDATVP  109

Query  428  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  607
            +SIRL+SMK+PKFD GLTE+QMI HM+ LASKNK+FKS+IGMGYYNT+VP VILRNIMEN
Sbjct  110  KSIRLESMKYPKFDEGLTESQMIAHMQELASKNKIFKSFIGMGYYNTYVPTVILRNIMEN  169

Query  608  PGWYTQYTPYQAEISQGRLESLLNFQTMIT--DLTGLPMSNASLLDEGTAAAEAMAMCNN  781
            PGWYTQYTPYQAEI+QGRLESLLNFQTM+T  DLTGLPMSNASLLDEGTAAAEAMAMCNN
Sbjct  170  PGWYTQYTPYQAEIAQGRLESLLNFQTMVTHYDLTGLPMSNASLLDEGTAAAEAMAMCNN  229

Query  782  IFKGKKKTFIIASNCHPQTID  844
            I KGKKKTFIIASNCHPQTID
Sbjct  230  IQKGKKKTFIIASNCHPQTID  250



>ref|XP_001755004.1| predicted protein [Physcomitrella patens]
 gb|EDQ80458.1| predicted protein [Physcomitrella patens]
Length=946

 Score =   410 bits (1055),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 188/253 (74%), Positives = 219/253 (87%), Gaps = 0/253 (0%)
 Frame = +2

Query  371   MAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIG  550
             MA  CGF  +DA+IDATVP+SIR   +K  K+  GLTE++++ H K+LASKNKV +S+IG
Sbjct  1     MAGMCGFEDMDAMIDATVPKSIRRPDLKLSKYAEGLTESELLAHFKSLASKNKVMRSFIG  60

Query  551   MGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNAS  730
             MGY++T VP VILRNI+ENPGWYTQYTPYQAEI+QGRLESLLNFQTMITDLTG+PMSNAS
Sbjct  61    MGYHDTHVPTVILRNILENPGWYTQYTPYQAEIAQGRLESLLNFQTMITDLTGMPMSNAS  120

Query  731   LLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDID  910
             LLDEGTAAAEAM MC+NI +G+KKTF++A NCHPQTI++CKTRADG  L VV AD K  D
Sbjct  121   LLDEGTAAAEAMTMCSNIARGRKKTFLVADNCHPQTIEVCKTRADGLGLNVVVADYKKFD  180

Query  911   YKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIV  1090
             Y S DV GVLVQYP T+G V DY +F+KNAHAHGVKVVMA+DLL+LT+L PPGELGAD+V
Sbjct  181   YSSKDVSGVLVQYPATDGSVNDYSDFVKNAHAHGVKVVMATDLLSLTVLTPPGELGADMV  240

Query  1091  VGSAQRFGVPMGY  1129
             VGSAQRFGVPMGY
Sbjct  241   VGSAQRFGVPMGY  253



>ref|XP_006644607.1| PREDICTED: glycine dehydrogenase [decarboxylating] 2, mitochondrial-like 
[Oryza brachyantha]
Length=946

 Score =   408 bits (1048),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 200/254 (79%), Positives = 222/254 (87%), Gaps = 1/254 (0%)
 Frame = +2

Query  371   MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  547
             MA  CGF +LDALIDATVP +IR   M F  KFD G TE+QMI+HM+ LA+ NK +KS+I
Sbjct  1     MASECGFNTLDALIDATVPAAIRAPQMHFSGKFDAGFTESQMIDHMQRLAAMNKAYKSFI  60

Query  548   GMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNA  727
             GMGYYNT VP VILRN+MENP WYTQYTPYQAEI+QGRLESLLN+QTM+ DLTGLPMSNA
Sbjct  61    GMGYYNTHVPGVILRNLMENPAWYTQYTPYQAEIAQGRLESLLNYQTMVADLTGLPMSNA  120

Query  728   SLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDI  907
             SLLDE TAAAEAMAMCN I K KKKTF+IASNCHPQTID+C+TRA GF+L VV AD KD 
Sbjct  121   SLLDEATAAAEAMAMCNGILKSKKKTFLIASNCHPQTIDVCQTRAAGFDLNVVVADAKDF  180

Query  908   DYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADI  1087
             DY SGDVCGVL+QYPGTEGEVLDY EF+K+AHAHGVKVVMA+DLLALT L+PPGE+GADI
Sbjct  181   DYSSGDVCGVLIQYPGTEGEVLDYAEFVKDAHAHGVKVVMATDLLALTSLRPPGEIGADI  240

Query  1088  VVGSAQRFGVPMGY  1129
              VGSAQRFGVPMGY
Sbjct  241   AVGSAQRFGVPMGY  254



>gb|EAZ37623.1| hypothetical protein OsJ_21958 [Oryza sativa Japonica Group]
Length=1005

 Score =   391 bits (1004),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/283 (69%), Positives = 225/283 (80%), Gaps = 27/283 (10%)
 Frame = +2

Query  284   RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  460
             RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  56    RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  115

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
             +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPYQ
Sbjct  116   RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQ  175

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AEI+QGRLESLLN+QTM+ DLTGLPMSNASLLDE TAAAEAMAMCN I K KKKTF+IAS
Sbjct  176   AEIAQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGILKSKKKTFLIAS  235

Query  821   NCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
             NCHPQTID+C+TRA G                           PGTEGEVLDY EF+++A
Sbjct  236   NCHPQTIDVCQTRAAG--------------------------TPGTEGEVLDYAEFVRDA  269

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             HAHGVKVVMA+DLLALT L+PPGE+GADI VGSAQRFGVPMGY
Sbjct  270   HAHGVKVVMATDLLALTSLRPPGEIGADIAVGSAQRFGVPMGY  312



>ref|XP_001420206.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98499.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=976

 Score =   389 bits (999),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/282 (63%), Positives = 224/282 (79%), Gaps = 1/282 (0%)
 Frame = +2

Query  287   RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPK  463
             R++S EALKP DTF RRHNS T ++ ++M    GF  +DALIDATVP++IRL  +M   +
Sbjct  10    RAVSTEALKPLDTFERRHNSGTTQEVAEMCAVIGFKDIDALIDATVPENIRLKKTMDMGE  69

Query  464   FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQA  643
             +   LTE++ +  MKN+ASKNKVFK+YIG GY+ T VP VILRNI+ENPGWYTQYTPYQA
Sbjct  70    YTQPLTESEFLTMMKNMASKNKVFKNYIGTGYHGTHVPTVILRNILENPGWYTQYTPYQA  129

Query  644   EISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASN  823
             E SQGRLESLLNFQTMITDLTG+P+SN+SLLDEGTAAAEAM MC+ + +GKK  F +++ 
Sbjct  130   EASQGRLESLLNFQTMITDLTGMPLSNSSLLDEGTAAAEAMTMCSALNRGKKPKFYVSNK  189

Query  824   CHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAH  1003
             CHPQTI + +TRA+G  L+ V  D    DY + DVCGVLVQYP T+G ++DY   +  A 
Sbjct  190   CHPQTIAVVQTRAEGLGLEAVVGDENSFDYTAKDVCGVLVQYPATDGSIIDYKPIVSQAQ  249

Query  1004  AHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             A+G++VV A+DLL+LTML+PPGE GADIV+GS+QRFGVPMGY
Sbjct  250   ANGIRVVAAADLLSLTMLQPPGEWGADIVIGSSQRFGVPMGY  291



>ref|XP_003081763.1| GCSP_FLAAN Glycine dehydrogenase [decarboxylating], mitochondrial 
precursor (Glycine decarboxylase) (ISS), partial [Ostreococcus 
tauri]
Length=880

 Score =   384 bits (985),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 223/288 (77%), Gaps = 1/288 (0%)
 Frame = +2

Query  269   ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  448
             A+    R++S  +LKP DTF RRHNS T E+ ++M +  GF ++DALIDATVP +IRL  
Sbjct  9     ANAMSARNVSAASLKPLDTFERRHNSGTEEEVAEMCKVVGFENIDALIDATVPTNIRLPK  68

Query  449   -MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  625
              M   K+   LTE++ +  MK++A KNKV+K+YIG GY+ T VPPVILRNI+ENPGWYTQ
Sbjct  69    LMDMGKYTEPLTESEFLAKMKDIAGKNKVYKTYIGAGYHGTHVPPVILRNILENPGWYTQ  128

Query  626   YTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKT  805
             YTPYQAE SQGRLESL+NFQTMITDLTG+P+SN+SLLDEGTAAAEAM MC+ + +GKK  
Sbjct  129   YTPYQAEASQGRLESLMNFQTMITDLTGMPLSNSSLLDEGTAAAEAMTMCSALNRGKKPK  188

Query  806   FIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGE  985
             F ++  CHPQTI + KTRA+G  L+ +  D    DY + DVCGVLVQYP T G V+DY  
Sbjct  189   FYVSDKCHPQTISVVKTRAEGLGLEAIVGDENSFDYTAKDVCGVLVQYPATNGAVIDYKP  248

Query  986   FIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +  AHA G++VV A+DLL+LT+L+PPGE GADIVVGS+QRFGVPMG+
Sbjct  249   IVAKAHASGIRVVAAADLLSLTVLQPPGEWGADIVVGSSQRFGVPMGF  296



>emb|CEF99477.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
1 [Ostreococcus tauri]
Length=1019

 Score =   384 bits (987),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 223/288 (77%), Gaps = 1/288 (0%)
 Frame = +2

Query  269   ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  448
             A+    R++S  +LKP DTF RRHNS T E+ ++M +  GF ++DALIDATVP +IRL  
Sbjct  47    ANAMSARNVSAASLKPLDTFERRHNSGTEEEVAEMCKVVGFENIDALIDATVPTNIRLPK  106

Query  449   -MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  625
              M   K+   LTE++ +  MK++A KNKV+K+YIG GY+ T VPPVILRNI+ENPGWYTQ
Sbjct  107   LMDMGKYTEPLTESEFLAKMKDIAGKNKVYKTYIGAGYHGTHVPPVILRNILENPGWYTQ  166

Query  626   YTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKT  805
             YTPYQAE SQGRLESL+NFQTMITDLTG+P+SN+SLLDEGTAAAEAM MC+ + +GKK  
Sbjct  167   YTPYQAEASQGRLESLMNFQTMITDLTGMPLSNSSLLDEGTAAAEAMTMCSALNRGKKPK  226

Query  806   FIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGE  985
             F ++  CHPQTI + KTRA+G  L+ +  D    DY + DVCGVLVQYP T G V+DY  
Sbjct  227   FYVSDKCHPQTISVVKTRAEGLGLEAIVGDENSFDYTAKDVCGVLVQYPATNGAVIDYKP  286

Query  986   FIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +  AHA G++VV A+DLL+LT+L+PPGE GADIVVGS+QRFGVPMG+
Sbjct  287   IVAKAHASGIRVVAAADLLSLTVLQPPGEWGADIVVGSSQRFGVPMGF  334



>ref|XP_002979861.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
 gb|EFJ19263.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
Length=946

 Score =   380 bits (975),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 207/254 (81%), Gaps = 2/254 (1%)
 Frame = +2

Query  371   MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  547
             MAE  GF S+D L++ATVP+ I+   M  P KF  GLTE+QMI+HMK LA+KNK+ KSYI
Sbjct  1     MAEVVGFSSMDELVEATVPKPIKRGPMSLPGKFHEGLTESQMIDHMKYLAAKNKIAKSYI  60

Query  548   GMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNA  727
             GMGYYNT VPPVILRNIMENPGWYTQYTPYQAEI+QGRLESLLN+QTMI +LTGLPMSNA
Sbjct  61    GMGYYNTIVPPVILRNIMENPGWYTQYTPYQAEIAQGRLESLLNYQTMIAELTGLPMSNA  120

Query  728   SLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDI  907
             SLLDEGTAAAEAM MC NI   K+  F+IASNCHPQTID+C TRADG  +     D    
Sbjct  121   SLLDEGTAAAEAMGMCLNIGSRKRPKFLIASNCHPQTIDVCVTRADGLGMTASIVDPDKF  180

Query  908   DYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADI  1087
             ++ S DVCGVLVQYP T+G + DY   I +AHA+GVKVV+A+DLLALT LKPPGE+GAD+
Sbjct  181   EF-SKDVCGVLVQYPATDGSITDYASLISSAHANGVKVVVATDLLALTCLKPPGEIGADM  239

Query  1088  VVGSAQRFGVPMGY  1129
              VGSAQRFGVP+GY
Sbjct  240   AVGSAQRFGVPLGY  253



>ref|XP_007510359.1| glycine dehydrogenase [Bathycoccus prasinos]
 emb|CCO18704.1| glycine dehydrogenase [Bathycoccus prasinos]
Length=1040

 Score =   380 bits (977),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/284 (62%), Positives = 220/284 (77%), Gaps = 3/284 (1%)
 Frame = +2

Query  287   RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD---SMKF  457
             R ISVE+L P DTF RRHNSA+ E+  +MA F GF S+  LIDATVP +I+     ++  
Sbjct  72    RQISVESLGPLDTFERRHNSASKEEAEEMARFVGFKSVRELIDATVPDNIKAPQALNLGS  131

Query  458   PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  637
              +++ G +E + ++  K +A KNKVFK+Y+G GY+ T VP VILRNI+ENPGWYTQYTPY
Sbjct  132   EEYNRGYSETEFLDMFKKMAGKNKVFKNYLGTGYHGTHVPQVILRNILENPGWYTQYTPY  191

Query  638   QAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIA  817
             QAEISQGRLESLLNFQTMI+DLT +P+SN+SLLDEGTAAAEAM MC+ I +GKK  F ++
Sbjct  192   QAEISQGRLESLLNFQTMISDLTKMPLSNSSLLDEGTAAAEAMTMCSAIARGKKPKFYVS  251

Query  818   SNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKN  997
             + CHPQTI+IC+TRADG  L++V  D    DY    VCGV+VQYP T+G VLDY + ++ 
Sbjct  252   NKCHPQTIEICRTRADGLGLEIVVGDEATFDYNDKQVCGVMVQYPATDGSVLDYSDVVEK  311

Query  998   AHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             AH  G+KVV A D+LALT LKPPGE GAD+VVGSAQRFGVP+GY
Sbjct  312   AHKGGMKVVAACDILALTQLKPPGEWGADMVVGSAQRFGVPLGY  355



>ref|XP_002988429.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
 gb|EFJ10519.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
Length=946

 Score =   378 bits (970),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 207/254 (81%), Gaps = 2/254 (1%)
 Frame = +2

Query  371   MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  547
             MAE  GF S+D L++ATVP+ I+   M  P KF  GLTE+QMI+HMK LA+KNK+ KSYI
Sbjct  1     MAEAVGFSSMDELVEATVPKPIKRGPMSLPGKFHEGLTESQMIDHMKYLAAKNKIAKSYI  60

Query  548   GMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNA  727
             GMGYYNT VPPVILRNIMENPGWYTQYTPYQAEI+QGRLESLLN+QTM+ +LTGLPMSNA
Sbjct  61    GMGYYNTIVPPVILRNIMENPGWYTQYTPYQAEIAQGRLESLLNYQTMVAELTGLPMSNA  120

Query  728   SLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDI  907
             SLLDEGTAAAEAM MC NI   K+  F+IASNCHPQTID+C TRADG  +     D    
Sbjct  121   SLLDEGTAAAEAMGMCLNIGSRKRPKFLIASNCHPQTIDVCVTRADGLGMTASIVDPDKF  180

Query  908   DYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADI  1087
             ++ S DVCGVLVQYP T+G + DY   + +AHA+GVKVV+A+DLLALT LKPPGE+GAD+
Sbjct  181   EF-SKDVCGVLVQYPATDGSITDYASLVSSAHANGVKVVVATDLLALTCLKPPGEIGADM  239

Query  1088  VVGSAQRFGVPMGY  1129
              VGSAQRFGVP+GY
Sbjct  240   AVGSAQRFGVPLGY  253



>ref|XP_002503477.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
 gb|ACO64735.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
Length=988

 Score =   378 bits (971),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/282 (65%), Positives = 225/282 (80%), Gaps = 1/282 (0%)
 Frame = +2

Query  287   RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPK  463
             R+I+VEALKP D+F RRHNSAT +++++MA++ GF S+DAL+DATVP  IR   SM   K
Sbjct  20    RTIAVEALKPLDSFERRHNSATKKEEAEMAKYVGFDSMDALVDATVPSDIRRAGSMDMGK  79

Query  464   FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQA  643
             +   L+E++ +   K++ASKNKVFKSY G GYY T VP VILRN++ENPGWYTQYTPYQA
Sbjct  80    WTQPLSESEFLSTFKSMASKNKVFKSYQGTGYYGTHVPTVILRNVLENPGWYTQYTPYQA  139

Query  644   EISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASN  823
             EI+QGRLESLLN+QTMI+DLT LPM+NASLLDEGTAAAEAM MC+ + +GKK  F+I+  
Sbjct  140   EIAQGRLESLLNYQTMISDLTALPMANASLLDEGTAAAEAMTMCSAVNRGKKPKFLISDK  199

Query  824   CHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAH  1003
             CHPQTI++C+TRADG  L VV  D    DY   DVCGVL+QYP T+G V+DY   +K+AH
Sbjct  200   CHPQTIEVCRTRADGLGLTVVVGDENSFDYSGNDVCGVLLQYPATDGAVIDYSPVVKSAH  259

Query  1004  AHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             A G KVV A+DLLALT L PPGE GADI +GSAQRFGVPMG+
Sbjct  260   AAGAKVVAAADLLALTSLVPPGEWGADICIGSAQRFGVPMGF  301



>ref|XP_005850088.1| hypothetical protein CHLNCDRAFT_16305, partial [Chlorella variabilis]
 gb|EFN57986.1| hypothetical protein CHLNCDRAFT_16305, partial [Chlorella variabilis]
Length=324

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 222/283 (78%), Gaps = 3/283 (1%)
 Frame = +2

Query  287   RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI-RLDSMKF-P  460
             R ISV+ALKPSD F  RHNS +  ++  MA+ CGFPSLDAL++ATVP +I R D M   P
Sbjct  1     RPISVQALKPSDRFEPRHNSISEAEKQSMAQLCGFPSLDALVEATVPDAIKRTDGMPLGP  60

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
             K+  GLTE++ +   K +ASKNKVFKSYIGMGYYNT VPPVILRN++ENPGWYTQYTPYQ
Sbjct  61    KYHEGLTESEFLAMFKEMASKNKVFKSYIGMGYYNTHVPPVILRNLLENPGWYTQYTPYQ  120

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AEISQGRLESLLNFQTM++DLTG+ MSNASLLDE TAAAEAM MC+ + +GKK  F+++ 
Sbjct  121   AEISQGRLESLLNFQTMVSDLTGMAMSNASLLDEATAAAEAMTMCSAVARGKKPKFLVSD  180

Query  821   NCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
              CHPQTI +C+TRADG  LKVV  D       S DVCG+L+QYP T+G V +Y    + A
Sbjct  181   KCHPQTIAVCQTRADGLGLKVVVQDEASFSMDS-DVCGILLQYPATDGSVHNYKGIAEKA  239

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              A  VKVV+ASDLLALT L PPGE GADIV+GSAQRFGVP+GY
Sbjct  240   AAAKVKVVVASDLLALTKLTPPGEWGADIVIGSAQRFGVPLGY  282



>ref|XP_003055654.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
 gb|EEH60906.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
Length=1045

 Score =   375 bits (962),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/282 (65%), Positives = 224/282 (79%), Gaps = 1/282 (0%)
 Frame = +2

Query  287   RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPK  463
             RSI+ E L+P D+F RRHNSAT E++ +MA++ GF S+DAL+DATVP  IR    M   +
Sbjct  73    RSIATETLRPLDSFERRHNSATKEEEIEMAKYVGFDSMDALVDATVPTDIRRAGEMDMGE  132

Query  464   FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQA  643
             +   L+E++ +   K +ASKNKVFKSY G GYY T VPPVILRN++ENPGWYTQYTPYQA
Sbjct  133   WTSPLSESEYLARFKAMASKNKVFKSYQGTGYYGTHVPPVILRNVLENPGWYTQYTPYQA  192

Query  644   EISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASN  823
             EISQGRLESLLN+QTMI+DLTGLPM+NASLLDEGTAAAEAM MC+ + +GKK  F+I+  
Sbjct  193   EISQGRLESLLNYQTMISDLTGLPMANASLLDEGTAAAEAMTMCSAMNRGKKPKFLISDK  252

Query  824   CHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAH  1003
             CHPQTI +C+TRADG  L+VV A   D DY S DVCG+L+QYP T+G V+DY   ++ AH
Sbjct  253   CHPQTIAVCETRADGLGLEVVVAAESDFDYASNDVCGILLQYPATDGAVIDYSPVVEKAH  312

Query  1004  AHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             A G KVV A+DLLALT+L+PPGE  ADI +GSAQRFGVPMG+
Sbjct  313   AAGAKVVAAADLLALTVLRPPGEWKADICIGSAQRFGVPMGF  354



>ref|XP_001692993.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
 gb|EDP03562.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
Length=1039

 Score =   371 bits (953),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 226/292 (77%), Gaps = 4/292 (1%)
 Frame = +2

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             +GF AS    RSISV AL+PSD F  RHNS TP +   M +  GF SLDALIDATVP++I
Sbjct  59    SGFAAS--GIRSISVAALQPSDDFKPRHNSGTPAEIDSMVKATGFGSLDALIDATVPKAI  116

Query  437   -RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
              R D M   K+  G+TE+Q +E+ K +ASKNKV+KSYIGMGYY T VP VILRN++ENPG
Sbjct  117   VRKDGMNLGKYHEGMTESQFLEYFKAMASKNKVYKSYIGMGYYGTHVPNVILRNVLENPG  176

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYTQYTPYQAEI+QGRLESLLNFQTMI DLTG+ +SNASLLDE TAAAEAM MC+ I +G
Sbjct  177   WYTQYTPYQAEIAQGRLESLLNFQTMICDLTGMAISNASLLDEATAAAEAMTMCSAIARG  236

Query  794   KKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVL  973
             KK  F+++S CHPQTI +C+TRA+G  L+ V  D   + Y + DVCGVL+QYP T+G + 
Sbjct  237   KKPKFLVSSKCHPQTIAVCQTRAEGLGLEAVVVDEDKMAY-AKDVCGVLLQYPATDGSIS  295

Query  974   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DY   +  AHA  VKV +A+DLLALTML PPGE GADIV+GSAQRFGVPMGY
Sbjct  296   DYKALVAKAHAANVKVCVATDLLALTMLAPPGEWGADIVIGSAQRFGVPMGY  347



>ref|XP_002956892.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
 gb|EFJ42017.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
Length=978

 Score =   352 bits (903),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 230/320 (72%), Gaps = 16/320 (5%)
 Frame = +2

Query  173   LHRPARYVSSLAPCAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSAT  352
             + R AR +  +   A     Q R++ +G  F         I+V+AL PSD F  RHNS +
Sbjct  1     MRRAARLLRGVGQAA-----QSRFAASGVRF---------IAVDALLPSDDFKPRHNSGS  46

Query  353   PEDQSKMAEFCGFPSLDALIDATVPQSI-RLDSMKFPKFDHGLTEAQMIEHMKNLASKNK  529
             P +   M    GF SLDALIDATVP++I R D M   K+  G+TE+Q + + K++A KNK
Sbjct  47    PAEIDAMVNMTGFSSLDALIDATVPKAIVRKDGMDLGKYHEGMTESQFLSYFKSMAGKNK  106

Query  530   VFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTG  709
             V KS++GMGYY+  VPPVILRN++ENPGWYTQYTPYQAEI+QGRLESLLNFQTM+ DLTG
Sbjct  107   VLKSFLGMGYYDVHVPPVILRNVLENPGWYTQYTPYQAEIAQGRLESLLNFQTMVCDLTG  166

Query  710   LPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVT  889
             + +SNASLLDE TAAAEAM MC+ + +GKK  F+++S CHPQTI +C+TRA+G  L+ V 
Sbjct  167   MSISNASLLDEATAAAEAMTMCSAVARGKKPKFLVSSKCHPQTIAVCQTRAEGLGLEAVV  226

Query  890   ADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPG  1069
             AD     Y   DVCGVLVQYP T+G V DY   +  AHA  VKV +++DLLALTML PPG
Sbjct  227   ADEDKFVYGK-DVCGVLVQYPATDGTVSDYKALVAAAHAANVKVCVSTDLLALTMLTPPG  285

Query  1070  ELGADIVVGSAQRFGVPMGY  1129
             E GADIVVGSAQRFGVPMGY
Sbjct  286   EWGADIVVGSAQRFGVPMGY  305



>ref|XP_005649750.1| glycine dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE25206.1| glycine dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=1041

 Score =   345 bits (885),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/281 (60%), Positives = 211/281 (75%), Gaps = 1/281 (0%)
 Frame = +2

Query  287   RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKF  466
             R ISV+ L+P+D F  RHNS T ++  +M    GF S+  LIDATVP++IR   M   ++
Sbjct  64    RQISVQTLQPTDVFAPRHNSGTEQEVQEMVNLTGFGSMAELIDATVPKAIRRGQMDLGEY  123

Query  467   DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAE  646
               G TE++ I   K +A KNK+FKSY+GMGYYNT +PPVI RN++ENPGWYTQYTPYQAE
Sbjct  124   TKGYTESEFIAKFKKMAEKNKMFKSYLGMGYYNTHLPPVIQRNLLENPGWYTQYTPYQAE  183

Query  647   ISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNC  826
             I+QGRLESLLNFQT++TDLTG+ +SNASLLDE TAAAEAM MC+ + +GKK TF+++  C
Sbjct  184   IAQGRLESLLNFQTVVTDLTGMQISNASLLDEATAAAEAMTMCSALARGKKLTFLVSDKC  243

Query  827   HPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHA  1006
             HPQTI +C++RADG  LKVV  D    +    DV GVL+QYP T+G + DY   ++ AH 
Sbjct  244   HPQTIAVCQSRADGLGLKVVVGDEASFNIDK-DVSGVLLQYPATDGSIHDYKALVEKAHQ  302

Query  1007  HGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
                KV +A+DLLALT L PPGE GADIV+GSAQRFGVPMGY
Sbjct  303   AKAKVCVATDLLALTQLTPPGEWGADIVIGSAQRFGVPMGY  343



