BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig925

Length=799
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009589996.1|  PREDICTED: protein TIC 40, chloroplastic iso...    152   3e-40   Nicotiana tomentosiformis
ref|XP_009589995.1|  PREDICTED: protein TIC 40, chloroplastic iso...    151   2e-39   
ref|XP_009589994.1|  PREDICTED: protein TIC 40, chloroplastic iso...    151   3e-39   
ref|XP_009781712.1|  PREDICTED: protein TIC 40, chloroplastic           146   2e-37   Nicotiana sylvestris
ref|XP_006350341.1|  PREDICTED: protein TIC 40, chloroplastic-like      137   1e-33   Solanum tuberosum [potatoes]
ref|XP_004250413.1|  PREDICTED: protein TIC 40, chloroplastic           135   3e-33   Solanum lycopersicum
ref|XP_011074953.1|  PREDICTED: protein TIC 40, chloroplastic-like      123   8e-29   Sesamum indicum [beniseed]
gb|EYU28232.1|  hypothetical protein MIMGU_mgv1a006810mg                119   2e-27   Erythranthe guttata [common monkey flower]
emb|CDP16507.1|  unnamed protein product                                116   2e-26   Coffea canephora [robusta coffee]
ref|XP_011096645.1|  PREDICTED: protein TIC 40, chloroplastic-like      114   1e-25   Sesamum indicum [beniseed]
gb|KJB08546.1|  hypothetical protein B456_001G088300                    100   5e-21   Gossypium raimondii
ref|XP_002282574.1|  PREDICTED: protein TIC 40, chloroplastic iso...    100   8e-21   Vitis vinifera
ref|XP_009345566.1|  PREDICTED: protein TIC 40, chloroplastic-like    98.2    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_009361377.1|  PREDICTED: protein TIC 40, chloroplastic-like    98.2    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_009343221.1|  PREDICTED: protein TIC 40, chloroplastic-like    97.1    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_010665362.1|  PREDICTED: protein TIC 40, chloroplastic iso...  96.3    2e-19   Vitis vinifera
ref|XP_011457702.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  92.0    3e-19   Fragaria vesca subsp. vesca
ref|XP_011469440.1|  PREDICTED: protein TIC 40, chloroplastic         95.9    3e-19   Fragaria vesca subsp. vesca
ref|XP_007219338.1|  hypothetical protein PRUPE_ppa019327mg           93.2    6e-19   
ref|XP_008375657.1|  PREDICTED: protein TIC 40, chloroplastic         95.1    7e-19   
ref|XP_003538352.1|  PREDICTED: protein TIC 40, chloroplastic-like    94.7    8e-19   Glycine max [soybeans]
gb|KHN24689.1|  Protein TIC 40, chloroplastic                         94.7    9e-19   Glycine soja [wild soybean]
ref|XP_009335023.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  94.0    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_009335022.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  94.0    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_009335021.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  94.0    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_003553154.1|  PREDICTED: protein TIC 40, chloroplastic-like    93.6    2e-18   Glycine max [soybeans]
ref|XP_006372572.1|  hypothetical protein POPTR_0017s02900g           92.8    4e-18   
ref|XP_011001576.1|  PREDICTED: protein TIC 40, chloroplastic-like    92.8    4e-18   Populus euphratica
ref|XP_007146938.1|  hypothetical protein PHAVU_006G083300g           91.7    5e-18   Phaseolus vulgaris [French bean]
ref|XP_007032984.1|  Hydroxyproline-rich glycoprotein family prot...  91.7    6e-18   
ref|XP_007032985.1|  Hydroxyproline-rich glycoprotein family prot...  91.7    8e-18   
ref|XP_007146937.1|  hypothetical protein PHAVU_006G083300g           91.7    9e-18   Phaseolus vulgaris [French bean]
ref|XP_007032983.1|  Hydroxyproline-rich glycoprotein family prot...  91.7    1e-17   
gb|KHG12553.1|  Protein TIC 40, chloroplastic                         89.7    5e-17   Gossypium arboreum [tree cotton]
gb|KDO50794.1|  hypothetical protein CISIN_1g014282mg                 87.8    5e-17   Citrus sinensis [apfelsine]
ref|XP_006430578.1|  hypothetical protein CICLE_v10011792mg           87.8    7e-17   
gb|KDO50793.1|  hypothetical protein CISIN_1g014282mg                 87.8    8e-17   Citrus sinensis [apfelsine]
ref|XP_006400200.1|  hypothetical protein EUTSA_v10013528mg           88.6    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_006430577.1|  hypothetical protein CICLE_v10011792mg           88.2    1e-16   Citrus clementina [clementine]
ref|XP_006482104.1|  PREDICTED: protein TIC 40, chloroplastic-like    88.2    2e-16   Citrus sinensis [apfelsine]
gb|KDO50792.1|  hypothetical protein CISIN_1g014282mg                 87.8    2e-16   Citrus sinensis [apfelsine]
gb|KDO50790.1|  hypothetical protein CISIN_1g014282mg                 88.2    2e-16   Citrus sinensis [apfelsine]
ref|XP_009335019.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  88.2    2e-16   Pyrus x bretschneideri [bai li]
gb|KEH34556.1|  hydroxyproline-rich glycoprotein family protein       87.8    2e-16   Medicago truncatula
ref|XP_012077827.1|  PREDICTED: protein TIC 40, chloroplastic         87.8    3e-16   Jatropha curcas
ref|XP_008232181.1|  PREDICTED: protein TIC 40, chloroplastic         88.2    4e-16   
ref|XP_009121468.1|  PREDICTED: protein TIC 40, chloroplastic         85.5    2e-15   Brassica rapa
emb|CDY49648.1|  BnaC09g41260D                                        85.1    3e-15   Brassica napus [oilseed rape]
ref|XP_010243906.1|  PREDICTED: protein TIC 40, chloroplastic iso...  84.0    5e-15   Nelumbo nucifera [Indian lotus]
ref|XP_009126128.1|  PREDICTED: protein TIC 40, chloroplastic         83.2    1e-14   Brassica rapa
emb|CDX69438.1|  BnaA10g17870D                                        82.8    1e-14   
emb|CDX85495.1|  BnaA02g03180D                                        82.8    1e-14   
emb|CDY38098.1|  BnaC02g06750D                                        82.4    2e-14   Brassica napus [oilseed rape]
ref|XP_002305876.1|  hypothetical protein POPTR_0004s08560g           82.0    2e-14   
gb|ERN20031.1|  hypothetical protein AMTR_s00071p00175860             81.6    2e-14   Amborella trichopoda
ref|XP_006858564.2|  PREDICTED: protein TIC 40, chloroplastic         81.6    3e-14   Amborella trichopoda
ref|XP_004500418.1|  PREDICTED: protein TIC 40, chloroplastic-like    80.5    8e-14   Cicer arietinum [garbanzo]
ref|XP_011007247.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  80.1    1e-13   Populus euphratica
ref|XP_011007248.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  80.1    1e-13   Populus euphratica
ref|XP_008463125.1|  PREDICTED: protein TIC 40, chloroplastic iso...  79.3    2e-13   Cucumis melo [Oriental melon]
ref|XP_011655127.1|  PREDICTED: protein TIC 40, chloroplastic iso...  79.3    2e-13   Cucumis sativus [cucumbers]
ref|XP_008463124.1|  PREDICTED: protein TIC 40, chloroplastic iso...  79.3    2e-13   Cucumis melo [Oriental melon]
ref|XP_004148914.1|  PREDICTED: protein TIC 40, chloroplastic iso...  79.3    2e-13   Cucumis sativus [cucumbers]
gb|EPS65548.1|  hypothetical protein M569_09229                       77.0    2e-13   Genlisea aurea
gb|KFK25892.1|  hypothetical protein AALP_AA8G175800                  79.0    2e-13   Arabis alpina [alpine rockcress]
ref|XP_008786486.1|  PREDICTED: protein TIC 40, chloroplastic iso...  78.2    3e-13   Phoenix dactylifera
ref|XP_010054591.1|  PREDICTED: protein TIC 40, chloroplastic         79.0    3e-13   Eucalyptus grandis [rose gum]
ref|XP_008786485.1|  PREDICTED: protein TIC 40, chloroplastic iso...  78.6    3e-13   Phoenix dactylifera
ref|NP_197165.1|  protein TIC 40                                      78.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930575.1|  PREDICTED: protein TIC 40, chloroplastic-like    78.6    3e-13   Elaeis guineensis
sp|Q8GT66.1|TIC40_PEA  RecName: Full=Protein TIC 40, chloroplasti...  77.4    9e-13   Pisum sativum [garden pea]
emb|CAB50925.1|  translocon Tic40                                     77.4    9e-13   Pisum sativum [garden pea]
ref|XP_010420360.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  77.0    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002871727.1|  hypothetical protein ARALYDRAFT_488521           77.0    1e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_010453825.1|  PREDICTED: protein TIC 40, chloroplastic-like    77.0    1e-12   Camelina sativa [gold-of-pleasure]
gb|ABR16602.1|  unknown                                               76.3    2e-12   Picea sitchensis
gb|ABF19057.1|  plastid Tic40                                         75.9    3e-12   Ricinus communis
ref|XP_002531917.1|  conserved hypothetical protein                   75.5    3e-12   
ref|XP_010492574.1|  PREDICTED: protein TIC 40, chloroplastic         75.1    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010243907.1|  PREDICTED: protein TIC 40, chloroplastic iso...  72.8    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010684620.1|  PREDICTED: protein TIC 40, chloroplastic         72.0    5e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006653431.1|  PREDICTED: protein TIC 40, chloroplastic-like    71.6    6e-11   
ref|XP_010525071.1|  PREDICTED: protein TIC 40, chloroplastic-like    71.2    6e-11   Tarenaya hassleriana [spider flower]
ref|XP_010525068.1|  PREDICTED: protein TIC 40, chloroplastic-like    70.5    2e-10   Tarenaya hassleriana [spider flower]
dbj|BAJ86047.1|  predicted protein                                    69.7    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94953.1|  predicted protein                                    69.7    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97578.1|  predicted protein                                    70.1    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO50789.1|  hypothetical protein CISIN_1g014282mg                 69.7    3e-10   Citrus sinensis [apfelsine]
ref|XP_008668043.1|  PREDICTED: translocon Tic40 isoform X1           69.3    3e-10   Zea mays [maize]
ref|XP_003579805.1|  PREDICTED: protein TIC 40, chloroplastic         69.3    4e-10   Brachypodium distachyon [annual false brome]
ref|XP_004975683.1|  PREDICTED: protein TIC 40, chloroplastic-like    69.3    5e-10   Setaria italica
ref|NP_001149949.1|  translocon Tic40                                 68.9    5e-10   
tpg|DAA37691.1|  TPA: translocon Tic40                                68.9    5e-10   
ref|XP_006287761.1|  hypothetical protein CARUB_v10000974mg           67.8    1e-09   
ref|XP_010912645.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  67.0    2e-09   
ref|XP_009383448.1|  PREDICTED: protein TIC 40, chloroplastic-like    67.4    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912644.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  67.0    2e-09   Elaeis guineensis
ref|XP_002447878.1|  hypothetical protein SORBIDRAFT_06g017360        67.0    3e-09   Sorghum bicolor [broomcorn]
ref|XP_010912646.1|  PREDICTED: protein TIC 40, chloroplastic-lik...  66.6    3e-09   
ref|XP_008662036.1|  PREDICTED: translocon Tic40 isoform X1           65.5    9e-09   Zea mays [maize]
ref|NP_001151469.1|  translocon Tic40                                 65.5    9e-09   Zea mays [maize]
gb|ACG42966.1|  translocon Tic40                                      65.5    1e-08   Zea mays [maize]
ref|XP_010558601.1|  PREDICTED: protein TIC 40, chloroplastic         65.1    1e-08   Tarenaya hassleriana [spider flower]
ref|NP_001052871.1|  Os04g0439900                                     65.1    1e-08   
ref|XP_002983230.1|  hypothetical protein SELMODRAFT_445476           64.3    2e-08   
ref|XP_002961333.1|  hypothetical protein SELMODRAFT_437721           64.3    2e-08   Selaginella moellendorffii
ref|XP_009413418.1|  PREDICTED: protein TIC 40, chloroplastic-like    61.6    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001773126.1|  predicted protein                                60.1    5e-07   
ref|XP_001769091.1|  predicted protein                                57.8    3e-06   
ref|XP_007032982.1|  Hydroxyproline-rich glycoprotein family prot...  55.5    2e-05   
gb|KHG16406.1|  Protein TIC 40, chloroplastic                         54.7    3e-05   Gossypium arboreum [tree cotton]



