BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig896

Length=706
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07923.1|  unnamed protein product                                233   5e-70   Coffea canephora [robusta coffee]
ref|XP_004236895.1|  PREDICTED: UBX domain-containing protein 2         221   3e-65   Solanum lycopersicum
ref|XP_006355016.1|  PREDICTED: UBX domain-containing protein 2-like    218   4e-64   Solanum tuberosum [potatoes]
ref|XP_010654914.1|  PREDICTED: UBX domain-containing protein 2 i...    213   2e-62   Vitis vinifera
ref|XP_011070500.1|  PREDICTED: UBX domain-containing protein 2         213   2e-62   Sesamum indicum [beniseed]
ref|XP_003631347.1|  PREDICTED: UBX domain-containing protein 2 i...    213   2e-62   Vitis vinifera
ref|XP_009587838.1|  PREDICTED: UBX domain-containing protein 2         212   5e-62   Nicotiana tomentosiformis
ref|XP_002311564.2|  hypothetical protein POPTR_0008s14230g             207   3e-60   
ref|XP_010654910.1|  PREDICTED: UBX domain-containing protein 2 i...    207   3e-60   Vitis vinifera
ref|XP_009775836.1|  PREDICTED: UBX domain-containing protein 2         206   6e-60   Nicotiana sylvestris
gb|EYU30238.1|  hypothetical protein MIMGU_mgv1a006061mg                206   8e-60   Erythranthe guttata [common monkey flower]
ref|XP_011025166.1|  PREDICTED: UBX domain-containing protein 7-like    204   5e-59   Populus euphratica
ref|XP_002315828.1|  UBX domain-containing family protein               204   7e-59   
ref|XP_006378421.1|  hypothetical protein POPTR_0010s10910g             204   7e-59   
ref|XP_008220984.1|  PREDICTED: UBX domain-containing protein 2 i...    203   1e-58   Prunus mume [ume]
ref|XP_008220982.1|  PREDICTED: UBX domain-containing protein 2 i...    203   1e-58   Prunus mume [ume]
gb|EYU30240.1|  hypothetical protein MIMGU_mgv1a006061mg                202   3e-58   Erythranthe guttata [common monkey flower]
ref|XP_010043889.1|  PREDICTED: UBX domain-containing protein 2 i...    202   4e-58   Eucalyptus grandis [rose gum]
gb|EYU30239.1|  hypothetical protein MIMGU_mgv1a006061mg                202   5e-58   Erythranthe guttata [common monkey flower]
gb|EYU30237.1|  hypothetical protein MIMGU_mgv1a006061mg                202   5e-58   Erythranthe guttata [common monkey flower]
ref|XP_010043888.1|  PREDICTED: UBX domain-containing protein 2 i...    201   6e-58   Eucalyptus grandis [rose gum]
ref|XP_009351643.1|  PREDICTED: UBX domain-containing protein 2 i...    200   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_009351642.1|  PREDICTED: UBX domain-containing protein 2 i...    200   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_009351644.1|  PREDICTED: UBX domain-containing protein 2 i...    200   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_010270775.1|  PREDICTED: UBX domain-containing protein 2 i...    198   6e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010270774.1|  PREDICTED: UBX domain-containing protein 2 i...    198   9e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010270773.1|  PREDICTED: UBX domain-containing protein 2 i...    198   1e-56   Nelumbo nucifera [Indian lotus]
gb|AFK39103.1|  unknown                                                 187   2e-55   Lotus japonicus
ref|XP_011021683.1|  PREDICTED: UBX domain-containing protein 2-like    193   9e-55   Populus euphratica
gb|EPS73806.1|  hypothetical protein M569_00949                         192   1e-54   Genlisea aurea
gb|KDO53548.1|  hypothetical protein CISIN_1g013325mg                   186   3e-54   Citrus sinensis [apfelsine]
ref|XP_004509607.1|  PREDICTED: UBX domain-containing protein 7-like    192   3e-54   Cicer arietinum [garbanzo]
ref|XP_010088526.1|  UBX domain-containing protein 2                    192   4e-54   Morus notabilis
gb|KDO53547.1|  hypothetical protein CISIN_1g013325mg                   186   2e-53   Citrus sinensis [apfelsine]
ref|XP_006420698.1|  hypothetical protein CICLE_v10005240mg             185   9e-53   
gb|KJB30688.1|  hypothetical protein B456_005G158000                    186   2e-52   Gossypium raimondii
gb|KJB30689.1|  hypothetical protein B456_005G158000                    186   2e-52   Gossypium raimondii
ref|XP_007045357.1|  UBX domain-containing protein isoform 2            186   2e-52   
ref|XP_007045358.1|  UBX domain-containing protein isoform 3            186   3e-52   
ref|XP_002521873.1|  UBX domain-containing protein, putative            186   3e-52   
ref|XP_007045356.1|  UBX domain-containing protein isoform 1            187   3e-52   
gb|KDO53543.1|  hypothetical protein CISIN_1g013325mg                   186   3e-52   Citrus sinensis [apfelsine]
ref|XP_003547850.1|  PREDICTED: UBX domain-containing protein 7-l...    186   3e-52   Glycine max [soybeans]
ref|XP_006470883.1|  PREDICTED: UBX domain-containing protein 2-like    186   4e-52   Citrus sinensis [apfelsine]
gb|KDO53544.1|  hypothetical protein CISIN_1g013325mg                   186   4e-52   Citrus sinensis [apfelsine]
gb|KHG06883.1|  UBX domain-containing 7                                 186   4e-52   Gossypium arboreum [tree cotton]
gb|KJB30690.1|  hypothetical protein B456_005G158000                    186   4e-52   Gossypium raimondii
gb|KJB30687.1|  hypothetical protein B456_005G158000                    186   4e-52   Gossypium raimondii
ref|XP_012072428.1|  PREDICTED: UBX domain-containing protein 2 i...    185   5e-52   Jatropha curcas
ref|XP_012072427.1|  PREDICTED: UBX domain-containing protein 2 i...    185   7e-52   Jatropha curcas
ref|XP_003531952.1|  PREDICTED: UBX domain-containing protein 7-l...    180   9e-50   Glycine max [soybeans]
ref|XP_008456878.1|  PREDICTED: UBX domain-containing protein 2         179   1e-49   
ref|XP_010680042.1|  PREDICTED: UBX domain-containing protein 2         179   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007156392.1|  hypothetical protein PHAVU_003G282600g             179   3e-49   Phaseolus vulgaris [French bean]
ref|XP_003628976.1|  UBX domain-containing protein                      176   2e-48   Medicago truncatula
ref|XP_010554359.1|  PREDICTED: UBX domain-containing protein 2-like    176   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_010527851.1|  PREDICTED: UBX domain-containing protein 2 i...    172   4e-47   Tarenaya hassleriana [spider flower]
ref|XP_008389121.1|  PREDICTED: UBX domain-containing protein 2-l...    171   2e-46   Malus domestica [apple tree]
ref|XP_008389120.1|  PREDICTED: UBX domain-containing protein 2-l...    170   3e-46   Malus domestica [apple tree]
ref|XP_008389122.1|  PREDICTED: UBX domain-containing protein 2-l...    170   3e-46   Malus domestica [apple tree]
ref|XP_002890064.1|  UBX domain-containing protein                      170   7e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_010476513.1|  PREDICTED: UBX domain-containing protein 2-like    169   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010496241.1|  PREDICTED: UBX domain-containing protein 2-like    169   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010458959.1|  PREDICTED: UBX domain-containing protein 2-like    168   2e-45   Camelina sativa [gold-of-pleasure]
emb|CDY69105.1|  BnaCnng61890D                                          168   2e-45   Brassica napus [oilseed rape]
ref|XP_006307428.1|  hypothetical protein CARUB_v10009052mg             168   3e-45   Capsella rubella
ref|XP_004140414.1|  PREDICTED: UBX domain-containing protein 2         167   4e-45   Cucumis sativus [cucumbers]
ref|XP_010935375.1|  PREDICTED: UBX domain-containing protein 5 i...    166   1e-44   
ref|XP_010935374.1|  PREDICTED: UBX domain-containing protein 2 i...    165   2e-44   Elaeis guineensis
ref|XP_006416998.1|  hypothetical protein EUTSA_v10007578mg             165   5e-44   Eutrema salsugineum [saltwater cress]
ref|NP_563954.1|  UBX domain-containing protein                         164   8e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDY45269.1|  BnaA06g09390D                                          162   5e-43   Brassica napus [oilseed rape]
ref|XP_009148836.1|  PREDICTED: UBX domain-containing protein 2         160   2e-42   Brassica rapa
ref|XP_004297788.1|  PREDICTED: UBX domain-containing protein 2 i...    159   9e-42   Fragaria vesca subsp. vesca
ref|XP_008804300.1|  PREDICTED: UBX domain-containing protein 7         158   9e-42   Phoenix dactylifera
ref|XP_011463491.1|  PREDICTED: UBX domain-containing protein 2 i...    159   1e-41   Fragaria vesca subsp. vesca
ref|XP_009401234.1|  PREDICTED: UBX domain-containing protein 2         156   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007052064.1|  UBX domain-containing protein                      149   2e-38   
ref|XP_009398016.1|  PREDICTED: UBX domain-containing protein 2-like    142   7e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN06997.1|  UBX domain-containing protein 7                         141   3e-35   Glycine soja [wild soybean]
ref|XP_009773267.1|  PREDICTED: uncharacterized protein LOC104223510    134   4e-35   Nicotiana sylvestris
ref|XP_007045359.1|  UBX domain-containing protein isoform 4            139   6e-35   
ref|NP_001077535.1|  UBX domain-containing protein                      138   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110537.1|  PREDICTED: UBX domain-containing protein 2-like    133   1e-32   Brassica rapa