>ref|XP_005538536.1| glycine dehydrogenase, mitochondrial precursor [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82500.1| glycine dehydrogenase, mitochondrial precursor [Cyanidioschyzon 
merolae strain 10D]
Length=1068

 Score =   333 bits (853),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 205/283 (72%), Gaps = 3/283 (1%)
 Frame = +2

Query  284   RRSISVEALKPSDTFPRRHN-SATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP  460
             RR  S  A  P D F +RH  S  PE   KM +  G  S++ L+D T+P+SIR  + +  
Sbjct  70    RRGASSSAFAPLDLFYKRHTGSGNPEANEKMLQVLGVKSIEELMDQTIPKSIR--TTRKL  127

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
                    E++++  ++ +A +N++ +++IG GYY T +PPVI RNI+ENP WYTQYTPYQ
Sbjct  128   SVGPKRAESEVLAELRQIAKQNELRRNFIGCGYYGTIMPPVIQRNILENPAWYTQYTPYQ  187

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AE++QGRLESLLNFQTM+ DLTGLP++NASLLDEGTAAAEAM+MC  + K KK  F +  
Sbjct  188   AEVAQGRLESLLNFQTMVGDLTGLPIANASLLDEGTAAAEAMSMCAAVSKRKKLRFFVDK  247

Query  821   NCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
             + HPQTI + K RA+  ++++V  + + + +   D+CG LVQYP T+G + DY  F++NA
Sbjct  248   DVHPQTIAVMKVRAEPMDIELVVDNWQQVQWDGADLCGALVQYPATDGTIHDYTSFVENA  307

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             HAHG +VV+ASDLLALTML+PPGE GADI VGSAQRFGVPMGY
Sbjct  308   HAHGTRVVVASDLLALTMLRPPGEWGADIAVGSAQRFGVPMGY  350



>ref|XP_011398598.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25702.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
Length=1211

 Score =   334 bits (856),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/283 (60%), Positives = 208/283 (73%), Gaps = 3/283 (1%)
 Frame = +2

Query  287   RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKF  466
             R+IS+E+L+PSDTF  RHNS TP +  +M    GF SLDALIDATVP SIR + +     
Sbjct  235   RAISIESLQPSDTFEPRHNSITPNEVKEMVGLLGFDSLDALIDATVPASIRREGVMELAN  294

Query  467   DH--GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
              H  G+TE+  I+  + LA +NKV  S+IGMGYY T  PPVILRNI+ENPGWYTQYTPYQ
Sbjct  295   SHPDGITESAFIKEFRALAEQNKVASSHIGMGYYGTITPPVILRNILENPGWYTQYTPYQ  354

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AEI+QGRLE+LL FQTM++DLT LP++NASLLDEGTAAAEAMAMC+ + +GKK  F+++ 
Sbjct  355   AEIAQGRLEALLVFQTMVSDLTALPLANASLLDEGTAAAEAMAMCSALARGKKPRFLVSE  414

Query  821   NCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
              CHPQTI + +TRA G  L+V   D     +     CGVL+QYP T+G V DY E    A
Sbjct  415   RCHPQTIAVVQTRAKGLGLEVEVGDETGFAFDD-TTCGVLLQYPATDGSVRDYAELAAAA  473

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              A G KVV+A+DLLAL  L PPGE GAD+ +GSAQRFGVPMG+
Sbjct  474   KAAGTKVVVATDLLALAALAPPGEWGADVALGSAQRFGVPMGF  516



>gb|KFH65627.1| glycine dehydrogenase [Mortierella verticillata NRRL 6337]
Length=1018

 Score =   330 bits (846),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 160/289 (55%), Positives = 200/289 (69%), Gaps = 10/289 (3%)
 Frame = +2

Query  287   RSISVE------ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  448
             RSI  E         P DTF RRHN  +  +  +M    G   +D L   T+P  IR  S
Sbjct  45    RSIHTEKPPARTVFSPLDTFVRRHNGPSQGEIKEMLSAIGLKDMDGLTGKTIPDRIR--S  102

Query  449   MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQY  628
              +    DHG TE +++E +K +ASKNK+FK+YIGMGY +  VP VILRN+MENPGWYTQY
Sbjct  103   TRALALDHGFTEKEVLERLKYIASKNKLFKNYIGMGYTDVVVPNVILRNVMENPGWYTQY  162

Query  629   TPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTF  808
             TPYQ EI+QGRLESLLN+QTM+TDLTG+ ++NASLLDEGTAAAEAM MC +    KK TF
Sbjct  163   TPYQPEIAQGRLESLLNYQTMVTDLTGMSIANASLLDEGTAAAEAMLMCWSATNRKKSTF  222

Query  809   IIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS--GDVCGVLVQYPGTEGEVLDYG  982
              +  NCHPQTI   +TRA+ F +KVV  D +  D++S  G++ GVL+QYP T G V DY 
Sbjct  223   FVDENCHPQTIACVQTRAEAFNIKVVVGDHRSFDFESIKGEMAGVLIQYPDTRGNVSDYK  282

Query  983   EFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
                   H +G +VV A+DL+ALTML PPGE GADI +G++QRFGVP+GY
Sbjct  283   GLADKIHGYGAQVVAATDLMALTMLTPPGEWGADIALGNSQRFGVPLGY  331



>ref|XP_005716298.1| glycine dehydrogenase (decarboxylating), mitochondrial precursor 
[Chondrus crispus]
 emb|CDF36479.1| glycine dehydrogenase (decarboxylating), mitochondrial precursor 
[Chondrus crispus]
Length=1042

 Score =   327 bits (838),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/294 (55%), Positives = 211/294 (72%), Gaps = 6/294 (2%)
 Frame = +2

Query  257   AGFPASHQQRRSISV--EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  430
             + F    Q  R+ S   E    +D+F  RHN+ T  D S+M  F G   ++ LID TVP 
Sbjct  48    SSFSNLSQYARTFSAVPELFSATDSFANRHNN-TSRDVSEMLAFLGLQDINQLIDQTVPS  106

Query  431   SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             SIR  + +  +    L+E + +  +K +ASKNK+++++IGMGY+ T  P VILRNI+ENP
Sbjct  107   SIR--NNRDLEVGPALSETEALAKLKAMASKNKLYQNHIGMGYHGTLTPHVILRNILENP  164

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
             GWYTQYTPYQAEI+QGRLESLLN+QTM+ D+TGLP++NASLLDE TAAAEAM+MC NI +
Sbjct  165   GWYTQYTPYQAEIAQGRLESLLNYQTMVADITGLPVANASLLDEATAAAEAMSMCFNIAR  224

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSG-DVCGVLVQYPGTEGE  967
              KKK+F ++   HPQTID+ KTRA+GF ++V+  D K  D  +  D+CG L+QYP T+G 
Sbjct  225   RKKKSFFVSELVHPQTIDLVKTRAEGFGVQVIVGDHKTYDVAANKDLCGTLIQYPATDGS  284

Query  968   VLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             + DY  FI  + + G KVVMA+DLLALT LK PGE+GAD  VG++QRFGVPMGY
Sbjct  285   IDDYEPFIAASKSAGAKVVMATDLLALTTLKSPGEMGADFAVGNSQRFGVPMGY  338



>ref|XP_005711074.1| unnamed protein product [Chondrus crispus]
 emb|CDF40780.1| unnamed protein product [Chondrus crispus]
Length=262

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 189/253 (75%), Gaps = 2/253 (1%)
 Frame = +2

Query  371   MAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIG  550
             M  F G   ++ LID TVP SIR  + +  +    L+E + +  +K +ASKNK+++++IG
Sbjct  1     MFAFLGLQDINQLIDQTVPSSIR--NNRDLEVGSSLSETEALAKLKAMASKNKLYQNHIG  58

Query  551   MGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNAS  730
             MGY+ T  P VILRNI+ENPG YTQYTPYQAEI+QGRLESLLN+QTM+ D+TGLP++NAS
Sbjct  59    MGYHGTLTPHVILRNILENPGCYTQYTPYQAEIAQGRLESLLNYQTMVADITGLPVANAS  118

Query  731   LLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDID  910
             LLDE TAAAEAM+MC NI + KKK+F ++   HPQTID+ KTRA+ F ++V+  D K  D
Sbjct  119   LLDEATAAAEAMSMCFNIARRKKKSFFVSELVHPQTIDLVKTRAERFGVEVIVGDHKTYD  178

Query  911   YKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIV  1090
               + D+CG L+QYP T+G + DY  FI  + + G KVVMA+DLLALT LK PGE+GAD  
Sbjct  179   AANKDLCGTLIQYPATDGSIDDYEPFIAASKSVGAKVVMATDLLALTTLKSPGEMGADFA  238

Query  1091  VGSAQRFGVPMGY  1129
             V ++QRFGVPMGY
Sbjct  239   VRNSQRFGVPMGY  251



>emb|CBJ30901.1| Glycine dehydrogenase (decarboxylating) [Ectocarpus siliculosus]
Length=1000

 Score =   324 bits (830),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/270 (57%), Positives = 192/270 (71%), Gaps = 2/270 (1%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIE  499
             DTF RRH   +  D   M +  G  SLD L+D TVP SIRLD       +  L+E++ + 
Sbjct  43    DTFARRHIGPSDADVEVMMKTVGVKSLDDLVDRTVPHSIRLDEPL--DLEDALSESEALT  100

Query  500   HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLN  679
              ++ +A KN+V K++IGMGY  T VPPVILRN++ENPGWYT YTPYQAEISQGRL+SLLN
Sbjct  101   AIRKIADKNQVMKNFIGMGYSETTVPPVILRNMLENPGWYTAYTPYQAEISQGRLQSLLN  160

Query  680   FQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTR  859
             FQTM+ DLTG+ MSNASLLDE TAAAEAM MCN +  GK+K F +A +CHPQ I + +TR
Sbjct  161   FQTMVADLTGMDMSNASLLDEATAAAEAMFMCNGLKNGKRKKFFVAEDCHPQNITLVETR  220

Query  860   ADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDL  1039
                  L +V  D K +D+   D  G L+QYP T G+V++  EF+K AH  G  VV A+DL
Sbjct  221   GGALNLDIVVGDPKTVDFSGEDYSGALIQYPNTYGDVINPEEFVKKAHDAGTLVVAATDL  280

Query  1040  LALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             ++L+MLKPPG+ G DI VGSAQRFGVP+GY
Sbjct  281   MSLSMLKPPGDFGVDIAVGSAQRFGVPLGY  310



>ref|XP_009056743.1| hypothetical protein LOTGIDRAFT_216694 [Lottia gigantea]
 gb|ESO92602.1| hypothetical protein LOTGIDRAFT_216694 [Lottia gigantea]
Length=1025

 Score =   323 bits (827),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 201/281 (72%), Gaps = 5/281 (2%)
 Frame = +2

Query  290   SISVEALKPS-DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKF  466
             S ++E + PS D FP RH      ++  M +F G  S+D L+  TVPQ I L+  +    
Sbjct  39    STALEKILPSQDVFPERHIGPNEREKRDMLKFMGLQSIDELVTKTVPQDILLN--RKLDI  96

Query  467   DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAE  646
             D  L E Q+IEH++ +ASKN++++SYIG+GYYNT+VP  I+RNI ENPGW TQYTPYQAE
Sbjct  97    DQPLGEHQLIEHLRGIASKNEIWRSYIGIGYYNTYVPHTIMRNIFENPGWTTQYTPYQAE  156

Query  647   ISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNC  826
             ++QGRLESLLNFQTMI DLT L +SNASLLDE TAAAEAM +C      K++ F +  NC
Sbjct  157   LAQGRLESLLNFQTMICDLTALAISNASLLDEATAAAEAMGLCYK--ANKRRRFYVDVNC  214

Query  827   HPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHA  1006
             HPQ I + KTR D   ++V+T + +++D+ + DVCGVLVQYP TEG + +Y   I++A A
Sbjct  215   HPQNIAVVKTRGDALGIEVITGNWREMDFSTHDVCGVLVQYPNTEGSIENYSGLIEDAQA  274

Query  1007  HGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              G  V+ A+D LAL +LKPPGELG DI +G+ QRFG+P+GY
Sbjct  275   CGTLVIAATDPLALAILKPPGELGFDIALGTTQRFGIPLGY  315



>ref|WP_009768707.1| glycine dehydrogenase, decarboxylating [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ67914.1| glycine dehydrogenase, decarboxylating [Oscillatoriales cyanobacterium 
JSC-12]
Length=995

 Score =   322 bits (824),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/274 (57%), Positives = 197/274 (72%), Gaps = 3/274 (1%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  487
             L  +D+F  RH     ED ++M    G+ +LD LIDATVPQSIRL S    K + G  E 
Sbjct  45    LDYTDSFADRHIGPNQEDIAQMLNVLGYSNLDTLIDATVPQSIRLKSPL--KLEAGKAEY  102

Query  488   QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLE  667
             Q+++ +K +A +N+VF+SYIGMGY N   PPVI RNI+ENPGWYTQYTPYQ EISQGRLE
Sbjct  103   QLLQELKEIAQENQVFRSYIGMGYSNCITPPVIQRNILENPGWYTQYTPYQPEISQGRLE  162

Query  668   SLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDI  847
             +LLNFQT++TDLTGL ++NASLLDEGTAAAEAM+M   + K + KTF I+  CHPQTI +
Sbjct  163   ALLNFQTVVTDLTGLEIANASLLDEGTAAAEAMSMSYGLCKTEAKTFWISEVCHPQTIAV  222

Query  848   CKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVM  1027
              KTRA    ++V+  +    ++    V GVL+QYP T+G + DY  F   AHA G  V +
Sbjct  223   VKTRATALGIEVIVGNHHSFEFDQ-PVFGVLLQYPATDGAIYDYHAFCDRAHAAGALVTV  281

Query  1028  ASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             A+DLL+LT+LKPPGE GADI VG+ QRFGVP+GY
Sbjct  282   AADLLSLTLLKPPGEFGADIAVGNTQRFGVPLGY  315



>ref|WP_040728598.1| glycine dehydrogenase [Thiomicrospira sp. Kp2]
Length=972

 Score =   319 bits (817),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/278 (53%), Positives = 204/278 (73%), Gaps = 3/278 (1%)
 Frame = +2

Query  296   SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  475
             ++E L+ S++F +RH      +Q  M +  G  S+D L++  +PQSIR  ++   + ++G
Sbjct  5     TLEELQQSESFVKRHLGPDATEQQAMLDLLGMASIDELLEKVIPQSIRRRALM--ELENG  62

Query  476   LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQ  655
             LTE Q +  +K +AS+N+V KSYIGMGYYNT  PP I RNI+ENP WYT YTPYQAEISQ
Sbjct  63    LTEHQSLAKLKAIASQNRVLKSYIGMGYYNTHTPPTIQRNILENPAWYTAYTPYQAEISQ  122

Query  656   GRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQ  835
             GRLE++LNFQTM++DLTGL ++NAS+LDE TA AEAM +C  + K K K F +A +CHPQ
Sbjct  123   GRLEAMLNFQTMVSDLTGLELANASMLDEATACAEAMTLCQRMSKSKGKVFFVAEDCHPQ  182

Query  836   TIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGV  1015
              I++ +TRA+   ++VV  +  ++ ++  D+ GVL+QYPGT G+V D  E I+ AHA   
Sbjct  183   NIEVVQTRAEPLGIEVVIGN-PELGFEEYDLFGVLLQYPGTYGDVTDLTEVIEQAHAKKA  241

Query  1016  KVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              V +++DLLALT+LKPPGE+GAD+V+G+ QRFGVP+GY
Sbjct  242   LVAVSADLLALTLLKPPGEMGADVVIGNTQRFGVPLGY  279



>emb|CDS12383.1| hypothetical protein LRAMOSA04578 [Absidia idahoensis var. thermophila]
Length=1015

 Score =   317 bits (813),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/278 (55%), Positives = 198/278 (71%), Gaps = 4/278 (1%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  481
             +  KP DTFPRRH      D++ M +  G   +D L+  T+P +IR  S K      G+ 
Sbjct  62    QVFKPLDTFPRRHIGPDDADKAAMLKSIGLKDIDELLSKTIPPAIR--SPKTLALSEGVP  119

Query  482   EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGR  661
             E ++++ +K++ASKNKV++SYIGMGY +T VP VILRN++ENP WYTQYTPYQ EISQGR
Sbjct  120   ERELLKRLKSIASKNKVYRSYIGMGYTDTVVPNVILRNVLENPAWYTQYTPYQPEISQGR  179

Query  662   LESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTI  841
             LESLLNFQTM++D+TGLP++NASLLDEGTAAAEAM MC    +  K TFI+  NCHPQTI
Sbjct  180   LESLLNFQTMVSDMTGLPIANASLLDEGTAAAEAMLMCWQSGRRAKNTFIVDENCHPQTI  239

Query  842   DICKTRADGFELKVVTADLKDIDYKS--GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGV  1015
                KTRA+ F + VV A++ +  ++    D+ GVL+QYP T G V DY       HA G 
Sbjct  240   ACLKTRAESFNINVVVANVFNFKFEEHKKDLAGVLLQYPNTRGTVHDYEALTATVHAAGG  299

Query  1016  KVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             KV +A+DL+AL +LK PGE GADI +G++QRFGVP+G+
Sbjct  300   KVAVATDLMALAVLKAPGEFGADIALGNSQRFGVPLGF  337



>emb|CDH56548.1| glycine dehydrogenase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1016

 Score =   317 bits (813),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/278 (55%), Positives = 198/278 (71%), Gaps = 4/278 (1%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  481
             +  KP DTFPRRH      D++ M +  G   +D L+  T+P +IR  S K      G+ 
Sbjct  63    QVFKPLDTFPRRHIGPDDADKAAMLKSIGLKDIDELLSKTIPPAIR--SPKALALSEGVP  120

Query  482   EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGR  661
             E ++++ +K++ASKNKV++SYIGMGY +T VP VILRN++ENP WYTQYTPYQ EISQGR
Sbjct  121   ERELLKRLKSIASKNKVYRSYIGMGYTDTVVPNVILRNVLENPAWYTQYTPYQPEISQGR  180

Query  662   LESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTI  841
             LESLLNFQTM++D+TGLP++NASLLDEGTAAAEAM MC    +  K TFI+  NCHPQTI
Sbjct  181   LESLLNFQTMVSDMTGLPIANASLLDEGTAAAEAMLMCWQSGRRAKNTFIVDENCHPQTI  240

Query  842   DICKTRADGFELKVVTADLKDIDYKS--GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGV  1015
                KTRA+ F + VV A++ +  ++    D+ GVL+QYP T G V DY       HA G 
Sbjct  241   ACLKTRAESFNINVVVANVFNFKFEEHKKDLAGVLLQYPNTRGTVHDYEALTATVHAAGG  300

Query  1016  KVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             KV +A+DL+AL +LK PGE GADI +G++QRFGVP+G+
Sbjct  301   KVAVATDLMALAVLKAPGEFGADIALGNSQRFGVPLGF  338



>ref|XP_011435045.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
isoform X2 [Crassostrea gigas]
Length=1020

 Score =   317 bits (813),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 205/297 (69%), Gaps = 7/297 (2%)
 Frame = +2

Query  242   YSGAGAGFPASHQQRRSISVEALKP-SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  418
             ++  GA F     +R + S++ L P  D F  RH      ++  M +F G  ++D LI  
Sbjct  24    HASTGAQFAVV--KRWTSSLDKLYPRHDNFIERHIGPNEVEKKAMLDFIGMKTIDELIVK  81

Query  419   TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  598
              VP +I +D  +    D  L E ++IE ++ +A+KN+V++SYIG+GYYNT+ P  ILRNI
Sbjct  82    AVPANILMD--RELDLDEPLGELELIEKLEMMANKNEVWRSYIGIGYYNTYTPHTILRNI  139

Query  599   MENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCN  778
              ENPGW TQYTPYQAE++QGRLESLLN+QTM+ D+TGLP++NASLLDE TAAAEAM +C 
Sbjct  140   FENPGWTTQYTPYQAELAQGRLESLLNYQTMVVDMTGLPIANASLLDEATAAAEAMGLCY  199

Query  779   NIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGT  958
                  K++ F I  +CHPQTI + +TRA    + V+  D KD+D+ + D+ G L+QYP T
Sbjct  200   R--HNKRRKFYIDKHCHPQTIGVVETRASALGIDVIRLDWKDMDFSNRDISGTLIQYPDT  257

Query  959   EGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +G V DY E + NAHA+G  V  A+DLLALTML+PPGE G DI VGS+QRFG+PMGY
Sbjct  258   DGNVHDYMELVDNAHANGTLVTCATDLLALTMLRPPGEFGVDIAVGSSQRFGIPMGY  314



>ref|XP_011435044.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
isoform X1 [Crassostrea gigas]
Length=1020

 Score =   317 bits (813),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 205/297 (69%), Gaps = 7/297 (2%)
 Frame = +2

Query  242   YSGAGAGFPASHQQRRSISVEALKP-SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  418
             ++  GA F     +R + S++ L P  D F  RH      ++  M +F G  ++D LI  
Sbjct  24    HASTGAQFAVV--KRWTSSLDKLYPRHDNFIERHIGPNEVEKKAMLDFIGMKTIDELIVK  81

Query  419   TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  598
              VP +I +D  +    D  L E ++IE ++ +A+KN+V++SYIG+GYYNT+ P  ILRNI
Sbjct  82    AVPANILMD--RELDLDEPLGELELIEKLEMMANKNEVWRSYIGIGYYNTYTPHTILRNI  139

Query  599   MENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCN  778
              ENPGW TQYTPYQAE++QGRLESLLN+QTM+ D+TGLP++NASLLDE TAAAEAM +C 
Sbjct  140   FENPGWTTQYTPYQAELAQGRLESLLNYQTMVVDMTGLPIANASLLDEATAAAEAMGLCY  199

Query  779   NIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGT  958
                  K++ F I  +CHPQTI + +TRA    + V+  D KD+D+ + D+ G L+QYP T
Sbjct  200   R--HNKRRKFYIDKHCHPQTIGVVETRASALGIDVIRLDWKDMDFSNRDISGTLIQYPDT  257

Query  959   EGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +G V DY E + NAHA+G  V  A+DLLALTML+PPGE G DI VGS+QRFG+PMGY
Sbjct  258   DGNVHDYMELVDNAHANGTLVTCATDLLALTMLRPPGEFGVDIAVGSSQRFGIPMGY  314



>emb|CEI88334.1| Putative Glycine dehydrogenase [Rhizopus microsporus]
Length=518

 Score =   305 bits (782),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 194/276 (70%), Gaps = 4/276 (1%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  487
             L P DTFPRRH  +  ++  +M    G   +D L+  T+P +IR  S K      GL E 
Sbjct  52    LAPLDTFPRRHIGSEGKEVQEMLHQLGIKDIDELLGKTIPSAIR--SPKPLAIGQGLPER  109

Query  488   QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLE  667
             Q+++ +K++ASKN + +SYIG GY +T VP VILRNI+ENP WYTQYTPYQ EI+QGRLE
Sbjct  110   QLLKRLKDIASKNVINRSYIGQGYTDTVVPNVILRNILENPAWYTQYTPYQPEIAQGRLE  169

Query  668   SLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDI  847
             SLLN+QTM++DLTGLP++NASLLDEGTAAAEAM M     + KKK +++  NCHPQTI  
Sbjct  170   SLLNYQTMVSDLTGLPIANASLLDEGTAAAEAMLMSWQSARSKKKVYVVDENCHPQTIAC  229

Query  848   CKTRADGFELKVVTADLKDIDYKSG--DVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
              K RA+ F +++V A++    ++    ++CGVL+QYP T G V DY       H+ G  V
Sbjct  230   LKLRAEAFNIEIVVANVLQYHFEENKKNLCGVLLQYPNTRGSVHDYEALTAQIHSAGGLV  289

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+DL+ALT+LK PGE GADI +G++QRFGVP+G+
Sbjct  290   AVATDLMALTLLKAPGEFGADIALGNSQRFGVPLGF  325



>ref|WP_044171749.1| glycine dehydrogenase [Oscillatoria sp. PCC 10802]
Length=977

 Score =   315 bits (807),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/281 (54%), Positives = 200/281 (71%), Gaps = 5/281 (2%)
 Frame = +2

Query  290   SISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKF  466
             S+  + L P+D+F RRH    P++  +M E  G PSLDALI+ TVP +IRL   ++ P  
Sbjct  17    SLPGQRLAPADSFVRRHIGPRPDEIRQMLEVLGVPSLDALIEKTVPAAIRLKQPLQLPAA  76

Query  467   DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAE  646
                 +E   +  +K +ASKN++F+S+ G GY++   PPVILRNI+ENPGWYT YTPYQAE
Sbjct  77    G---SEYAALAQLKEIASKNEIFRSFTGTGYHDCITPPVILRNILENPGWYTAYTPYQAE  133

Query  647   ISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNC  826
             I+QGRLE+LLNFQTMI DLTG+ ++NASLLDEGTAAAE MA+   + K K K F IA +C
Sbjct  134   IAQGRLEALLNFQTMIIDLTGMEIANASLLDEGTAAAEGMAVSLGLCKTKAKAFFIAQDC  193

Query  827   HPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHA  1006
             HPQTI++ +TRA+   ++V+  D +   +    + G L+QYP T+G V DY  FI+ AHA
Sbjct  194   HPQTIEVVRTRANPLGIEVIVGDWQTFTFDR-PIFGALLQYPTTDGTVCDYRHFIEQAHA  252

Query  1007  HGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              G  V +A+D+L+L +LKPPGE GADI VGS QRFGVP+GY
Sbjct  253   AGALVTVAADILSLCLLKPPGEFGADIAVGSTQRFGVPLGY  293



>gb|EKC42749.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Crassostrea 
gigas]
Length=1243

 Score =   317 bits (811),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 205/297 (69%), Gaps = 7/297 (2%)
 Frame = +2

Query  242   YSGAGAGFPASHQQRRSISVEALKP-SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  418
             ++  GA F     +R + S++ L P  D F  RH      ++  M +F G  ++D LI  
Sbjct  52    HASTGAQFAVV--KRWTSSLDKLYPRHDNFIERHIGPNEVEKKAMLDFIGMKTIDELIVK  109

Query  419   TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  598
              VP +I +D  +    D  L E ++IE ++ +A+KN+V++SYIG+GYYNT+ P  ILRNI
Sbjct  110   AVPANILMD--RELDLDEPLGELELIEKLEMMANKNEVWRSYIGIGYYNTYTPHTILRNI  167