>ref|XP_009589996.1| PREDICTED: protein TIC 40, chloroplastic isoform X3 [Nicotiana 
tomentosiformis]
Length=323

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 108/147 (73%), Gaps = 7/147 (5%)
 Frame = +3

Query  249  PQLVLGLSPN------NGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTIL  410
            P++VLGLS N        KP FGLP LP++ +K   I R  T F  VS FQ PR+TK I+
Sbjct  10   PKMVLGLSSNPRNLVITSKPFFGLPHLPKRPSKNARIVRPTTCFEVVSCFQGPRLTKKIV  69

Query  411  MKRLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAART  590
             +++GRDCFAST+SG QQTSSVGV+PQF+A  PSS +GSPLFWIGVGV LSALFSW A  
Sbjct  70   PEKIGRDCFASTTSGGQQTSSVGVNPQFSAPSPSSQVGSPLFWIGVGVGLSALFSWVASY  129

Query  591  LKNYAMQQAFKTMMGQA-NTQNNQFGN  668
            LK YAMQQAFKTMMGQ  N QN+ F N
Sbjct  130  LKKYAMQQAFKTMMGQMNNNQNSPFSN  156



>ref|XP_009589995.1| PREDICTED: protein TIC 40, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=381

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = +3

Query  243  CCPQLVLGLSPN------NGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKT  404
              P++VLGLS N        KP FGLP LP++ +K   I R  T F  VS FQ PR+TK 
Sbjct  8    SSPKMVLGLSSNPRNLVITSKPFFGLPHLPKRPSKNARIVRPTTCFEVVSCFQGPRLTKK  67

Query  405  ILMKRLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAA  584
            I+ +++GRDCFAST+SG QQTSSVGV+PQF+A  PSS +GSPLFWIGVGV LSALFSW A
Sbjct  68   IVPEKIGRDCFASTTSGGQQTSSVGVNPQFSAPSPSSQVGSPLFWIGVGVGLSALFSWVA  127

Query  585  RTLKNYAMQQAFKTMMGQA-NTQNNQFGN  668
              LK YAMQQAFKTMMGQ  N QN+ F N
Sbjct  128  SYLKKYAMQQAFKTMMGQMNNNQNSPFSN  156



>ref|XP_009589994.1| PREDICTED: protein TIC 40, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=382

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = +3

Query  243  CCPQLVLGLSPN------NGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKT  404
              P++VLGLS N        KP FGLP LP++ +K   I R  T F  VS FQ PR+TK 
Sbjct  8    SSPKMVLGLSSNPRNLVITSKPFFGLPHLPKRPSKNARIVRPTTCFEVVSCFQGPRLTKK  67

Query  405  ILMKRLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAA  584
            I+ +++GRDCFAST+SG QQTSSVGV+PQF+A  PSS +GSPLFWIGVGV LSALFSW A
Sbjct  68   IVPEKIGRDCFASTTSGGQQTSSVGVNPQFSAPSPSSQVGSPLFWIGVGVGLSALFSWVA  127

Query  585  RTLKNYAMQQAFKTMMGQA-NTQNNQFGN  668
              LK YAMQQAFKTMMGQ  N QN+ F N
Sbjct  128  SYLKKYAMQQAFKTMMGQMNNNQNSPFSN  156



>ref|XP_009781712.1| PREDICTED: protein TIC 40, chloroplastic [Nicotiana sylvestris]
Length=392

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 107/147 (73%), Gaps = 7/147 (5%)
 Frame = +3

Query  249  PQLVLGLSPN------NGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTIL  410
            P++VLG+S N        KP FGLP LP++ +K   I R  T    +S FQ PR+TK I+
Sbjct  10   PKMVLGVSSNPRNSVITSKPFFGLPHLPKRPSKNARIVRPTTCCEVISCFQGPRLTKKIV  69

Query  411  MKRLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAART  590
            +++ GRDCFAST+SG QQTSSVGV+PQF+A  PSS +GSPLFWIGVGV LSALFSW A  
Sbjct  70   LEKKGRDCFASTTSGGQQTSSVGVNPQFSAPSPSSQVGSPLFWIGVGVGLSALFSWLASY  129

Query  591  LKNYAMQQAFKTMMGQA-NTQNNQFGN  668
            LK YAMQQAFKTMMGQ  N QN+ F N
Sbjct  130  LKKYAMQQAFKTMMGQMNNNQNSPFSN  156



>ref|XP_006350341.1| PREDICTED: protein TIC 40, chloroplastic-like [Solanum tuberosum]
Length=443

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 99/144 (69%), Gaps = 4/144 (3%)
 Frame = +3

Query  249  PQLVLGLSPN---NGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTILMKR  419
            P++VLGLS N   + KP+FGLP LP++  K   I R  T F  VS FQ PR+TK I++ +
Sbjct  10   PKMVLGLSSNPVISNKPLFGLPHLPKRPFKNGRIVRPTTCFEVVSCFQSPRLTKKIVLGK  69

Query  420  LGRDCFAstssgsqqtssvg-vsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLK  596
             GR  FAST++   Q +S   V+PQF+A    S +GSPLFWIGVGV LSALF+W A  LK
Sbjct  70   SGRGSFASTTTSGGQQTSSVGVNPQFSAPSQPSQVGSPLFWIGVGVGLSALFAWVASYLK  129

Query  597  NYAMQQAFKTMMGQANTQNNQFGN  668
             YAMQQA KTMMGQ N QN+QF N
Sbjct  130  KYAMQQALKTMMGQMNGQNSQFSN  153



>ref|XP_004250413.1| PREDICTED: protein TIC 40, chloroplastic [Solanum lycopersicum]
Length=443

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = +3

Query  243  CCPQLVLGLSPNN---GKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTILM  413
              P++VLGLS N+    KP FGLP LP++  K     R  T F  VS FQ PR+TK I++
Sbjct  8    SSPKMVLGLSSNSVISSKPFFGLPHLPKRPFKNGRTVRPTTCFEVVSCFQGPRLTKKIVL  67

Query  414  KRLGRDCFAstssgsqqtssvg-vsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAART  590
             + GR  FAST++   + +S   V+PQF+A  P S +GSPLFWIGVGV  SALF+W A  
Sbjct  68   GKSGRGSFASTTTSGGKQTSSVGVNPQFSAPSPPSQMGSPLFWIGVGVGFSALFAWVASY  127

Query  591  LKNYAMQQAFKTMMGQANTQNNQFGN  668
            LK YAMQQA KTMMGQ N QN+QF N
Sbjct  128  LKKYAMQQALKTMMGQMNGQNSQFSN  153