gb|AFW59833.1|  hypothetical protein ZEAMMB73_017157                    121   4e-30   
ref|XP_006855568.1|  PREDICTED: UBX domain-containing protein 2 i...    125   1e-29   Amborella trichopoda
ref|XP_011627484.1|  PREDICTED: UBX domain-containing protein 2 i...    125   1e-29   Amborella trichopoda
gb|AEV41029.1|  putative UBX domain-containing protein                  124   2e-29   Oryza minuta
gb|AEV40978.1|  putative UBX domain-containing protein                  124   2e-29   Oryza punctata
ref|NP_001170636.1|  uncharacterized protein LOC100384688               124   2e-29   Zea mays [maize]
tpg|DAA35439.1|  TPA: hypothetical protein ZEAMMB73_856149              124   3e-29   
ref|XP_002447303.1|  hypothetical protein SORBIDRAFT_06g032400          124   3e-29   Sorghum bicolor [broomcorn]
ref|XP_008668717.1|  PREDICTED: UBX domain-containing protein 2-like    123   5e-29   
ref|XP_004960126.1|  PREDICTED: UBX domain-containing protein 2-like    121   2e-28   Setaria italica
ref|XP_010240593.1|  PREDICTED: UBX domain-containing protein 7 i...    118   8e-28   
gb|EYU24728.1|  hypothetical protein MIMGU_mgv1a025994mg                117   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_003580790.1|  PREDICTED: UBX domain-containing protein 2 i...    118   2e-27   Brachypodium distachyon [annual false brome]
gb|AEV41122.1|  putative UBX domain-containing protein                  115   2e-26   Oryza officinalis
emb|CAE02831.2|  OSJNBa0043A12.36                                       114   8e-26   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK05667.1|  predicted protein                                      114   8e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KGN50781.1|  hypothetical protein Csa_5G259710                       106   1e-24   Cucumis sativus [cucumbers]
ref|XP_001758899.1|  predicted protein                                  107   1e-23   
gb|AAF63167.1|AC010657_3  T5E21.7                                       102   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009759130.1|  PREDICTED: UBX domain-containing protein 7-like  99.8    5e-21   Nicotiana sylvestris
ref|XP_010527852.1|  PREDICTED: UBX domain-containing protein 2 i...  96.7    7e-20   Tarenaya hassleriana [spider flower]
ref|XP_008801336.1|  PREDICTED: UBX domain-containing protein 2-like  95.1    2e-19   
ref|XP_009601783.1|  PREDICTED: uncharacterized protein LOC104097...  95.1    2e-19   Nicotiana tomentosiformis
ref|XP_006343881.1|  PREDICTED: UBX domain-containing protein 7-like  95.1    3e-19   Solanum tuberosum [potatoes]
ref|XP_010325366.1|  PREDICTED: LOW QUALITY PROTEIN: UBX domain-c...  91.3    5e-18   
ref|XP_010253434.1|  PREDICTED: UBX domain-containing protein 7-like  90.9    6e-18   Nelumbo nucifera [Indian lotus]
ref|XP_006414812.1|  hypothetical protein EUTSA_v10027208mg           90.1    1e-17   
tpg|DAA35438.1|  TPA: hypothetical protein ZEAMMB73_856149            89.0    5e-17   
ref|XP_009599661.1|  PREDICTED: UBX domain-containing protein 7 h...  87.0    1e-16   Nicotiana tomentosiformis
emb|CDX84023.1|  BnaC08g16220D                                        87.8    2e-16   
gb|KDO53545.1|  hypothetical protein CISIN_1g013325mg                 86.3    2e-16   Citrus sinensis [apfelsine]
ref|XP_008342902.1|  PREDICTED: LOW QUALITY PROTEIN: membrane-ass...  84.3    4e-16   
ref|XP_009139538.1|  PREDICTED: UBX domain-containing protein 2       84.3    2e-15   Brassica rapa
gb|KDO48110.1|  hypothetical protein CISIN_1g021440mg                 82.4    3e-15   Citrus sinensis [apfelsine]
gb|KDO48111.1|  hypothetical protein CISIN_1g021440mg                 82.4    3e-15   Citrus sinensis [apfelsine]
ref|XP_006480638.1|  PREDICTED: UBX domain-containing protein 7-l...  80.9    5e-15   
ref|XP_006480637.1|  PREDICTED: UBX domain-containing protein 7-l...  80.9    8e-15   
ref|XP_006480635.1|  PREDICTED: UBX domain-containing protein 7-l...  80.9    8e-15   
ref|XP_006480636.1|  PREDICTED: UBX domain-containing protein 7-l...  80.9    8e-15   
ref|XP_006653862.1|  PREDICTED: UBX domain-containing protein 2-like  81.6    1e-14   
ref|XP_009601784.1|  PREDICTED: uncharacterized protein LOC104097...  79.7    4e-14   Nicotiana tomentosiformis
emb|CDY01207.1|  BnaA04g06120D                                        80.5    1e-13   
gb|EEE61882.1|  hypothetical protein OsJ_16574                        79.0    1e-13   Oryza sativa Japonica Group [Japonica rice]
gb|AIE88273.1|  hypothetical protein OG_BBa0063K01.4                  78.2    4e-13   Oryza glaberrima
ref|XP_006414811.1|  hypothetical protein EUTSA_v10027532mg           77.8    4e-13   
gb|EMT10976.1|  hypothetical protein F775_30110                       76.6    8e-13   
gb|EMS63720.1|  UBX domain-containing protein 7                       76.6    1e-12   Triticum urartu
ref|XP_003604178.1|  UBX domain-containing protein                    73.6    4e-12   Medicago truncatula
emb|CDY68911.1|  BnaAnng28760D                                        74.7    4e-12   Brassica napus [oilseed rape]
ref|XP_006446591.1|  hypothetical protein CICLE_v10017670mg           72.8    1e-11   Citrus clementina [clementine]
ref|XP_006470475.1|  PREDICTED: UBX domain-containing protein 7-like  72.4    2e-11   
sp|P0DKI4.1|PUX14_ARATH  RecName: Full=Putative plant UBX domain-...  71.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KDO55137.1|  hypothetical protein CISIN_1g036413mg                 70.5    7e-11   Citrus sinensis [apfelsine]
ref|NP_193161.3|  UBX domain-containing pseudogene                    70.1    2e-10   
ref|NP_001190727.1|  UBX domain-containing pseudogene                 70.1    2e-10   
emb|CAB10204.1|  hypothetical protein                                 69.7    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414754.1|  hypothetical protein EUTSA_v10027144mg           68.2    5e-10   
ref|NP_001054216.1|  Os04g0670800                                     67.0    1e-09   
gb|KEH28537.1|  UBX domain protein                                    65.5    2e-09   Medicago truncatula
gb|KGN50782.1|  hypothetical protein Csa_5G259720                     63.9    2e-09   Cucumis sativus [cucumbers]
ref|XP_003604169.1|  UBX domain-containing protein                    65.5    3e-09   
gb|KEH28538.1|  UBX domain protein                                    65.5    3e-09   Medicago truncatula
gb|KFK22408.1|  hypothetical protein AALP_AAs65522U000100             65.9    4e-09   Arabis alpina [alpine rockcress]
gb|AEV41076.1|  putative UBX domain-containing protein                65.5    5e-09   Oryza minuta
ref|XP_010519462.1|  PREDICTED: UBX domain-containing protein 2-like  65.1    5e-09   Tarenaya hassleriana [spider flower]
ref|XP_002868299.1|  predicted protein                                64.3    2e-08   
ref|XP_007222574.1|  hypothetical protein PRUPE_ppa008429mg           62.8    3e-08   
ref|XP_010436606.1|  PREDICTED: UBX domain-containing protein 2-like  60.5    2e-07   
ref|XP_010445452.1|  PREDICTED: UBX domain-containing protein 7       60.1    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_005643712.1|  hypothetical protein COCSUDRAFT_59648            58.5    1e-06   Coccomyxa subellipsoidea C-169
ref|XP_010450078.1|  PREDICTED: UBX domain-containing protein 2-like  57.8    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_005796061.1|  PREDICTED: UBX domain-containing protein 7-like  57.8    2e-06   Xiphophorus maculatus
ref|XP_007884078.1|  PREDICTED: UBX domain-containing protein 7 i...  57.4    2e-06   Callorhinchus milii [Australian ghost shark]
ref|XP_006285935.1|  hypothetical protein CARUB_v10007447mg           57.4    3e-06   
gb|KFK22146.1|  hypothetical protein AALP_AAs62910U000300             57.4    3e-06   Arabis alpina [alpine rockcress]
ref|XP_007884019.1|  PREDICTED: UBX domain-containing protein 7 i...  56.2    6e-06   Callorhinchus milii [Australian ghost shark]
ref|XP_002874517.1|  predicted protein                                55.8    8e-06   
ref|XP_005303673.1|  PREDICTED: UBX domain-containing protein 7       55.8    1e-05   
emb|CDY12746.1|  BnaC04g28950D                                        55.5    1e-05   Brassica napus [oilseed rape]
ref|XP_004079303.2|  PREDICTED: UBX domain-containing protein 7       55.5    1e-05   
gb|KFO81222.1|  UBX domain-containing protein 7                       55.1    2e-05   Cuculus canorus
ref|XP_006414759.1|  hypothetical protein EUTSA_v10027233mg           55.1    2e-05   
ref|XP_010792284.1|  PREDICTED: UBX domain-containing protein 7       54.7    2e-05   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009566058.1|  PREDICTED: UBX domain-containing protein 7       55.1    2e-05   Cuculus canorus
ref|XP_005721383.1|  PREDICTED: UBX domain-containing protein 7-like  55.1    2e-05   Pundamilia nyererei
ref|XP_010741940.1|  PREDICTED: LOW QUALITY PROTEIN: UBX domain-c...  55.1    2e-05   
ref|XP_007431490.1|  PREDICTED: UBX domain-containing protein 7 i...  54.7    2e-05   Python bivittatus
ref|XP_007559513.1|  PREDICTED: UBX domain-containing protein 7       54.7    2e-05   Poecilia formosa
ref|XP_008432356.1|  PREDICTED: UBX domain-containing protein 7       54.7    2e-05   Poecilia reticulata
ref|XP_001373967.2|  PREDICTED: UBX domain-containing protein 7       54.7    2e-05   Monodelphis domestica