Query  599   MENPGWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCN  778
              ENPGW TQYTPYQAE++QGRLESLLN+QTM+ D+TGLP++NASLLDE TAAAEAM +C 
Sbjct  168   FENPGWTTQYTPYQAELAQGRLESLLNYQTMVVDMTGLPIANASLLDEATAAAEAMGLCY  227

Query  779   NIFKGKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGT  958
                  K++ F I  +CHPQTI + +TRA    + V+  D KD+D+ + D+ G L+QYP T
Sbjct  228   R--HNKRRKFYIDKHCHPQTIGVVETRASALGIDVIRLDWKDMDFSNRDISGTLIQYPDT  285

Query  959   EGEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +G V DY E + NAHA+G  V  A+DLLALTML+PPGE G DI VGS+QRFG+PMGY
Sbjct  286   DGNVHDYMELVDNAHANGTLVTCATDLLALTMLRPPGEFGVDIAVGSSQRFGIPMGY  342



>ref|XP_006681352.1| hypothetical protein BATDEDRAFT_20549 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77981.1| hypothetical protein BATDEDRAFT_20549 [Batrachochytrium dendrobatidis 
JAM81]
Length=1019

 Score =   314 bits (804),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/293 (53%), Positives = 200/293 (68%), Gaps = 5/293 (2%)
 Frame = +2

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             AGF  S   R + S    +P DTF RRH   +  D  KM +  G  SL+AL+  TVP++I
Sbjct  50    AGFSTSIIARSTPS-SIFEPLDTFARRHIGPSSADVQKMCKVVGVDSLEALVAKTVPENI  108

Query  437   RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  616
              + ++   +   GLTE++ +  +K +ASKNKV +SYIGMGY  T  PPVILRNIMENPGW
Sbjct  109   SIQNLT--RLGPGLTESEALAEIKRIASKNKVMRSYIGMGYNGTITPPVILRNIMENPGW  166

Query  617   YTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGK  796
             YTQYTPYQ EISQGRLESL+N+QTM+ +LTG+ ++NASLLDEGTAAAEAM +C      K
Sbjct  167   YTQYTPYQPEISQGRLESLINYQTMVQELTGMDIANASLLDEGTAAAEAMLICFTAANRK  226

Query  797   KKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS--GDVCGVLVQYPGTEGEV  970
             K  F +   C PQTI   +TRA GF ++V+  D +  D+ +    VCG L+QYP   G V
Sbjct  227   KNIFFVDQACFPQTIACVQTRAAGFGIEVIVGDYESFDFSANKNKVCGTLIQYPNQFGRV  286

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +Y  F+K AH +G  V  A+DLLAL +LKPPGE+G D+ +G++QRFGVP+GY
Sbjct  287   NNYEAFVKKAHDNGALVACATDLLALCLLKPPGEMGVDMALGNSQRFGVPLGY  339



>ref|WP_035493337.1| glycine dehydrogenase, partial [Geitlerinema sp. PCC 7105]
Length=983

 Score =   313 bits (802),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 199/276 (72%), Gaps = 5/276 (2%)
 Frame = +2

Query  305   ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLT  481
             A  P+  F +RHN +TP+D  +M E  G+ S+D+LIDA VP  IRL   +  P+    L+
Sbjct  28    ATPPNLAFVQRHNGSTPQDIDRMLEILGYDSIDSLIDAIVPAQIRLKQPLNLPQ---PLS  84

Query  482   EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGR  661
             EAQ ++ ++ +A KN++F+S+IG GY+++  PPVI RNI+ENPGWYT YTPYQAEI+QGR
Sbjct  85    EAQALQQLRAIAQKNQIFRSFIGTGYHDSITPPVIQRNILENPGWYTAYTPYQAEIAQGR  144

Query  662   LESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTI  841
             LE+LLNFQTM+ DLTG+ ++NASLLDEGTAAAEAM++     K K   + + + CHPQT+
Sbjct  145   LEALLNFQTMVMDLTGMEIANASLLDEGTAAAEAMSLSLGASKSKANAYFVDAGCHPQTL  204

Query  842   DICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
             ++ KTRA+  +++++  D K  D+ S  V G L+QYP T G V DY +FI+ AH     V
Sbjct  205   EVVKTRANPLDIEIIVGDWKTFDF-STPVFGALLQYPTTTGAVCDYRQFIETAHEQKAIV  263

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+D+L+L +L PPGE GADI VGS QRFG+P+GY
Sbjct  264   TVAADILSLALLTPPGEFGADIAVGSTQRFGIPLGY  299



>dbj|GAL03183.1| glycine dehydrogenase [Photobacterium aphoticum]
Length=366

 Score =   297 bits (760),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 192/280 (69%), Gaps = 10/280 (4%)
 Frame = +2

Query  299   VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS---MKFPKFD  469
             ++AL     F  RHN      Q  M +  G  ++D LID TVP +IRL +   +  P+  
Sbjct  7     LQALSDDTEFAGRHNGPDAAQQQIMLDAIGVATVDQLIDETVPAAIRLPAPMDLAAPQ--  64

Query  470   HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEI  649
                +EA M+  +K +A KN + +S+IG GYYNT  P VILRN++ENPGWYT YTPYQ EI
Sbjct  65    ---SEADMLAALKTIAQKNTLHRSFIGQGYYNTHTPNVILRNVLENPGWYTAYTPYQPEI  121

Query  650   SQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCH  829
             SQGRLESLLN+Q MI DLTG+ ++NASLLDEGTAAAEAM +C    K K K F ++++ H
Sbjct  122   SQGRLESLLNYQQMIMDLTGMELANASLLDEGTAAAEAMTLCQRASKNKSKAFFLSNDLH  181

Query  830   PQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAH  1009
             PQTID+ +TRA    +++++   +++D  + DV G L+QYPGT G + D  + I  AH+ 
Sbjct  182   PQTIDVVRTRAHFIGIEIISGKAEELD--NHDVFGALLQYPGTTGNITDLTDIITQAHSK  239

Query  1010  GVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
                V +ASDLLALT+L  PGE+GAD+VVGSAQRFGVPMG+
Sbjct  240   KTLVAVASDLLALTVLAAPGEMGADVVVGSAQRFGVPMGF  279



>dbj|GAM17937.1| hypothetical protein SAMD00019534_011120, partial [Acytostelium 
subglobosum LB1]
Length=1024

 Score =   313 bits (801),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 194/279 (70%), Gaps = 9/279 (3%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKM--------AEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  475
             DTFPRRH   + ED + M        A      SLD LI+ TVP+SI +      + +H 
Sbjct  61    DTFPRRHIGPSDEDINVMLSKITTSKASSVRPTSLDNLIEYTVPKSISMQRDLDIEGNHI  120

Query  476   LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQ  655
               E Q++   + L  KNK+F+S+IGMGYYNT  P VI RNI+ENPGWYT YTPYQAEISQ
Sbjct  121   KGENQILAEFRELVKKNKLFRSFIGMGYYNTITPHVIQRNILENPGWYTPYTPYQAEISQ  180

Query  656   GRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKK-TFIIASNCHP  832
             GRLESL+NFQTM+TDLTGL M+NASLLDE TAA+EA+ MC N+ KGKK   F++   CHP
Sbjct  181   GRLESLINFQTMVTDLTGLAMANASLLDEATAASEAVTMCINLSKGKKDFAFLVDKRCHP  240

Query  833   QTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHG  1012
             QTID  KTRA+   +++     +D DY   DV GVLVQYP T+G + DY   ++ AHA+ 
Sbjct  241   QTIDTIKTRAEPKGVRIEVCSYQDFDYSRNDVVGVLVQYPATDGSLRDYRAVVEKAHANK  300

Query  1013  VKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
               VV A+DLLALTML PPGE GADI +G++QRFGVP+G+
Sbjct  301   ALVVCATDLLALTMLTPPGEWGADIALGNSQRFGVPLGF  339



>ref|WP_019556676.1| glycine dehydrogenase [Thiomicrospira arctica]
Length=973

 Score =   311 bits (798),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 201/290 (69%), Gaps = 9/290 (3%)
 Frame = +2

Query  269   ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-D  445
             A+  Q    S+E L+ SD F  RH     ++Q  M       SL+ L+D  VP SIR  D
Sbjct  4     ATLSQLADCSLEELQQSDKFITRHLGPDDDEQLAMLRSLKMASLNELLDKVVPSSIRRHD  63

Query  446   SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  625
              M   +   GLTE Q +E +K +ASKN V KSYIGMGYYNTF PP I RNI+ENP WYT 
Sbjct  64    PMDLAE---GLTEQQSLEKLKAIASKNIVLKSYIGMGYYNTFTPPTIQRNILENPAWYTA  120

Query  626   YTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKT  805
             YTPYQAEISQGRLE++LNFQTM++DLTGL ++NASLLDE TA AEAM +C  + K K K 
Sbjct  121   YTPYQAEISQGRLEAMLNFQTMVSDLTGLELANASLLDEATACAEAMTLCQRMSKSKGKV  180

Query  806   FIIASNCHPQTIDICKTRADGFELKVVTAD-LKDI-DYKSGDVCGVLVQYPGTEGEVLDY  979
             F +A +CHPQ I++ +TRA+   ++VV  + + ++ DY   D+ GVL+QYPGT GEV D+
Sbjct  181   FFVADDCHPQNIEVIQTRAEPLGIEVVVGNPINELADY---DLFGVLLQYPGTYGEVSDF  237

Query  980   GEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              E I+  HA    V M++DLLALT+LK PGE+GAD+ +G+ QRFGVP+GY
Sbjct  238   SELIEKIHAKKALVAMSADLLALTLLKTPGEMGADVAIGNTQRFGVPLGY  287



>gb|EPB87900.1| glycine dehydrogenase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=1008

 Score =   312 bits (800),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 195/276 (71%), Gaps = 4/276 (1%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  487
             L P DTFPRRH  +   +   M    G  S+D ++  T+P +IR  S K      G+ E 
Sbjct  50    LAPLDTFPRRHLGSESNEVKSMLNQLGVKSIDEMLAKTIPSAIR--SPKPLSIPEGIPER  107

Query  488   QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLE  667
             Q++  +K++ASKNK+ +SYIG GY +T VP VILRNI+ENP WYTQYTPYQ EI+QGRLE
Sbjct  108   QLLARLKDIASKNKINRSYIGQGYTDTVVPNVILRNILENPAWYTQYTPYQPEIAQGRLE  167

Query  668   SLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDI  847
             SLLN+QTMITDLTG+P++NASLLDEGTAAAEAM M     + KK  F++  NCHPQTI  
Sbjct  168   SLLNYQTMITDLTGMPIANASLLDEGTAAAEAMLMAWQAGRRKKNLFVVDENCHPQTIAC  227

Query  848   CKTRADGFELKVVTADLKDIDYKSG--DVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
              KTRA+ F ++VV AD    ++     ++CGVL+QYP T G V DY E   N HA G +V
Sbjct  228   LKTRAESFNIEVVVADTFHYNFAENKKNLCGVLLQYPDTRGSVKDYEELTANVHAAGGQV  287

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+DL+ALT+LK PGE GAD+ +G++QRFGVPMG+
Sbjct  288   AVATDLMALTLLKSPGEFGADMALGNSQRFGVPMGF  323



>ref|WP_039743276.1| glycine dehydrogenase [Hassallia byssoidea]
 gb|KIF35727.1| glycine dehydrogenase [Hassallia byssoidea VB512170]
Length=1019

 Score =   312 bits (800),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 202/288 (70%), Gaps = 8/288 (3%)
 Frame = +2

Query  269   ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-D  445
             +SH+Q  S   +  + S  FP RH     +D  +M E  G  +LD LID TVPQ+IRL  
Sbjct  10    SSHEQVLS---QTSQKSSNFPERHIGPNCDDIQQMLELLGISNLDTLIDKTVPQAIRLKQ  66

Query  446   SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  625
             S++ P+    L+E   +  +K +A KN+V++S+IGMGYY+   PPVI RNI+ENPGWYT 
Sbjct  67    SLQLPE---ALSEYAALAKLKQIAVKNEVYRSFIGMGYYDCITPPVIQRNILENPGWYTA  123

Query  626   YTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKT  805
             YTPYQ+EI+QGRLE+LLNFQTMI DLTGL ++NASLLDE TAAAEAM+M   + K K  T
Sbjct  124   YTPYQSEIAQGRLEALLNFQTMIIDLTGLEIANASLLDEATAAAEAMSMSYGVCKNKANT  183

Query  806   FIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGE  985
             + ++ +CHPQTID+ +TRA    +K+V  D +  D+ +  + G ++QYP T+G + DY  
Sbjct  184   YFVSQDCHPQTIDVLQTRAKPLGIKIVVGDHQTFDF-AQPIFGAILQYPATDGTIYDYRA  242

Query  986   FIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             FI+ AHA G  V +A+D L+LT+L PPGE GADI VGS QRFG+P+G+
Sbjct  243   FIEKAHAEGALVTVAADPLSLTLLTPPGEFGADIAVGSTQRFGIPLGF  290



>ref|WP_008684764.1| glycine dehydrogenase [Rhodopirellula sallentina]
 gb|EMI53503.1| glycine dehydrogenase [Rhodopirellula sallentina SM41]
Length=990

 Score =   311 bits (798),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 195/284 (69%), Gaps = 6/284 (2%)
 Frame = +2

Query  284   RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFP  460
             R S +  A+   D F RRH   +  DQ+ M    GF SLDAL DATVP  IRLD  +  P
Sbjct  15    RPSTTTNAIDFVDGFARRHIGPSDRDQAAMLGTLGFDSLDALSDATVPADIRLDEPLDIP  74

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
                    E + ++ ++ +ASKNKV++S IGMGY  T  PPVILRN++ENPGWYTQYTPYQ
Sbjct  75    D---PRGERETLQGLRTIASKNKVYRSCIGMGYTGTVTPPVILRNVLENPGWYTQYTPYQ  131

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AEI+QGRLE+LLNFQTMI DLTGLP++ ASLLDE TAAAEAM MC +I + +K  F  + 
Sbjct  132   AEIAQGRLEALLNFQTMIADLTGLPLAGASLLDEATAAAEAMGMCVSIARHQKTGFWASD  191

Query  821   NCHPQTIDICKTRADGF--ELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIK  994
             +CHPQT+ + +TRA G   +LKV      D DY  G +CGVLVQYP T+G + DY    +
Sbjct  192   DCHPQTLALLQTRAAGLGVDLKVGPISEIDFDYGEGGLCGVLVQYPTTDGRINDYKALAE  251

Query  995   NAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
              A +     V A+DLL+LT++ PPGE GADI VGSAQRFGVPMG
Sbjct  252   QAKSKQCLTVAAADLLSLTLITPPGEWGADICVGSAQRFGVPMG  295



>emb|CEP11218.1| hypothetical protein [Parasitella parasitica]
Length=1008

 Score =   312 bits (799),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 197/276 (71%), Gaps = 4/276 (1%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  487
             L P DTFPRRH  +   + + M +  G  S+D L+  T+P +IR  S K      G+ E 
Sbjct  50    LAPLDTFPRRHLGSESNEINAMLKQLGVKSIDELLAKTIPSAIR--SPKALSIPEGVPER  107

Query  488   QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLE  667
             Q++  +K++ASKNK+ +SYIG GY +T VP VILRNI+ENP WYTQYTPYQ EI+QGRLE
Sbjct  108   QLLARLKDIASKNKINRSYIGQGYTDTVVPNVILRNILENPAWYTQYTPYQPEIAQGRLE  167

Query  668   SLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDI  847
             SLLN+QTMITDLTG+P++NASLLDEGTAAAEAM M     + KK  F++  NCHPQTI  
Sbjct  168   SLLNYQTMITDLTGMPIANASLLDEGTAAAEAMLMAWQAGRRKKNLFVVDENCHPQTIAC  227

Query  848   CKTRADGFELKVVTADLKDIDYKSG--DVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
              KTRA+ F ++VV AD    ++     ++CGVL+QYP T G V DY E   + HA G +V
Sbjct  228   LKTRAESFNIEVVVADTFHFNFAENKKNLCGVLLQYPDTRGSVKDYEELTASVHAAGGQV  287

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+DL+ALT+LK PGE GAD+ +G++QRFGVPMG+
Sbjct  288   AVATDLMALTLLKSPGEFGADMALGNSQRFGVPMGF  323



>pdb|4LGL|A Chain A, Crystal Structure Of Glycine Decarboxylase P-protein 
From Synechocystis Sp. Pcc 6803, Apo Form
 pdb|4LGL|B Chain B, Crystal Structure Of Glycine Decarboxylase P-protein 
From Synechocystis Sp. Pcc 6803, Apo Form
Length=983

 Score =   311 bits (798),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/277 (55%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGL  478
             E L P+D+F  RH      +Q +M +  GF +L  LID  VP +IR   S++ P      
Sbjct  25    EKLAPADSFLDRHLGPGETEQRQMLQTLGFDTLGDLIDQAVPPAIRFPRSLQLPASQ---  81

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   I  +K++ASKN+VF+SYIGMGYY+T  PPVI RNI+ENPGWYT YTPYQAEI+QG
Sbjct  82    SEYGAIAQLKSIASKNQVFRSYIGMGYYDTITPPVIQRNILENPGWYTAYTPYQAEIAQG  141

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQTM+ DLTGL ++NASLLDEGTAAAEAMA+   + K K   F +A +CHPQT
Sbjct  142   RLEALLNFQTMVMDLTGLEIANASLLDEGTAAAEAMALSYGVSKSKANAFFVAQDCHPQT  201

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA+   ++V+  D     + S  + G L+QYP T+G V DY  FI  AH H   
Sbjct  202   IEVIKTRANPLGIEVIVGDHHTFSF-STSIFGALLQYPATDGAVYDYRSFIDKAHQHQAL  260

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D L+LT+L PPGELGADI VGS QRFG+P+GY
Sbjct  261   VTLAADPLSLTLLTPPGELGADIAVGSTQRFGIPLGY  297



>ref|WP_010873139.1| glycine dehydrogenase (decarboxylating) [Synechocystis sp. PCC 
6803]
 sp|P74416.1|GCSP_SYNY3 RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAA18516.1| P protein of glycine cleavage complex [Synechocystis sp. PCC 
6803]
 dbj|BAK50693.1| P protein of glycine cleavage complex [Synechocystis sp. PCC 
6803]
 dbj|BAL29691.1| P protein of glycine cleavage complex [Synechocystis sp. PCC 
6803 substr. GT-I]
 dbj|BAL32860.1| P protein of glycine cleavage complex [Synechocystis sp. PCC 
6803 substr. PCC-N]
 dbj|BAL36029.1| P protein of glycine cleavage complex [Synechocystis sp. PCC 
6803 substr. PCC-P]
 dbj|BAM54758.1| glycine dehydrogenase [Bacillus subtilis BEST7613]
 gb|AGF52205.1| P protein of glycine cleavage complex [Synechocystis sp. PCC 
6803]
Length=983

 Score =   311 bits (798),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/277 (55%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGL  478
             E L P+D+F  RH      +Q +M +  GF +L  LID  VP +IR   S++ P      
Sbjct  25    EKLAPADSFLDRHLGPGETEQRQMLQTLGFDTLGDLIDQAVPPAIRFPRSLQLPASQ---  81

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   I  +K++ASKN+VF+SYIGMGYY+T  PPVI RNI+ENPGWYT YTPYQAEI+QG
Sbjct  82    SEYGAIAQLKSIASKNQVFRSYIGMGYYDTITPPVIQRNILENPGWYTAYTPYQAEIAQG  141

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQTM+ DLTGL ++NASLLDEGTAAAEAMA+   + K K   F +A +CHPQT
Sbjct  142   RLEALLNFQTMVMDLTGLEIANASLLDEGTAAAEAMALSYGVSKSKANAFFVAQDCHPQT  201

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA+   ++V+  D     + S  + G L+QYP T+G V DY  FI  AH H   
Sbjct  202   IEVIKTRANPLGIEVIVGDHHTFSF-STSIFGALLQYPATDGAVYDYRSFIDKAHQHQAL  260

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D L+LT+L PPGELGADI VGS QRFG+P+GY
Sbjct  261   VTLAADPLSLTLLTPPGELGADIAVGSTQRFGIPLGY  297



>pdb|4LHC|A Chain A, Crystal Structure Of Synechocystis Sp. Pcc 6803 Glycine 
Decarboxylase (p-protein), Holo Form With Pyridoxal-5'-phosphate 
And Glycine
 pdb|4LHC|B Chain B, Crystal Structure Of Synechocystis Sp. Pcc 6803 Glycine 
Decarboxylase (p-protein), Holo Form With Pyridoxal-5'-phosphate 
And Glycine
 pdb|4LHD|A Chain A, Crystal Structure Of Synechocystis Sp. Pcc 6803 Glycine 
Decarboxylase (p-protein), Holo Form With Pyridoxal-5'-phosphate 
And Glycine, Closed Flexible Loop
 pdb|4LHD|B Chain B, Crystal Structure Of Synechocystis Sp. Pcc 6803 Glycine 
Decarboxylase (p-protein), Holo Form With Pyridoxal-5'-phosphate 
And Glycine, Closed Flexible Loop
Length=983

 Score =   311 bits (798),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/277 (55%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGL  478
             E L P+D+F  RH      +Q +M +  GF +L  LID  VP +IR   S++ P      
Sbjct  25    EKLAPADSFLDRHLGPGETEQRQMLQTLGFDTLGDLIDQAVPPAIRFPRSLQLPASQ---  81

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   I  +K++ASKN+VF+SYIGMGYY+T  PPVI RNI+ENPGWYT YTPYQAEI+QG
Sbjct  82    SEYGAIAQLKSIASKNQVFRSYIGMGYYDTITPPVIQRNILENPGWYTAYTPYQAEIAQG  141

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQTM+ DLTGL ++NASLLDEGTAAAEAMA+   + K K   F +A +CHPQT
Sbjct  142   RLEALLNFQTMVMDLTGLEIANASLLDEGTAAAEAMALSYGVSKSKANAFFVAQDCHPQT  201

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA+   ++V+  D     + S  + G L+QYP T+G V DY  FI  AH H   
Sbjct  202   IEVIKTRANPLGIEVIVGDHHTFSF-STSIFGALLQYPATDGAVYDYRSFIDKAHQHQAL  260

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D L+LT+L PPGELGADI VGS QRFG+P+GY
Sbjct  261   VTLAADPLSLTLLTPPGELGADIAVGSTQRFGIPLGY  297



>ref|XP_008606102.1| glycine dehydrogenase [Saprolegnia diclina VS20]
 gb|EQC40403.1| glycine dehydrogenase [Saprolegnia diclina VS20]
Length=1001

 Score =   311 bits (797),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 193/271 (71%), Gaps = 5/271 (2%)
 Frame = +2

Query  317   SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQM  493
             +D F RRH  A+ +D + M    G  SL+ALI  TVP+ IRL   +  P     ++E+Q 
Sbjct  33    TDQFARRHIGASEDDTAFMLNTIGEKSLEALIKKTVPKEIRLKKKLNLPA---PMSESQA  89

Query  494   IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESL  673
             +  ++ +A KNK +KS+IG G+ +   P  I RN++ENPGWYT YTPYQAE+SQGRLE L
Sbjct  90    MAKLRKIAKKNKTYKSFIGTGFNDCLTPFAIKRNLLENPGWYTAYTPYQAEVSQGRLEML  149

Query  674   LNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICK  853
             LNFQTM++DLTG P++ ASLLDEGTAAAEAMA+C+    GK+  F +AS+CHPQTI + K
Sbjct  150   LNFQTMLSDLTGFPIAGASLLDEGTAAAEAMALCHGAANGKRTKFFVASDCHPQTIAVLK  209

Query  854   TRADGFELKVVTAD-LKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMA  1030
             TRA+GF +++V  + L D D+ SGD  G L+QYP T G V DY  F   AHA+G  V++A
Sbjct  210   TRAEGFGIELVFGNALTDADFSSGDFSGTLIQYPNTYGSVADYEAFTTAAHANGTMVIVA  269

Query  1031  SDLLALTMLKPPGELGADIVVGSAQRFGVPM  1123
             +DLLALT LKPP E GADI VGSAQRFGVP+
Sbjct  270   TDLLALTQLKPPAEFGADIAVGSAQRFGVPL  300



>gb|EFA86802.1| glycine dehydrogenase [Polysphondylium pallidum PN500]
Length=1014

 Score =   311 bits (798),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 194/279 (70%), Gaps = 9/279 (3%)
 Frame = +2

Query  320   DTFPRRHNSATPED-QSKMAEFCGFP-------SLDALIDATVPQSIRLDSMKFPKFDHG  475
             DTFPRRH   + E+ +S + E            SLD LID TVP SIR+      + +  
Sbjct  52    DTFPRRHIGPSDEEIKSMLKEITTSKQSKVTPQSLDQLIDYTVPSSIRMQRDLDIEGNKI  111

Query  476   LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQ  655
               E +M++  + L  +NKVF+S+IGMGYY +  P VI RNI+ENPGWYT YTPYQAEISQ
Sbjct  112   KGEFEMLQEFRELVKQNKVFRSFIGMGYYGSITPHVIQRNILENPGWYTPYTPYQAEISQ  171

Query  656   GRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKK-TFIIASNCHP  832
             GRLESL+NFQTM++DLT LPM+NASLLDEGTAAAEA+ MC NI K KK   F+I   CHP
Sbjct  172   GRLESLINFQTMVSDLTKLPMANASLLDEGTAAAEAVTMCINISKTKKTPAFLIDRRCHP  231

Query  833   QTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHG  1012
             QTID  +TRA+   +++   D KD DY  GDV GVLVQYP T+G + DY    + AH + 
Sbjct  232   QTIDNIRTRAEPKGVRIEVVDFKDFDYSKGDVVGVLVQYPATDGSISDYRALTQKAHENN  291

Query  1013  VKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
               VV A+DL+ALTML PPGE GADI +G++QRFGVP+G+
Sbjct  292   ALVVCATDLMALTMLTPPGEWGADIALGNSQRFGVPLGF  330



>ref|XP_005703180.1| glycine dehydrogenase subunit 2 [Galdieria sulphuraria]
 gb|EME26660.1| glycine dehydrogenase subunit 2 [Galdieria sulphuraria]
Length=339