>ref|XP_011074953.1| PREDICTED: protein TIC 40, chloroplastic-like [Sesamum indicum]
Length=429

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 96/147 (65%), Gaps = 5/147 (3%)
 Frame = +3

Query  243  CCPQLVLGLSPN-----NGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTI  407
              P+++ G+S       +  P  GLP L +K  K        +SF+ +S+F+ P  TKTI
Sbjct  8    SSPKIMFGVSSKPRDSISSTPFVGLPNLLKKPGKHGRAPNSTSSFTVLSFFKAPNATKTI  67

Query  408  LMKRLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAAR  587
            + +++ RDCFAS +SG Q+TSSVG +PQ +  PP S++GSPLFWIGVGV LSALFSW A 
Sbjct  68   VPEKVARDCFASIASGGQETSSVGANPQLSVPPPPSHVGSPLFWIGVGVGLSALFSWVAG  127

Query  588  TLKNYAMQQAFKTMMGQANTQNNQFGN  668
              K YAM+QAFKT   Q N QNN FGN
Sbjct  128  RAKKYAMEQAFKTFTQQMNAQNNPFGN  154



>gb|EYU28232.1| hypothetical protein MIMGU_mgv1a006810mg [Erythranthe guttata]
Length=430

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 101/149 (68%), Gaps = 8/149 (5%)
 Frame = +3

Query  243  CCPQLVLGLSPN------NGKPIFGLPVLPRKSTKMIGITRLKTS-FSTVSYFQDPRITK  401
              P++VLG+SPN      + KP+ GLP L +K+      T + TS    +S F+ P+ TK
Sbjct  8    SSPKIVLGVSPNPRNSVISSKPLVGLPNLLKKTGNYGRHTTIHTSSLQVLSLFRSPKPTK  67

Query  402  TILMKRLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWA  581
            TI+ ++  +D FA+ SS  Q+TSSVGV+PQ +  PPSS +GSPLFWIGVGV LSALFS+ 
Sbjct  68   TIVSEKAAKDRFATISSSGQETSSVGVNPQLSV-PPSSQVGSPLFWIGVGVGLSALFSFV  126

Query  582  ARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            A  LK YAM+QAFKT   Q NTQN+ FGN
Sbjct  127  AGRLKKYAMEQAFKTFTQQMNTQNSPFGN  155



>emb|CDP16507.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 93/144 (65%), Gaps = 5/144 (3%)
 Frame = +3

Query  243  CCPQLVLGLSPNNGKPIFGLPVL--PRKSTKMIGITRLKTSFSTVSYFQDPRITKTILMK  416
            C P++VLGLS N    IF  P L  P+K + +    R K S S + +   P +++ +L+K
Sbjct  8    CSPKMVLGLSQNPKNSIFNKPFLGFPQKPSSISSNPR-KPSTSLLPFPHLP-VSRRVLVK  65

Query  417  RLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLK  596
              G DCFAST+S S Q +S          PP S++GSPLFWIGVGV  SALFSW A  LK
Sbjct  66   LKG-DCFASTTSSSNQQTSSVGVNPLPVQPPPSSVGSPLFWIGVGVGFSALFSWVATNLK  124

Query  597  NYAMQQAFKTMMGQANTQNNQFGN  668
             YAMQQAFKTMMGQ NTQ+NQFGN
Sbjct  125  KYAMQQAFKTMMGQMNTQSNQFGN  148



>ref|XP_011096645.1| PREDICTED: protein TIC 40, chloroplastic-like [Sesamum indicum]
Length=431

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 93/146 (64%), Gaps = 7/146 (5%)
 Frame = +3

Query  252  QLVLGLSPN------NGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTILM  413
            ++V+G SPN      +G    GLP L +K+ K     +  +S S +S FQ P +TKTI+ 
Sbjct  11   KIVVGFSPNPRNSIVSGNSFVGLPYLLKKTGKNGRNFKSSSSVSVLSLFQAPMVTKTIVP  70

Query  414  KRLGRDCFAstssgsqqtssvg-vsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAART  590
            +R+ RDCFAS +S S Q +S    +PQ   +PP S +GSPLFWIGVGV L+ALFSW A  
Sbjct  71   ERVARDCFASIASSSSQETSSVGANPQLPVTPPPSQVGSPLFWIGVGVGLAALFSWVAGR  130

Query  591  LKNYAMQQAFKTMMGQANTQNNQFGN  668
            +K YAM+QA KT   Q N QNN FGN
Sbjct  131  VKKYAMEQALKTFTQQMNAQNNPFGN  156



>gb|KJB08546.1| hypothetical protein B456_001G088300 [Gossypium raimondii]
Length=428

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            P  T  PPSS +GSPLFWIGVGV LSALF+W A +LK YAMQQAFKTMMGQ NTQNNQF 
Sbjct  91   PYPTVPPPSSQIGSPLFWIGVGVGLSALFTWVASSLKKYAMQQAFKTMMGQMNTQNNQFA  150

Query  666  N  668
            N
Sbjct  151  N  151



>ref|XP_002282574.1| PREDICTED: protein TIC 40, chloroplastic isoform X1 [Vitis vinifera]
 emb|CBI39284.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 99/146 (68%), Gaps = 15/146 (10%)
 Frame = +3

Query  243  CCPQLVLGLSPNNGKPI------FGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKT  404
              P+LVLG SP+N + I      F LP+L RK  K I  ++   S         PR  + 
Sbjct  8    SSPKLVLGHSPSNPRHISCAHSSFSLPLLFRKPRKFIAASQSGAS---------PRTPRH  58

Query  405  ILMKRLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAA  584
            ++  +LG +CFAS SS SQ TSSVGV+PQF+  PPSSN+GSPLFWIGVGV LSALFSW A
Sbjct  59   VVETKLGTECFASISSSSQGTSSVGVNPQFSPPPPSSNIGSPLFWIGVGVGLSALFSWVA  118

Query  585  RTLKNYAMQQAFKTMMGQANTQNNQF  662
              LK YAMQQAFKT+MGQ ++QNNQF
Sbjct  119  SNLKKYAMQQAFKTLMGQMDSQNNQF  144



>ref|XP_009345566.1| PREDICTED: protein TIC 40, chloroplastic-like [Pyrus x bretschneideri]
Length=450

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQ +  PP SN+GSPLFWIGVGV LSALFSW A  LKNYAMQQAFKT+MGQ N Q++QF 
Sbjct  88   PQISVPPPPSNVGSPLFWIGVGVGLSALFSWVATRLKNYAMQQAFKTLMGQMNPQDSQFN  147

Query  666  N  668
            N
Sbjct  148  N  148



>ref|XP_009361377.1| PREDICTED: protein TIC 40, chloroplastic-like [Pyrus x bretschneideri]
Length=447

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQ +  PP SN+GSPLFWIGVGV LSALFSW A  LKNYAMQQAFKT+MGQ N Q++QF 
Sbjct  88   PQISVPPPPSNVGSPLFWIGVGVGLSALFSWVATRLKNYAMQQAFKTLMGQMNPQDSQFN  147

Query  666  N  668
            N
Sbjct  148  N  148



>ref|XP_009343221.1| PREDICTED: protein TIC 40, chloroplastic-like [Pyrus x bretschneideri]
Length=446

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQ +  PP +N+GSPLFWIGVGV LSALFSW A  LKNYAMQQAFKT+MGQ N Q++QF 
Sbjct  88   PQISVPPPPTNVGSPLFWIGVGVGLSALFSWVATRLKNYAMQQAFKTLMGQMNPQDSQFN  147

Query  666  N  668
            N
Sbjct  148  N  148



>ref|XP_010665362.1| PREDICTED: protein TIC 40, chloroplastic isoform X2 [Vitis vinifera]
Length=435

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 99/146 (68%), Gaps = 16/146 (11%)
 Frame = +3

Query  243  CCPQLVLGLSPNNGKPI------FGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKT  404
              P+LVLG SP+N + I      F LP+L RK  K I  ++   S  T      PR  +T
Sbjct  8    SSPKLVLGHSPSNPRHISCAHSSFSLPLLFRKPRKFIAASQSGASPRT------PRHVET  61

Query  405  ILMKRLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAA  584
                +LG +CFAS SS SQ TSSVGV+PQF+  PPSSN+GSPLFWIGVGV LSALFSW A
Sbjct  62   ----KLGTECFASISSSSQGTSSVGVNPQFSPPPPSSNIGSPLFWIGVGVGLSALFSWVA  117

Query  585  RTLKNYAMQQAFKTMMGQANTQNNQF  662
              LK YAMQQAFKT+MGQ ++QNNQF
Sbjct  118  SNLKKYAMQQAFKTLMGQMDSQNNQF  143



>ref|XP_011457702.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=152

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQF+A PP S +GS LFWIGVGVA SA+FSWAA  ++ Y +QQAFK++MGQ NTQN+QF 
Sbjct  6    PQFSAPPPPSTIGSSLFWIGVGVAFSAVFSWAAGKIQKYVVQQAFKSVMGQMNTQNDQFS  65

Query  666  N  668
            N
Sbjct  66   N  66



>ref|XP_011469440.1| PREDICTED: protein TIC 40, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=427

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQF+A PP S +GSPLFWIGVGVA SA+FSWAA  L+ Y +QQAFK +MGQ NTQN+QF 
Sbjct  86   PQFSAPPPPSTIGSPLFWIGVGVAFSAVFSWAAGKLQKYVVQQAFKNVMGQMNTQNDQFS  145