ref|XP_008332241.1|  PREDICTED: UBX domain-containing protein 7       54.7    2e-05   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004542734.1|  PREDICTED: UBX domain-containing protein 7-like  54.7    2e-05   Maylandia zebra
ref|XP_005151293.1|  PREDICTED: UBX domain-containing protein 7       54.7    2e-05   Melopsittacus undulatus
ref|XP_004373649.1|  PREDICTED: UBX domain-containing protein 7       54.7    3e-05   Trichechus manatus latirostris
ref|XP_003438186.2|  PREDICTED: UBX domain-containing protein 7       54.7    3e-05   
ref|XP_006786563.1|  PREDICTED: UBX domain-containing protein 7-like  54.7    3e-05   Neolamprologus brichardi [lyretail cichlid]
ref|XP_002886675.1|  predicted protein                                53.9    3e-05   
ref|XP_010022496.1|  PREDICTED: UBX domain-containing protein 7       53.9    4e-05   Nestor notabilis
ref|XP_003978227.1|  PREDICTED: UBX domain-containing protein 7       53.9    5e-05   Takifugu rubripes [tiger puffer]
ref|XP_007537896.1|  PREDICTED: UBX domain-containing protein 7 i...  53.5    6e-05   Erinaceus europaeus [common hedgehog]
gb|KFP66219.1|  UBX domain-containing protein 7                       53.1    7e-05   Cariama cristata
ref|XP_008283973.1|  PREDICTED: UBX domain-containing protein 7       53.1    7e-05   Stegastes partitus
ref|XP_006124906.1|  PREDICTED: UBX domain-containing protein 7       53.1    7e-05   
emb|CAG07636.1|  unnamed protein product                              53.1    8e-05   Tetraodon nigroviridis
ref|XP_006010569.1|  PREDICTED: UBX domain-containing protein 7       53.1    8e-05   
ref|XP_003218371.1|  PREDICTED: UBX domain-containing protein 7       53.1    8e-05   Anolis carolinensis [Carolina anole]
ref|XP_009139540.1|  PREDICTED: UBX domain-containing protein 7-like  52.8    1e-04   Brassica rapa
sp|P0DKI5.1|PUX16_ARATH  RecName: Full=Plant UBX domain-containin...  52.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005529566.1|  PREDICTED: UBX domain-containing protein 7       52.8    1e-04   
ref|XP_008499110.1|  PREDICTED: UBX domain-containing protein 7       52.4    1e-04   Calypte anna
gb|KFP06318.1|  UBX domain-containing protein 7                       52.4    1e-04   Calypte anna
ref|XP_422667.3|  PREDICTED: UBX domain-containing protein 7 isof...  52.4    1e-04   
gb|EMC77931.1|  UBX domain-containing protein 7                       52.0    2e-04   
ref|XP_010157159.1|  PREDICTED: UBX domain-containing protein 7       52.0    2e-04   Eurypyga helias
gb|KFW11978.1|  UBX domain-containing protein 7                       52.0    2e-04   Eurypyga helias
ref|XP_010490003.1|  PREDICTED: UBX domain-containing protein 2-like  51.6    2e-04   
ref|XP_009939092.1|  PREDICTED: UBX domain-containing protein 7       52.0    2e-04   Opisthocomus hoazin [hoatzin]
ref|XP_009995047.1|  PREDICTED: UBX domain-containing protein 7       52.0    2e-04   Chaetura pelagica
gb|KFR15588.1|  UBX domain-containing protein 7                       52.0    2e-04   Opisthocomus hoazin [hoatzin]
emb|CDY01206.1|  BnaA04g06130D                                        51.6    2e-04   
ref|XP_646734.1|  UAS domain-containing protein                       51.6    2e-04   Dictyostelium discoideum AX4
ref|XP_010519525.1|  PREDICTED: UBX domain-containing protein 2-like  51.6    2e-04   Tarenaya hassleriana [spider flower]
gb|KFW91268.1|  UBX domain-containing protein 7                       51.6    3e-04   Phalacrocorax carbo [common cormorant]
ref|XP_009503466.1|  PREDICTED: UBX domain-containing protein 7       51.6    3e-04   Phalacrocorax carbo [common cormorant]
ref|XP_009642777.1|  PREDICTED: UBX domain-containing protein 7       51.6    3e-04   Egretta garzetta
gb|KFQ45369.1|  UBX domain-containing protein 7                       51.2    3e-04   Nestor notabilis
ref|XP_005050918.1|  PREDICTED: UBX domain-containing protein 7       51.6    3e-04   
dbj|BAC85247.1|  unnamed protein product                              50.4    3e-04   Homo sapiens [man]
ref|XP_009139539.1|  PREDICTED: UBX domain-containing protein 2-like  51.2    3e-04   Brassica rapa
ref|XP_009584874.1|  PREDICTED: UBX domain-containing protein 7       51.2    3e-04   Fulmarus glacialis
gb|KFP20656.1|  UBX domain-containing protein 7                       51.2    3e-04   Egretta garzetta
gb|KFO08321.1|  UBX domain-containing protein 7                       51.2    3e-04   Balearica regulorum gibbericeps
ref|XP_010311687.1|  PREDICTED: UBX domain-containing protein 7       51.2    3e-04   Balearica regulorum gibbericeps
gb|KFV98068.1|  UBX domain-containing protein 7                       51.2    3e-04   Fulmarus glacialis
gb|KFZ68476.1|  UBX domain-containing protein 7                       51.2    4e-04   Podiceps cristatus
gb|KFW86225.1|  UBX domain-containing protein 7                       50.8    4e-04   Manacus vitellinus
gb|KFQ00398.1|  UBX domain-containing protein 7                       50.8    4e-04   Haliaeetus albicilla
ref|XP_008928489.1|  PREDICTED: UBX domain-containing protein 7       50.8    4e-04   
emb|CDQ70866.1|  unnamed protein product                              51.2    4e-04   Oncorhynchus mykiss
gb|EOA95320.1|  UBX domain-containing protein 7                       50.8    4e-04   Anas platyrhynchos [duck]
ref|XP_010130823.1|  PREDICTED: UBX domain-containing protein 7       50.8    4e-04   Buceros rhinoceros silvestris
gb|KFV57093.1|  UBX domain-containing protein 7                       50.8    4e-04   Tyto alba [Schleiereule]
gb|KFP92412.1|  UBX domain-containing protein 7                       50.8    4e-04   Apaloderma vittatum
ref|XP_005028141.1|  PREDICTED: UBX domain-containing protein 7       50.8    4e-04   
gb|KFO87511.1|  UBX domain-containing protein 7                       50.8    4e-04   Buceros rhinoceros silvestris
gb|KFV14929.1|  UBX domain-containing protein 7                       50.8    4e-04   Pterocles gutturalis
gb|KFQ95214.1|  UBX domain-containing protein 7                       50.8    4e-04   Nipponia nippon
ref|XP_010559592.1|  PREDICTED: UBX domain-containing protein 7       50.8    4e-04   Haliaeetus leucocephalus
gb|KFP38427.1|  UBX domain-containing protein 7                       50.8    4e-04   Chlamydotis macqueenii
ref|XP_005241643.1|  PREDICTED: UBX domain-containing protein 7       50.8    4e-04   
ref|XP_011593203.1|  PREDICTED: UBX domain-containing protein 7 i...  50.8    4e-04   Aquila chrysaetos canadensis
ref|XP_009875011.1|  PREDICTED: UBX domain-containing protein 7       50.8    4e-04   Apaloderma vittatum
gb|KFP51814.1|  UBX domain-containing protein 7                       50.8    4e-04   Cathartes aura
ref|XP_009912522.1|  PREDICTED: UBX domain-containing protein 7 i...  50.8    4e-04   Haliaeetus albicilla
gb|KFM11413.1|  UBX domain-containing protein 7                       50.8    4e-04   Aptenodytes forsteri
ref|XP_010081335.1|  PREDICTED: UBX domain-containing protein 7       50.8    4e-04   Pterocles gutturalis
ref|XP_009897769.1|  PREDICTED: UBX domain-containing protein 7       50.8    4e-04   Picoides pubescens
ref|XP_009969814.1|  PREDICTED: UBX domain-containing protein 7       50.8    4e-04   Tyto alba [Schleiereule]
ref|XP_009283288.1|  PREDICTED: UBX domain-containing protein 7       50.8    5e-04   Aptenodytes forsteri
gb|KFW66282.1|  UBX domain-containing protein 7                       50.8    5e-04   Pygoscelis adeliae
ref|XP_005344897.1|  PREDICTED: UBX domain-containing protein 7       50.8    5e-04   Microtus ochrogaster [prairie voles]
ref|XP_010290507.1|  PREDICTED: UBX domain-containing protein 7       50.8    5e-04   Phaethon lepturus
ref|XP_009321171.1|  PREDICTED: UBX domain-containing protein 7       50.8    5e-04   Pygoscelis adeliae
gb|KFV66581.1|  UBX domain-containing protein 7                       50.8    5e-04   Picoides pubescens
gb|KFQ80041.1|  UBX domain-containing protein 7                       50.8    5e-04   Phaethon lepturus
ref|XP_008836748.1|  PREDICTED: UBX domain-containing protein 7       50.8    5e-04   Nannospalax galili
ref|XP_010124459.1|  PREDICTED: UBX domain-containing protein 7       50.4    5e-04   Chlamydotis macqueenii
gb|KGL73458.1|  UBX domain-containing protein 7                       50.4    6e-04   Tinamus guttatus
ref|XP_007883905.1|  PREDICTED: UBX domain-containing protein 7 i...  50.4    6e-04   Callorhinchus milii [Australian ghost shark]
emb|CDY12747.1|  BnaC04g28940D                                        50.4    6e-04   Brassica napus [oilseed rape]
gb|AGH62811.1|  UBX1                                                  50.1    7e-04   Brassica napus [oilseed rape]
gb|KDR07635.1|  UBX domain-containing protein 7                       50.4    7e-04   Zootermopsis nevadensis
gb|KFO55952.1|  UBX domain-containing protein 7                       50.4    7e-04   Corvus brachyrhynchos
ref|XP_008627792.1|  PREDICTED: UBX domain-containing protein 7       50.1    7e-04   
ref|XP_008767028.1|  PREDICTED: UBX domain-containing protein 7-l...  49.7    7e-04   Rattus norvegicus [brown rat]
gb|KGL93583.1|  UBX domain-containing protein 7                       50.1    7e-04   Charadrius vociferus
ref|XP_009883704.1|  PREDICTED: UBX domain-containing protein 7       50.1    8e-04   Charadrius vociferus
ref|NP_001001951.1|  UBX domain-containing protein 7                  50.1    8e-04   Danio rerio [leopard danio]