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 152/277 (55%), Positives = 196/277 (71%), Gaps = 5/277 (2%)
 Frame = +2

Query  305   ALKPSDTFPRRH-NSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  481
              L+  D F  RH  S    D   M +     +LD LI  TVP  IR  S        GLT
Sbjct  28    VLEAQDIFENRHIGSGKEADIQAMLQALKLNTLDELIQETVPAKIR--SKTGLGIGSGLT  85

Query  482   EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGR  661
             E++ +++++ LA +N++++++IGMGYY T VP VI RNI+ENP WYTQYTPYQAE+SQGR
Sbjct  86    ESEALKYIRKLAQRNELYQNHIGMGYYGTLVPAVIQRNILENPAWYTQYTPYQAEVSQGR  145

Query  662   LESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTI  841
             LESLLN+QTM++DLTGLP++ ASLLDE TAAAEAMAMC  + K KK+ F+I+ +CHPQTI
Sbjct  146   LESLLNYQTMVSDLTGLPIAGASLLDEATAAAEAMAMCYALSKQKKRIFVISDSCHPQTI  205

Query  842   DICKTRADGFELKVVTADLKDIDYK--SGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGV  1015
              +  TRA+GF ++VV   +   ++K   G VCG+L+QYP T+G + DY   I  AH  G 
Sbjct  206   GVICTRAEGFGIEVVVGKMHSFNWKEVQGQVCGILLQYPTTQGIIEDYENIITEAHHSGA  265

Query  1016  KVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
             KV+M+ DLLALTMLKPPGE+ AD  VGS+QRFGVPMG
Sbjct  266   KVIMSCDLLALTMLKPPGEMHADFAVGSSQRFGVPMG  302



>ref|WP_044451621.1| glycine dehydrogenase, partial [Mastigocladus laminosus]
 gb|KIY11150.1| glycine dehydrogenase, partial [Mastigocladus laminosus UU774]
Length=736

 Score =   306 bits (783),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/277 (52%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             E+ + S  F +RH     +D  +M +  G  S+DALI+ TVPQSIRL  ++  P+    L
Sbjct  18    ESTEKSSDFKQRHIGPNADDMQQMLDLLGVSSVDALINQTVPQSIRLSRALNLPE---AL  74

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K++A KN++F+S+IGMGYY+T  P VI RNI+ENPGWYT YTPYQ EI+QG
Sbjct  75    SEYAAVAKLKDIALKNQIFRSFIGMGYYDTITPAVIQRNILENPGWYTAYTPYQPEIAQG  134

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQTMI DLTGL ++NASLLDE TA AEAM M   I K K   F ++ +CHPQT
Sbjct  135   RLEALLNFQTMIIDLTGLEIANASLLDEATAVAEAMTMSYGICKNKANAFFVSQDCHPQT  194

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             ID+ +TRA    +K++  D +  D+ S  + G ++QYP ++G V DY  F++ AHA G  
Sbjct  195   IDVLQTRARPLGIKIIIGDHQSFDF-SESIFGAVLQYPASDGTVYDYRAFVEKAHAVGAL  253

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D L+LT+L PPGE GADI +GS QRFG+P+GY
Sbjct  254   VTVAADPLSLTLLTPPGEFGADIAIGSTQRFGIPLGY  290



>ref|WP_037223913.1| glycine dehydrogenase, partial [Richelia intracellularis]
Length=658

 Score =   303 bits (776),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 147/272 (54%), Positives = 193/272 (71%), Gaps = 5/272 (2%)
 Frame = +2

Query  317   SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQM  493
             S TF +RH     +D  KM +  G  +LD LID  VPQ IRL+ S++ P     L++   
Sbjct  27    SFTFAQRHIGPNSQDIRKMLDVLGLGNLDDLIDRAVPQGIRLNRSLELPA---ALSQYAA  83

Query  494   IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESL  673
             +  +K++A+KNKVF+S+IGMGYY+  VP VI RNI+ENPGWYT YTPYQ EI+QGRLE+L
Sbjct  84    LGKLKDIAAKNKVFRSFIGMGYYDCVVPTVIQRNILENPGWYTAYTPYQPEIAQGRLEAL  143

Query  674   LNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICK  853
             LNFQTMI DLTGL ++NASLLDEGTAAAEAM+M     K K   F ++ +CHPQTI++ +
Sbjct  144   LNFQTMIIDLTGLEIANASLLDEGTAAAEAMSMSYGATKHKANGFFVSQDCHPQTIEVLR  203

Query  854   TRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMAS  1033
             TRA    + ++T D +  D+ S  + G ++QYP T+G + DY  FI+ AHA    V +A+
Sbjct  204   TRARPLGINIITGDHRTFDF-SEPIFGAVLQYPATDGSIYDYRPFIQKAHAERALVTVAA  262

Query  1034  DLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DLL+LT+L+PPGE GADI VG+ QRFGV MGY
Sbjct  263   DLLSLTLLRPPGEFGADIAVGTTQRFGVSMGY  294



>ref|WP_007414923.1| glycine dehydrogenase [Pedosphaera parvula]
 gb|EEF61028.1| glycine dehydrogenase [bacterium Ellin514]
Length=979

 Score =   310 bits (794),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 158/277 (57%), Positives = 198/277 (71%), Gaps = 11/277 (4%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  484
             L+P D+F  RH   +  +  +M    GF  LD LI+  VPQ I+L  S+  P       E
Sbjct  33    LEP-DSFVPRHIGPSSNETREMLAALGFKELDELINTVVPQQIQLKRSLHLPA---SRGE  88

Query  485   AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRL  664
               ++  +K +AS+N+VF+S+IGMGY++   PPVI RN++ENPGWYTQYTPYQAEI+QGRL
Sbjct  89    HHVLTELKAIASQNQVFRSFIGMGYHDCITPPVIQRNVLENPGWYTQYTPYQAEIAQGRL  148

Query  665   ESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTID  844
             E+LLNFQTMI DLTGL ++NASLLDEGTAAAEAM MCN I K     F ++S CHPQTID
Sbjct  149   EALLNFQTMIVDLTGLDIANASLLDEGTAAAEAMHMCNAI-KADGNVFFVSSECHPQTID  207

Query  845   ICKTRADGFELKVVTADLKD--IDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I KTRA    ++VV  D +   +D K   V GVLVQYPGT G++ +Y EF K AHA G  
Sbjct  208   IVKTRALPLGVEVVIGDHRTFPVDEK---VFGVLVQYPGTFGDIHNYSEFFKQAHAAGAL  264

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              V+A+DLL+LT+L+PPGE GADI +GSAQRFGVP+GY
Sbjct  265   TVVAADLLSLTLLRPPGEFGADIAIGSAQRFGVPLGY  301



>gb|EIE87692.1| glycine dehydrogenase [Rhizopus delemar RA 99-880]
Length=1008

 Score =   310 bits (795),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 196/276 (71%), Gaps = 4/276 (1%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  487
             L P DTFPRRH  +  ++   M +  G  ++D L+  T+P +IR  S K      G+ E 
Sbjct  54    LAPLDTFPRRHVGSEGKEVQDMLKQLGMKNVDELLGKTIPSAIR--SPKALAIGEGVPER  111

Query  488   QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLE  667
             Q++  +K +ASKNK+ +SYIG GY +T VP VILRNI+ENP WYTQYTPYQ EI+QGRLE
Sbjct  112   QLLARLKEIASKNKLNRSYIGQGYTDTVVPNVILRNILENPAWYTQYTPYQPEIAQGRLE  171

Query  668   SLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDI  847
             SLLN+QTM++DLTGLP++NASLLDEGTAAAEAM MC    + KK  F++  NCHPQTI  
Sbjct  172   SLLNYQTMVSDLTGLPIANASLLDEGTAAAEAMLMCWQAARQKKNLFVVDENCHPQTIAC  231

Query  848   CKTRADGFELKVVTADLKDIDYKS--GDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
              K RA+ F ++++ AD  +  ++    ++CGVL+QYP T G V DY     N HA G +V
Sbjct  232   LKARAESFNIEIIVADTLNYHFEEHKKELCGVLLQYPNTRGSVKDYEALAANIHAVGGQV  291

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+DL+ALT+LK PGELGADI  G++QRFGVP+G+
Sbjct  292   AVATDLMALTLLKSPGELGADIAFGNSQRFGVPLGF  327



>ref|WP_009094772.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
 gb|EMI46247.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
Length=990

 Score =   310 bits (794),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 197/285 (69%), Gaps = 6/285 (2%)
 Frame = +2

Query  281   QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKF  457
             +  S +  A+   D F RRH   +P + S+M    GF SLDAL DATVP  IRLD  +  
Sbjct  14    ETSSAATNAIDFVDGFSRRHIGPSPTELSEMLSTIGFDSLDALSDATVPADIRLDQPLDI  73

Query  458   PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  637
             P+      E + ++ ++ +A KNKV++S IGMGY  T  PPVILRN++ENPGWYTQYTPY
Sbjct  74    PE---PRGERETLQGLRTIAGKNKVYRSCIGMGYTGTVTPPVILRNVLENPGWYTQYTPY  130

Query  638   QAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIA  817
             QAEI+QGRLE+LLNFQTMI DLTGLP++ ASLLDE TAAAEAM MC +I K +K  F  +
Sbjct  131   QAEIAQGRLEALLNFQTMIADLTGLPLAGASLLDEATAAAEAMGMCISIAKHQKTGFWAS  190

Query  818   SNCHPQTIDICKTRADGFELKVVTADLKDID--YKSGDVCGVLVQYPGTEGEVLDYGEFI  991
              +CHPQT+ + +TRA G  + +    + +ID  Y  G +CGVLVQYP T+G + +Y E  
Sbjct  191   DDCHPQTLALLQTRAAGLGVDLKIGPISEIDFSYGKGGLCGVLVQYPTTDGRINNYRELA  250

Query  992   KNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
               A A+    V A+DLL+LT++ PPGE GADI VGSAQRFGVPMG
Sbjct  251   STAKANQCLTVAAADLLSLTLITPPGEWGADICVGSAQRFGVPMG  295



>ref|WP_035986474.1| glycine dehydrogenase [Leptolyngbya sp. KIOST-1]
Length=978

 Score =   309 bits (792),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 200/274 (73%), Gaps = 6/274 (2%)
 Frame = +2

Query  314   PSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQ  490
             P  +F  RH      D   M +  G+ SLD LI+ATVP +IR    +K P+   G +EA 
Sbjct  32    PLSSFVARHLGPDAGDTKAMLKALGYSSLDELIEATVPATIRFQQPLKLPQ---GWSEAA  88

Query  491   MIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLES  670
              +EH+K +A++N+V++SY+G+GY NT  P VI RN++ENPGWYTQYTPYQ EI+QGRLE+
Sbjct  89    ALEHLKGIAAQNQVWRSYLGLGYANTLTPAVIQRNVLENPGWYTQYTPYQPEIAQGRLEA  148

Query  671   LLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQTIDI  847
             LLNFQT++TDLTG+ ++NASLLDEGTAAAEAM +  N  K K  KTF +++ CHPQTID+
Sbjct  149   LLNFQTLVTDLTGMEIANASLLDEGTAAAEAMTLAFNARKQKDAKTFWVSAACHPQTIDV  208

Query  848   CKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVM  1027
              KTRA    ++VV AD +  ++++  V GVL+QYP ++G + DY EF+  AHA    V +
Sbjct  209   VKTRAQPLGIEVVVADHRQFNFET-PVFGVLLQYPASDGAIYDYEEFVALAHAAKALVTV  267

Query  1028  ASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             A+DLL+LT+L+PPGE  ADIVVGS QRFGVP+GY
Sbjct  268   AADLLSLTLLRPPGEFDADIVVGSTQRFGVPLGY  301



>ref|WP_038329010.1| glycine dehydrogenase, partial [gamma proteobacterium SCGC AAA076-D13]
Length=405

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/278 (51%), Positives = 192/278 (69%), Gaps = 5/278 (2%)
 Frame = +2

Query  299   VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHG  475
             +E L  +D F  RH  ++ E +++M  + GF +LD LID  VP  IR    K P     G
Sbjct  5     IEDLLNNDAFTNRHIGSSSEQKNQMLNYLGFDNLDKLIDEIVPDVIR---RKEPMNIADG  61

Query  476   LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQ  655
             ++E   ++ ++NLA  N  +KS+IG GYYN+  PPVI RN+ ENP WYT YTPYQ EISQ
Sbjct  62    MSELAALKQLRNLARMNIRYKSFIGQGYYNSITPPVIQRNVEENPAWYTAYTPYQPEISQ  121

Query  656   GRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQ  835
             GRLE+L+NFQTM++DLTG+ ++NAS+LDE TA AEAM +C+ + K K  TF +A++C+ Q
Sbjct  122   GRLEALMNFQTMVSDLTGMDLANASMLDEATACAEAMTLCHRVSKSKSNTFFVANDCYAQ  181

Query  836   TIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGV  1015
              +++ KTRA+   ++VV  D   ID K  D  GVL+QYP T G   DY + I++ H    
Sbjct  182   NLEVIKTRAEPLNIEVVVGD-PLIDLKDLDCFGVLLQYPNTYGAFSDYSKLIESIHEKKA  240

Query  1016  KVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              V +++DLLALT+LKPPGE+GADIVVG+ QRFGVP+GY
Sbjct  241   LVSVSADLLALTLLKPPGEMGADIVVGNTQRFGVPIGY  278



>ref|WP_044034863.1| glycine dehydrogenase, partial [Microcystis aeruginosa]
Length=582

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 193/276 (70%), Gaps = 3/276 (1%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  481
             + L  +D+F  RH   T  +  KM    G  +++ LI  TVP +IRL   K       L+
Sbjct  21    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATVEELIAQTVPAAIRLQ--KSLNLAPALS  78

Query  482   EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGR  661
             E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QGR
Sbjct  79    EYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQGR  138

Query  662   LESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTI  841
             LE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM M   + K K   F I+S+CHPQTI
Sbjct  139   LEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMTMSYGLCKTKANAFFISSSCHPQTI  198

Query  842   DICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
             ++ KTRA    + ++  D +  D+++  + G L+QYP T+G + DY EFI  A  +G  V
Sbjct  199   EVVKTRAIPLGIDIIIDDHRLFDFQT-PIFGALLQYPATDGLIYDYREFIAKAQENGALV  257

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  258   TVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  293



>gb|KDO30366.1| glycine dehydrogenase [Saprolegnia parasitica CBS 223.65]
Length=1001

 Score =   309 bits (792),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 192/271 (71%), Gaps = 5/271 (2%)
 Frame = +2

Query  317   SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQM  493
             +D F RRH  A+ +D + M    G  SL++LI  TVP+ IRL   +  P     ++E+Q 
Sbjct  33    TDQFARRHIGASEDDTAFMLNTIGEKSLESLIKKTVPKEIRLKKKLNLPA---PMSESQA  89

Query  494   IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESL  673
             +  ++ +A KNK +KS+IG G+ +   P  I RN++ENPGWYT YTPYQAE+SQGRLE L
Sbjct  90    MAKLRKIAKKNKTYKSFIGTGFNDCLTPFAIKRNLLENPGWYTAYTPYQAEVSQGRLEML  149

Query  674   LNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICK  853
             LNFQTM++DLTG P++ ASLLDEGTAAAEAMA+C+    GK+  F +AS+CHPQTI + K
Sbjct  150   LNFQTMLSDLTGFPIAGASLLDEGTAAAEAMALCHGAANGKRTKFFVASDCHPQTIAVLK  209

Query  854   TRADGFELKVVTAD-LKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMA  1030
             TRA+GF + +V  + L D D+ SGD  G L+QYP T G V DY  F K AH +G  V++A
Sbjct  210   TRAEGFGIDLVFGNALTDADFSSGDFSGTLIQYPNTYGSVADYEAFTKAAHDNGTMVIVA  269

Query  1031  SDLLALTMLKPPGELGADIVVGSAQRFGVPM  1123
             +DLLALT LKPP E GADI VGSAQRFGVP+
Sbjct  270   TDLLALTQLKPPAEFGADIAVGSAQRFGVPL  300



>ref|WP_044179699.1| glycine dehydrogenase [Photobacterium damselae]
Length=957

 Score =   308 bits (790),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 192/271 (71%), Gaps = 6/271 (2%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQMI  496
             +TF  RHN  T E Q  M    G  SLD LID TVP +IRL   ++ PK    + E  ++
Sbjct  11    NTFVNRHNGPTLEQQQTMLAAIGVDSLDQLIDQTVPANIRLPQPLQLPK---AINEEMLL  67

Query  497   EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLL  676
             + +K++A KN + KSYIG GYYNT+ P VILRNI+ENPGWYT YTPYQ EISQGRLESLL
Sbjct  68    QQLKHIAQKNIINKSYIGQGYYNTYTPSVILRNILENPGWYTAYTPYQPEISQGRLESLL  127

Query  677   NFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKT  856
             N+Q M+ DLTG+ ++NASLLDE TAAAEAM +C    K K   F +++  HPQT+D+ +T
Sbjct  128   NYQQMVMDLTGMDLANASLLDESTAAAEAMMLCKRASKNKSPAFFVSNEVHPQTLDVIRT  187

Query  857   RADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASD  1036
             RA    ++V+T +L+ +D  + +V G L+QYPG+ GE+ D    I NAHA    V +ASD
Sbjct  188   RAKLVGIEVITGNLEQLD--NSEVFGALLQYPGSSGEIHDLTAIIANAHAKKTLVAVASD  245

Query  1037  LLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LLALT+L P GE+GAD+VVGSAQRFGVPMG+
Sbjct  246   LLALTLLTPSGEMGADVVVGSAQRFGVPMGF  276



>ref|WP_027846740.1| glycine dehydrogenase [Mastigocoleus testarum]
Length=977

 Score =   308 bits (789),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/272 (54%), Positives = 193/272 (71%), Gaps = 5/272 (2%)
 Frame = +2

Query  317   SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQM  493
             SD F  RH   +PED  +M    G  SL+ LI+ TVP SIR  +S+K P      +E   
Sbjct  23    SDNFVTRHIGPSPEDIQQMLHVLGLSSLNDLIEQTVPPSIRQHNSLKLPA---AQSEYAA  79

Query  494   IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESL  673
             +  +K LA KN+VF+S+IGMGYY+   PPVI RNI+ENPGWYT YTPYQ EI+QGRLE+L
Sbjct  80    LAQLKELAGKNQVFRSFIGMGYYDCITPPVIQRNILENPGWYTAYTPYQPEIAQGRLEAL  139

Query  674   LNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICK  853
             LNFQTM  DLTGL ++NASLLDE TAAAEAM+M   + K K +T+ ++ +CHPQT+ + +
Sbjct  140   LNFQTMTIDLTGLEIANASLLDEATAAAEAMSMSYGVCKKKSETYFVSQDCHPQTVAVLQ  199

Query  854   TRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMAS  1033
             TRA    +K++  D ++ D+ S  + G L+QYP ++G V DY +FI+ AH     V +A+
Sbjct  200   TRARPLGIKIIIGDHREFDF-SQPIFGALLQYPASDGTVCDYAKFIEQAHEQKALVTVAA  258

Query  1034  DLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DLL+LT+LKPPGE GADIVVGS QRFG+P+GY
Sbjct  259   DLLSLTLLKPPGEFGADIVVGSTQRFGIPLGY  290



>ref|WP_015130859.1| glycine dehydrogenase [Calothrix sp. PCC 7507]
 gb|AFY35062.1| Glycine dehydrogenase (decarboxylating) [Calothrix sp. PCC 7507]
Length=980

 Score =   308 bits (789),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/274 (52%), Positives = 196/274 (72%), Gaps = 5/274 (2%)
 Frame = +2

Query  311   KPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEA  487
             K S+ F +RH   + +D  +M E  G P+LDALI+ TVPQ+IRL  S++ P      +E 
Sbjct  22    KSSNNFAQRHIGPSSDDIQQMLEVLGIPNLDALINQTVPQAIRLHQSLQLPT---AQSEY  78

Query  488   QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLE  667
               +  +K LA+KN+VF+S+IGMGYY+   PPVI RNI+ENPGWYT YTPYQ EI+QGRLE
Sbjct  79    AALAKLKQLATKNQVFRSFIGMGYYDCVTPPVIARNILENPGWYTAYTPYQPEIAQGRLE  138

Query  668   SLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDI  847
             +LLNFQTMI DLTGL ++NASLLDE TAAAEAM++   + K K   + ++ +CHPQTID+
Sbjct  139   ALLNFQTMIIDLTGLEIANASLLDEATAAAEAMSLSYGVTKNKANAYFVSRDCHPQTIDV  198

Query  848   CKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVM  1027
              +TRA+   +K++  D +  D++   + G ++QYP ++G + DY  FI+ AH  G  V +
Sbjct  199   LQTRAEPLGIKIIIGDHQTFDFQQ-PIFGAVLQYPASDGTIYDYRAFIEKAHVEGALVTV  257

Query  1028  ASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             A+D+L+LT+L PPGE GADI VGS QR G+P+G+
Sbjct  258   AADILSLTLLTPPGEFGADIAVGSTQRLGIPLGF  291



>ref|WP_015956701.1| glycine dehydrogenase [Cyanothece sp. PCC 7424]
 gb|ACK73118.1| glycine dehydrogenase [Cyanothece sp. PCC 7424]
Length=976

 Score =   307 bits (787),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 194/276 (70%), Gaps = 5/276 (2%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  484
             L  +D+F  RH     ++  +M    G  SLD L+D TVP +IRL+  ++ P+     +E
Sbjct  17    LASTDSFVNRHIGPNRDEIEQMLTLLGLSSLDELVDKTVPPAIRLERELRLPQPQ---SE  73

Query  485   AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRL  664
                +  +K++ASKNK+++S+IGMGYY+   PPVI RNI+ENPGWYT YTPYQAEI+QGRL
Sbjct  74    YAALTQLKSIASKNKIYRSFIGMGYYDCITPPVIQRNILENPGWYTAYTPYQAEIAQGRL  133

Query  665   ESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQTI  841
             E+LLNFQTMI +LTGL ++NASLLDEGTAAAEAM M   + K K    F ++S CHPQTI
Sbjct  134   EALLNFQTMIIELTGLEIANASLLDEGTAAAEAMTMSYGLCKNKNANAFFVSSRCHPQTI  193

Query  842   DICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
             ++ KTRA    ++++ AD +  D+    + G L+QYP T+G + DY EFI  AH  G  V
Sbjct  194   EVIKTRAYPLNIEIIIADHQTFDFNKTPIFGALLQYPATDGTIYDYREFITKAHEVGALV  253

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+D+L+L +L PPGE GADI VGSAQRFGVPMGY
Sbjct  254   TVAADILSLALLTPPGEFGADIAVGSAQRFGVPMGY  289



>dbj|GAN00874.1| glycine dehydrogenase protein [Mucor ambiguus]
Length=1008

 Score =   308 bits (788),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 194/276 (70%), Gaps = 4/276 (1%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  487
             L P DTFPRRH  +   +   M    G  S+D ++  T+P +IR  S K      G+ E 
Sbjct  50    LAPLDTFPRRHLGSESNEVKSMLNQLGVKSIDEMLAKTIPSAIR--SPKPLSIPEGVPER  107

Query  488   QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLE  667
             Q++  +K++ASKNK+ +SYIG GY +T VP VILRNI+ENP WYTQYTPYQ EI+QGRLE
Sbjct  108   QLLARLKDIASKNKINRSYIGQGYTDTVVPNVILRNILENPAWYTQYTPYQPEIAQGRLE  167

Query  668   SLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDI  847
             SLLN+QTMITDLTGLP++NASLLDEGTAAAEAM M     + KK  F++  NCHPQTI  
Sbjct  168   SLLNYQTMITDLTGLPIANASLLDEGTAAAEAMLMAWQAGRRKKNLFVVDENCHPQTIAC  227

Query  848   CKTRADGFELKVVTADLKDIDYKSG--DVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
              KTRA+ F ++V+ AD    ++     ++CGVL+QYP T G V DY     + HA G +V
Sbjct  228   LKTRAESFNIEVIVADTFHYNFAENKKNLCGVLLQYPDTRGSVKDYENLTASIHAAGGQV  287

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+DL+ALT+LK PGE GAD+ +G++QRFGVPMG+
Sbjct  288   AVATDLMALTLLKSPGEFGADMALGNSQRFGVPMGF  323



>ref|WP_044202817.1| glycine dehydrogenase [Flammeovirga sp. OC4]
Length=966

 Score =   307 bits (786),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 188/275 (68%), Gaps = 8/275 (3%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQMI  496
             + F  RHN+       +M +  G   +D LI  TVP+ IRL  ++  P     LTE Q +
Sbjct  9     ERFEARHNAPNHTQIEEMLKALGVSDIDELIAQTVPEKIRLKKALNLPA---PLTEYQFL  65

Query  497   EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLL  676
                K +A KNKV++SYIGMGYYNT  PPVILRNIMENPGWYT YTPYQAEI+QGRLE LL
Sbjct  66    RQFKEVAQKNKVYRSYIGMGYYNTITPPVILRNIMENPGWYTAYTPYQAEIAQGRLEMLL  125

Query  677   NFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKK----TFIIASNCHPQTID  844
             NFQTM+TDLTG+ ++NASLLDE TAA E + M +   KG KK     F  A  CHPQT+D
Sbjct  126   NFQTMVTDLTGMELANASLLDEATAAGEVVHMFHGARKGAKKKQANKFFAAQTCHPQTLD  185

Query  845   ICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVV  1024
             + KTR     +++V  D+ ++D     + GVLVQYP T G + DY +FI  AH +GV V 
Sbjct  186   LLKTRCTPIGVELVIGDVAELDVTDPTLFGVLVQYPDTNGAISDYTDFIAAAHENGVLVA  245

Query  1025  MASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             MASDLLALTMLK PG++ AD VVGSAQRFGVPMGY
Sbjct  246   MASDLLALTMLKEPGKMDADAVVGSAQRFGVPMGY  280



>ref|WP_015157279.1| glycine dehydrogenase subunit alpha/beta [Chroococcidiopsis thermalis]
 gb|AFY90741.1| glycine dehydrogenase (decarboxylating) beta subunit, glycine 
dehydrogenase (decarboxylating) alpha subunit [Chroococcidiopsis 
thermalis PCC 7203]
Length=988