Query  666  N  668
            N
Sbjct  146  N  146



>ref|XP_007219338.1| hypothetical protein PRUPE_ppa019327mg, partial [Prunus persica]
 gb|EMJ20537.1| hypothetical protein PRUPE_ppa019327mg, partial [Prunus persica]
Length=233

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQ +  PP SN+GSPLFWIGVGV LSALFSW    L  YAMQQAFKT+MGQ NTQ++QF 
Sbjct  88   PQISVPPPPSNIGSPLFWIGVGVGLSALFSWVRTRLLKYAMQQAFKTLMGQMNTQDSQFN  147

Query  666  N  668
            N
Sbjct  148  N  148



>ref|XP_008375657.1| PREDICTED: protein TIC 40, chloroplastic [Malus domestica]
Length=449

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQ +  PP S +GSPLFWIGVGV LSALFSW A  LKNYAMQQAFKT+MGQ N Q++QF 
Sbjct  88   PQISVPPPPSYVGSPLFWIGVGVGLSALFSWVATRLKNYAMQQAFKTLMGQMNPQDSQFN  147

Query  666  N  668
            N
Sbjct  148  N  148



>ref|XP_003538352.1| PREDICTED: protein TIC 40, chloroplastic-like [Glycine max]
Length=429

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 1/61 (2%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQ + SP SS +GSPLFWIGVGV LSALFS  A  LK YAMQQAFKTMMGQ N+QNNQFG
Sbjct  87   PQLSPSP-SSTIGSPLFWIGVGVGLSALFSVVASRLKKYAMQQAFKTMMGQMNSQNNQFG  145

Query  666  N  668
            N
Sbjct  146  N  146



>gb|KHN24689.1| Protein TIC 40, chloroplastic [Glycine soja]
Length=429

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 1/61 (2%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQ + SP SS +GSPLFWIGVGV LSALFS  A  LK YAMQQAFKTMMGQ N+QNNQFG
Sbjct  87   PQLSPSP-SSTIGSPLFWIGVGVGLSALFSVVASRLKKYAMQQAFKTMMGQMNSQNNQFG  145

Query  666  N  668
            N
Sbjct  146  N  146



>ref|XP_009335023.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X4 [Pyrus 
x bretschneideri]
Length=408

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +3

Query  489  QFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            Q +  PP +N+GSPLFWIGVGV LSALFSW A  LKNYAMQQAFKT+MGQ N Q++QF N
Sbjct  51   QISVPPPPTNVGSPLFWIGVGVGLSALFSWVATRLKNYAMQQAFKTLMGQMNPQDSQFNN  110



>ref|XP_009335022.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X3 [Pyrus 
x bretschneideri]
Length=408

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +3

Query  489  QFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            Q +  PP +N+GSPLFWIGVGV LSALFSW A  LKNYAMQQAFKT+MGQ N Q++QF N
Sbjct  51   QISVPPPPTNVGSPLFWIGVGVGLSALFSWVATRLKNYAMQQAFKTLMGQMNPQDSQFNN  110



>ref|XP_009335021.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X2 [Pyrus 
x bretschneideri]
Length=411

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +3

Query  489  QFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            Q +  PP +N+GSPLFWIGVGV LSALFSW A  LKNYAMQQAFKT+MGQ N Q++QF N
Sbjct  54   QISVPPPPTNVGSPLFWIGVGVGLSALFSWVATRLKNYAMQQAFKTLMGQMNPQDSQFNN  113



>ref|XP_003553154.1| PREDICTED: protein TIC 40, chloroplastic-like [Glycine max]
 gb|KHN18624.1| Protein TIC 40, chloroplastic [Glycine soja]
Length=432

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  507  PSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            PSS +GSPLFWIGVGV LSALFS  A  LK YAMQQAFKTMMGQ N+QNNQFGN
Sbjct  96   PSSTIGSPLFWIGVGVGLSALFSVVASRLKKYAMQQAFKTMMGQMNSQNNQFGN  149



>ref|XP_006372572.1| hypothetical protein POPTR_0017s02900g [Populus trichocarpa]
 gb|ERP50369.1| hypothetical protein POPTR_0017s02900g [Populus trichocarpa]
Length=435

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 6/119 (5%)
 Frame = +3

Query  309  LPRKSTKMIGITRLKTSFSTVSYFQDPRITKTILMKRLGRDCFAstssgsqqtssvgvsP  488
             P +++K +  T  + S S +S    PR T      + G + FAS SS S Q ++     
Sbjct  43   FPHRTSKTVTHTS-RISISALSQSHGPRRTS-----KNGSEYFASISSLSGQQTASVGVN  96

Query  489  QFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
              + SPP S +GSPLFW+GVGVALSA+FSW A  LKNYAMQQAFK++  Q N QNNQF 
Sbjct  97   PQSVSPPPSQIGSPLFWVGVGVALSAIFSWVATRLKNYAMQQAFKSLTEQMNAQNNQFN  155



>ref|XP_011001576.1| PREDICTED: protein TIC 40, chloroplastic-like [Populus euphratica]
Length=433

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 84/151 (56%), Gaps = 17/151 (11%)
 Frame = +3

Query  243  CCPQLVLGLS---PNNGKPIFGL----PVLP---RKSTKMIGITRLKTSFSTVSYFQDPR  392
              P+LV+G      N   P F +    P LP   R S  +   +R+  S S +S    PR
Sbjct  12   SSPKLVMGYPTSLKNPTTPKFSISTTRPSLPFSHRTSKTVPHSSRI--SISALSQSHGPR  69

Query  393  ITKTILMKRLGRDCFAstssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALF  572
             T      + G + FAS SS S Q ++       + SPP S +GSPLFW+GVGVALSA+F
Sbjct  70   RTS-----KNGSEYFASISSSSGQQTASVGVNPQSVSPPPSQIGSPLFWVGVGVALSAIF  124

Query  573  SWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            SW A  LKNYAMQQAFK++  Q N QNNQF 
Sbjct  125  SWVATRLKNYAMQQAFKSLTEQMNAQNNQFN  155



>ref|XP_007146938.1| hypothetical protein PHAVU_006G083300g [Phaseolus vulgaris]
 gb|ESW18932.1| hypothetical protein PHAVU_006G083300g [Phaseolus vulgaris]
Length=367

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            PPSS +GSPLFWIGVGV LSALFS  A  LK YAMQQAFKTMMGQ N+ NN FGN
Sbjct  97   PPSSTIGSPLFWIGVGVGLSALFSMVASRLKKYAMQQAFKTMMGQMNSPNNDFGN  151



>ref|XP_007032984.1| Hydroxyproline-rich glycoprotein family protein isoform 3 [Theobroma 
cacao]
 gb|EOY03910.1| Hydroxyproline-rich glycoprotein family protein isoform 3 [Theobroma 
cacao]
Length=368

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALF+W A +LK YAMQQAFKTMMGQ NTQNNQF N
Sbjct  109  IGSPLFWIGVGVGLSALFTWVASSLKKYAMQQAFKTMMGQMNTQNNQFSN  158



>ref|XP_007032985.1| Hydroxyproline-rich glycoprotein family protein isoform 4, partial 
[Theobroma cacao]
 gb|EOY03911.1| Hydroxyproline-rich glycoprotein family protein isoform 4, partial 
[Theobroma cacao]
Length=412

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALF+W A +LK YAMQQAFKTMMGQ NTQNNQF N
Sbjct  109  IGSPLFWIGVGVGLSALFTWVASSLKKYAMQQAFKTMMGQMNTQNNQFSN  158



>ref|XP_007146937.1| hypothetical protein PHAVU_006G083300g [Phaseolus vulgaris]
 gb|ESW18931.1| hypothetical protein PHAVU_006G083300g [Phaseolus vulgaris]
Length=430

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQ +  PPSS +GSPLFWIGVGV LSALFS  A  LK YAMQQAFKTMMGQ N+ NN FG
Sbjct  92   PQLSP-PPSSTIGSPLFWIGVGVGLSALFSMVASRLKKYAMQQAFKTMMGQMNSPNNDFG  150

Query  666  N  668
            N
Sbjct  151  N  151



>ref|XP_007032983.1| Hydroxyproline-rich glycoprotein family protein isoform 2 [Theobroma 
cacao]
 gb|EOY03909.1| Hydroxyproline-rich glycoprotein family protein isoform 2 [Theobroma 
cacao]
Length=433

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALF+W A +LK YAMQQAFKTMMGQ NTQNNQF N
Sbjct  109  IGSPLFWIGVGVGLSALFTWVASSLKKYAMQQAFKTMMGQMNTQNNQFSN  158



>gb|KHG12553.1| Protein TIC 40, chloroplastic [Gossypium arboreum]
Length=422

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 72/111 (65%), Gaps = 7/111 (6%)
 Frame = +3

Query  339  ITRLKTSFSTVSYFQDPRITKTILMKRLGRDCFAstssgsqqtssvg-vsPQFTASPPSS  515
            IT  ++  S+ ++   PR    I+ ++   + FAS SS S Q +S   V+P  T  PPSS
Sbjct  41   ITPRRSRISSSTHSTPPRSLPQIVFRKSIDERFASISSSSNQQTSSVGVNPYPTVPPPSS  100

Query  516  NLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
             +GSPLFWIGVGV LSALF+W       YAMQQAFKTMMGQ NTQNNQF N
Sbjct  101  QIGSPLFWIGVGVGLSALFTW------KYAMQQAFKTMMGQMNTQNNQFAN  145



>gb|KDO50794.1| hypothetical protein CISIN_1g014282mg [Citrus sinensis]
Length=262

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 87/143 (61%), Gaps = 8/143 (6%)
 Frame = +3

Query  243  CCPQLVLGLSPNNGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTILMKRL  422
              P+LVL  + N   P  G+   PR+S+ +    +L TS  + S    P         ++
Sbjct  12   TSPKLVLNYT-NFKHPTRGI-TGPRRSSSLALPFKLSTSRISASVRAGPHQNG-----QV  64

Query  423  GRDCFAs-tssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKN  599
            G   FAS TSSG QQTSSVGV+P     PPSSN+GSPLFW+GVGV LSALFS+ A  LK 
Sbjct  65   GAGGFASLTSSGGQQTSSVGVNPNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQ  124

Query  600  YAMQQAFKTMMGQANTQNNQFGN  668
            YAMQQA K MM Q NTQN  FGN
Sbjct  125  YAMQQALKGMMNQMNTQNKPFGN  147



>ref|XP_006430578.1| hypothetical protein CICLE_v10011792mg [Citrus clementina]
 gb|ESR43818.1| hypothetical protein CICLE_v10011792mg [Citrus clementina]
Length=326

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            P     PPSSN+GSPLFW+GVGV LSALFS+ A  LK YAMQQA K MM Q NTQN  FG
Sbjct  87   PNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQYAMQQALKGMMNQMNTQNKPFG  146

Query  666  N  668
            N
Sbjct  147  N  147



>gb|KDO50793.1| hypothetical protein CISIN_1g014282mg [Citrus sinensis]
Length=326

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 86/143 (60%), Gaps = 8/143 (6%)
 Frame = +3

Query  243  CCPQLVLGLSPNNGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTILMKRL  422
              P+LVL  + N   P  G+   PR+S+ +    +L TS  + S    P     +     
Sbjct  12   TSPKLVLNYT-NFKHPTRGI-TGPRRSSSLALPFKLSTSRISASVRAGPHQNGQV-----  64

Query  423  GRDCFAs-tssgsqqtssvgvsPQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKN  599
            G   FAS TSSG QQTSSVGV+P     PPSSN+GSPLFW+GVGV LSALFS+ A  LK 
Sbjct  65   GAGGFASLTSSGGQQTSSVGVNPNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQ  124

Query  600  YAMQQAFKTMMGQANTQNNQFGN  668
            YAMQQA K MM Q NTQN  FGN
Sbjct  125  YAMQQALKGMMNQMNTQNKPFGN  147



>ref|XP_006400200.1| hypothetical protein EUTSA_v10013528mg [Eutrema salsugineum]
 gb|ESQ41653.1| hypothetical protein EUTSA_v10013528mg [Eutrema salsugineum]
Length=449

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  315  RKSTKMI-GITRLKTSFSTVSYFQDPR-ITKTILMKRLGRDCFAstssgsqqtssvgvsP  488
            R++ K++   +++  S  + S+   P    + +++K   RD  +  SS   Q ++    P
Sbjct  34   RRTPKVVFRCSKISASAKSQSHSSRPENAGEIVVVKHRSRDFASIFSSNRDQQTTSVAYP  93

Query  489  QFTASPPSSN-LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
                 PPSS+ +GSPLFWIGVGV LSALFSW   +LK YAMQ A KTMM Q NTQN+QF 
Sbjct  94   NAAVPPPSSSTIGSPLFWIGVGVGLSALFSWVTSSLKKYAMQTAMKTMMNQMNTQNSQFN  153

Query  666  N  668
            N
Sbjct  154  N  154



>ref|XP_006430577.1| hypothetical protein CICLE_v10011792mg [Citrus clementina]
 gb|ESR43817.1| hypothetical protein CICLE_v10011792mg [Citrus clementina]
Length=427

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            P     PPSSN+GSPLFW+GVGV LSALFS+ A  LK YAMQQA K MM Q NTQN  FG
Sbjct  87   PNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQYAMQQALKGMMNQMNTQNKPFG  146

Query  666  N  668
            N
Sbjct  147  N  147



>ref|XP_006482104.1| PREDICTED: protein TIC 40, chloroplastic-like [Citrus sinensis]
Length=427

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            P     PPSSN+GSPLFW+GVGV LSALFS+ A  LK YAMQQA K MM Q NTQN  FG
Sbjct  87   PNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQYAMQQALKGMMNQMNTQNKPFG  146

Query  666  N  668
            N
Sbjct  147  N  147



>gb|KDO50792.1| hypothetical protein CISIN_1g014282mg [Citrus sinensis]
Length=414

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            P     PPSSN+GSPLFW+GVGV LSALFS+ A  LK YAMQQA K MM Q NTQN  FG
Sbjct  87   PNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQYAMQQALKGMMNQMNTQNKPFG  146

Query  666  N  668
            N
Sbjct  147  N  147



>gb|KDO50790.1| hypothetical protein CISIN_1g014282mg [Citrus sinensis]
Length=427

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            P     PPSSN+GSPLFW+GVGV LSALFS+ A  LK YAMQQA K MM Q NTQN  FG
Sbjct  87   PNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQYAMQQALKGMMNQMNTQNKPFG  146

Query  666  N  668
            N
Sbjct  147  N  147



>ref|XP_009335019.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X1 [Pyrus 
x bretschneideri]
Length=446

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  516  NLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            N+GSPLFWIGVGV LSALFSW A  LKNYAMQQAFKT+MGQ N Q++QF N
Sbjct  98   NVGSPLFWIGVGVGLSALFSWVATRLKNYAMQQAFKTLMGQMNPQDSQFNN  148



>gb|KEH34556.1| hydroxyproline-rich glycoprotein family protein [Medicago truncatula]
Length=435

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            PPSS +GSPLFWIGVGV  SALFS  A  LK YAMQQAFKTMMGQ NTQNN F
Sbjct  94   PPSSTVGSPLFWIGVGVGFSALFSVVASRLKKYAMQQAFKTMMGQMNTQNNPF  146



>ref|XP_012077827.1| PREDICTED: protein TIC 40, chloroplastic [Jatropha curcas]
Length=468

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 72/119 (61%), Gaps = 7/119 (6%)
 Frame = +3

Query  306  VLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTILMKRLGRDCFAstssgsqqtssvgvs  485
            ++PR S   I       S  T S+    R ++   ++RLG + FAS SS + Q +S    
Sbjct  51   IVPRNSRTFI-------SALTHSHTSGGRPSRVSQIRRLGTEHFASISSSNGQQTSSVGF  103

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
                  PPSS  GSPLFW+G+GV LSALFSWAA  LK YAMQQAFKTMM Q NT NNQF
Sbjct  104  SPQPVPPPSSQFGSPLFWVGIGVGLSALFSWAASNLKKYAMQQAFKTMMNQMNTPNNQF  162



>ref|XP_008232181.1| PREDICTED: protein TIC 40, chloroplastic [Prunus mume]
Length=613

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFSW A  LK YAMQQAFKT+MGQ NTQ++QF N
Sbjct  265  IGSPLFWIGVGVGLSALFSWVATNLKKYAMQQAFKTLMGQMNTQDSQFNN  314



>ref|XP_009121468.1| PREDICTED: protein TIC 40, chloroplastic [Brassica rapa]
Length=457

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 79/144 (55%), Gaps = 8/144 (6%)
 Frame = +3

Query  249  PQLVLGLS-PNNGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTILMKRLG  425
            P+L++G +  ++ KP  G     R+S K++ + R K S S+         T  I++ +  
Sbjct  16   PKLLIGCNFTSSLKPPVGFS---RRSPKIL-LRRSKISASSAQSHSPSDSTGEIVVVKHK  71

Query  426  RDCFAstssgsqqtssvgvsPQFTASPP---SSNLGSPLFWIGVGVALSALFSWAARTLK  596
               FAS  S      +  V+    A PP   SS +GSPLFWIGVGV LSALFSW     K
Sbjct  72   TKAFASIFSSRSDKQTASVASPSVAVPPPSSSSTIGSPLFWIGVGVGLSALFSWVTSNAK  131

Query  597  NYAMQQAFKTMMGQANTQNNQFGN  668
             YAMQ A KTMM Q NTQN+QF N
Sbjct  132  KYAMQTAMKTMMNQMNTQNSQFNN  155



>emb|CDY49648.1| BnaC09g41260D [Brassica napus]
Length=455

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 67/125 (54%), Gaps = 3/125 (2%)
 Frame = +3

Query  303  PVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTILMKRLGRDCFAstssgsqqtssvgv  482
            PV   + T  I + R KTS S+            I++ +     FAS  S +    +  V
Sbjct  29   PVGFSRRTPKILLRRSKTSASSAQSHSPSENAGEIVVVKHKTKAFASIFSSTSDKQTTSV  88

Query  483  sPQFTASPP---SSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQN  653
            +    A PP   SS +GSPLFWIGVGV LSALFSW     K YAMQ A KTMM Q NTQN
Sbjct  89   ASPSAAVPPPSSSSTIGSPLFWIGVGVGLSALFSWVTSNAKKYAMQTAMKTMMNQMNTQN  148

Query  654  NQFGN  668
            +QF N
Sbjct  149  SQFNN  153



>ref|XP_010243906.1| PREDICTED: protein TIC 40, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=438

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 95/149 (64%), Gaps = 12/149 (8%)
 Frame = +3

Query  249  PQLVLGLSPN-----NGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTI--  407
            P+ +LG SP+     + +P+F    LP+K  +  GI R +   S+VS       T+ I  
Sbjct  9    PKFLLGSSPSLTGISSRRPLF-FSNLPKKRRE--GIVRTRNLISSVSQGNVDGTTRRIPR  65