>emb|CDP07923.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 148/189 (78%), Gaps = 8/189 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG LS ++QQ+LV+SFLEIAVGQ+ADTARQFLQATSWKL+EA+QLFY+GN+GG AA S+
Sbjct  1    MDGVLSPADQQSLVSSFLEIAVGQTADTARQFLQATSWKLDEAIQLFYIGNEGGAAASSA  60

Query  336  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
             SP LE+  P      S  SG+     D++ +QGD D+VRPPLPVIRDVLYD  ++ G  
Sbjct  61   QSPQLESDLP--LDDPSLRSGTRTDLEDQNIRQGDGDDVRPPLPVIRDVLYDNTMLFGAS  118

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGS  677
             MGGS+HEAR+VVPFRNFE+E+K PGVWET+  S      S  NLASLYRPPFALMY GS
Sbjct  119  RMGGSSHEARAVVPFRNFEEELKRPGVWETENGSASTVDKSQYNLASLYRPPFALMYQGS  178

Query  678  FEKAKDAAR  704
            FEKAKDAAR
Sbjct  179  FEKAKDAAR  187



>ref|XP_004236895.1| PREDICTED: UBX domain-containing protein 2 [Solanum lycopersicum]
Length=466

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 143/188 (76%), Gaps = 8/188 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG +SAS+QQ LV+SFLEIAVGQ+ADTARQFLQATSWKLEEA+QLFY+GN+GG AA  +
Sbjct  1    MDGVMSASDQQMLVSSFLEIAVGQTADTARQFLQATSWKLEEAIQLFYIGNEGGAAASFN  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
               L N A        S+SG    S D +  QGD D+VRPPLPV R+VLYD AV+ G   
Sbjct  61   SPQLGNDA---LLGDPSLSGVGNDSADTNLLQGDGDDVRPPLPVKREVLYDNAVLYGSSG  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            MGGS+ E R VVPFRNFE+EMKHPGVWE +K S S      DNLASLYRPPFALMYHGSF
Sbjct  118  MGGSSREPRLVVPFRNFEEEMKHPGVWEAEKRSTSTADAAQDNLASLYRPPFALMYHGSF  177

Query  681  EKAKDAAR  704
            EKAKDAAR
Sbjct  178  EKAKDAAR  185



>ref|XP_006355016.1| PREDICTED: UBX domain-containing protein 2-like [Solanum tuberosum]
Length=462

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 143/188 (76%), Gaps = 8/188 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG +SAS+QQ LV+SFLEIAVGQ+ADTARQFLQATSWKLEEA+QLFY+GN+ G AA  +
Sbjct  1    MDGVMSASDQQMLVSSFLEIAVGQTADTARQFLQATSWKLEEAIQLFYIGNESGAAAFFN  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
               L N A        S+SG +  S D +  QGD D+VRPPLPV R+VLYD AV+ G   
Sbjct  61   SPQLGNDA---LLGDPSLSGVVNDSVDTNLVQGDGDDVRPPLPVKREVLYDNAVLYGSSG  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            MGGS+ E R VVPFRNFE+EMKHPGVWE +K S S      DNLASLYRPPFALMYHGSF
Sbjct  118  MGGSSREPRLVVPFRNFEEEMKHPGVWEAEKRSTSTADAAQDNLASLYRPPFALMYHGSF  177

Query  681  EKAKDAAR  704
            EKAKDAAR
Sbjct  178  EKAKDAAR  185



>ref|XP_010654914.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Vitis 
vinifera]
Length=453

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 143/188 (76%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LSA ++Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  A SS
Sbjct  1    MESILSA-DKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGTMAASS  59

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            YS P+EN +P       S SGS K   +E+  Q D DEVRPPLPVIR+ LYD A++ G+ 
Sbjct  60   YSPPIENISP---LPDQSSSGSRKDIENENVVQDDGDEVRPPLPVIREALYDDAMLYGVS  116