 Score =   307 bits (787),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 196/284 (69%), Gaps = 7/284 (2%)
 Frame = +2

Query  278   QQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  457
             +Q++ IS E++    +F +RH    P +  +M E  G P+LDALID TVPQ+IR    + 
Sbjct  12    RQQKQISSESI----SFRQRHIGPQPIEVEQMLEVLGLPTLDALIDRTVPQAIR--QQRS  65

Query  458   PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  637
              + +   +E   +  +K +ASKN+VF+S+IGMGYY    PPVI RNI+ENPGWYT YTPY
Sbjct  66    LQLEGDRSEHAALAQLKAIASKNQVFRSFIGMGYYGCITPPVIQRNILENPGWYTAYTPY  125

Query  638   QAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIA  817
             Q EI+QGRLE+LLNFQT I DLTGL ++NASLLDEGTAAAEAM M   + K K K F ++
Sbjct  126   QPEIAQGRLEALLNFQTTIIDLTGLEIANASLLDEGTAAAEAMTMSYGLCKTKAKAFFVS  185

Query  818   SNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKN  997
              NCHPQTI + +TRA    + V+  D +   +    V GVL+QYP ++G + DY  F++ 
Sbjct  186   QNCHPQTIQVVQTRARPLGINVIVGDHQTFKFDV-PVFGVLLQYPASDGTIYDYRAFVEQ  244

Query  998   AHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             AHA G  V +A+D L+LT+L PPGE GADI VGS QRFGVPMGY
Sbjct  245   AHAAGALVTVAADPLSLTLLTPPGEWGADIAVGSTQRFGVPMGY  288



>ref|WP_020531529.1| glycine dehydrogenase [Flexithrix dorotheae]
Length=966

 Score =   307 bits (786),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 195/274 (71%), Gaps = 7/274 (3%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQMI  496
             D F  RHNS   ++  +M       SLD LI+ T+P  IRL   +  PK     TE Q +
Sbjct  10    DQFENRHNSLEADEIQEMLNAVKAESLDELIEQTIPSKIRLKKQLDLPK---AKTEHQFL  66

Query  497   EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLL  676
                + +ASKNK+FKSYIG+GY++   PPVILRNI+ENPGWYT YTPYQAEI+QGRLE LL
Sbjct  67    NEFRKIASKNKIFKSYIGLGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQGRLEMLL  126

Query  677   NFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKK---TFIIASNCHPQTIDI  847
             NFQT+ITDLT + ++NASLLDEGTAAAEAM++       KKK    F ++ +CHPQTID+
Sbjct  127   NFQTLITDLTHMDIANASLLDEGTAAAEAMSIFQAFSSRKKKGANKFFVSESCHPQTIDV  186

Query  848   CKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVM  1027
              KTRA    + +VT + +++D  + ++ GVLVQYP +EG V+DY  FI  AH   V V +
Sbjct  187   LKTRARHIGITLVTGNHQEVDLTNPELFGVLVQYPLSEGNVVDYTNFIAAAHESNVLVGV  246

Query  1028  ASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             A+DLL+LT+LK PGE+GAD+VVGSAQRFGVP+GY
Sbjct  247   AADLLSLTLLKAPGEMGADVVVGSAQRFGVPLGY  280



>ref|WP_019487125.1| glycine dehydrogenase [Kamptonema formosum]
Length=984

 Score =   307 bits (786),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/281 (54%), Positives = 192/281 (68%), Gaps = 7/281 (2%)
 Frame = +2

Query  296   SVEALKPSDT--FPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKF  466
             S +   P+ T  F  RH   T  +   M +  G P+LD LID TVPQ+IRL   +K P  
Sbjct  10    STQQPTPASTGGFVNRHIGPTAAEVQLMLDVLGSPTLDRLIDKTVPQAIRLKQPLKLPA-  68

Query  467   DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAE  646
                  E   I  +K +ASKN+VF+S+IGMGYY+   PPVI RNI+ENPGWYT YTPYQAE
Sbjct  69    --ATREYAAIAQLKEIASKNQVFRSFIGMGYYDCITPPVIQRNILENPGWYTAYTPYQAE  126

Query  647   ISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNC  826
             I+QGRLE+LLNFQTMI DLTGL ++NASLLDEGTAA+EAM M   I K K K F ++ +C
Sbjct  127   IAQGRLEALLNFQTMIIDLTGLEIANASLLDEGTAASEAMTMTYGISKNKAKAFFVSKDC  186

Query  827   HPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHA  1006
             HPQTI++ +TRA      ++  D +  ++   ++ G L+QYP T+G + DY  FI+ AH 
Sbjct  187   HPQTIEVVQTRAQPLGFDIIIGDHQTFEFDK-EIFGALLQYPATDGIIYDYKNFIEQAHN  245

Query  1007  HGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              G  V +A+D+L+L +LKPPGE GADI VGS QRFGVPMGY
Sbjct  246   RGALVTVAADILSLCLLKPPGEFGADIAVGSTQRFGVPMGY  286



>ref|XP_007270989.1| glycine dehydrogenase [Fomitiporia mediterranea MF3/22]
 gb|EJC98691.1| glycine dehydrogenase [Fomitiporia mediterranea MF3/22]
Length=1010

 Score =   307 bits (787),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/295 (52%), Positives = 195/295 (66%), Gaps = 4/295 (1%)
 Frame = +2

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             AG P+    R        KP DTF  RH      +Q  M    GF S+DA +DA+VP SI
Sbjct  27    AGGPSPSPSRTRAQGSLFKPLDTFTERHIGPNESEQKMMLGALGFESMDAFVDASVPPSI  86

Query  437   RLDSMKFPK-FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
             RL +        H  +E++++   ++LA KNK FKSYIGMGY+N  VPPVILRNI+ENP 
Sbjct  87    RLPAGTMDDAVIHSFSESELLRRARDLAKKNKPFKSYIGMGYHNAVVPPVILRNIIENPA  146

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYT YTPYQ EI+QGRLESL+NFQTM+  LT + ++NASLLDEGTAAAE M M       
Sbjct  147   WYTPYTPYQPEIAQGRLESLVNFQTMVMSLTAMHVANASLLDEGTAAAEGMTMSYAASNM  206

Query  794   KKKTFIIASNCHPQTIDICKTRADGFELKVVTAD---LKDIDYKSGDVCGVLVQYPGTEG  964
             K+KTF++ S   PQTI + +TRA GF +K+V  D   L + +    D+CGVL+QYP  +G
Sbjct  207   KRKTFVVHSGVLPQTISVLQTRAKGFGIKLVIGDIFKLVEDEAVRSDLCGVLIQYPDVDG  266

Query  965   EVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              V D+   + + HA    V+ A+DLLALTMLKPPGE GAD+V+G++ RFGVPMGY
Sbjct  267   RVTDFSGLVSSVHAANGLVICATDLLALTMLKPPGEWGADVVLGNSARFGVPMGY  321



>ref|XP_004991539.1| glycine decarboxylase multi-enzyme complex P subunit [Salpingoeca 
rosetta]
 gb|EGD76625.1| glycine decarboxylase multi-enzyme complex P subunit [Salpingoeca 
rosetta]
Length=982

 Score =   306 bits (785),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/284 (53%), Positives = 192/284 (68%), Gaps = 4/284 (1%)
 Frame = +2

Query  281   QRRSISV-EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  457
             Q R + V + ++P D F  RH    P +   M   C F  LD +I   VP+ IRL   + 
Sbjct  23    QTRHLRVPDWVEPCDKFLFRHIGPDPAEIQTMLRTCSFEDLDDMIAKAVPEDIRL--RRT  80

Query  458   PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  637
             P  D  LTE++++E +K L S+N+VF+SYIGMGYY T  P  I RN++ENPGWYT YTPY
Sbjct  81    PHLDEPLTESEVLERLKQLGSRNQVFRSYIGMGYYGTLTPTAIKRNVLENPGWYTPYTPY  140

Query  638   QAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIA  817
             QAEI+QGR+ESLLNFQTMI DLT LP++NASLLDE TA AEA++MC +    K+K F++ 
Sbjct  141   QAEIAQGRMESLLNFQTMIQDLTSLPIANASLLDEATAGAEALSMCFSAHNHKRKMFLLD  200

Query  818   SNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKN  997
             S CHPQT  +  TRA     KV+    ++ ++ S DVCG LVQYP T GE+ +  E +  
Sbjct  201   SRCHPQTEALVYTRAKYIGAKVIKQSWENFEFTS-DVCGCLVQYPDTHGEIHNIDELVAK  259

Query  998   AHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             AH  G  V  A+DLLALT+++ PGE GADI VGSAQRFGVP+GY
Sbjct  260   AHDAGALVACATDLLALTVMRSPGEFGADIAVGSAQRFGVPLGY  303



>ref|WP_044223259.1| glycine dehydrogenase [Flammeovirga pacifica]
Length=966

 Score =   306 bits (785),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 191/275 (69%), Gaps = 8/275 (3%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMI  496
             + F  RHN+       +M    G   +D LI  TVP+ IRL+  ++ P+    LTE Q +
Sbjct  9     ERFEARHNAPNHTQIEEMLAALGVSDIDELIAQTVPEKIRLEKPLELPQ---PLTEYQFL  65

Query  497   EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLL  676
                K +A KNK+++SYIGMGYYNT  PPVILRNIMENPGWYT YTPYQAEI+QGRLE LL
Sbjct  66    RQFKTIAEKNKIYRSYIGMGYYNTITPPVILRNIMENPGWYTAYTPYQAEIAQGRLEMLL  125

Query  677   NFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKK----TFIIASNCHPQTID  844
             NFQTM+TDLTG+ ++NASLLDE TAA E + M +   KG KK     F  A++CHPQT+D
Sbjct  126   NFQTMVTDLTGMELANASLLDEATAAGEVVHMFHGARKGAKKKQANKFFAANSCHPQTLD  185

Query  845   ICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVV  1024
             + KTR     +++V  D+ ++D     + GVLVQYP T G + DY +FI  AH +GV V 
Sbjct  186   LIKTRCTPIGVELVIGDVAELDITDPTLFGVLVQYPDTNGAISDYTDFIAAAHDNGVLVA  245

Query  1025  MASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             MASDLLALT+LK PG++ AD VVGSAQRFGVPMGY
Sbjct  246   MASDLLALTLLKEPGKMDADAVVGSAQRFGVPMGY  280



>ref|WP_009360452.1| glycine dehydrogenase [alpha proteobacterium HIMB114]
 gb|EMH80367.1| glycine dehydrogenase, decarboxylating [alpha proteobacterium 
HIMB114]
Length=953

 Score =   306 bits (784),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 188/268 (70%), Gaps = 2/268 (1%)
 Frame = +2

Query  326   FPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHM  505
             F RRH   +  DQ+KM  + GF SLD  I   VP+ I  +S      D  ++E   ++ +
Sbjct  9     FIRRHIGPSSSDQNKMLSYLGFNSLDEFIKKIVPEKILENSAL--NIDSPISENAALQQL  66

Query  506   KNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNFQ  685
             K +AS+NK+FKS+IGMGYY T+ P VILRN++ENPGWYT YTPYQ E++QGRLE LLNFQ
Sbjct  67    KQIASQNKIFKSFIGMGYYGTYTPNVILRNLLENPGWYTSYTPYQPEVAQGRLEMLLNFQ  126

Query  686   TMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRAD  865
              M+TDLTG+ ++NASLLDEGTAAAEA+A+C  I K K     I+ NC+PQTID+ KTRA+
Sbjct  127   QMVTDLTGMDIANASLLDEGTAAAEAVALCQRIDKSKLHKIFISKNCNPQTIDVVKTRAE  186

Query  866   GFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLLA  1045
              F L+V+  D  +I    GD+   + QYP T GE+     FIK       K ++ +DLLA
Sbjct  187   PFNLEVIIGDDDNIGKIEGDLLCSIYQYPNTYGEINGAENFIKKTQDKNGKAILVTDLLA  246

Query  1046  LTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LT+LKPPGE+GADIVVG++QRFGVPMGY
Sbjct  247   LTLLKPPGEMGADIVVGNSQRFGVPMGY  274



>ref|WP_039713483.1| glycine dehydrogenase [Scytonema millei]
 gb|KIF22216.1| glycine dehydrogenase [Scytonema millei VB511283]
Length=992

 Score =   306 bits (785),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 195/284 (69%), Gaps = 7/284 (2%)
 Frame = +2

Query  278   QQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  457
             +Q++ IS E++    +F +RH    P +  +M E  G P+LDALID TVPQ+IR    + 
Sbjct  12    RQQKQISSESI----SFRQRHIGPQPIEVEQMLEVLGLPTLDALIDRTVPQAIR--QQRS  65

Query  458   PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  637
              + +   +E   +  +K +ASKN+VF+S IGMGYY    PPVI RNI+ENPGWYT YTPY
Sbjct  66    LQLEGDRSEYAALAQLKAIASKNQVFRSLIGMGYYGCITPPVIQRNILENPGWYTAYTPY  125

Query  638   QAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIA  817
             Q EI+QGRLE+LLNFQT I DLTGL ++NASLLDEGTAAAEAM M   + K K K F ++
Sbjct  126   QPEIAQGRLEALLNFQTTIIDLTGLEIANASLLDEGTAAAEAMTMSYGLCKTKAKAFFVS  185

Query  818   SNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKN  997
              NCHPQTI + +TRA    + V+  D +   +    V GVL+QYP ++G + DY  F++ 
Sbjct  186   QNCHPQTIQVVQTRARPLGINVIVGDHQTFKFDV-PVFGVLLQYPASDGTIYDYRAFVEQ  244

Query  998   AHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             AHA G  V +A+D L+LT+L PPGE GADI VGS QRFGVPMGY
Sbjct  245   AHAAGALVTVAADPLSLTLLTPPGEWGADIAVGSTQRFGVPMGY  288



>ref|WP_036029761.1| glycine dehydrogenase, partial [Leptolyngbya sp. PCC 6406]
Length=968

 Score =   305 bits (782),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 194/271 (72%), Gaps = 4/271 (1%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIE  499
             D F  RH   +PED   M    G+ SL AL+DA +P  IRL   +      GL E   ++
Sbjct  1     DAFADRHIGPSPEDIQAMVATLGYDSLGALMDAIIPAGIRLG--RSLALAEGLGEQAALK  58

Query  500   HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLN  679
              +  +A +N+V++SY+G+GY+NT  PPVI RN++ENPGWYTQYTPYQ EI+QGRLE+LLN
Sbjct  59    SLGAIADQNQVWRSYLGLGYHNTITPPVIQRNVLENPGWYTQYTPYQPEIAQGRLEALLN  118

Query  680   FQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQTIDICKT  856
             FQT++TDLTGL ++NASLLDEGTAAAEAM +  N  K K  KTF +++ CHPQT+++ KT
Sbjct  119   FQTLVTDLTGLEIANASLLDEGTAAAEAMTLSFNARKQKGVKTFWVSAACHPQTLEVVKT  178

Query  857   RADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASD  1036
             RA    ++V+  D ++ D+++  + G L+QYP T+G V DY EF+  AHA    V +A+D
Sbjct  179   RALPLGIEVIVGDHREFDFQT-PIFGTLLQYPATDGAVYDYSEFVTQAHAAKALVTVAAD  237

Query  1037  LLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             LL+LT+LKPPGE GADI VGS QRFGVP+GY
Sbjct  238   LLSLTLLKPPGEFGADIAVGSTQRFGVPLGY  268



>gb|ESA20942.1| hypothetical protein GLOINDRAFT_343379 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX62240.1| glycine decarboxylase subunit P [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX62241.1| glycine decarboxylase subunit P [Rhizophagus irregularis DAOM 
197198w]
Length=1019

 Score =   306 bits (784),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 162/296 (55%), Positives = 209/296 (71%), Gaps = 7/296 (2%)
 Frame = +2

Query  257   AGFPASHQQRRS--ISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  430
             + FP S ++  S  +  +A  P DTFPRRHN  +  +   M E      ++ L+  TVP 
Sbjct  48    SNFPKSFRKFSSTPLKYDAFSPLDTFPRRHNGPSDTEIKAMLETIDVKDMEELVLKTVPA  107

Query  431   SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  610
             +IR  S      + GLTE++++E +K +ASKNKV+KSYIGMGY NT VP VILRNI+E+P
Sbjct  108   NIR--SKDALALEEGLTESELMERLKRIASKNKVYKSYIGMGYANTIVPSVILRNILESP  165

Query  611   GWYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFK  790
             GWYTQYTPYQ EISQGRLESLLNFQTM+TDLTG+ ++NASLLDEGTAAAEAM +  +  K
Sbjct  166   GWYTQYTPYQPEISQGRLESLLNFQTMVTDLTGMDLANASLLDEGTAAAEAMLISFSARK  225

Query  791   GKKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKS---GDVCGVLVQYPGTE  961
              K KTF +   CHPQTI   +TR++GF + V+  D    D+++    D+ GVLVQYP T+
Sbjct  226   QKCKTFFVDERCHPQTIACLQTRSEGFGINVIVGDALKYDFENKHKNDLAGVLVQYPATD  285

Query  962   GEVLDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             G + DY +F    H+ G +VV A+DLLALT+L PPGE GADI VG++QRFGVP+GY
Sbjct  286   GNIYDYSDFSARIHSLGGQVVCATDLLALTLLIPPGEWGADIAVGNSQRFGVPLGY  341



>gb|KIE11464.1| glycine dehydrogenase [Tolypothrix bouteillei VB521301]
Length=982

 Score =   305 bits (782),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 191/270 (71%), Gaps = 5/270 (2%)
 Frame = +2

Query  323   TFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMIE  499
             +F  RH   +  D  +M +  G+ SLD LID TVPQ IRL   +K P      TE   ++
Sbjct  23    SFQARHIGPSSNDIQQMLKVLGYSSLDELIDKTVPQGIRLSRPLKLPDVK---TEYAALD  79

Query  500   HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLN  679
              +K +ASKN+VF+S+IG GYY+   PPVI RNI+ENPGWYT YTPYQ EI+QGRLE+LLN
Sbjct  80    TLKEIASKNQVFRSFIGTGYYDCITPPVIQRNILENPGWYTAYTPYQPEIAQGRLEALLN  139

Query  680   FQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTR  859
             FQTMI DLTGL ++NASLLDE TAAAEAM+M   + K K  ++ ++ +CHPQTID+ +TR
Sbjct  140   FQTMIIDLTGLEIANASLLDEATAAAEAMSMSYGVCKSKANSYFVSQDCHPQTIDVLQTR  199

Query  860   ADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDL  1039
             A+   +K++  D +  D+ S  + G ++QYP T+G + DY  F++ AHA G  V +A+D 
Sbjct  200   ANPLGIKIIVGDHQSFDF-SEPIFGAILQYPATDGTIYDYRAFVEKAHAEGALVTVAADP  258

Query  1040  LALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             L+LT+L PPGE GADI +GS QRFG+P+GY
Sbjct  259   LSLTLLTPPGEFGADIAIGSTQRFGIPLGY  288



>ref|WP_019497275.1| glycine dehydrogenase [Calothrix sp. PCC 7103]
Length=959

 Score =   305 bits (781),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 191/275 (69%), Gaps = 11/275 (4%)
 Frame = +2

Query  317   SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQ--  490
             S+ F  RH   +      M E  GF SLD LID +VPQ+I+L      K +  L+EA+  
Sbjct  21    SNNFQVRHIGPSDVQVRHMLEVMGFSSLDELIDKSVPQAIQL------KRELNLSEAKSE  74

Query  491   --MIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRL  664
                +  +K +A +N+V++SYIGMGYYN   PPVILRNI+ENPGWYT YTPYQ EISQGRL
Sbjct  75    YAALAQLKEIALQNQVYRSYIGMGYYNCITPPVILRNILENPGWYTAYTPYQPEISQGRL  134

Query  665   ESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTID  844
             E+LLNFQTMI DLTGL ++NASLLDEGTAAAEAM M   I K K  TF ++ +CHPQTID
Sbjct  135   EALLNFQTMIIDLTGLEIANASLLDEGTAAAEAMTMSYGICKNKANTFFVSQDCHPQTID  194

Query  845   ICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVV  1024
             + +TRA    +++V  D +  D++   + G ++QYP T+G + DY  F + AH  G  V 
Sbjct  195   VLQTRARPLGIEIVIGDHRTFDFEQA-IFGAVLQYPATDGTIYDYSTFCQQAHQKGALVT  253

Query  1025  MASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +A+D+++L +L PPGE GADIVVGS QRFGVP+GY
Sbjct  254   VAADIMSLCLLTPPGEFGADIVVGSTQRFGVPLGY  288



>ref|WP_026736448.1| glycine dehydrogenase [Fischerella sp. PCC 9605]
Length=973

 Score =   305 bits (781),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 193/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGL  478
             E+ + S  F  RH     +D  +M    G  SLDALID TVPQSIRL   +K P+    L
Sbjct  18    ESTQKSSNFKERHIGPNADDIQQMLAVLGISSLDALIDQTVPQSIRLSRPLKLPE---AL  74

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K +A KN+VF+S+IGMGYY+T  P VI RNI+ENPGWYT YTPYQ EI+QG
Sbjct  75    SEYAALTKLKEIALKNQVFRSFIGMGYYDTITPAVIQRNILENPGWYTAYTPYQPEIAQG  134

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQTM+ DLTGL ++NASLLDE TAAAEAM+M   + K K  TF ++++CHPQT
Sbjct  135   RLEALLNFQTMMIDLTGLEIANASLLDEATAAAEAMSMSYGVCKNKANTFFVSNDCHPQT  194

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             ID+ +TRA    + ++  D +  D+    + G ++QYP ++G + DY  F++ AHA G  
Sbjct  195   IDVLQTRAKPLGIHIIVGDRQTFDFAE-PIFGAILQYPASDGTIYDYRAFVEKAHAVGAL  253

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D L+LT+L PPGE GADI VGS QRFG+P+GY
Sbjct  254   VTVAADPLSLTLLTPPGEFGADIAVGSTQRFGIPLGY  290



>ref|WP_017309685.1| glycine dehydrogenase [Fischerella sp. PCC 9339]
Length=980

 Score =   305 bits (781),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/277 (52%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             E+ + S  F +RH     +D  +M +  G  S+DALI+ TVPQSIRL  ++  P+    L
Sbjct  18    ESTEKSSDFKQRHIGPNADDMQQMLDLLGVSSVDALINQTVPQSIRLSRALNLPE---AL  74

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K++A KN++F+S+IGMGYY+T  P VI RNI+ENPGWYT YTPYQ EI+QG
Sbjct  75    SEYAAVAKLKDIALKNQIFRSFIGMGYYDTITPAVIQRNILENPGWYTAYTPYQPEIAQG  134

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQTMI DLTGL ++NASLLDE TA AEAM M   I K K   F ++ +CHPQT
Sbjct  135   RLEALLNFQTMIIDLTGLEIANASLLDEATAVAEAMTMSYGICKNKANAFFVSQDCHPQT  194

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             ID+ +TRA    +K++  D +  D+ S  + G ++QYP ++G V DY  F++ AHA G  
Sbjct  195   IDVLQTRARPLGIKIIIGDHQSFDF-SESIFGAVLQYPASDGTVYDYRAFVEKAHAVGAL  253

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D L+LT+L PPGE GADI +GS QRFG+P+GY
Sbjct  254   VTVAADPLSLTLLTPPGEFGADIAIGSTQRFGIPLGY  290



>ref|WP_008273963.1| glycine dehydrogenase [Cyanothece sp. CCY0110]
 gb|EAZ92819.1| glycine dehydrogenase [Cyanothece sp. CCY0110]
Length=985

 Score =   305 bits (781),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 198/276 (72%), Gaps = 6/276 (2%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  484
             L P+D F  RH     ++  KM +  GF +LD L+DA VP++IRL   +  P+     +E
Sbjct  25    LSPTDRFSDRHIGPNSQEVDKMLKVLGFSTLDQLMDAAVPKAIRLSKPLNLPE---AQSE  81

Query  485   AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRL  664
                +  +K++ASKN++F+SYIGMGYY+   PPVI RNI+ENPGWYT YTPYQAEI+QGRL
Sbjct  82    YAALAQLKSIASKNQIFRSYIGMGYYDCITPPVIQRNILENPGWYTAYTPYQAEIAQGRL  141

Query  665   ESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQTI  841
             E+LLN+QTMI +LTGL ++NASLLDEGTAAAEAM+M   + K KK   F + S+CHPQTI
Sbjct  142   EALLNYQTMIVELTGLEIANASLLDEGTAAAEAMSMSYGLCKNKKANAFFVDSHCHPQTI  201

Query  842   DICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
             ++ KTRA   +++++ AD +  D+ + ++ G L+QYP T+G + DY  FI+ AH  G  V
Sbjct  202   EVIKTRAYPLDIELIIADHRFFDFDT-EIFGALLQYPATDGSLYDYRTFIETAHDQGAVV  260

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+D L+L +L PPGE GADI VGS QRFGVP+GY
Sbjct  261   TVAADPLSLALLTPPGEFGADIAVGSTQRFGVPLGY  296



>ref|WP_033335677.1| glycine dehydrogenase [Scytonema hofmanni]
Length=983

 Score =   305 bits (780),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 192/270 (71%), Gaps = 5/270 (2%)
 Frame = +2

Query  323   TFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMIE  499
             +F  RH   +  D  +M E  G+ SLD LI+ TVPQ IRL   +K P+     TE   + 
Sbjct  23    SFQARHIGPSSNDIQQMLEVLGYTSLDELINKTVPQGIRLSRPLKLPEAQ---TEYAALV  79

Query  500   HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLN  679
              +K +ASKN+VF+S+IG GYY+   PPVI RNI+ENPGWYT YTPYQ EI+QGRLE+LLN
Sbjct  80    TLKEIASKNQVFRSFIGTGYYDCITPPVIQRNILENPGWYTAYTPYQPEIAQGRLEALLN  139

Query  680   FQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTR  859
             FQTMI DLTGL ++NASLLDE TAAAEAM+M   + K K  ++ ++ +CHPQTID+ +TR
Sbjct  140   FQTMIIDLTGLEIANASLLDEATAAAEAMSMSYGVCKSKANSYFVSQDCHPQTIDVLQTR  199