Query  408  -LMKRLGRDCFAstssgsqqtssvg-vsPQFTASPPSSNLGSPLFWIGVGVALSALFSWA  581
             + +RLG + FAS SS S+   S   V+PQ +A  P S++GSPLFWIGVGV LSALFSW 
Sbjct  66   DVRERLGMEVFASISSSSRTEVSSVGVNPQLSAPSPPSSIGSPLFWIGVGVGLSALFSWV  125

Query  582  ARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            A  LK YAMQQAFKT+MGQ +T+N QFGN
Sbjct  126  ATNLKKYAMQQAFKTLMGQMSTENKQFGN  154



>ref|XP_009126128.1| PREDICTED: protein TIC 40, chloroplastic [Brassica rapa]
Length=450

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFSWA   LK YAMQ A KTMM Q NTQN+QF N
Sbjct  104  IGSPLFWIGVGVGLSALFSWATSNLKKYAMQTAMKTMMNQMNTQNSQFNN  153



>emb|CDX69438.1| BnaA10g17870D [Brassica napus]
Length=457

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +3

Query  486  PQFTASPPSSN--LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQ  659
            P     PPSS+  +GSPLFWIGVGV LSALFSW     K YAMQ A KTMM Q NTQN+Q
Sbjct  93   PSAAVPPPSSSSTIGSPLFWIGVGVGLSALFSWVTSNAKKYAMQTAMKTMMNQMNTQNSQ  152

Query  660  FGN  668
            F N
Sbjct  153  FNN  155



>emb|CDX85495.1| BnaA02g03180D [Brassica napus]
Length=450

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFSWA   LK YAMQ A KTMM Q NTQN+QF N
Sbjct  104  IGSPLFWIGVGVGLSALFSWATSNLKKYAMQTAMKTMMNQMNTQNSQFNN  153



>emb|CDY38098.1| BnaC02g06750D [Brassica napus]
Length=450

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFSWA   +K YAMQ A KTMM Q NTQN+QF N
Sbjct  103  IGSPLFWIGVGVGLSALFSWATSNVKKYAMQTAMKTMMNQMNTQNSQFNN  152



>ref|XP_002305876.1| hypothetical protein POPTR_0004s08560g [Populus trichocarpa]
 gb|EEE86387.1| hypothetical protein POPTR_0004s08560g [Populus trichocarpa]
Length=429

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            +GSPLFW+GVGV LSA+FSW A  +KNYAMQQAFK++  Q NTQNNQF
Sbjct  102  IGSPLFWVGVGVGLSAIFSWVATRVKNYAMQQAFKSLTEQMNTQNNQF  149



>gb|ERN20031.1| hypothetical protein AMTR_s00071p00175860 [Amborella trichopoda]
Length=416

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            S +GSPLFWIGVGV +SALFSW A  LK YAMQQAFKTMMGQ ++ N+QF
Sbjct  99   SYVGSPLFWIGVGVGISALFSWVATNLKKYAMQQAFKTMMGQMSSNNSQF  148



>ref|XP_006858564.2| PREDICTED: protein TIC 40, chloroplastic [Amborella trichopoda]
 ref|XP_011628606.1| PREDICTED: protein TIC 40, chloroplastic [Amborella trichopoda]
Length=428

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            S +GSPLFWIGVGV +SALFSW A  LK YAMQQAFKTMMGQ ++ N+QF
Sbjct  99   SYVGSPLFWIGVGVGISALFSWVATNLKKYAMQQAFKTMMGQMSSNNSQF  148



>ref|XP_004500418.1| PREDICTED: protein TIC 40, chloroplastic-like [Cicer arietinum]
Length=433

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            +GSPLFWIGVGV  SALFS  A  LK YAMQQAFKTMMGQ NTQNN F
Sbjct  99   VGSPLFWIGVGVGFSALFSIVASRLKKYAMQQAFKTMMGQMNTQNNPF  146



>ref|XP_011007247.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X1 [Populus 
euphratica]
Length=438

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            +GSPLFW+GVGV LSA+FSW A  +KNYAMQQAFK++  Q N QNNQF
Sbjct  110  IGSPLFWVGVGVGLSAIFSWVATRVKNYAMQQAFKSLTEQMNAQNNQF  157



>ref|XP_011007248.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X2 [Populus 
euphratica]
Length=437

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            +GSPLFW+GVGV LSA+FSW A  +KNYAMQQAFK++  Q N QNNQF
Sbjct  110  IGSPLFWVGVGVGLSAIFSWVATRVKNYAMQQAFKSLTEQMNAQNNQF  157



>ref|XP_008463125.1| PREDICTED: protein TIC 40, chloroplastic isoform X2 [Cucumis 
melo]
Length=416

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFW+GVGV LSALF+W A  LK YAMQQAFKTMM Q N+QN+   N
Sbjct  99   VGSPLFWVGVGVGLSALFTWVASYLKKYAMQQAFKTMMSQMNSQNSPMSN  148



>ref|XP_011655127.1| PREDICTED: protein TIC 40, chloroplastic isoform X2 [Cucumis 
sativus]
Length=416

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFW+GVGV LSALF+W A  LK YAMQQAFKTMM Q N+QN+   N
Sbjct  99   VGSPLFWVGVGVGLSALFTWVASYLKKYAMQQAFKTMMSQMNSQNSPMSN  148



>ref|XP_008463124.1| PREDICTED: protein TIC 40, chloroplastic isoform X1 [Cucumis 
melo]
Length=419

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFW+GVGV LSALF+W A  LK YAMQQAFKTMM Q N+QN+   N
Sbjct  99   VGSPLFWVGVGVGLSALFTWVASYLKKYAMQQAFKTMMSQMNSQNSPMSN  148



>ref|XP_004148914.1| PREDICTED: protein TIC 40, chloroplastic isoform X1 [Cucumis 
sativus]
Length=419

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFW+GVGV LSALF+W A  LK YAMQQAFKTMM Q N+QN+   N
Sbjct  99   VGSPLFWVGVGVGLSALFTWVASYLKKYAMQQAFKTMMSQMNSQNSPMSN  148



>gb|EPS65548.1| hypothetical protein M569_09229, partial [Genlisea aurea]
Length=247

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PQ +  PPS  +GSPLFWIGVGV LSALFSW A  +K YAM QAF+++  Q N QN  FG
Sbjct  28   PQISVPPPS-QVGSPLFWIGVGVGLSALFSWLAGRVKKYAMDQAFRSLSQQMNAQNISFG  86

Query  666  N  668
            +
Sbjct  87   S  87



>gb|KFK25892.1| hypothetical protein AALP_AA8G175800 [Arabis alpina]
Length=444

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFSW     K YAMQ A KTMM Q NTQN+QF N
Sbjct  102  IGSPLFWIGVGVGLSALFSWVTSNAKKYAMQTAMKTMMNQMNTQNSQFNN  151



>ref|XP_008786486.1| PREDICTED: protein TIC 40, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=359

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +3

Query  486  PQFTASPPS-SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            P     PPS SN+GSPLFWIGVGV LSALFS  A  LK YAMQQAF TMM QA  Q  Q 
Sbjct  24   PHLPVPPPSTSNIGSPLFWIGVGVGLSALFSVVATRLKRYAMQQAFNTMMNQAAQQTGQS  83

Query  663  GN  668
             N
Sbjct  84   NN  85



>ref|XP_010054591.1| PREDICTED: protein TIC 40, chloroplastic [Eucalyptus grandis]
 gb|KCW89872.1| hypothetical protein EUGRSUZ_A02100 [Eucalyptus grandis]
Length=495

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +3

Query  531  LFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            LFWIGVGV +SALFSW A  LK YAMQQAFK MMGQ N+QNNQF 
Sbjct  172  LFWIGVGVGVSALFSWVANYLKKYAMQQAFKAMMGQMNSQNNQFA  216



>ref|XP_008786485.1| PREDICTED: protein TIC 40, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=435

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +3

Query  486  PQFTASPPS-SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            P     PPS SN+GSPLFWIGVGV LSALFS  A  LK YAMQQAF TMM QA  Q  Q 
Sbjct  100  PHLPVPPPSTSNIGSPLFWIGVGVGLSALFSVVATRLKRYAMQQAFNTMMNQAAQQTGQS  159

Query  663  GN  668
             N
Sbjct  160  NN  161



>ref|NP_197165.1| protein TIC 40 [Arabidopsis thaliana]
 sp|Q9FMD5.1|TIC40_ARATH RecName: Full=Protein TIC 40, chloroplastic; AltName: Full=Protein 
PIGMENT DEFECTIVE EMBRYO 120; AltName: Full=Translocon 
at the inner envelope membrane of chloroplasts 40; Short=AtTIC40; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16131.1|AF428299_1 AT5g16620/MTG13_6 [Arabidopsis thaliana]
 dbj|BAB10189.1| translocon Tic40-like protein [Arabidopsis thaliana]
 gb|AAM13009.1| translocon Tic40-like protein [Arabidopsis thaliana]
 gb|AAP31939.1| At5g16620 [Arabidopsis thaliana]
 gb|AED92318.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
Length=447

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFS+    LK YAMQ A KTMM Q NTQN+QF N
Sbjct  105  IGSPLFWIGVGVGLSALFSYVTSNLKKYAMQTAMKTMMNQMNTQNSQFNN  154



>ref|XP_010930575.1| PREDICTED: protein TIC 40, chloroplastic-like [Elaeis guineensis]
Length=433

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +3

Query  486  PQFTASPPS-SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            P     PPS SN+GSPLFWIGVGV LSALFS  A  LK +AMQQAF TMM  A  Q  QF
Sbjct  100  PHLPMPPPSVSNIGSPLFWIGVGVGLSALFSMVATRLKRHAMQQAFNTMMNHAAQQTGQF  159