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGS  677
              G  +HEA S+V FRNF+ EMK PG+WE++K     A NS DNLASLYRPPFALM+HG 
Sbjct  117  RGGYPSHEASSLVAFRNFDDEMKRPGIWESEKGATSTAENSRDNLASLYRPPFALMHHGP  176

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  177  FEKAKVAA  184



>ref|XP_011070500.1| PREDICTED: UBX domain-containing protein 2 [Sesamum indicum]
Length=453

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 140/190 (74%), Gaps = 11/190 (6%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS ++QQ LV+SFLEIAVG++A+TARQFLQAT WKLEEA+QLFYVGN+G +A PS 
Sbjct  3    MEGVLSPTDQQKLVSSFLEIAVGETAETARQFLQATGWKLEEAIQLFYVGNEGRIATPSV  62

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            YS P E+  P       S    +     + + + D ++VRPPLPV RDVLYD  ++ G  
Sbjct  63   YSPPTESDLP----LNDSNLSELGKELVDKDVRQDGEDVRPPLPVKRDVLYDNRMLYGGA  118

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYHG  674
             +GGS++ + +VVPFRNFE+EMKHPGVWE ++ S+S+      DNLASLYRPPFALM+HG
Sbjct  119  RLGGSSYASHTVVPFRNFEEEMKHPGVWEAEEGSSSSVADKTQDNLASLYRPPFALMFHG  178

Query  675  SFEKAKDAAR  704
             FEKAKD AR
Sbjct  179  PFEKAKDEAR  188



>ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Vitis 
vinifera]
 emb|CBI27509.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 143/188 (76%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LSA ++Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  A SS
Sbjct  1    MESILSA-DKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGTMAASS  59

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            YS P+EN +P       S SGS K   +E+  Q D DEVRPPLPVIR+ LYD A++ G+ 
Sbjct  60   YSPPIENISP---LPDQSSSGSRKDIENENVVQDDGDEVRPPLPVIREALYDDAMLYGVS  116

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGS  677
              G  +HEA S+V FRNF+ EMK PG+WE++K     A NS DNLASLYRPPFALM+HG 
Sbjct  117  RGGYPSHEASSLVAFRNFDDEMKRPGIWESEKGATSTAENSRDNLASLYRPPFALMHHGP  176

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  177  FEKAKVAA  184



>ref|XP_009587838.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana tomentosiformis]
Length=453

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 145/188 (77%), Gaps = 8/188 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG +SA++QQ LV+SFLEIAVGQ+ADTARQFLQATSWKL+EA+QLFY+GN+ G AA  +
Sbjct  1    MDGVMSATDQQILVSSFLEIAVGQTADTARQFLQATSWKLDEAIQLFYIGNEAGAAASFN  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             S L N A       SS+SG++K S D S  QGD D++RPPLPV R+VLYD AV+ G   
Sbjct  61   SSQLGNDA---LLGGSSLSGAVKESADNSWGQGDGDDIRPPLPVKREVLYDNAVLYGSSG  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            +GGS+ E R VVPFRNFE+EMK PGVWE +K S S      DNLASLYRPPFALMYHG F
Sbjct  118  VGGSSREPRLVVPFRNFEEEMKRPGVWEAEKRSISTADAAQDNLASLYRPPFALMYHGPF  177

Query  681  EKAKDAAR  704
            EKAKDAAR
Sbjct  178  EKAKDAAR  185



>ref|XP_002311564.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
 gb|EEE88931.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
Length=455

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 137/187 (73%), Gaps = 11/187 (6%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV A +S
Sbjct  3    MEGMLSANDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVASAS  62

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            + P   T              +K  G+E+   G  +EVR PLPV+RD LYD A++ G   
Sbjct  63   HPPQTET------RTDVHESGLKDFGNENVGPGGGEEVRAPLPVVRDTLYDDAMLYGASR  116

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            MG   HEA S++ FRNF++EMKH GVWE+D+ S S      DNLASLYRPPF LM+HGSF
Sbjct  117  MGHPPHEASSLIAFRNFDEEMKHSGVWESDQGSTSTIDNPRDNLASLYRPPFHLMFHGSF  176

Query  681  EKAKDAA  701
            EKAKDAA
Sbjct  177  EKAKDAA  183



>ref|XP_010654910.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Vitis 
vinifera]
Length=454

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 143/190 (75%), Gaps = 16/190 (8%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LSA ++Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  A SS
Sbjct  1    MESILSA-DKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGTMAASS  59

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVI--RG  506
            YS P+EN +P       S SGS K   +E+  Q D DEVRPPLPVIR+ LYD A++  RG
Sbjct  60   YSPPIENISP---LPDQSSSGSRKDIENENVVQDDGDEVRPPLPVIREALYDDAMLVSRG  116

Query  507  LPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYH  671
                G  +HEA S+V FRNF+ EMK PG+WE++K     A NS DNLASLYRPPFALM+H
Sbjct  117  ----GYPSHEASSLVAFRNFDDEMKRPGIWESEKGATSTAENSRDNLASLYRPPFALMHH  172

Query  672  GSFEKAKDAA  701
            G FEKAK AA
Sbjct  173  GPFEKAKVAA  182



>ref|XP_009775836.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana sylvestris]
Length=454

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 141/188 (75%), Gaps = 8/188 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG  SA++QQ LV+SFLEIAVGQ+ADTARQFLQATSWKL+EA+QLFY+GN+ G AA  +
Sbjct  1    MDGVRSATDQQMLVSSFLEIAVGQTADTARQFLQATSWKLDEAIQLFYIGNEAGAAASFN  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
               L N A        S+SG++K   D S  QGD D++RPPLPV R+VLYD AV+ G   
Sbjct  61   SPELGNDA---LLGDPSLSGAVKDLADNSWGQGDGDDIRPPLPVKREVLYDNAVLYGSSG  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            +GGS+ E R VVPFRNFE+EMK PGVWE +K S S      DNLASLYRPPFALMYHG F
Sbjct  118  VGGSSREPRLVVPFRNFEEEMKRPGVWEAEKRSISTADAAQDNLASLYRPPFALMYHGPF  177

Query  681  EKAKDAAR  704
            EKAKDAAR
Sbjct  178  EKAKDAAR  185



>gb|EYU30238.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 137/190 (72%), Gaps = 10/190 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G  S+ +QQ +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S 
Sbjct  3    MEGFSSSIDQQNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESV  62

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            YS P EN  PL + ++S +   +           D  +VRPPLPV RDVLYD++++ G+ 
Sbjct  63   YSTPAENELPLDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGVQ  119

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYHG  674
             +G S H   SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM+ G
Sbjct  120  RVGDSPHATHSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALMFQG  179

Query  675  SFEKAKDAAR  704
             FEKAKD AR
Sbjct  180  PFEKAKDNAR  189



>ref|XP_011025166.1| PREDICTED: UBX domain-containing protein 7-like [Populus euphratica]
Length=455

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 133/187 (71%), Gaps = 11/187 (6%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV A +S
Sbjct  3    MEGMLSANDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVASAS  62

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            + P   T      S     G+              +EVR PLPV+RD LYD A++ G   
Sbjct  63   HPPQTETRTDVHESGLKDFGNENVGPSGG------EEVRAPLPVVRDTLYDDAMLYGASR  116

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            MG   HEA S++ FRNF++EMKH GVWE+D+ S S      DNLASLYRPPF LM+HGSF
Sbjct  117  MGHPPHEASSLIAFRNFDEEMKHSGVWESDQGSTSTIDNPRDNLASLYRPPFHLMFHGSF  176

Query  681  EKAKDAA  701
            EKAKDA+
Sbjct  177  EKAKDAS  183



>ref|XP_002315828.1| UBX domain-containing family protein [Populus trichocarpa]
 gb|EEF01999.1| UBX domain-containing family protein [Populus trichocarpa]
Length=444

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 132/187 (71%), Gaps = 18/187 (10%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LS +++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GG  A +S
Sbjct  1    MERMLSENDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGAVASAS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            + P   T P             +   +E     D +EVR PLPV+RD LYD A++ G   
Sbjct  61   HPPPTETWP-------------EDLENEKVGHSDGEEVRAPLPVVRDTLYDDAMLYGASR  107

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSF  680
             G   HEA S++ FRNF++EMKHPGVWE+D+ S     NS DNLASLYRPPF LM+HGSF
Sbjct  108  TGYPPHEASSLIAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLMFHGSF  167

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  168  EKAKGAA  174



>ref|XP_006378421.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
 gb|ERP56218.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
Length=451

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 134/187 (72%), Gaps = 11/187 (6%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LS +++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GG  A +S
Sbjct  1    MERMLSENDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGAVASAS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            + P   T P        +   +K   +E     D +EVR PLPV+RD LYD A++ G   
Sbjct  61   HPPPTETWP------EVLESGLKDLENEKVGHSDGEEVRAPLPVVRDTLYDDAMLYGASR  114