Query  860   ADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDL  1039
             A+   +K+V  D +  D+ S  + G ++QYP T+G++ DY  F++ AHA G  V +A+D 
Sbjct  200   ANPLGIKIVVGDHQTFDF-SEPIFGAILQYPATDGKIYDYRAFVEKAHAEGALVTVAADP  258

Query  1040  LALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             L+LT+L PPGE GADI +GS QRFG+P+GY
Sbjct  259   LSLTLLTPPGEFGADIAIGSTQRFGIPLGY  288



>ref|WP_012627655.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
 gb|ACL44578.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
Length=996

 Score =   305 bits (780),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 199/278 (72%), Gaps = 5/278 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGL  478
             E     D F +RH    P D  +M E  G  SLD LID TVP  IRLD  +  P+   G 
Sbjct  38    EMFSHPDRFAQRHIGPPPHDVQQMVEDLGLDSLDELIDQTVPAPIRLDRPLDLPE---GR  94

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E++ +E +K +A +N++F+S+IGMGYY  F PPVI RNI+ENPGWYTQYTPYQAEI+QG
Sbjct  95    SESEALEMLKTIARQNQIFRSFIGMGYYGCFTPPVIQRNILENPGWYTQYTPYQAEIAQG  154

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQ  835
             RLE+LLNFQTM++DLTGLP++NASLLDEGTAAAEAM M  N+ K    KTF++A NCHPQ
Sbjct  155   RLEALLNFQTMVSDLTGLPVANASLLDEGTAAAEAMTMSYNLQKNTSAKTFLVAENCHPQ  214

Query  836   TIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGV  1015
             TI++ +TRA    L+VV AD    D+ +    GVL+QYP T+G + DY   +  AH +G 
Sbjct  215   TIEVVQTRALPLGLEVVVADPHSYDFANRATFGVLLQYPATDGRIQDYRAVVDRAHQNGA  274

Query  1016  KVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              V +A+DLLALT+L PP E GADI +GS+QRFGVP+GY
Sbjct  275   LVTVATDLLALTLLTPPAEWGADIAIGSSQRFGVPLGY  312



>ref|WP_006670601.1| glycine dehydrogenase [Arthrospira maxima]
 gb|EDZ92219.1| glycine dehydrogenase [Arthrospira maxima CS-328]
Length=979

 Score =   304 bits (779),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 192/273 (70%), Gaps = 5/273 (2%)
 Frame = +2

Query  314   PSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQ  490
             P+D F  RH      +  +M    G+ S+++LID T+PQ IRL+  +  P     LTE Q
Sbjct  32    PADQFLNRHIGPNDAEIQQMLSAIGYNSIESLIDNTIPQGIRLNRPLNLPT---PLTEHQ  88

Query  491   MIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLES  670
              +  ++ +ASKN++++S+IGMGY +   PPVI RNI+ENPGWYT YTPYQAEI+QGRLE+
Sbjct  89    ALVKLREIASKNQIYRSFIGMGYSDCITPPVIQRNILENPGWYTAYTPYQAEIAQGRLEA  148

Query  671   LLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDIC  850
             LLNFQT++ DLTGL ++NASLLDEGTAAAEAM M   I K K   F ++ +CHPQTI++ 
Sbjct  149   LLNFQTLVIDLTGLEIANASLLDEGTAAAEAMTMSYGISKAKAHHFFVSQDCHPQTIEVL  208

Query  851   KTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMA  1030
             +TRA    ++++  D +  D+ S  + G L+QYP T G + DY EFI+ AH H   + MA
Sbjct  209   QTRAKPLGIEIIIGDFRTFDF-SDPIFGALLQYPATNGAIYDYREFIQTAHNHKAIITMA  267

Query  1031  SDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +D+L+LT+L PPGELGADI VGS QR GVP+GY
Sbjct  268   ADILSLTLLTPPGELGADIAVGSTQRLGVPLGY  300



>emb|CCE19870.1| Glycine dehydrogenase (decarboxylating) [Arthrospira sp. PCC 
8005]
 emb|CDM98358.1| Glycine dehydrogenase [decarboxylating] [Arthrospira sp. PCC 
8005]
Length=979

 Score =   304 bits (779),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 192/273 (70%), Gaps = 5/273 (2%)
 Frame = +2

Query  314   PSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQ  490
             P+D F  RH      +  +M    G+ S+++LID T+PQ IRL+  +  P     LTE Q
Sbjct  32    PADQFLNRHIGPNDAEIQQMLSAIGYNSIESLIDNTIPQGIRLNRPLNLPT---PLTEHQ  88

Query  491   MIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLES  670
              +  ++ +ASKN++++S+IGMGY +   PPVI RNI+ENPGWYT YTPYQAEI+QGRLE+
Sbjct  89    ALVKLREIASKNQIYRSFIGMGYSDCITPPVIQRNILENPGWYTAYTPYQAEIAQGRLEA  148

Query  671   LLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDIC  850
             LLNFQT++ DLTGL ++NASLLDEGTAAAEAM M   I K K   F ++ +CHPQTI++ 
Sbjct  149   LLNFQTLVIDLTGLEIANASLLDEGTAAAEAMTMSYGISKAKAHHFFVSQDCHPQTIEVL  208

Query  851   KTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMA  1030
             +TRA    ++++  D +  D+ S  + G L+QYP T G + DY EFI+ AH H   + MA
Sbjct  209   QTRAKPLGIEIIIGDFRTFDF-SDPIFGALLQYPATNGAIYDYREFIQTAHNHKAIITMA  267

Query  1031  SDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +D+L+LT+L PPGELGADI VGS QR GVP+GY
Sbjct  268   ADILSLTLLTPPGELGADIAVGSTQRLGVPLGY  300



>ref|WP_006622636.1| glycine dehydrogenase [Arthrospira platensis]
 gb|EKD08666.1| glycine dehydrogenase [Arthrospira platensis C1]
Length=979

 Score =   304 bits (779),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 192/273 (70%), Gaps = 5/273 (2%)
 Frame = +2

Query  314   PSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQ  490
             P+D F  RH      +  +M    G+ S+++LID T+PQ IRL+  +  P     LTE Q
Sbjct  32    PADQFLNRHIGPNDAEIQQMLSAIGYNSIESLIDNTIPQGIRLNRPLNLPT---PLTEHQ  88

Query  491   MIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLES  670
              +  ++ +ASKN++++S+IGMGY +   PPVI RNI+ENPGWYT YTPYQAEI+QGRLE+
Sbjct  89    ALVKLREIASKNQIYRSFIGMGYSDCITPPVIQRNILENPGWYTAYTPYQAEIAQGRLEA  148

Query  671   LLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDIC  850
             LLNFQT++ DLTGL ++NASLLDEGTAAAEAM M   I K K   F ++ +CHPQTI++ 
Sbjct  149   LLNFQTLVIDLTGLEIANASLLDEGTAAAEAMTMSYGISKAKAHHFFVSQDCHPQTIEVL  208

Query  851   KTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMA  1030
             +TRA    ++++  D +  D+ S  + G L+QYP T G + DY EFI+ AH H   + MA
Sbjct  209   QTRAKPLGIEIIIGDFRTFDF-SDPIFGALLQYPATNGAIYDYREFIQTAHNHKAIITMA  267

Query  1031  SDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +D+L+LT+L PPGELGADI VGS QR GVP+GY
Sbjct  268   ADILSLTLLTPPGELGADIAVGSTQRLGVPLGY  300



>ref|WP_028946840.1| glycine dehydrogenase [Synechocystis sp. PCC 6714]
 gb|AIE72693.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Synechocystis sp. PCC 6714]
Length=984

 Score =   304 bits (779),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/277 (57%), Positives = 199/277 (72%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGL  478
             E L P++ F  RH      +Q +M +  GF SL  LID  VPQ+IRL  S+K P      
Sbjct  27    EKLAPAEAFVDRHLGPGEGEQQQMLQELGFQSLGELIDQAVPQAIRLHGSLKLPSPQ---  83

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
              E   I  +K++ASKN+VF+SYIGMGYY+T  PPVI RNI+ENPGWYT YTPYQAEI+QG
Sbjct  84    GEYGAIAQLKSIASKNQVFRSYIGMGYYDTITPPVIQRNILENPGWYTAYTPYQAEIAQG  143

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQTM+ DLTGL ++NASLLDEGTAAAEAMA+   + K K   F +A +CHPQT
Sbjct  144   RLEALLNFQTMVMDLTGLEIANASLLDEGTAAAEAMALSYGVSKSKANAFFVAQDCHPQT  203

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA+   ++V+  + +  D+ S  + G L+QYP T+GEV DY  FI  AHAH   
Sbjct  204   IEVIKTRANPLGIEVIVGNHQSFDF-STPIFGALLQYPATDGEVYDYRSFINQAHAHQAL  262

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+DLL+LT+L PPGELGADI VGS QRFG+P+GY
Sbjct  263   VTLAADLLSLTLLTPPGELGADIAVGSTQRFGIPLGY  299



>ref|XP_008527904.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Equus przewalskii]
Length=420

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 192/279 (69%), Gaps = 7/279 (3%)
 Frame = +2

Query  299   VEALKPS-DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDH  472
             +E L P  D F RRH     +DQ +M +  G  S+D LI+ TVP SIRL   K P K + 
Sbjct  53    LERLLPRHDDFARRHVGPGDKDQREMLQALGLASVDDLIEKTVPASIRL---KRPLKMED  109

Query  473   GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEIS  652
              + E +++  ++ +ASKN++++SYIGMGYYN  VP  ILRN++ENPGW TQYTPYQ E+S
Sbjct  110   PVCENEILATLRAIASKNQIWRSYIGMGYYNCSVPQTILRNLLENPGWITQYTPYQPEVS  169

Query  653   QGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHP  832
             QGRLESLLN+QTM+ D+TGL  +NASLLDE TAAAEAM +C+     K++ F +   CHP
Sbjct  170   QGRLESLLNYQTMVCDITGLDTANASLLDEATAAAEAMQLCHR--HNKRRKFFVDPRCHP  227

Query  833   QTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHG  1012
             QTI + +TRA    + +     +++D+   DV GVL QYP TEG+V D+ E ++ AH  G
Sbjct  228   QTIAVVQTRAKYTGVLIELKLPQEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQTG  287

Query  1013  VKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
                  A+DLLAL +L+PPGE G DI +GS+QRFGVP+GY
Sbjct  288   SLACCATDLLALCILRPPGEFGVDIALGSSQRFGVPLGY  326



>ref|WP_045872920.1| glycine dehydrogenase [Tolypothrix sp. PCC 7601]
 gb|EKE99133.1| glycine dehydrogenase [Tolypothrix sp. PCC 7601]
Length=972

 Score =   304 bits (778),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 196/289 (68%), Gaps = 5/289 (2%)
 Frame = +2

Query  266   PASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD  445
             P      R I+ E  +  + F RRH     +D  +M    G PSLD LI+ TVPQ+IRL 
Sbjct  6     PVPKSSDRQIATEGKQDLNNFRRRHIGPNSDDIEQMLGVLGLPSLDVLINKTVPQAIRLQ  65

Query  446   -SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  622
              ++  P+     TE   +  +K +A KN+VF+S+IGMGYY+   P VI RNI+ENPGWYT
Sbjct  66    GALNLPE---AQTEYAALAKLKQIADKNQVFRSFIGMGYYDCITPAVIARNILENPGWYT  122

Query  623   QYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKK  802
              YTPYQ EI+QGRLE+LLNFQTMI DLTGL ++NASLLDE TAAAEAM++   + K K  
Sbjct  123   AYTPYQPEIAQGRLEALLNFQTMIIDLTGLEIANASLLDEATAAAEAMSLSYGVCKNKAN  182

Query  803   TFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYG  982
             T+ ++ +CHPQTID+ +TRA+   + ++  D +  D++   + G ++QYP ++G + DY 
Sbjct  183   TYFVSRDCHPQTIDVLQTRAEPLGINIIIGDHQTFDFEQ-PIFGAILQYPASDGTIYDYR  241

Query  983   EFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              FI+ AHA G  V +A+D L+LT+L PPGE GADI +GS QRFG+P+G+
Sbjct  242   AFIEKAHAKGALVTVAADPLSLTLLTPPGEFGADIAIGSTQRFGIPLGF  290



>ref|WP_035999593.1| glycine dehydrogenase [Leptolyngbya sp. JSC-1]
Length=1011

 Score =   304 bits (779),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 192/269 (71%), Gaps = 5/269 (2%)
 Frame = +2

Query  326   FPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEH  502
             F  RH    P D  +M    G+ SL+ALID  VP +IRL   K P +   G +E ++++ 
Sbjct  64    FQHRHIGPRPTDIQEMLALLGYDSLEALIDQAVPAAIRL---KQPLQIGEGRSEYELLQQ  120

Query  503   MKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLNF  682
             +K +A++N++++SYIGMGY N   P VI RNI+ENPGWYTQYTPYQ EI+QGRLE+LLNF
Sbjct  121   LKAIAAQNQIYRSYIGMGYANCITPAVIQRNILENPGWYTQYTPYQPEIAQGRLEALLNF  180

Query  683   QTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTRA  862
             QTM+ DLTG+ ++NASLLDEGTAAAEAM M   + KG  KTF +++ CHPQTID+ +TRA
Sbjct  181   QTMVMDLTGMEIANASLLDEGTAAAEAMTMSYGLTKGNAKTFWVSAACHPQTIDVVRTRA  240

Query  863   DGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDLL  1042
                 ++VV  D +  ++    V GVL+QYP T+G +  Y   ++ AH  G  V +A+DLL
Sbjct  241   IPLGIQVVVGDHRTAEFDD-SVFGVLLQYPATDGAIYAYEAVVEQAHHAGALVTVAADLL  299

Query  1043  ALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +LT+LKPPGE GADIVVG+ QRFGVP+GY
Sbjct  300   SLTLLKPPGEFGADIVVGNTQRFGVPLGY  328



>ref|WP_017304511.1| glycine dehydrogenase [Spirulina subsalsa]
Length=983

 Score =   304 bits (778),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/279 (53%), Positives = 191/279 (68%), Gaps = 4/279 (1%)
 Frame = +2

Query  296   SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDH  472
             + E     D F  RH      +   M E  G+ SLD LID  VP+ IR  S +  P    
Sbjct  25    TAETAHQGDRFVNRHIGIGGAEVETMLEVLGYTSLDQLIDDAVPRGIRFKSRLNLPAAQ-  83

Query  473   GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEIS  652
               TE + ++ +K +A++NK+ +S++GMGY +   PPVI RNI+ENPGWYT YTPYQAEI+
Sbjct  84    --TEYEALQSLKAIATQNKIARSFLGMGYSDCITPPVIQRNILENPGWYTAYTPYQAEIA  141

Query  653   QGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHP  832
             QGRLE+LLN+QTMI +LTGL ++NASLLDEGTAAAEAM M   + K K +TF +++ CHP
Sbjct  142   QGRLEALLNYQTMIIELTGLEIANASLLDEGTAAAEAMTMSYGLCKNKSQTFFVSNACHP  201

Query  833   QTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHG  1012
             QTID+  TRA+   L++V  D    D+    V GVL+QYP T+G + DY  FI+NAHA G
Sbjct  202   QTIDVVVTRAEPLGLEIVVGDHHTFDFSETPVFGVLLQYPATDGAIYDYRAFIENAHAIG  261

Query  1013  VKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
               V MA+D L+LT+L PPGELGADI VGS QRFGVP+G+
Sbjct  262   ALVTMAADPLSLTLLTPPGELGADIAVGSTQRFGVPLGF  300



>ref|WP_013030982.1| glycine dehydrogenase [Sideroxydans lithotrophicus]
 gb|ADE13086.1| glycine dehydrogenase [Sideroxydans lithotrophicus ES-1]
Length=949

 Score =   303 bits (776),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/277 (52%), Positives = 194/277 (70%), Gaps = 10/277 (4%)
 Frame = +2

Query  317   SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQM  493
             SD F  RHN  + +D   M +    PSLDALID TVP +IRL   +  P    G++E   
Sbjct  2     SDQFVNRHNGPSAQDVQAMLKKIDAPSLDALIDQTVPAAIRLRKPLNLPD---GMSEHAF  58

Query  494   IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESL  673
             ++H++ +A+KNK++KSYIG+GYY+T VPP I RN++ENPGWYT YTPYQAEI+QGRLE+L
Sbjct  59    LQHLRGIAAKNKLYKSYIGLGYYDTVVPPAIQRNVLENPGWYTAYTPYQAEIAQGRLEAL  118

Query  674   LNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNI-----FKGKKKTFIIASNCHPQT  838
             LNFQTMI DLTG+ ++NASLLDE TAAAEAM M + +         K +F +++ C PQT
Sbjct  119   LNFQTMIMDLTGMEIANASLLDEATAAAEAMHMLHGLRSREDAAAGKNSFFVSNECFPQT  178

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA    +++V  D K +      + G L+QYP  +G V DY +F+K A  HG+ 
Sbjct  179   IELLKTRAKPLGIELVIGDFKSVTLND-KLYGALLQYPTADGTVHDYADFVKRAKTHGMT  237

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             + +A+D+L+L +L PPGE GAD+V+GS QRFGVPMGY
Sbjct  238   IAVAADILSLVLLTPPGEWGADVVLGSTQRFGVPMGY  274



>ref|WP_009544701.1| MULTISPECIES: glycine dehydrogenase [Cyanothece]
 gb|ACB51957.1| glycine cleavage system protein P [Cyanothece sp. ATCC 51142]
Length=985

 Score =   303 bits (777),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 198/276 (72%), Gaps = 6/276 (2%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  484
             L P+D+F  RH     ++  KM +  GF +L+ LIDATVPQ IRL  S+  P+     +E
Sbjct  25    LAPTDSFINRHIGPNRQEIDKMLKMLGFSTLEQLIDATVPQGIRLSKSLNLPE---AQSE  81

Query  485   AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRL  664
                +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPYQAEI+QGRL
Sbjct  82    YGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPYQAEIAQGRL  141

Query  665   ESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQTI  841
             E+LLN+QTMI +LTGL ++NASLLDEGTAAAEAM+M   + K KK   F + S+CHPQTI
Sbjct  142   EALLNYQTMIVELTGLEIANASLLDEGTAAAEAMSMSYGLCKNKKANAFFVDSHCHPQTI  201

Query  842   DICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
             ++ +TRA    + ++ AD +  D+ + ++ G L+QYP T+G + DY  FI+ AH  G  V
Sbjct  202   EVIRTRAYPLGIDLIIADHRFFDFDT-EIFGALLQYPATDGTLYDYRTFIETAHNQGALV  260

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+D L+L +L PPGE GADI VGS QRFGVP+GY
Sbjct  261   TVAADPLSLALLTPPGEFGADIAVGSTQRFGVPLGY  296



>ref|XP_008334077.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Cynoglossus semilaevis]
Length=610

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/278 (52%), Positives = 191/278 (69%), Gaps = 5/278 (2%)
 Frame = +2

Query  299   VEALKPS-DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  475
             +E++ P  D F  RH      ++ +M +  GF S+D LID TVP SIRL      K D  
Sbjct  63    IESIFPRHDDFSERHIGPGEREKKEMLDLLGFKSIDQLIDKTVPSSIRLQGNM--KMDDP  120

Query  476   LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQ  655
             + E +++E ++ +ASKNK++KSYIGMGYYN  VPP I RN++EN GW TQYTPYQ E+SQ
Sbjct  121   VCENEVLETLQKIASKNKLWKSYIGMGYYNCSVPPPIQRNLLENSGWVTQYTPYQPEVSQ  180

Query  656   GRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQ  835
             GRLESLLN+QTMI D+TGLP++NASLLDEGTAAAEAM +C+   + K++TF I   CHPQ
Sbjct  181   GRLESLLNYQTMICDMTGLPVANASLLDEGTAAAEAMQLCHR--QNKRQTFYIDPRCHPQ  238

Query  836   TIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGV  1015
             TI + +TRA+   ++        +D+   +V GVL QYP T+G+V D+ E +  AH  G 
Sbjct  239   TIAVVQTRANYIGVQTELKLPHQMDFSGKNVSGVLFQYPDTDGKVEDFTELVDRAHKGGA  298

Query  1016  KVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
                 A+DLLAL  L+PPGE G D+ +GS+QRFGVP+ Y
Sbjct  299   LACCATDLLALCTLRPPGEFGVDVALGSSQRFGVPLCY  336



>ref|WP_044206069.1| glycine dehydrogenase [Coleofasciculus chthonoplastes]
Length=992

 Score =   303 bits (777),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 200/288 (69%), Gaps = 6/288 (2%)
 Frame = +2

Query  272   SHQQRRSISV-EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  448
             SH  + ++S  + L  +D+F RRH     ED ++M E  G+ SLD LID  VP  IRL+ 
Sbjct  18    SHDSQPTLSAADHLLSTDSFARRHIGVNAEDVAQMLEALGYSSLDELIDVAVPSIIRLNH  77

Query  449   -MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  625
              +  P      +E   + H++++ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT 
Sbjct  78    PLNLPP---AQSEKAALAHLRDIASKNQVFRSFIGMGYHDCITPPVIQRNILENPGWYTA  134

Query  626   YTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKT  805
             YTPYQAEI+QGRLE+LLNFQT+I +LTGL ++N+SLLDEGTAAAEAM+M   + + K   
Sbjct  135   YTPYQAEIAQGRLEALLNFQTLIIELTGLDIANSSLLDEGTAAAEAMSMSYGLCRTKANA  194

Query  806   FIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGE  985
             F ++ +CHPQTI + +TRA    ++++  D +  D +S  + G L+QYP T+G + DY E
Sbjct  195   FFVSQDCHPQTIQVVQTRAKPLGIEIIVGDHQTFDLES-PIFGALLQYPATDGTIYDYRE  253

Query  986   FIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             F+   H  G  V +A+D L+LT+L PPGE GADI VG+ QRFGVP+GY
Sbjct  254   FVTQVHEAGGLVTVAADPLSLTLLTPPGEFGADIAVGTTQRFGVPLGY  301



>gb|EDX77003.1| glycine dehydrogenase [Coleofasciculus chthonoplastes PCC 7420]
Length=997

 Score =   303 bits (777),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 200/288 (69%), Gaps = 6/288 (2%)
 Frame = +2

Query  272   SHQQRRSISV-EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  448
             SH  + ++S  + L  +D+F RRH     ED ++M E  G+ SLD LID  VP  IRL+ 
Sbjct  23    SHDSQPTLSAADHLLSTDSFARRHIGVNAEDVAQMLEALGYSSLDELIDVAVPSIIRLNH  82

Query  449   -MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  625
              +  P      +E   + H++++ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT 
Sbjct  83    PLNLPP---AQSEKAALAHLRDIASKNQVFRSFIGMGYHDCITPPVIQRNILENPGWYTA  139

Query  626   YTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKT  805
             YTPYQAEI+QGRLE+LLNFQT+I +LTGL ++N+SLLDEGTAAAEAM+M   + + K   
Sbjct  140   YTPYQAEIAQGRLEALLNFQTLIIELTGLDIANSSLLDEGTAAAEAMSMSYGLCRTKANA  199

Query  806   FIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGE  985
             F ++ +CHPQTI + +TRA    ++++  D +  D +S  + G L+QYP T+G + DY E
Sbjct  200   FFVSQDCHPQTIQVVQTRAKPLGIEIIVGDHQTFDLES-PIFGALLQYPATDGTIYDYRE  258

Query  986   FIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             F+   H  G  V +A+D L+LT+L PPGE GADI VG+ QRFGVP+GY
Sbjct  259   FVTQVHEAGGLVTVAADPLSLTLLTPPGEFGADIAVGTTQRFGVPLGY  306



>ref|WP_021833183.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii]
 emb|CCQ56429.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0005]
Length=800

 Score =   300 bits (767),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/284 (52%), Positives = 202/284 (71%), Gaps = 7/284 (2%)
 Frame = +2

Query  287   RSISVE-ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFP  460
             R+ ++E  L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ IRL  ++  P
Sbjct  17    RTYNIENTLAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGIRLSKTLILP  76

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
             +     +E   +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  77    E---AQSEYGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  133

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIA  817
             AEI+QGRL++LLN+QTMI +LTGL ++NASLLDEGTA AEAM+M   + K K    F + 
Sbjct  134   AEIAQGRLKALLNYQTMIVELTGLEIANASLLDEGTAVAEAMSMSYGLCKNKNANAFFVD  193

Query  818   SNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKN  997
              +CHPQTI++ KTRA    ++++ AD +  +++  ++ G L+QYP T+G + DY  FI++
Sbjct  194   CHCHPQTIEVIKTRAYPLGIELIIADHRFFEFEQ-EIFGALLQYPATDGTIYDYRTFIES  252

Query  998   AHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             AH  G  V +A+D L+L +L PPGE GADI VGS QRFGVP+GY
Sbjct  253   AHDKGALVTVAADPLSLALLTPPGEFGADIAVGSTQRFGVPLGY  296



>ref|WP_006619236.1| glycine dehydrogenase [Arthrospira platensis]
 dbj|BAI88198.1| glycine cleavage system P protein [Arthrospira platensis NIES-39]
 gb|KDR57354.1| glycine dehydrogenase [Arthrospira platensis str. Paraca]
Length=979

 Score =   303 bits (776),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 191/273 (70%), Gaps = 5/273 (2%)
 Frame = +2

Query  314   PSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQ  490
             P+D F  RH      +  +M     + S+++LID T+PQ IRL+  +  P     LTE Q
Sbjct  32    PADQFLNRHIGPNDAEIQQMLSAIAYNSIESLIDNTIPQGIRLNRPLNLPA---PLTEHQ  88

Query  491   MIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLES  670
              +  ++ +ASKN+V++S+IGMGY +   PP+I RNI+ENPGWYT YTPYQAEI+QGRLE+
Sbjct  89    ALVKLREIASKNQVYRSFIGMGYSDCITPPIIQRNILENPGWYTAYTPYQAEIAQGRLEA  148

Query  671   LLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDIC  850
             LLNFQT++ DLTGL ++NASLLDEGTAAAEAM M   I K K   F ++ +CHPQTID+ 
Sbjct  149   LLNFQTLVIDLTGLEIANASLLDEGTAAAEAMTMSYGISKAKAHHFFVSQDCHPQTIDVL  208