Query  663  GN  668
             N
Sbjct  160  NN  161



>sp|Q8GT66.1|TIC40_PEA RecName: Full=Protein TIC 40, chloroplastic; AltName: Full=Translocon 
at the inner envelope membrane of chloroplasts 40; 
Short=PsTIC40; Flags: Precursor [Pisum sativum]
 gb|AAN75219.1| chloroplast protein translocon component Tic40 precursor [Pisum 
sativum]
Length=436

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            +GSPLFWIG+GV  SALFS  A  +K YAMQQAFK+MMGQ NTQNN F
Sbjct  99   VGSPLFWIGIGVGFSALFSVVASRVKKYAMQQAFKSMMGQMNTQNNPF  146



>emb|CAB50925.1| translocon Tic40 [Pisum sativum]
Length=436

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            +GSPLFWIG+GV  SALFS  A  +K YAMQQAFK+MMGQ NTQNN F
Sbjct  99   VGSPLFWIGIGVGFSALFSVVASRVKKYAMQQAFKSMMGQMNTQNNPF  146



>ref|XP_010420360.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X1 [Camelina 
sativa]
 ref|XP_010420361.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X2 [Camelina 
sativa]
Length=445

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFS     LK YAMQ A KTMM Q NTQN+QF N
Sbjct  103  IGSPLFWIGVGVGLSALFSLVTSNLKKYAMQTAMKTMMNQMNTQNSQFNN  152



>ref|XP_002871727.1| hypothetical protein ARALYDRAFT_488521 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47986.1| hypothetical protein ARALYDRAFT_488521 [Arabidopsis lyrata subsp. 
lyrata]
Length=447

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFS     LK YAMQ A KTMM Q NTQN+QF N
Sbjct  105  IGSPLFWIGVGVGLSALFSLVTSNLKKYAMQTAMKTMMNQMNTQNSQFNN  154



>ref|XP_010453825.1| PREDICTED: protein TIC 40, chloroplastic-like [Camelina sativa]
Length=445

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFS     LK YAMQ A KTMM Q NTQN+QF N
Sbjct  103  IGSPLFWIGVGVGLSALFSLVTSNLKKYAMQTAMKTMMNQMNTQNSQFNN  152



>gb|ABR16602.1| unknown [Picea sitchensis]
Length=450

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  492  FTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            F A P  + +GSPL WIGVGV +SALFSW A ++K YAMQQ FKTMMGQA    +Q G
Sbjct  107  FPAQPSPTYIGSPLLWIGVGVGISALFSWVANSVKRYAMQQVFKTMMGQAAPGTSQPG  164



>gb|ABF19057.1| plastid Tic40 [Ricinus communis]
Length=460

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  531  LFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            LFWIGVGV LSA+FS  A  +KNYAMQQAFK+MM Q NTQN+QF N
Sbjct  117  LFWIGVGVGLSAIFSLVATRVKNYAMQQAFKSMMNQMNTQNDQFNN  162



>ref|XP_002531917.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30461.1| conserved hypothetical protein [Ricinus communis]
Length=465

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  531  LFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            LFWIGVGV LSA+FS  A  +KNYAMQQAFK+MM Q NTQN+QF N
Sbjct  122  LFWIGVGVGLSAIFSLVATRVKNYAMQQAFKSMMNQMNTQNDQFNN  167



>ref|XP_010492574.1| PREDICTED: protein TIC 40, chloroplastic [Camelina sativa]
Length=445

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIG GV LSALFS     LK YAMQ A KTMM Q NTQN+QF N
Sbjct  103  IGSPLFWIGCGVGLSALFSLVTSNLKKYAMQTAMKTMMNQMNTQNSQFNN  152



>ref|XP_010243907.1| PREDICTED: protein TIC 40, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=432

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 92/149 (62%), Gaps = 18/149 (12%)
 Frame = +3

Query  249  PQLVLGLSPN-----NGKPIFGLPVLPRKSTKMIGITRLKTSFSTVSYFQDPRITKTI--  407
            P+ +LG SP+     + +P+F    LP+K  +  GI R +   S+VS       T+ I  
Sbjct  9    PKFLLGSSPSLTGISSRRPLF-FSNLPKKRRE--GIVRTRNLISSVSQGNVDGTTRRIPR  65

Query  408  -LMKRLGRDCFAstssgsqqtssvg-vsPQFTASPPSSNLGSPLFWIGVGVALSALFSWA  581
             + +RLG + FAS SS S+   S   V+PQ +A  P S++GSPLFWIGVGV LSALFSW 
Sbjct  66   DVRERLGMEVFASISSSSRTEVSSVGVNPQLSAPSPPSSIGSPLFWIGVGVGLSALFSW-  124

Query  582  ARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
                  YAMQQAFKT+MGQ +T+N QFGN
Sbjct  125  -----KYAMQQAFKTLMGQMSTENKQFGN  148



>ref|XP_010684620.1| PREDICTED: protein TIC 40, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=467

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 77/137 (56%), Gaps = 9/137 (7%)
 Frame = +3

Query  285  KPIFGLPVLPRKSTKMIGITRLKT-----SFSTVSYFQDPRITKTILMKRLGRDCFAsts  449
            K  FGLP+LP+K +  + +T+ ++     +FST +  +    +     K  G + FASTS
Sbjct  27   KQCFGLPLLPKKPSGSVYVTKPRSKTILFAFSTPNSRRKSGNSSNNDKKNNGVELFASTS  86

Query  450  sgsqqtssvgvsP----QFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQA  617
            S + + S+              PP S  GSPLFWIGVGV  SALFS+ A  L+ +AMQQA
Sbjct  87   SATNKGSAQETISVGVNPQPYPPPPSQFGSPLFWIGVGVGFSALFSFVASRLQKFAMQQA  146

Query  618  FKTMMGQANTQNNQFGN  668
            FKT+M Q   Q+NQ  N
Sbjct  147  FKTVMNQMGPQSNQSSN  163



>ref|XP_006653431.1| PREDICTED: protein TIC 40, chloroplastic-like, partial [Oryza 
brachyantha]
Length=370

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQA  641
            PPSS +GSP+FWIGVGVALSA FS  +  +K YAMQQAFK+MM QA
Sbjct  39   PPSSYIGSPVFWIGVGVALSAAFSMVSSMVKKYAMQQAFKSMMTQA  84



>ref|XP_010525071.1| PREDICTED: protein TIC 40, chloroplastic-like [Tarenaya hassleriana]
Length=323

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  531  LFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            LFWIGVGV  SALFSW   +LK YAMQ A KTMM Q N Q+NQF N
Sbjct  112  LFWIGVGVGFSALFSWVTSSLKKYAMQTAMKTMMSQMNMQSNQFNN  157



>ref|XP_010525068.1| PREDICTED: protein TIC 40, chloroplastic-like [Tarenaya hassleriana]
Length=451

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  531  LFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            LFWIGVGV  SALFSW   +LK YAMQ A KTMM Q N Q+NQF N
Sbjct  112  LFWIGVGVGFSALFSWVTSSLKKYAMQTAMKTMMSQMNMQSNQFNN  157



>dbj|BAJ86047.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=362

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PPSS +GSP+FWIG+GVALSA FS  +  +K YAM+QAFK+MM QA    N FG
Sbjct  93   PPSSYIGSPVFWIGIGVALSAAFSMVSSMVKKYAMEQAFKSMMTQAPP--NTFG  144



>dbj|BAJ94953.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PPSS +GSP+FWIG+GVALSA FS  +  +K YAM+QAFK+MM QA    N FG
Sbjct  93   PPSSYIGSPVFWIGIGVALSAAFSMVSSMVKKYAMEQAFKSMMTQAPP--NTFG  144



>dbj|BAJ97578.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=426

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQA  641
            PPSS +GSP+FWIG+GVALSA FS  +  +K YAM+QAFK+MM QA
Sbjct  93   PPSSYIGSPVFWIGIGVALSAAFSMVSSMVKKYAMEQAFKSMMTQA  138



>gb|KDO50789.1| hypothetical protein CISIN_1g014282mg [Citrus sinensis]
Length=397

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  486  PQFTASPPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFK  623
            P     PPSSN+GSPLFW+GVGV LSALFS+ A  LK YAMQQA K
Sbjct  87   PNLPMPPPSSNVGSPLFWVGVGVGLSALFSFVASRLKQYAMQQALK  132



>ref|XP_008668043.1| PREDICTED: translocon Tic40 isoform X1 [Zea mays]
Length=357

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            PPSS +GSP+FWIGVGVALS  F+  +  LK YAM+QAFK+MM QA    N FG+
Sbjct  100  PPSSYIGSPVFWIGVGVALSVAFTTVSSMLKKYAMEQAFKSMMTQAPP--NSFGS  152



>ref|XP_003579805.1| PREDICTED: protein TIC 40, chloroplastic [Brachypodium distachyon]
Length=426

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFG  665
            PPSS +GSP+FWIG+G+ALSA FS  +  +K YAM+QAFK+MM Q  T  N FG
Sbjct  93   PPSSYIGSPVFWIGIGIALSAAFSMVSSMVKKYAMEQAFKSMMTQ--TPPNTFG  144



>ref|XP_004975683.1| PREDICTED: protein TIC 40, chloroplastic-like [Setaria italica]
Length=433

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            PPSS +GSP+FWIGVGVALS  F+  +  +K YAMQQAFK+MM Q  + +N FG+
Sbjct  98   PPSSYIGSPVFWIGVGVALSVAFTTVSSMVKKYAMQQAFKSMMSQ--SPSNSFGS  150