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSF  680
             G   HEA S++ FRNF++EMKHPGVWE+D+ S     NS DNLASLYRPPF LM+HGSF
Sbjct  115  TGYPPHEASSLIAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLMFHGSF  174

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  175  EKAKGAA  181



>ref|XP_008220984.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Prunus 
mume]
Length=454

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 132/187 (71%), Gaps = 6/187 (3%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG +SA++QQ LV SFLEIAVGQ+ADTARQFLQAT W+LEEA+QLFYVGN+ G  A ++
Sbjct  1    MDGVISANDQQRLVTSFLEIAVGQTADTARQFLQATGWQLEEAIQLFYVGNEAGSIA-AA  59

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P EN   L D +  +    +    +E+  Q   DEVRPP+PVIRDVLYD A + G P 
Sbjct  60   QPPTENIDHLADQTSGANENVVHHGINENVGQLGEDEVRPPMPVIRDVLYDDAALYGSPR  119

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWE-----TDKASNSADNLASLYRPPFALMYHGSF  680
               S HE+ SV+ FRNFE+EMKHPGVWE     T  A  + DNLASLYRPPF L++ GSF
Sbjct  120  ARFSQHESGSVIAFRNFEEEMKHPGVWESGQGATSSAETARDNLASLYRPPFKLLFQGSF  179

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  180  EKAKGAA  186



>ref|XP_008220982.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Prunus 
mume]
Length=456

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 132/187 (71%), Gaps = 6/187 (3%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG +SA++QQ LV SFLEIAVGQ+ADTARQFLQAT W+LEEA+QLFYVGN+ G  A ++
Sbjct  1    MDGVISANDQQRLVTSFLEIAVGQTADTARQFLQATGWQLEEAIQLFYVGNEAGSIA-AA  59

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P EN   L D +  +    +    +E+  Q   DEVRPP+PVIRDVLYD A + G P 
Sbjct  60   QPPTENIDHLADQTSGANENVVHHGINENVGQLGEDEVRPPMPVIRDVLYDDAALYGSPR  119

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWE-----TDKASNSADNLASLYRPPFALMYHGSF  680
               S HE+ SV+ FRNFE+EMKHPGVWE     T  A  + DNLASLYRPPF L++ GSF
Sbjct  120  ARFSQHESGSVIAFRNFEEEMKHPGVWESGQGATSSAETARDNLASLYRPPFKLLFQGSF  179

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  180  EKAKGAA  186



>gb|EYU30240.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=437

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 137/191 (72%), Gaps = 11/191 (6%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G  S+ +QQ +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S 
Sbjct  3    MEGFSSSIDQQNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESV  62

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG-L  509
            YS P EN  PL + ++S +   +           D  +VRPPLPV RDVLYD++++ G +
Sbjct  63   YSTPAENELPLDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGRV  119

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYH  671
              +G S H   SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM+ 
Sbjct  120  QRVGDSPHATHSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALMFQ  179

Query  672  GSFEKAKDAAR  704
            G FEKAKD AR
Sbjct  180  GPFEKAKDNAR  190



>ref|XP_010043889.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW85907.1| hypothetical protein EUGRSUZ_B02622 [Eucalyptus grandis]
Length=453

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 136/187 (73%), Gaps = 8/187 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LS +E+Q++++SFLEIAVGQ+ADTARQFLQATSWKLEEALQLFYVGN+GGV    S
Sbjct  1    MESLLSPTEKQSMISSFLEIAVGQTADTARQFLQATSWKLEEALQLFYVGNEGGVIGGQS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P  +       +  +   S   +G+E+  Q D DEVRPPLPV R+VLYD A+    PA
Sbjct  61   NPPPVDGG-NAACADENAGVSRNDNGNENIGQHDEDEVRPPLPVRREVLYDDAI--SYPA  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSF  680
            +G  +HE+ S++ FRNF++EMK PGVWE+D+ S     N+ DNLASLYRPPF LMY GSF
Sbjct  118  LGMGSHESSSLIAFRNFDEEMKRPGVWESDQGSTSTAENARDNLASLYRPPFHLMYRGSF  177

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  178  EKAKTAA  184



>gb|EYU30239.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 137/191 (72%), Gaps = 11/191 (6%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G  S+ +QQ +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S 
Sbjct  3    MEGFSSSIDQQNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESV  62

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG-L  509
            YS P EN  PL + ++S +   +           D  +VRPPLPV RDVLYD++++ G +
Sbjct  63   YSTPAENELPLDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGRV  119

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYH  671
              +G S H   SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM+ 
Sbjct  120  QRVGDSPHATHSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALMFQ  179

Query  672  GSFEKAKDAAR  704
            G FEKAKD AR
Sbjct  180  GPFEKAKDNAR  190



>gb|EYU30237.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=459

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 137/191 (72%), Gaps = 11/191 (6%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G  S+ +QQ +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S 
Sbjct  3    MEGFSSSIDQQNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESV  62

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG-L  509
            YS P EN  PL + ++S +   +           D  +VRPPLPV RDVLYD++++ G +
Sbjct  63   YSTPAENELPLDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGRV  119

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYH  671
              +G S H   SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM+ 
Sbjct  120  QRVGDSPHATHSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALMFQ  179

Query  672  GSFEKAKDAAR  704
            G FEKAKD AR
Sbjct  180  GPFEKAKDNAR  190



>ref|XP_010043888.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Eucalyptus 
grandis]
Length=459

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 136/187 (73%), Gaps = 8/187 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LS +E+Q++++SFLEIAVGQ+ADTARQFLQATSWKLEEALQLFYVGN+GGV    S
Sbjct  1    MESLLSPTEKQSMISSFLEIAVGQTADTARQFLQATSWKLEEALQLFYVGNEGGVIGGQS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P  +       +  +   S   +G+E+  Q D DEVRPPLPV R+VLYD A+    PA
Sbjct  61   NPPPVDGG-NAACADENAGVSRNDNGNENIGQHDEDEVRPPLPVRREVLYDDAI--SYPA  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSF  680
            +G  +HE+ S++ FRNF++EMK PGVWE+D+ S     N+ DNLASLYRPPF LMY GSF
Sbjct  118  LGMGSHESSSLIAFRNFDEEMKRPGVWESDQGSTSTAENARDNLASLYRPPFHLMYRGSF  177

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  178  EKAKTAA  184



>ref|XP_009351643.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=454

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 132/187 (71%), Gaps = 7/187 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G +SA++QQTLV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+   ++
Sbjct  1    MEGVMSANDQQTLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMTEAA  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P EN   L + +            +E+ +Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDQLAEQASGVNENVALPGVNENVEQFADDEVRAPMPVIRDVLYDDMSLYGAPR  120

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
               S H   SV+ FRNFE+EMKHPGVWE+D+ + S+     DNLASLYRPPF L++ GSF
Sbjct  121  ARFSQH--GSVIAFRNFEEEMKHPGVWESDQGATSSANAVQDNLASLYRPPFKLLFQGSF  178

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  179  EKAKSAA  185



>ref|XP_009351642.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=457

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 132/187 (71%), Gaps = 7/187 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G +SA++QQTLV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+   ++
Sbjct  1    MEGVMSANDQQTLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMTEAA  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P EN   L + +            +E+ +Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDQLAEQASGVNENVALPGVNENVEQFADDEVRAPMPVIRDVLYDDMSLYGAPR  120

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
               S H   SV+ FRNFE+EMKHPGVWE+D+ + S+     DNLASLYRPPF L++ GSF
Sbjct  121  ARFSQH--GSVIAFRNFEEEMKHPGVWESDQGATSSANAVQDNLASLYRPPFKLLFQGSF  178

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  179  EKAKSAA  185



>ref|XP_009351644.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Pyrus 
x bretschneideri]
Length=452

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 132/187 (71%), Gaps = 7/187 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G +SA++QQTLV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+   ++
Sbjct  1    MEGVMSANDQQTLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMTEAA  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P EN   L + +            +E+ +Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDQLAEQASGVNENVALPGVNENVEQFADDEVRAPMPVIRDVLYDDMSLYGAPR  120

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
               S H   SV+ FRNFE+EMKHPGVWE+D+ + S+     DNLASLYRPPF L++ GSF
Sbjct  121  ARFSQH--GSVIAFRNFEEEMKHPGVWESDQGATSSANAVQDNLASLYRPPFKLLFQGSF  178

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  179  EKAKSAA  185



>ref|XP_010270775.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Nelumbo 
nucifera]
Length=427