Query  851   KTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMA  1030
             +TRA    ++++  D +  D+ S  + G L+QYP T G + DY EFI+ AH H   + MA
Sbjct  209   ETRAKPLGIEIIIGDFRTFDF-SEPIFGALLQYPATNGAIYDYREFIQTAHNHKAIITMA  267

Query  1031  SDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +D+L+LT+L PPGELGADI VGS QR GVP+GY
Sbjct  268   ADILSLTLLTPPGELGADIAVGSTQRLGVPLGY  300



>ref|WP_010572852.1| glycine dehydrogenase [Leptospira kmetyi]
 gb|EQA52590.1| glycine dehydrogenase [Leptospira kmetyi serovar Malaysia str. 
Bejo-Iso9]
Length=964

 Score =   303 bits (775),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 201/287 (70%), Gaps = 6/287 (2%)
 Frame = +2

Query  275   HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SM  451
             +Q + ++    L P DTFPRRH    P    +M +  G  SL+ LID  VP  IRL  S+
Sbjct  7     NQTKSNLEKVGLDPLDTFPRRHIGPDPNQTGEMLKELGLSSLEELIDKAVPAGIRLKKSL  66

Query  452   KFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYT  631
               PK     TE ++++ +K +AS+N+VF+SYIG GY    VP VI RNI+ENPGWYT YT
Sbjct  67    DLPKAS---TEHKILQDLKLIASQNQVFRSYIGAGYNACIVPGVIQRNILENPGWYTAYT  123

Query  632   PYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTF  808
             PYQAEISQGRLE+LLNFQTMI DLTGL +SNASLLDEGTAAAEAM +  ++ K +  K F
Sbjct  124   PYQAEISQGRLEALLNFQTMIIDLTGLEISNASLLDEGTAAAEAMFLAYSVRKNETAKKF  183

Query  809   IIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEF  988
              ++  CHPQT+D+  TRA+   ++VV  + + ++    D  GVL+QYP T+G+V+DY  F
Sbjct  184   FVSELCHPQTVDVVVTRANPLGIEVVIGNHESLELNE-DFFGVLLQYPATDGKVIDYTSF  242

Query  989   IKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             I+ AH  G    +A+DLLALT+LK PGE+GADI VGS+QRFG+P+G+
Sbjct  243   IQRAHNVGAVSTVAADLLALTILKSPGEMGADIAVGSSQRFGLPLGF  289



>ref|WP_021830956.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii]
 emb|CCQ51788.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 8502]
Length=985

 Score =   303 bits (775),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 203/284 (71%), Gaps = 7/284 (2%)
 Frame = +2

Query  287   RSISVE-ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFP  460
             R+ ++E  L P+D+F  RH     +D  KM +  GF SLD LIDATVPQ IRL  ++  P
Sbjct  17    RTYNIENTLAPTDSFINRHIGPNSQDIDKMLKVLGFSSLDKLIDATVPQGIRLSKTLILP  76

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
             +     +E   +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPYQ
Sbjct  77    E---AQSEYGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPYQ  133

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIA  817
             AEI+QGRL++LLN+QTMI +LTGL ++NASLLDEGTAAAEAM+M   + K K    F + 
Sbjct  134   AEIAQGRLKALLNYQTMIVELTGLEIANASLLDEGTAAAEAMSMSYGLCKNKNANAFFVD  193

Query  818   SNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKN  997
              +CHPQTI++ KTRA    ++++ AD +  +++  ++ G L+QYP T+G + DY  FI++
Sbjct  194   CHCHPQTIEVIKTRAYPLGIELIIADHRFFEFEQ-EIFGALLQYPATDGTIYDYRTFIES  252

Query  998   AHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             AH  G  V +A+D L+L +L PPGE GADI VGS QRFGVP+GY
Sbjct  253   AHDKGALVTVAADPLSLALLTPPGEFGADIAVGSTQRFGVPLGY  296



>ref|WP_044034232.1| glycine dehydrogenase [Microcystis aeruginosa]
Length=981

 Score =   302 bits (774),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             + L  +D+F  RH   T  +  KM    G  +++ LI  TVP  IRL  S+  P     L
Sbjct  21    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATVEELIAQTVPSGIRLQKSLNLPP---AL  77

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QG
Sbjct  78    SEYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQG  137

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM M   + K K   F I+S+CHPQT
Sbjct  138   RLEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMTMSYGLCKTKANAFFISSSCHPQT  197

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA    + ++  D +  D+K+  + G L+QYP T+G + DY EFI  A  +G  
Sbjct  198   IEVVKTRAIPLGIDIIIEDHRLFDFKT-PIFGALLQYPATDGVIYDYREFISKAQENGAL  256

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  257   VTVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  293



>ref|XP_004343370.1| glycine dehydrogenase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE97008.1| glycine dehydrogenase [Capsaspora owczarzaki ATCC 30864]
Length=1029

 Score =   303 bits (776),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 192/275 (70%), Gaps = 3/275 (1%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPE-DQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTE  484
             L+P D+F RRH   T E D   M + C   SL+ LID T+P  IRL   +        +E
Sbjct  78    LEPLDSFERRHIGVTTESDVKTMLDACKVDSLEQLIDKTIPAGIRLH--RELAIGAAQSE  135

Query  485   AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRL  664
             + + + +K++AS+NK+F+SYIGMGYYNT  PPVI RN++ENPGWYTQYTPYQ E+SQGRL
Sbjct  136   STLHKTLKSIASENKIFRSYIGMGYYNTLTPPVIQRNVIENPGWYTQYTPYQPEVSQGRL  195

Query  665   ESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTID  844
             ESLLN+QT++ DLT LP  NASLLDE TAA EA+ M       KK  F+  +  +PQT+ 
Sbjct  196   ESLLNYQTLVADLTKLPFPNASLLDEATAAGEAITMAFVNSGSKKPRFVADAAINPQTLA  255

Query  845   ICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVV  1024
             + +TRA+  +++VVTAD+   D+ + DVCGVLVQYP   G+V DY    + AH  G  VV
Sbjct  256   LLRTRAEPHKIEVVTADVLKFDFSANDVCGVLVQYPTLSGDVHDYSALAERAHKAGALVV  315

Query  1025  MASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              A+DLLALT++K PGE GADI +G+AQRFGVP+GY
Sbjct  316   AATDLLALTVIKAPGEWGADIALGNAQRFGVPLGY  350



>ref|WP_029407226.1| glycine dehydrogenase [Thiomicrospira sp. Milos-T2]
Length=982

 Score =   302 bits (774),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 148/283 (52%), Positives = 192/283 (68%), Gaps = 3/283 (1%)
 Frame = +2

Query  281   QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP  460
             Q    S+  L+ S+ F  RH      +Q  M +  G  S+  LID  VP SIR    +  
Sbjct  8     QLAKASLNELEQSEAFVNRHLGPDNAEQIAMLKTLGMNSIAELIDQVVPASIR--RQQAM  65

Query  461   KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQ  640
                 GLTE Q +  +K++A KN+V KS+IGMGYYNT  PP I RNI+ENP WYT YTPYQ
Sbjct  66    DIAEGLTEHQSLNKLKSIAQKNQVLKSFIGMGYYNTLTPPTIQRNILENPAWYTAYTPYQ  125

Query  641   AEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIAS  820
             AEISQGRLE++LNFQTM++DLTGL ++NAS+LDE TA AE+M +C  + K K K F +A 
Sbjct  126   AEISQGRLEAMLNFQTMVSDLTGLELANASMLDEATACAESMTLCQRMSKAKGKVFFVAE  185

Query  821   NCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
             +CHPQ I + KTRA+   ++VV  +     ++  D+ GVL+QYPGT GEV D    I+N 
Sbjct  186   DCHPQNIAVVKTRAEPLGIEVVVGNPSK-GFEDYDLFGVLLQYPGTYGEVNDLTSLIENL  244

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             HA    V +++DLLALT+LKPPGE+GAD+VVG+ QRFGVP+GY
Sbjct  245   HAKKALVAVSADLLALTLLKPPGEMGADVVVGNTQRFGVPLGY  287



>ref|WP_006631620.1| glycine dehydrogenase [Microcoleus vaginatus]
 gb|EGK90642.1| Glycine dehydrogenase (decarboxylating) [Microcoleus vaginatus 
FGP-2]
Length=990

 Score =   302 bits (774),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/275 (52%), Positives = 191/275 (69%), Gaps = 5/275 (2%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  484
             L   D F  RH   TP +  +M E  G   LD LID TVP +IR+ + ++ P      +E
Sbjct  16    LSSIDGFAGRHIGPTPSEIQQMLEVLGLSGLDDLIDKTVPAAIRISAPLQLPA---AQSE  72

Query  485   AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRL  664
                +  +K +A+KN+VF+SYIG GY++   PPVI RNI+ENPGWYT YTPYQAEI+QGRL
Sbjct  73    YSALAELKEIAAKNQVFRSYIGTGYHDCITPPVIQRNILENPGWYTAYTPYQAEIAQGRL  132

Query  665   ESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTID  844
             E+LLNFQTMI DLTGL ++NASLLDEGTAAAEAMA+     K K K F ++ +CHPQTI+
Sbjct  133   EALLNFQTMIIDLTGLEIANASLLDEGTAAAEAMAVSYGASKNKAKAFFVSQDCHPQTIE  192

Query  845   ICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVV  1024
             + +TRA    ++++  D    ++    + G L+QYP T+G + DY +FI++AH  G  V 
Sbjct  193   VVQTRAKPLGIEIIVGDHHSFEFDR-TIFGALLQYPATDGAIYDYTDFIRSAHEVGALVT  251

Query  1025  MASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +A+D+L+L +LKPPGE GADI VGS QRFGVPMG+
Sbjct  252   VAADILSLCLLKPPGEFGADIAVGSTQRFGVPMGF  286



>ref|WP_004161677.1| glycine dehydrogenase [Microcystis aeruginosa]
 emb|CCI17523.1| Glycine cleavage system P-protein (glycine dehydrogenase) [Microcystis 
aeruginosa PCC 9807]
Length=981

 Score =   302 bits (773),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             + L  +D+F  RH   T  +  KM    G  +L+ LI  TVP  IRL  S+  P     L
Sbjct  21    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATLEELIAQTVPSGIRLQKSLNLPP---AL  77

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QG
Sbjct  78    SEYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQG  137

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM M   + K K   F I+S+CHPQT
Sbjct  138   RLEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMTMSYGLCKTKANAFFISSSCHPQT  197

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA    + ++  D +  D+++  + G L+QYP T+G + DY EFI  A  +G  
Sbjct  198   IEVVKTRAIPLGIDIIIEDHRLFDFQT-PIFGALLQYPATDGVIYDYREFISKAQENGAL  256

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  257   VTVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  293



>ref|WP_006527089.1| glycine dehydrogenase, decarboxylating [Gloeocapsa sp. PCC 73106]
 gb|ELS00090.1| glycine dehydrogenase, decarboxylating [Gloeocapsa sp. PCC 73106]
Length=973

 Score =   302 bits (773),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 190/270 (70%), Gaps = 5/270 (2%)
 Frame = +2

Query  323   TFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQMIE  499
             +F RRH    P+  ++M +  GF SL+ LID T+P  IRL+  +  P      +EA  + 
Sbjct  28    SFARRHIGPNPQAIAEMLKIIGFSSLEHLIDKTIPADIRLNHQLNLPP---AQSEAVALA  84

Query  500   HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLN  679
              +K +ASKN+VF+S+IG GYYN + P VI RNI+ENPGWYT YTPYQAEI+QGRLE+LLN
Sbjct  85    GLKEIASKNQVFRSFIGQGYYNCYTPAVIQRNILENPGWYTAYTPYQAEIAQGRLEALLN  144

Query  680   FQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTR  859
             FQTMI +LTGL ++NASLLDEGTAAAEAM+M   + K K   F ++  CHPQTI + KTR
Sbjct  145   FQTMIIELTGLEIANASLLDEGTAAAEAMSMSYGLSKSKANAFFVSQTCHPQTIAVLKTR  204

Query  860   ADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDL  1039
             A+   ++++  D +  D+    + G +VQYP ++G + DY EFIK AH     V +A+D 
Sbjct  205   ANPLGIEIIVGDHEKFDFDK-PIFGAIVQYPASDGSIYDYREFIKRAHEVKALVTVAADP  263

Query  1040  LALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             L+LT+L PPGELGADI VGS QRFGVP+GY
Sbjct  264   LSLTLLTPPGELGADIAVGSTQRFGVPLGY  293



>emb|CCI24204.1| Glycine cleavage system P-protein (glycine dehydrogenase) [Microcystis 
aeruginosa PCC 9808]
Length=995

 Score =   302 bits (773),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             + L  +D+F  RH   T  +  KM    G  +++ LI  TVP  IRL  S+  P     L
Sbjct  35    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATVEELIAQTVPSGIRLQKSLNLPP---AL  91

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QG
Sbjct  92    SEYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQG  151

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM M   + K K   F I+S+CHPQT
Sbjct  152   RLEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMTMSYGLCKTKANAFFISSSCHPQT  211

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA    + ++  D +  D+K+  + G L+QYP T+G + DY EFI  A  +G  
Sbjct  212   IEVVKTRAIPLGIDIIIEDHRLFDFKT-PIFGALLQYPATDGVIYDYREFISKAQENGAL  270

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  271   VTVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  307



>ref|WP_017289075.1| glycine dehydrogenase [Leptolyngbya boryana]
Length=974

 Score =   301 bits (772),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/289 (51%), Positives = 196/289 (68%), Gaps = 3/289 (1%)
 Frame = +2

Query  263   FPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL  442
             F +S     ++S   L  +D F  RH     E+   M    G  S+  LI+  VP+SIR+
Sbjct  20    FDSSEPSESTVSTPELTYTDRFVDRHIGVRGEEIRAMLAVLGLNSISDLIEQAVPKSIRI  79

Query  443   DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  622
                +  +   G +E ++++ +K +ASKN+V +S IGMGY N   PPVI RNI+ENPGWYT
Sbjct  80    Q--RPLQIRSGRSEYELLKELKAIASKNQVLRSLIGMGYSNCITPPVIQRNILENPGWYT  137

Query  623   QYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKK  802
             QYTPYQ EISQGRLE+LLNFQTMI DLTGL ++NASLLDEGTAAAEAM+M   I K K K
Sbjct  138   QYTPYQPEISQGRLEALLNFQTMIMDLTGLEIANASLLDEGTAAAEAMSMSYGIVKNKAK  197

Query  803   TFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYG  982
             TF ++  CHPQTI++ +TRA    ++V+  D +  ++ +  + G L+QYP T+G + DY 
Sbjct  198   TFWVSEACHPQTIEVIQTRALPLGIEVIVGDHRTFEFDT-PIFGALLQYPATDGAIYDYS  256

Query  983   EFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             EF+  AH  G  V +A+DLL+LT+LK PGE GADI +G+ QRFGVP+GY
Sbjct  257   EFVDRAHQAGALVTVAADLLSLTLLKAPGEFGADIAIGNTQRFGVPLGY  305



>ref|WP_008692424.1| glycine dehydrogenase [Rhodopirellula maiorica]
 gb|EMI22017.1| glycine dehydrogenase [Rhodopirellula maiorica SM1]
Length=623

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/282 (55%), Positives = 197/282 (70%), Gaps = 6/282 (2%)
 Frame = +2

Query  290   SISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKF  466
             S +  A+   D F RRH  ++  + ++M +  GF SLDAL DATVP  IRLD+ +  P  
Sbjct  13    STATNAIDFVDGFARRHIGSSETELAEMLKLLGFDSLDALSDATVPADIRLDAPLDIPD-  71

Query  467   DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAE  646
                  E + ++ +K +ASKNK+++S IGMGY  T  PPVILRN++ENPGWYTQYTPYQAE
Sbjct  72    --PRGERECLQGLKAIASKNKMYRSCIGMGYTGTVTPPVILRNVLENPGWYTQYTPYQAE  129

Query  647   ISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNC  826
             ISQGRLE+LLNFQT+I DLTGLP++ ASLLDE TAAAEAM MC  I   KK  F  + +C
Sbjct  130   ISQGRLEALLNFQTVIADLTGLPLAGASLLDEATAAAEAMGMCIAIANHKKTGFWASDDC  189

Query  827   HPQTIDICKTRADGFELKVVTADLKDIDYK--SGDVCGVLVQYPGTEGEVLDYGEFIKNA  1000
             HPQTI + KTRA G  + +    + +ID++  +G +CGVLVQYP T+G + DY E    A
Sbjct  190   HPQTIALLKTRAAGLGVDLKVGPISEIDFEHGAGGLCGVLVQYPTTDGRINDYSELATQA  249

Query  1001  HAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMG  1126
               H    V A+DLLALT++ PPG+ GADI +GSAQRFGVPMG
Sbjct  250   KNHKCLTVAAADLLALTLITPPGQWGADICIGSAQRFGVPMG  291



>ref|WP_002777354.1| glycine dehydrogenase [Microcystis aeruginosa]
 emb|CCI07664.1| Glycine cleavage system P-protein (glycine dehydrogenase) [Microcystis 
aeruginosa PCC 7941]
Length=981

 Score =   301 bits (772),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             + L  +D+F  RH   T  +  KM    G  +++ LI  TVP  IRL  S+  P     L
Sbjct  21    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATVEELIAQTVPSGIRLQKSLNLPP---AL  77

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QG
Sbjct  78    SEYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQG  137

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM M   + K K   F I+S+CHPQT
Sbjct  138   RLEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMTMSYGLCKTKANAFFISSSCHPQT  197

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA    + ++  D +  D+K+  + G L+QYP T+G + DY EFI  A  +G  
Sbjct  198   IEVVKTRAIPLGIDIIIDDHRLFDFKT-PIFGALLQYPATDGLIYDYREFIAKAQENGAL  256

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  257   VTVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  293



>ref|WP_015784226.1| glycine dehydrogenase [Cyanothece sp. PCC 8802]
 gb|ACV01421.1| glycine dehydrogenase [Cyanothece sp. PCC 8802]
Length=983

 Score =   301 bits (772),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 200/276 (72%), Gaps = 6/276 (2%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  484
             L P+D+F  RH     ++  +M +  GF +LD LIDATVP+SIRL   +K P+     +E
Sbjct  25    LAPTDSFINRHIGPNSDEIDQMLKVLGFSTLDQLIDATVPESIRLSQPLKLPEPQ---SE  81

Query  485   AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRL  664
                +  +K++ASKN++++S+IGMGYY+   PPVI RNI+ENPGWYT YTPYQAEI+QGRL
Sbjct  82    YGALAQLKSIASKNQIYRSFIGMGYYDCITPPVIQRNILENPGWYTAYTPYQAEIAQGRL  141

Query  665   ESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQTI  841
             E+LLNFQTMI +LTGL ++NASLLDEGTAAAEAM M   + K K    F ++S+CHPQTI
Sbjct  142   EALLNFQTMIIELTGLEIANASLLDEGTAAAEAMTMSYGLCKNKDAHAFFVSSHCHPQTI  201

Query  842   DICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
             ++ KTRA+  +++++  D +  ++ +  + G L+QYP T+G + DY  FI+  H +G  V
Sbjct  202   EVIKTRANPLDIEIIIGDHRFFEFDT-PIFGALLQYPATDGVIHDYRSFIEKVHQNGGLV  260

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+D L+L +L PPGE+GADI VGS QRFGVP+GY
Sbjct  261   TVAADPLSLALLTPPGEIGADIAVGSTQRFGVPLGY  296



>ref|WP_012410110.1| glycine dehydrogenase (decarboxylating) [Nostoc punctiforme]
 sp|B2J427.1|GCSP_NOSP7 RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Nostoc punctiforme PCC 73102]
 gb|ACC82139.1| glycine dehydrogenase [Nostoc punctiforme PCC 73102]
Length=979

 Score =   301 bits (772),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 192/270 (71%), Gaps = 5/270 (2%)
 Frame = +2

Query  323   TFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMIE  499
             +F  RH     +D  +M +  GFPSLDALID TVPQ+IRL   +K P+ +   +E   + 
Sbjct  25    SFAPRHIGPNSDDIQQMLKVLGFPSLDALIDKTVPQTIRLKQPLKLPEAE---SEYAALA  81

Query  500   HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLN  679
              +K +A+KN+VF+SYIGMGYY+T  P VI RNI+ENPGWYT YTPYQ EI+QGRLE+LLN
Sbjct  82    SLKKIAAKNQVFRSYIGMGYYDTITPLVIGRNILENPGWYTAYTPYQPEIAQGRLEALLN  141

Query  680   FQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTR  859
             FQT+I DLTGL ++NASLLDE TAAAEAM++   + K +   + ++ +CHPQTID+ +TR
Sbjct  142   FQTLIIDLTGLEIANASLLDEATAAAEAMSLSYGVSKNQANAYFVSHDCHPQTIDVLQTR  201

Query  860   ADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDL  1039
             A    + ++  D +  D+    + G ++QYP ++G + DY  FI+ AHA G  V +A+D 
Sbjct  202   AKPLGINIIVGDHQTFDFDRA-IFGAVLQYPASDGTIYDYRAFIEKAHAKGALVTVAADP  260

Query  1040  LALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             L+LT+L PPGE GADI VGS QRFG+P+G+
Sbjct  261   LSLTLLTPPGEFGADIAVGSTQRFGIPLGF  290



>ref|WP_015175278.1| Glycine dehydrogenase (decarboxylating) [Oscillatoria nigro-viridis]
 gb|AFZ05957.1| Glycine dehydrogenase (decarboxylating) [Oscillatoria nigro-viridis 
PCC 7112]
Length=990

 Score =   301 bits (772),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 191/275 (69%), Gaps = 5/275 (2%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  484
             L P + F  RH   TP +  +M +  G  SLD LID TVP +IR+   ++ P      +E
Sbjct  16    LVPMNGFAGRHIGPTPSEIQQMLDVLGLSSLDELIDKTVPAAIRISGPLQLPA---AQSE  72

Query  485   AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRL  664
                +  +K +A+KN+VF+SYIG GY++   PPVI RNI+ENPGWYT YTPYQAEI+QGRL
Sbjct  73    YSALAELKEIAAKNQVFRSYIGTGYHDCITPPVIQRNILENPGWYTAYTPYQAEIAQGRL  132

Query  665   ESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTID  844
             E+LLNFQTMI DLTGL ++NASLLDEGTAAAEAMA+     K   K F ++ +CHPQT++
Sbjct  133   EALLNFQTMIVDLTGLEIANASLLDEGTAAAEAMAVSYGASKNHAKAFFVSQDCHPQTVE  192

Query  845   ICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVV  1024
             + +TRA    ++V+  D +  ++    + G LVQYP T+G + DY +FI++AH  G  V 
Sbjct  193   VVQTRAKPLGIEVIVGDHQSFEFDR-TIFGALVQYPATDGAIYDYRDFIRSAHEVGALVT  251

Query  1025  MASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +A+D+L+L +L PPGE GADI VGS QRFGVPMG+
Sbjct  252   VAADILSLCLLTPPGEFGADIAVGSTQRFGVPMGF  286



>ref|WP_029637128.1| glycine dehydrogenase [[Scytonema hofmanni] UTEX B 1581]
Length=980

 Score =   301 bits (771),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/274 (52%), Positives = 190/274 (69%), Gaps = 5/274 (2%)
 Frame = +2

Query  311   KPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEA  487
             + S  F RRH     +D  +M E  G   LD LID TVPQ+IRL  S++ P+    L+E 
Sbjct  21    QKSSNFTRRHIGPNSDDIQQMLELLGISDLDTLIDKTVPQAIRLKQSLQLPE---ALSEY  77

Query  488   QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLE  667
               +  +K +A KN+V++S+IGMGY +   PPVI RNI+ENPGWYT YTPYQ EI+QGRLE
Sbjct  78    AALAKLKQIAVKNEVYRSFIGMGYSDCITPPVIQRNILENPGWYTAYTPYQPEIAQGRLE  137

Query  668   SLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDI  847
             +LLNFQTMI DLTGL ++NASLLDE TAAAEAM+M   + K K  T+ ++ +CHPQTID+
Sbjct  138   ALLNFQTMIIDLTGLEIANASLLDEATAAAEAMSMSYGVCKNKANTYFVSQDCHPQTIDV  197

Query  848   CKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVM  1027
              +TRA    + ++  D +  ++    + G ++QYP T+G + DY  FI+ AHA G  V +
Sbjct  198   LQTRAKPLGINIIVGDHQAFNFAE-TIFGAILQYPATDGTIHDYRAFIEKAHAEGALVTV  256

Query  1028  ASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             A+D L+LT+L PPGE GADI VGS QRFG+P+G+
Sbjct  257   AADPLSLTLLTPPGEFGADIAVGSTQRFGIPLGF  290



>ref|WP_015119530.1| glycine dehydrogenase, decarboxylating [Rivularia sp. PCC 7116]
 gb|AFY55964.1| glycine dehydrogenase, decarboxylating [Rivularia sp. PCC 7116]
Length=961

 Score =   301 bits (770),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 194/270 (72%), Gaps = 5/270 (2%)
 Frame = +2

Query  323   TFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQMIE  499
             +F +RH   + +D ++M    GF +L+ LID  VPQ+IR + S+K P+     +E   +E
Sbjct  25    SFAQRHIGPSSDDVAQMLSVLGFDNLEQLIDRAVPQTIRTEGSLKLPE---AQSEYAALE  81

Query  500   HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLLN  679
              +K +ASKN+VF+S+IGMGYY++ +P VI RNI+ENPGWYT YTPYQ EI+QGRLE+LLN
Sbjct  82    TLKEIASKNQVFRSFIGMGYYDSIIPGVIQRNILENPGWYTAYTPYQPEIAQGRLEALLN  141

Query  680   FQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKTR  859
             FQT+ITDLTGL ++NASLLDE TAAAEAM+M   + K K  TF ++  CHPQTI + +TR
Sbjct  142   FQTLITDLTGLEIANASLLDEATAAAEAMSMSYGVCKNKANTFFVSQECHPQTIAVLQTR  201

Query  860   ADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASDL  1039
             A+   +++   + +  D+ S  + G +VQYP T GE+ DY +FI  AH  G  V +A+D 
Sbjct  202   AEPLGIQIFVGNHETFDF-SQPIFGAIVQYPATNGEIYDYRDFIAKAHESGALVTVAADP  260