>ref|NP_001149949.1| translocon Tic40 [Zea mays]
 gb|ACG37310.1| translocon Tic40 [Zea mays]
Length=433

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            PPSS +GSP+FWIGVGVALS  F+  +  LK YAM+QAFK+MM QA    N FG+
Sbjct  100  PPSSYIGSPVFWIGVGVALSVAFTTVSSMLKKYAMEQAFKSMMTQAPP--NSFGS  152



>tpg|DAA37691.1| TPA: translocon Tic40 [Zea mays]
Length=433

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            PPSS +GSP+FWIGVGVALS  F+  +  LK YAM+QAFK+MM QA    N FG+
Sbjct  100  PPSSYIGSPVFWIGVGVALSVAFTTVSSMLKKYAMEQAFKSMMTQAPP--NSFGS  152



>ref|XP_006287761.1| hypothetical protein CARUB_v10000974mg [Capsella rubella]
 gb|EOA20659.1| hypothetical protein CARUB_v10000974mg [Capsella rubella]
Length=441

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 6/50 (12%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +GSPLFWIGVGV LSALFS        YAMQ A KTMM Q NTQN+QF N
Sbjct  105  IGSPLFWIGVGVGLSALFSL------KYAMQTAMKTMMNQMNTQNSQFNN  148



>ref|XP_010912645.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X2 [Elaeis 
guineensis]
Length=404

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  513  SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNN  656
            SN+G+PLFW+GVGV LSALFS  A  LK YAMQQAF T+M Q    N+
Sbjct  107  SNIGAPLFWVGVGVGLSALFSMVATRLKRYAMQQAFNTVMNQTGQFND  154



>ref|XP_009383448.1| PREDICTED: protein TIC 40, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=436

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  513  SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            +++GSPLFWIGVGV LS +F   A   K +A+QQAFKTMM QA  Q  QF N
Sbjct  108  TSIGSPLFWIGVGVGLSVVFQVVAAKFKRFALQQAFKTMMDQAAPQGGQFNN  159



>ref|XP_010912644.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X1 [Elaeis 
guineensis]
Length=420

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  513  SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNN  656
            SN+G+PLFW+GVGV LSALFS  A  LK YAMQQAF T+M Q    N+
Sbjct  107  SNIGAPLFWVGVGVGLSALFSMVATRLKRYAMQQAFNTVMNQTGQFND  154



>ref|XP_002447878.1| hypothetical protein SORBIDRAFT_06g017360 [Sorghum bicolor]
 gb|EES12206.1| hypothetical protein SORBIDRAFT_06g017360 [Sorghum bicolor]
Length=436

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            PPSS  GSP+FWIGVGVALS  F+  +  +K YAM+QAFK+MM QA    N FG+
Sbjct  102  PPSSYFGSPVFWIGVGVALSVAFTTVSSMVKRYAMEQAFKSMMTQAPP--NSFGS  154



>ref|XP_010912646.1| PREDICTED: protein TIC 40, chloroplastic-like isoform X3 [Elaeis 
guineensis]
Length=362

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  513  SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNN  656
            SN+G+PLFW+GVGV LSALFS  A  LK YAMQQAF T+M Q    N+
Sbjct  107  SNIGAPLFWVGVGVGLSALFSMVATRLKRYAMQQAFNTVMNQTGQFND  154



>ref|XP_008662036.1| PREDICTED: translocon Tic40 isoform X1 [Zea mays]
Length=426

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            P SS +GSP+FWIGVGVALS  F+  +  LK YAMQQAFK+MM Q+    N FG+
Sbjct  100  PTSSYIGSPVFWIGVGVALSVAFTTVSSMLKRYAMQQAFKSMMTQSAP--NSFGS  152



>ref|NP_001151469.1| translocon Tic40 [Zea mays]
 gb|ACL54125.1| unknown [Zea mays]
 gb|AFW58314.1| translocon Tic40 [Zea mays]
Length=450

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            P SS +GSP+FWIGVGVALS  F+  +  LK YAMQQAFK+MM Q+    N FG+
Sbjct  100  PTSSYIGSPVFWIGVGVALSVAFTTVSSMLKRYAMQQAFKSMMTQSAP--NSFGS  152



>gb|ACG42966.1| translocon Tic40 [Zea mays]
Length=450

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +3

Query  504  PPSSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            P SS +GSP+FWIGVGVALS  F+  +  LK YAMQQAFK+MM Q+    N FG+
Sbjct  100  PTSSYIGSPVFWIGVGVALSVAFTTVSSMLKRYAMQQAFKSMMTQSAP--NSFGS  152



>ref|XP_010558601.1| PREDICTED: protein TIC 40, chloroplastic [Tarenaya hassleriana]
Length=460

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  LFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQF  662
            LFWIG+GV LSALFSW   +LK  AM+ A KTMM Q N Q+NQF
Sbjct  127  LFWIGIGVGLSALFSWVTSSLKQRAMETAMKTMMSQMNKQSNQF  170



>ref|NP_001052871.1| Os04g0439900 [Oryza sativa Japonica Group]
 dbj|BAF14785.1| Os04g0439900 [Oryza sativa Japonica Group]
 emb|CAH66845.1| H0525C06.8 [Oryza sativa Indica Group]
 dbj|BAG93784.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77331.1| hypothetical protein OsI_16005 [Oryza sativa Indica Group]
 gb|EEE61055.1| hypothetical protein OsJ_14912 [Oryza sativa Japonica Group]
Length=429

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQA  641
            +GSP+FWIGVGVALSA FS  +  +K YAMQQAFK+MM QA
Sbjct  103  IGSPVFWIGVGVALSAAFSMVSSMVKKYAMQQAFKSMMTQA  143



>ref|XP_002983230.1| hypothetical protein SELMODRAFT_445476 [Selaginella moellendorffii]
 gb|EFJ15572.1| hypothetical protein SELMODRAFT_445476 [Selaginella moellendorffii]
Length=392

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 10/65 (15%)
 Frame = +3

Query  489  QFTASPPS--SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMM---GQANTQN  653
            Q  + PP+  + +GSPL W+GVGV LS LFSWAA  +K  AMQQA K+MM   GQ     
Sbjct  52   QTVSVPPTQPAYIGSPLLWVGVGVGLSVLFSWAANYVKKQAMQQALKSMMSGPGQ-----  106

Query  654  NQFGN  668
            NQFGN
Sbjct  107  NQFGN  111



>ref|XP_002961333.1| hypothetical protein SELMODRAFT_437721 [Selaginella moellendorffii]
 gb|EFJ38872.1| hypothetical protein SELMODRAFT_437721 [Selaginella moellendorffii]
Length=413

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 10/65 (15%)
 Frame = +3

Query  489  QFTASPPS--SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMM---GQANTQN  653
            Q  + PP+  + +GSPL W+GVGV LS LFSWAA  +K  AMQQA K+MM   GQ     
Sbjct  73   QTVSVPPTQPAYIGSPLLWVGVGVGLSVLFSWAANYVKKQAMQQALKSMMSGPGQ-----  127

Query  654  NQFGN  668
            NQFGN
Sbjct  128  NQFGN  132



>ref|XP_009413418.1| PREDICTED: protein TIC 40, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  531  LFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            LFW+GVGV LS +F   A  LK +A+QQAFKTMM QA  Q  QF N
Sbjct  113  LFWVGVGVGLSVIFQVVAAKLKRHALQQAFKTMMDQAAPQGGQFNN  158



>ref|XP_001773126.1| predicted protein [Physcomitrella patens]
 gb|EDQ61979.1| predicted protein [Physcomitrella patens]
Length=615

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  513  SNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQA  641
            S +GSPL WIGVGV LSALFS+ A  +K YAMQQ  K+M G A
Sbjct  241  SYIGSPLLWIGVGVGLSALFSFGANAVKRYAMQQMLKSMTGSA  283



>ref|XP_001769091.1| predicted protein [Physcomitrella patens]
 gb|EDQ66065.1| predicted protein [Physcomitrella patens]
Length=556

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  510  SSNLGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTM  629
            SS +GSPL WIGVGV LSALFS+ A +++ YAMQQ  K+M
Sbjct  207  SSYIGSPLLWIGVGVGLSALFSFGANSVQRYAMQQMLKSM  246



>ref|XP_007032982.1| Hydroxyproline-rich glycoprotein family protein isoform 1 [Theobroma 
cacao]
 gb|EOY03908.1| Hydroxyproline-rich glycoprotein family protein isoform 1 [Theobroma 
cacao]
Length=531

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 44/109 (40%), Gaps = 59/109 (54%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSW----AARTLK--------NYAM------------------  608
            +GSPLFWIGVGV LSALF+W     A +LK        N AM                  
Sbjct  109  IGSPLFWIGVGVGLSALFTWVSTKVASSLKFGSSIGYCNEAMKTDYGKMNSCMGPHRVGG  168

Query  609  -----------------------------QQAFKTMMGQANTQNNQFGN  668
                                         QQAFKTMMGQ NTQNNQF N
Sbjct  169  LDFGVDDKVVVNGIMDPGYKIASQQKYAMQQAFKTMMGQMNTQNNQFSN  217



>gb|KHG16406.1| Protein TIC 40, chloroplastic [Gossypium arboreum]
Length=289

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 32/50 (64%), Gaps = 10/50 (20%)
 Frame = +3

Query  519  LGSPLFWIGVGVALSALFSWAARTLKNYAMQQAFKTMMGQANTQNNQFGN  668
            L  PL  IG    L+ALF+W       Y MQQAFKTM GQ NTQNNQFGN
Sbjct  102  LRHPLECIG----LAALFTW------KYVMQQAFKTMTGQMNTQNNQFGN  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876