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 135/187 (72%), Gaps = 8/187 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  L+A+E+Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  + S 
Sbjct  1    MESVLTATEKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGGPSSSH  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P E+  P       S SG  K   +E+  Q D  EVRPPLPV R+ LYD A++     
Sbjct  61   SPPGEDVQP---LPEESSSGQAKDIVNENVGQDDASEVRPPLPVKREALYDDAMLYRSSR  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            MG  +HE  S++ FRNF++EMK PGVWE+D+++ S      DNLASLYRPPFALM+HG F
Sbjct  118  MGYPSHETSSMIAFRNFDEEMKQPGVWESDQSAASTTDSPRDNLASLYRPPFALMHHGFF  177

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  178  EKAKVAA  184



>ref|XP_010270774.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 135/187 (72%), Gaps = 8/187 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  L+A+E+Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  + S 
Sbjct  1    MESVLTATEKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGGPSSSH  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P E+  P       S SG  K   +E+  Q D  EVRPPLPV R+ LYD A++     
Sbjct  61   SPPGEDVQP---LPEESSSGQAKDIVNENVGQDDASEVRPPLPVKREALYDDAMLYRSSR  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            MG  +HE  S++ FRNF++EMK PGVWE+D+++ S      DNLASLYRPPFALM+HG F
Sbjct  118  MGYPSHETSSMIAFRNFDEEMKQPGVWESDQSAASTTDSPRDNLASLYRPPFALMHHGFF  177

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  178  EKAKVAA  184



>ref|XP_010270773.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=450

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 135/187 (72%), Gaps = 8/187 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  L+A+E+Q++V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  + S 
Sbjct  1    MESVLTATEKQSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGGPSSSH  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P E+  P       S SG  K   +E+  Q D  EVRPPLPV R+ LYD A++     
Sbjct  61   SPPGEDVQP---LPEESSSGQAKDIVNENVGQDDASEVRPPLPVKREALYDDAMLYRSSR  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            MG  +HE  S++ FRNF++EMK PGVWE+D+++ S      DNLASLYRPPFALM+HG F
Sbjct  118  MGYPSHETSSMIAFRNFDEEMKQPGVWESDQSAASTTDSPRDNLASLYRPPFALMHHGFF  177

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  178  EKAKVAA  184



>gb|AFK39103.1| unknown [Lotus japonicus]
Length=195

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 133/186 (72%), Gaps = 9/186 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND-GGVAAPS  332
            M+G LSA EQQ++V+SFLE+A GQ+ADTARQFLQATSWKLEEALQLF +GN+ G V  PS
Sbjct  1    MEGVLSAIEQQSMVSSFLEVAQGQTADTARQFLQATSWKLEEALQLFLIGNEAGAVPPPS  60

Query  333  SYS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGL  509
            S++ PLEN          + S   K + +ES    D ++VRPPLPVIR+ LYD A++ G 
Sbjct  61   SHTPPLENA--DSWTDHQTSSEPRKDAANESSGHNDGEDVRPPLPVIRETLYDDAMLFGA  118

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHG  674
               G    E  ++V FRNFE+EM+ PGVWE+D+ +     +S DNLASLYRPPF LM++G
Sbjct  119  SRFGQRPQEPNALVAFRNFEEEMRRPGVWESDQGAASTPESSRDNLASLYRPPFHLMFNG  178

Query  675  SFEKAK  692
            SF+KAK
Sbjct  179  SFDKAK  184



>ref|XP_011021683.1| PREDICTED: UBX domain-containing protein 2-like [Populus euphratica]
Length=457

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 129/183 (70%), Gaps = 11/183 (6%)
 Frame = +3

Query  168  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPL  347
            LS +++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFY+GN+GG    +S+   
Sbjct  2    LSENDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYLGNEGGAVESASHPLP  61

Query  348  ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGS  527
              T P        +   +K   +E     D DEVR PLPV+RD LYD A++ G    G  
Sbjct  62   AETWP------EVLESGLKDLENEKVGHSDGDEVRAPLPVVRDTLYDDAMLYGASRTGYP  115

Query  528  AHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEKAK  692
              EA S++ FRNF++EMKHPGVWE+D+ S     NS DNLASLYRPPF LM+HGSFEKAK
Sbjct  116  PREASSLIAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLMFHGSFEKAK  175

Query  693  DAA  701
             AA
Sbjct  176  GAA  178



>gb|EPS73806.1| hypothetical protein M569_00949, partial [Genlisea aurea]
Length=451

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 135/193 (70%), Gaps = 21/193 (11%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LS+++QQ +V SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+ N+GG AA SS
Sbjct  2    MEAVLSSTDQQRMVTSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIENEGGSAAASS  61

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIR  503
            +S P EN  P  D S S +              G  D   +VRPPLP  RDVLYD  +  
Sbjct  62   FSFPPENDPPFKDLSRSELDKDF----------GSHDGGEDVRPPLPAKRDVLYDGLLPH  111

Query  504  GLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALM  665
                M G+ + A SVVPFRNF++EM+HPGVWE ++ S+S+      DNLASLYRPPFALM
Sbjct  112  NGERM-GTPYGAPSVVPFRNFQEEMRHPGVWEPERGSSSSMPTKPQDNLASLYRPPFALM  170

Query  666  YHGSFEKAKDAAR  704
            +HGSFEKAKD A+
Sbjct  171  FHGSFEKAKDYAK  183



>gb|KDO53548.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=238

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 125/187 (67%), Gaps = 16/187 (9%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSF  680
                 HE  S++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSF
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSF  169

Query  681  EKAKDAA  701
            EKAKDAA
Sbjct  170  EKAKDAA  176



>ref|XP_004509607.1| PREDICTED: UBX domain-containing protein 7-like [Cicer arietinum]
Length=460

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 137/189 (72%), Gaps = 9/189 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND-GGVAAPS  332
            M+G LS+++QQ+LV+SFLE+A GQ+ADTARQFLQATSWKLEEALQLF +G++ G V AP+
Sbjct  1    MEGMLSSNDQQSLVSSFLEVAQGQTADTARQFLQATSWKLEEALQLFLIGSETGAVPAPA  60

Query  333  SYS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGL  509
            S++ PLEN     D SL S      G+       G  DEVRPP+PVIR+ LYD A++ G 
Sbjct  61   SFTPPLENVDAWTDQSLLSEPRKDTGNQSGGVNDG--DEVRPPIPVIRETLYDDAMLYGG  118

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHG  674
            P +G  + E  S++ FRNFEQE + PGVWE+++     A +S DNLASLYRPPF LM+ G
Sbjct  119  PRLGHLSQEPSSLIAFRNFEQETRRPGVWESEQGAASTAESSRDNLASLYRPPFHLMFTG  178

Query  675  SFEKAKDAA  701
            SF+KAK AA
Sbjct  179  SFDKAKSAA  187



>ref|XP_010088526.1| UBX domain-containing protein 2 [Morus notabilis]
 gb|EXB36443.1| UBX domain-containing protein 2 [Morus notabilis]
Length=486

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 131/189 (69%), Gaps = 8/189 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG-VAAPS  332
            M+G LSAS+QQ++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVG +GG V  PS
Sbjct  24   MEGMLSASDQQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGGEGGAVVEPS  83

Query  333  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            S+SP          + +      +   +      D DEVR PLPVIR+ LYD   I+   
Sbjct  84   SHSPPRENLDAFAENAAREEAERENRNENLGLD-DVDEVRAPLPVIREALYDDPSIQAAS  142

Query  513  AM-GGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHG  674
             M G  +HE+ SV+ FRNF +E++ PGVWE+D+     A NS DNLASLYRPPF LM+HG
Sbjct  143  RMLGYPSHESNSVIAFRNFGEEIRRPGVWESDQGAASTADNSRDNLASLYRPPFHLMFHG  202

Query  675  SFEKAKDAA  701
             FEKAKD A
Sbjct  203  PFEKAKDTA  211



>gb|KDO53547.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=320

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 125/187 (67%), Gaps = 16/187 (9%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSF  680
                 HE  S++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSF
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSF  169

Query  681  EKAKDAA  701
            EKAKDAA
Sbjct  170  EKAKDAA  176



>ref|XP_006420698.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
 gb|ESR33938.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
Length=361

 Score =   185 bits (470),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 125/187 (67%), Gaps = 16/187 (9%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSF  680
                 HE  S++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSF
Sbjct  110  ARYPHHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSF  169

Query  681  EKAKDAA  701
            EKAKDAA
Sbjct  170  EKAKDAA  176



>gb|KJB30688.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=408

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  336  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
             SP +EN     D +   +  S          +    EVRPPLPV+R+ LYD A + G  
Sbjct  61   ESPAVENVDSWVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGAS  116

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGS  677
             +G    ++ S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G 
Sbjct  117  RLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGP  176