Query  1040  LALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             L+LT+L PPGE GADI VGS QRFG+P+G+
Sbjct  261   LSLTLLTPPGEFGADIAVGSTQRFGIPLGF  290



>emb|CEG63023.1| Putative Glycine dehydrogenase [Rhizopus microsporus]
 emb|CEI93099.1| Putative Glycine dehydrogenase [Rhizopus microsporus]
Length=1006

 Score =   301 bits (772),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 194/276 (70%), Gaps = 4/276 (1%)
 Frame = +2

Query  308   LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  487
             L P DTFPRRH  +  ++  +M    G   +D L+  T+P +IR  S K      GL E+
Sbjct  52    LAPLDTFPRRHIGSEGKEVQEMLHQLGIKDIDELLGKTIPSAIR--SPKPLAIGQGLPES  109

Query  488   QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLE  667
             Q+++ +K++ASKN V +SYIG GY +T VP VILRNI+ENP WYTQYTPYQ EI+QGRLE
Sbjct  110   QLLKRLKDIASKNMVNRSYIGQGYTDTVVPNVILRNILENPAWYTQYTPYQPEIAQGRLE  169

Query  668   SLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDI  847
             SLLN+QTM++DLTGLP++NASLLDEGTAAAEAM M     + KK  +++  NCHPQTI  
Sbjct  170   SLLNYQTMVSDLTGLPIANASLLDEGTAAAEAMLMSWQSARSKKNVYVVDENCHPQTIAC  229

Query  848   CKTRADGFELKVVTADLKDIDYKSG--DVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
              K RA+ F +++V A++    ++    ++CGVL+QYP T G V DY       H+ G  V
Sbjct  230   LKLRAEAFNIEIVVANVLQYHFEENKKNLCGVLLQYPNTRGSVHDYEALTARIHSAGGLV  289

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+DL+ALT+LK PGE GADI +G++QRFGVP+G+
Sbjct  290   AVATDLMALTLLKAPGEFGADIALGNSQRFGVPLGF  325



>ref|XP_003749134.2| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Rattus norvegicus]
Length=594

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 196/282 (70%), Gaps = 13/282 (5%)
 Frame = +2

Query  299   VEALKPS-DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDH  472
             +E L P  D F RRH     +D+ +M +  G  S+D LI+ TVP SIRL   K P K + 
Sbjct  57    LERLLPRHDDFARRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRL---KRPLKLED  113

Query  473   GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEIS  652
              + E +++E +  +ASKN++++SYIGMGYYN  VP  ILRN++EN GW TQYTPYQ E+S
Sbjct  114   PVCENEILETLHAIASKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWVTQYTPYQPEVS  173

Query  653   QGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHP  832
             QGRLESLLN+QTM++D+TGL M+NASLLDE TAAAEAM +C+     K+K F I   CHP
Sbjct  174   QGRLESLLNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHR--HNKRKRFFIDPRCHP  231

Query  833   QTIDICKTRADGFELKVVTADLK---DIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAH  1003
             QTI + +TRA   + + V  +LK   ++D+   DV GVL QYP TEG+V D+ E ++ AH
Sbjct  232   QTIAVVQTRA---KYRGVIVELKLPHEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAH  288

Query  1004  AHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
               G     A+DLLAL +L+PPGE G DI +G++QRFGVP+GY
Sbjct  289   QTGSLTCCATDLLALCILRPPGEFGVDIALGNSQRFGVPLGY  330



>gb|EAW38056.1| glycine dehydrogenase [Lyngbya sp. PCC 8106]
Length=992

 Score =   301 bits (771),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 194/273 (71%), Gaps = 6/273 (2%)
 Frame = +2

Query  317   SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQM  493
             +D+F +RH         +M E  GF +L+ LID T+P SIRL+ S+K P      +E   
Sbjct  42    TDSFLKRHIGPNFAAIQQMLETLGFSNLNELIDRTIPASIRLNRSLKLPV---AKSEYAA  98

Query  494   IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESL  673
             +  +K +ASKN++F+S+IGMGY N   PPVI RN++ENPGWYT YTPYQAEI+QGRLE+L
Sbjct  99    LAQLKEIASKNQIFRSFIGMGYSNCITPPVIQRNLLENPGWYTAYTPYQAEIAQGRLEAL  158

Query  674   LNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQTIDIC  850
             LNFQTMI DLTG+ ++NASLLDE TAAAEAM+M   + K KK   F ++ +CHPQTID+ 
Sbjct  159   LNFQTMIIDLTGMEIANASLLDEATAAAEAMSMSYGVSKAKKADAFFVSEDCHPQTIDVV  218

Query  851   KTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMA  1030
             KTRA    ++++  D K   +++  + G L+QYP T+G + DY EFI+ AH H   V +A
Sbjct  219   KTRALPLGIEIIVGDFKTFKFET-PIFGALLQYPATDGAIYDYREFIETAHKHKALVTVA  277

Query  1031  SDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +D+L+LT+L PPGE GADIVVG+ QR GVP+GY
Sbjct  278   ADILSLTLLTPPGEFGADIVVGNTQRLGVPLGY  310



>ref|WP_043997862.1| glycine dehydrogenase [Microcystis aeruginosa]
Length=981

 Score =   301 bits (770),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 194/276 (70%), Gaps = 3/276 (1%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  481
             + L  +D+F  RH   T  +  KM    G  +++ LI  TVP +IRL   K       L+
Sbjct  21    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATVEELIAQTVPAAIRLQ--KNLNLAPALS  78

Query  482   EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGR  661
             E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QGR
Sbjct  79    EYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQGR  138

Query  662   LESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTI  841
             LE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM+M   + K K   F I+S+CHPQTI
Sbjct  139   LEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMSMSYGLCKTKANAFFISSSCHPQTI  198

Query  842   DICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
             ++ KTRA    + ++  D +  D+K+  + G L+QYP T+G + DY EFI  A  +G  V
Sbjct  199   EVVKTRAIPLGIDIIIEDHRLFDFKT-PIFGALLQYPATDGVIYDYREFIAKAQENGALV  257

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  258   TVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  293



>ref|WP_023065539.1| glycine dehydrogenase [Lyngbya aestuarii]
 gb|ERT08292.1| glycine dehydrogenase [Lyngbya aestuarii BL J]
Length=992

 Score =   301 bits (771),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 193/273 (71%), Gaps = 6/273 (2%)
 Frame = +2

Query  317   SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQM  493
             +D+F +RH     E   +M E  GF  L+ LID T+P SIRL+ S+K P      +E   
Sbjct  42    TDSFLKRHIGPNLEAIQEMLETLGFSDLNELIDRTIPASIRLNRSLKLPI---AKSEYAA  98

Query  494   IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESL  673
             +  +K +ASKN++F+S+IGMGY N   PPVI RN++ENPGWYT YTPYQAEI+QGRLE+L
Sbjct  99    LAQLKEIASKNQIFRSFIGMGYSNCITPPVIQRNLLENPGWYTAYTPYQAEIAQGRLEAL  158

Query  674   LNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQTIDIC  850
             LNFQTMI DLTG+ ++NASLLDE TAAAEAM+M   + K KK   F ++ +CHPQTID+ 
Sbjct  159   LNFQTMIIDLTGMEIANASLLDEATAAAEAMSMSYGVSKAKKADAFFVSQDCHPQTIDVV  218

Query  851   KTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMA  1030
             KTRA    ++++  D K   + +  + G L+QYP T+G + DY + I+ AH H   V +A
Sbjct  219   KTRALPLGIEIIVGDFKTFKFDT-PIFGALLQYPATDGAIYDYRDLIETAHKHKALVTVA  277

Query  1031  SDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             +D+L+LT+L PPGE GADIVVG+ QRFGVP+GY
Sbjct  278   ADILSLTLLTPPGEFGADIVVGNTQRFGVPLGY  310



>ref|WP_036401293.1| glycine dehydrogenase [Microcystis aeruginosa]
 emb|CAO86628.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
Length=981

 Score =   301 bits (770),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             + L  +D+F  RH   T  +  KM    G  +L+ LI  TVP  IRL  S+  P     L
Sbjct  21    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATLEELIAQTVPSGIRLQKSLNLPP---AL  77

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QG
Sbjct  78    SEYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQG  137

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM M   + K K   F I+S+CHPQT
Sbjct  138   RLEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMTMSYGLCKTKANAFFISSSCHPQT  197

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA    + ++  D +  D+++  + G L+QYP T+G + DY +FI  A  +G  
Sbjct  198   IEVVKTRAIPLGIDIIIEDHRLFDFQT-PIFGALLQYPATDGVIYDYRQFIAKAQENGAL  256

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  257   VTVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  293



>ref|WP_039895601.1| glycine dehydrogenase, partial [Lyngbya sp. PCC 8106]
Length=950

 Score =   300 bits (769),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 193/272 (71%), Gaps = 6/272 (2%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQMI  496
             D+F +RH         +M E  GF +L+ LID T+P SIRL+ S+K P      +E   +
Sbjct  1     DSFLKRHIGPNFAAIQQMLETLGFSNLNELIDRTIPASIRLNRSLKLPV---AKSEYAAL  57

Query  497   EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLL  676
               +K +ASKN++F+S+IGMGY N   PPVI RN++ENPGWYT YTPYQAEI+QGRLE+LL
Sbjct  58    AQLKEIASKNQIFRSFIGMGYSNCITPPVIQRNLLENPGWYTAYTPYQAEIAQGRLEALL  117

Query  677   NFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKK-KTFIIASNCHPQTIDICK  853
             NFQTMI DLTG+ ++NASLLDE TAAAEAM+M   + K KK   F ++ +CHPQTID+ K
Sbjct  118   NFQTMIIDLTGMEIANASLLDEATAAAEAMSMSYGVSKAKKADAFFVSEDCHPQTIDVVK  177

Query  854   TRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMAS  1033
             TRA    ++++  D K   +++  + G L+QYP T+G + DY EFI+ AH H   V +A+
Sbjct  178   TRALPLGIEIIVGDFKTFKFET-PIFGALLQYPATDGAIYDYREFIETAHKHKALVTVAA  236

Query  1034  DLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             D+L+LT+L PPGE GADIVVG+ QR GVP+GY
Sbjct  237   DILSLTLLTPPGEFGADIVVGNTQRLGVPLGY  268



>emb|CCI35850.1| Glycine cleavage system P-protein (glycine dehydrogenase) [Microcystis 
aeruginosa PCC 9701]
Length=995

 Score =   301 bits (770),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 194/276 (70%), Gaps = 3/276 (1%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  481
             + L  +D+F  RH   T  +  KM    G  +++ LI  TVP +IRL   K       L+
Sbjct  35    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATVEELIAQTVPAAIRLQ--KNLNLAPALS  92

Query  482   EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGR  661
             E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QGR
Sbjct  93    EYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQGR  152

Query  662   LESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTI  841
             LE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM+M   + K K   F I+S+CHPQTI
Sbjct  153   LEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMSMSYGLCKTKANAFFISSSCHPQTI  212

Query  842   DICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKV  1021
             ++ KTRA    + ++  D +  D+K+  + G L+QYP T+G + DY EFI  A  +G  V
Sbjct  213   EVVKTRAIPLGIDIIIEDHRLFDFKT-PIFGALLQYPATDGVIYDYREFIAKAQENGALV  271

Query  1022  VMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  272   TVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  307



>emb|CCQ61793.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0401]
Length=985

 Score =   301 bits (770),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/293 (51%), Positives = 203/293 (69%), Gaps = 6/293 (2%)
 Frame = +2

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A  P ++  R       L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ I
Sbjct  8     ANQPKTNDNRTYDIENTLAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGI  67

Query  437   RLD-SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
             RL  ++  P+     +E   +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPG
Sbjct  68    RLSKTLILPE---AQSEYGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPG  124

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYT YTPYQAEI+QGRL++LLN+QTMI +LTGL ++NASLLDEGTAAAEAM+M   + K 
Sbjct  125   WYTAYTPYQAEIAQGRLKALLNYQTMIVELTGLEIANASLLDEGTAAAEAMSMSYGLCKN  184

Query  794   KK-KTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEV  970
             K    F +  +CHPQTI++ KTRA    ++++ AD +  +++  ++ G L+QYP T+G +
Sbjct  185   KNANAFFVDCHCHPQTIEVIKTRAYPLGIELIIADHRFFEFEQ-EIFGALLQYPATDGTI  243

Query  971   LDYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              DY  FI++AH  G  V +A+D L+L +L PPGE GADI VGS QRFGVP+GY
Sbjct  244   YDYRTFIESAHDKGALVTVAADPLSLALLTPPGEFGADIAVGSTQRFGVPLGY  296



>ref|WP_043999313.1| glycine dehydrogenase [Microcystis aeruginosa]
Length=981

 Score =   301 bits (770),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 195/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             + L  +D+F  RH   T  +  KM    G  +++ LI  TVP  IRL  S+  P     L
Sbjct  21    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATVEELIAQTVPSGIRLQKSLNLPP---AL  77

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QG
Sbjct  78    SEYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQG  137

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM+M   + K K   F ++S+CHPQT
Sbjct  138   RLEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMSMSYGLCKTKANAFFVSSSCHPQT  197

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA    + ++  D +  D+++  + G L+QYP T+G + DY EFI  A  +G  
Sbjct  198   IEVVKTRAIPLGIDIIIEDHRLFDFQT-PIFGALLQYPATDGVIYDYREFIAKAQENGAL  256

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  257   VTVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  293



>ref|WP_040944225.1| glycine dehydrogenase [Prochloron didemni]
Length=978

 Score =   300 bits (769),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 187/271 (69%), Gaps = 5/271 (2%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMI  496
             D+F  RH      +  +M +  GF +LDALI+  VP SIR  + ++ P     LTEA  +
Sbjct  20    DSFASRHIGPNTNEIEQMLKVLGFSTLDALIEQAVPPSIRYHAPLELPP---ALTEAAAL  76

Query  497   EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLL  676
               +K +A++NKVF+S+IG GY+N   PPVILRN++ENPGWYT YTPYQ EI+QGRLE+LL
Sbjct  77    TQIKAIAAENKVFRSFIGTGYHNCITPPVILRNVLENPGWYTAYTPYQGEIAQGRLEALL  136

Query  677   NFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKT  856
             NFQTMI DLTGL ++NASLLDEGTAAAEAM M   + K K K F +  +CHPQTI + KT
Sbjct  137   NFQTMIIDLTGLEIANASLLDEGTAAAEAMTMSYGLCKSKAKAFFVEGSCHPQTIAVIKT  196

Query  857   RADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASD  1036
             RA   +++V+  D    D+ S  + G L+QYP T+G + DY EFI   H     V MA+D
Sbjct  197   RARPLDIEVIVGDHGSFDF-SEPIFGALLQYPATDGAIYDYREFIARVHEEKALVTMAAD  255

Query  1037  LLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              L+L +L PPGELGADI VGS QRFGVP+GY
Sbjct  256   PLSLALLVPPGELGADIAVGSTQRFGVPLGY  286



>gb|KIJ83529.1| glycine dehydrogenase [Scytonema tolypothrichoides VB-61278]
Length=967

 Score =   300 bits (769),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 198/288 (69%), Gaps = 8/288 (3%)
 Frame = +2

Query  269   ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-D  445
             ++HQQ   +S E  +   +F  RH   +  D  +M E  G  +LD LID  VPQ+IRL D
Sbjct  10    SNHQQ---MSGETNQKLSSFQERHIGPSSSDIQQMLEVLGDITLDELIDQAVPQAIRLSD  66

Query  446   SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  625
             S++ P+  +   E   +  +K +ASKN+VF+S+IG+GYY+   PPVI RNI+ENPGWYT 
Sbjct  67    SLELPEAQN---EYAALAQLKEIASKNQVFRSFIGIGYYDCITPPVIGRNILENPGWYTA  123

Query  626   YTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKT  805
             YTPYQ EI+QGRLE+LLNFQTMI DLTGL ++NASLLDE TA AEAM+M     K K  T
Sbjct  124   YTPYQPEIAQGRLEALLNFQTMIIDLTGLEIANASLLDEATAGAEAMSMSYGFCKNKANT  183

Query  806   FIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGE  985
             + ++ +CHPQTID+ +TRA    + ++  D +  D+ S  + G ++QYP ++G + DY  
Sbjct  184   YFVSRDCHPQTIDVLQTRAQPLGIDIIVGDHQTFDF-SEPIFGAILQYPASDGTIYDYRS  242

Query  986   FIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             FI+  HA G  V +A+D L+LT+LKPPGE GADI VGS QRFG+P+GY
Sbjct  243   FIEKVHAQGGLVTVAADPLSLTLLKPPGEFGADIAVGSTQRFGIPLGY  290



>gb|ELS47332.1| glycine dehydrogenase [Microcystis aeruginosa DIANCHI905]
Length=1014

 Score =   301 bits (770),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 194/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             + L  +D+F  RH   T  +  KM    G  +L+ LI  TVP  IRL  S+  P     L
Sbjct  54    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATLEELIAQTVPSGIRLQKSLNLPP---AL  110

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QG
Sbjct  111   SEYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQG  170

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM M   + K K   F I+S+CHPQT
Sbjct  171   RLEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMTMSYGLCKTKANAFFISSSCHPQT  230

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA    + ++  D +  D+++  + G L+QYP T+G + DY +FI  A  +G  
Sbjct  231   IEVVKTRAIPLGIDIIIEDHRLFDFQT-PIFGALLQYPATDGVIYDYRQFIAKAQENGAL  289

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  290   VTVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  326



>ref|WP_011319516.1| glycine dehydrogenase (decarboxylating) [Anabaena variabilis]
 sp|Q3M9G1.1|GCSP_ANAVT RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Anabaena variabilis ATCC 29413]
 gb|ABA22375.1| glycine dehydrogenase (decarboxylating) alpha subunit [Anabaena 
variabilis ATCC 29413]
Length=974

 Score =   300 bits (768),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 190/271 (70%), Gaps = 5/271 (2%)
 Frame = +2

Query  320   DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQMI  496
             + F +RH   +  D   M +  GF SLD LI+ TVP +IRL   ++ P      TE   +
Sbjct  32    NNFIQRHIGPSSADIQHMLDVLGFSSLDDLIEKTVPSTIRLHKKLQLPT---AQTEYAAL  88

Query  497   EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQGRLESLL  676
               +K +ASKN+VF+SYIGMGYY+T  PPVI RNI+ENPGWYT YTPYQ EI+QGRLE+LL
Sbjct  89    AKLKQIASKNQVFRSYIGMGYYDTITPPVIGRNILENPGWYTAYTPYQPEIAQGRLEALL  148

Query  677   NFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQTIDICKT  856
             NFQTMI DLTGL ++NASLLDE TAAAEAM+M   + K K   + ++ +CHPQTID+ +T
Sbjct  149   NFQTMIIDLTGLEIANASLLDEATAAAEAMSMSYGVSKNKANAYFVSHDCHPQTIDVLQT  208

Query  857   RADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVKVVMASD  1036
             RA    ++++  D +  D++   + G ++QYP ++G + DY  FI+ AHA G  V +A+D
Sbjct  209   RAKPLGIEIIIGDHQTFDFQK-PIFGAVLQYPASDGTIYDYRAFIETAHAQGALVTVAAD  267

Query  1037  LLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
              L+LT+L PPGE GADI VGS QRFG+P+G+
Sbjct  268   PLSLTLLTPPGEFGADIAVGSTQRFGIPLGF  298



>ref|WP_016874717.1| glycine dehydrogenase [Chlorogloeopsis fritschii]
Length=987

 Score =   300 bits (769),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/292 (51%), Positives = 194/292 (66%), Gaps = 5/292 (2%)
 Frame = +2

Query  257   AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  436
             A  P      R    E  K S  F +RH     ++  +M    GF SLD LI+ TVPQSI
Sbjct  3     ASTPRPQSGDRKTPGEDNKKSSDFQQRHIGPNGDEIQQMLAEMGFSSLDTLIEQTVPQSI  62

Query  437   RLDS-MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  613
             RL   +  P     L+E   +  +K +A KN++F+S+IGMGYY++  PPVI RNI+ENPG
Sbjct  63    RLSRRLNLPA---ALSEYAALAKLKEIALKNRIFRSFIGMGYYDSITPPVIGRNILENPG  119

Query  614   WYTQYTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKG  793
             WYT YTPYQ EI+QGRLE+LLNFQTMI DLTGL ++NASLLDE TAAAEAM+M     K 
Sbjct  120   WYTAYTPYQPEIAQGRLEALLNFQTMIIDLTGLEIANASLLDEATAAAEAMSMSYGFCKN  179

Query  794   KKKTFIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVL  973
             K  T+ ++ +CHPQTID+ +TRA    + ++  D +  D+ S  + G +VQYP ++G + 
Sbjct  180   KSNTYFVSQDCHPQTIDVLQTRAKPLGINIIIGDHQTFDF-SEPIFGAIVQYPASDGTIY  238

Query  974   DYGEFIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             DY  F++ AHA G  V +A+D L+LT+L PPGE GADI VGS QRFG+P+GY
Sbjct  239   DYRAFVEKAHAVGALVTVAADPLSLTLLTPPGEFGADIAVGSTQRFGIPLGY  290



>emb|CCH98687.1| Glycine cleavage system P-protein (glycine dehydrogenase) [Microcystis 
aeruginosa PCC 9717]
Length=995

 Score =   300 bits (769),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 195/277 (70%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             + L  +D+F  RH   T  +  KM    G  +++ LI  TVP  IRL  S+  P     L
Sbjct  35    DLLDCTDSFVNRHIGPTETEIEKMLAVLGVATVEELIAQTVPSGIRLQKSLNLPP---AL  91

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E   +  +K +ASKN+VF+S+IGMGY++   PPVILRNI+ENPGWYT YTPYQAEI+QG
Sbjct  92    SEYAALAQLKAIASKNQVFRSFIGMGYHDCITPPVILRNILENPGWYTAYTPYQAEIAQG  151

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQT+IT LTGL ++NASLLDEGTAAAEAM+M   + K K   F ++S+CHPQT
Sbjct  152   RLEALLNFQTLITSLTGLEIANASLLDEGTAAAEAMSMSYGLCKTKANAFFVSSSCHPQT  211

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ KTRA    + ++  D +  D+++  + G L+QYP T+G + DY EFI  A  +G  
Sbjct  212   IEVVKTRAIPLGIDIIIEDHRLFDFQT-PIFGALLQYPATDGVIYDYREFIAKAQENGAL  270

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D+L+L +L PPGELGADI VGS+QRFGVP+GY
Sbjct  271   VTVAADILSLALLTPPGELGADIAVGSSQRFGVPLGY  307



>ref|WP_016866657.1| glycine dehydrogenase [Fischerella muscicola]
Length=979

 Score =   300 bits (768),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 199/288 (69%), Gaps = 8/288 (3%)
 Frame = +2

Query  269   ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-D  445
             + +QQ    S E L  SD F +RH     +D  +M +  G  SLD LI+ TVPQSIRL  
Sbjct  10    SGNQQNLGESTEKL--SD-FKQRHIGPNADDIQQMLDVLGVSSLDDLINQTVPQSIRLPR  66

Query  446   SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  625
             ++  P+    L+E   +  +K +A KN++F+S+IGMGYY+T  P VI RNI+ENPGWYT 
Sbjct  67    ALNLPE---ALSEYAALAKLKEIALKNQIFRSFIGMGYYDTITPTVIQRNILENPGWYTA  123

Query  626   YTPYQAEISQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKT  805
             YTPYQ EI+QGRLE+LLNFQTMI DLTGL ++NASLLDE TAAAEAM+M   I K K   
Sbjct  124   YTPYQPEIAQGRLEALLNFQTMIIDLTGLEIANASLLDEATAAAEAMSMSYGICKNKANA  183

Query  806   FIIASNCHPQTIDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGE  985
             F ++  CHPQTID+ +TRA    +K++ +D +  D+ S  + G ++QYP ++G + DY  
Sbjct  184   FFVSQECHPQTIDVLQTRAKPLGIKIIISDHESFDF-SEPIFGAILQYPASDGTIYDYRA  242

Query  986   FIKNAHAHGVKVVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             F++ AHA G  V +A+D L+LT+L PPGE GADI VGS QRFG+P+GY
Sbjct  243   FVEKAHAVGALVTVAADPLSLTLLIPPGEFGADIAVGSTQRFGIPLGY  290



>ref|WP_015225454.1| glycine dehydrogenase (decarboxylating) beta subunit [Halothece 
sp. PCC 7418]
 gb|AFZ43578.1| glycine dehydrogenase (decarboxylating) beta subunit [Halothece 
sp. PCC 7418]
Length=977

 Score =   300 bits (768),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 192/277 (69%), Gaps = 5/277 (2%)
 Frame = +2

Query  302   EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  478
             E L   D F  RH   T E+  +M +  GF SLDALID TVP SIRL   +  PK     
Sbjct  22    EVLGLEDQFVNRHVDPTSEEIDQMLKALGFSSLDALIDETVPSSIRLQKELDLPKQK---  78

Query  479   TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPYQAEISQG  658
             +E + ++ ++ +AS N+VF+S+IGMGYY+   P  I RNI+ENPGWYT YTPYQ EI+QG
Sbjct  79    SEYEALKQLRAIASDNQVFRSFIGMGYYDCITPAAIQRNILENPGWYTAYTPYQPEIAQG  138

Query  659   RLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIFKGKKKTFIIASNCHPQT  838
             RLE+LLNFQTMI+DLTGL ++N+SLLDE TAAAEAM+M   + K K   F ++  CHPQT
Sbjct  139   RLEALLNFQTMISDLTGLEIANSSLLDEATAAAEAMSMSVGVSKSKATAFFVSEECHPQT  198

Query  839   IDICKTRADGFELKVVTADLKDIDYKSGDVCGVLVQYPGTEGEVLDYGEFIKNAHAHGVK  1018
             I++ +TRA    L+V+  + ++ D+ S  + G L+QYP TEG++ DY EF++ AH     
Sbjct  199   IEVLQTRAQPLGLEVIVGNHREFDF-STPIFGALLQYPTTEGKICDYREFVEKAHEQKAL  257

Query  1019  VVMASDLLALTMLKPPGELGADIVVGSAQRFGVPMGY  1129
             V +A+D L+L +L PPGE GADI VGS QRFGVP+GY
Sbjct  258   VTVAADPLSLALLTPPGEWGADIAVGSTQRFGVPLGY  294



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3059054034320