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  177  FEKAKAAA  184



>gb|KJB30689.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=430

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 134/195 (69%), Gaps = 24/195 (12%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  336  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRD-------EVRPPLPVIRDVLYDT  491
             SP +EN               +  +  E ++ G+ D       EVRPPLPV+R+ LYD 
Sbjct  61   ESPAVENV-----------DSWVDQNSGELKESGNSDVGPIGGEEVRPPLPVVRETLYDD  109

Query  492  AVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPF  656
            A + G   +G    ++ S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF
Sbjct  110  ASLYGASRLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPF  169

Query  657  ALMYHGSFEKAKDAA  701
             LM+ G FEKAK AA
Sbjct  170  HLMFQGPFEKAKAAA  184



>ref|XP_007045357.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY01189.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
Length=454

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 130/188 (69%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+++Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV A SS
Sbjct  1    MEGILSATDKQRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVASSS  60

Query  336  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
             SP LEN       +   ++     +   +      D+VRPPLPV+R+ LYD  ++ G  
Sbjct  61   ESPALENVDSWASQNSGELNEPANDNVGSTGG----DDVRPPLPVVRETLYDDGMLYGAS  116

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGS  677
             +G    +  S V FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G 
Sbjct  117  RLGYPPQQLSSSVAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGP  176

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  177  FEKAKAAA  184



>ref|XP_007045358.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY01190.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
Length=451

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 130/188 (69%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+++Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV A SS
Sbjct  1    MEGILSATDKQRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVASSS  60

Query  336  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
             SP LEN       +   ++     +   +      D+VRPPLPV+R+ LYD  ++ G  
Sbjct  61   ESPALENVDSWASQNSGELNEPANDNVGSTGG----DDVRPPLPVVRETLYDDGMLYGAS  116

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGS  677
             +G    +  S V FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G 
Sbjct  117  RLGYPPQQLSSSVAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGP  176

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  177  FEKAKAAA  184



>ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis]
 gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis]
Length=452

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 126/188 (67%), Gaps = 19/188 (10%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG-VAAPS  332
            M+G LS +EQ ++VA FLEIA GQ+ADTA QFLQATSWKLEEALQLFYVGN+ G VA+ S
Sbjct  1    MEGILSDNEQ-SMVACFLEIAAGQTADTAIQFLQATSWKLEEALQLFYVGNETGQVASAS  59

Query  333  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
               PLEN               +K + +E   Q   D+VRPPLPV+RD LYD A+     
Sbjct  60   QSPPLENAG------------GLKDNENEKIGQNSADDVRPPLPVVRDTLYDDAMFYRTS  107

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGS  677
              G   HE+ S+V FRNF++EMK PGVWE+D+ + S      DNLASLYRPP  LM+HGS
Sbjct  108  RTGYPPHESSSLVAFRNFDEEMKRPGVWESDQGATSTADTARDNLASLYRPPLHLMFHGS  167

Query  678  FEKAKDAA  701
            FEKAK  A
Sbjct  168  FEKAKGVA  175



>ref|XP_007045356.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY01188.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
Length=479

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 130/188 (69%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+++Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV A SS
Sbjct  26   MEGILSATDKQRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVASSS  85

Query  336  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
             SP LEN       +   ++     +   +      D+VRPPLPV+R+ LYD  ++ G  
Sbjct  86   ESPALENVDSWASQNSGELNEPANDNVGSTGG----DDVRPPLPVVRETLYDDGMLYGAS  141

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGS  677
             +G    +  S V FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G 
Sbjct  142  RLGYPPQQLSSSVAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGP  201

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  202  FEKAKAAA  209



>gb|KDO53543.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=444

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 125/187 (67%), Gaps = 16/187 (9%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSF  680
                 HE  S++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSF
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSF  169

Query  681  EKAKDAA  701
            EKAKDAA
Sbjct  170  EKAKDAA  176



>ref|XP_003547850.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
 gb|KHN44547.1| UBX domain-containing protein 7 [Glycine soja]
Length=467

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 130/194 (67%), Gaps = 12/194 (6%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+EQQ++V+SFLE+A GQ+A+TARQFLQATSWKLEEALQLF +G++GG      
Sbjct  1    MEGVLSANEQQSMVSSFLEVAQGQTAETARQFLQATSWKLEEALQLFLIGSEGGAVPLPV  60

Query  336  YSPL-------ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTA  494
              P        EN     D    S       +  ES    D +EVRPPLPVIR+ LYD A
Sbjct  61   PPPPLLHTPPLENVDSWTDQQPLSEPRKDAAAASESIGLNDAEEVRPPLPVIRETLYDDA  120

Query  495  VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFA  659
            ++ G    G  +HE  S+V FRNFE+EM+ PGVWE+++     A  S DNLASLYRPPF 
Sbjct  121  MLYGASRAGHRSHEPSSLVAFRNFEEEMRQPGVWESEQGAASTAEASRDNLASLYRPPFH  180

Query  660  LMYHGSFEKAKDAA  701
            LM++G+F+KAKDAA
Sbjct  181  LMFNGAFDKAKDAA  194



>ref|XP_006470883.1| PREDICTED: UBX domain-containing protein 2-like [Citrus sinensis]
Length=444

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 125/187 (67%), Gaps = 16/187 (9%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSF  680
                 HE  S++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSF
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSF  169

Query  681  EKAKDAA  701
            EKAKDAA
Sbjct  170  EKAKDAA  176



>gb|KDO53544.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=445

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 125/187 (67%), Gaps = 16/187 (9%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MD  LSA+++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S
Sbjct  1    MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             SP E  A                    +  Q   DEVR PLPV+RD LYD A+      
Sbjct  61   RSPAEEIA-----------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSG  109

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSF  680
                 HE  S++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSF
Sbjct  110  ARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSF  169

Query  681  EKAKDAA  701
            EKAKDAA
Sbjct  170  EKAKDAA  176



>gb|KHG06883.1| UBX domain-containing 7 [Gossypium arboreum]
Length=453

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  336  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
             SP +EN     D +   +  S          +    EVRPPLPV+R+ LYD A + G  
Sbjct  61   ESPAVENVDSWVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGAS  116

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGS  677
             +G    ++ S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G 
Sbjct  117  RLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGP  176

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  177  FEKAKAAA  184



>gb|KJB30690.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=450

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 134/195 (69%), Gaps = 24/195 (12%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  336  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRD-------EVRPPLPVIRDVLYDT  491
             SP +EN               +  +  E ++ G+ D       EVRPPLPV+R+ LYD 
Sbjct  61   ESPAVENV-----------DSWVDQNSGELKESGNSDVGPIGGEEVRPPLPVVRETLYDD  109

Query  492  AVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPF  656
            A + G   +G    ++ S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF
Sbjct  110  ASLYGASRLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPF  169

Query  657  ALMYHGSFEKAKDAA  701
             LM+ G FEKAK AA
Sbjct  170  HLMFQGPFEKAKAAA  184



>gb|KJB30687.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
 gb|KJB30691.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=453

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSAS++Q++V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S
Sbjct  1    MEGMLSASDKQSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTAS  60

Query  336  YSP-LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
             SP +EN     D +   +  S          +    EVRPPLPV+R+ LYD A + G  
Sbjct  61   ESPAVENVDSWVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGAS  116

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGS  677
             +G    ++ S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G 
Sbjct  117  RLGLPPQQSSSLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGP  176

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  177  FEKAKAAA  184



>ref|XP_012072428.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Jatropha 
curcas]
Length=431

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 130/188 (69%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LSA+++Q +V+SFLEIAVGQ+A+TARQFLQATSWKLEEALQLFYVGND G  A +S
Sbjct  1    MEAMLSANDEQNMVSSFLEIAVGQTAETARQFLQATSWKLEEALQLFYVGNDVGPVASAS  60

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            +S P EN  P         +G +K   +++  Q   +EVR PLPV+RD LYD A+     
Sbjct  61   HSPPTENANP----WADENAGGVKDDENKNVGQDGGEEVRAPLPVVRDTLYDDAMFYRAY  116

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGS  677
              G    E+ S++ FRNFE+EMK PGVWE+D+     A N  DNLASLY PPF LM+ GS
Sbjct  117  RTGYPPQESGSLIAFRNFEEEMKRPGVWESDQGATSTAENPRDNLASLYSPPFRLMFQGS  176

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  177  FEKAKGAA  184



>ref|XP_012072427.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Jatropha 
curcas]
 gb|KDP38216.1| hypothetical protein JCGZ_04859 [Jatropha curcas]
Length=454

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 130/188 (69%), Gaps = 10/188 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LSA+++Q +V+SFLEIAVGQ+A+TARQFLQATSWKLEEALQLFYVGND G  A +S
Sbjct  1    MEAMLSANDEQNMVSSFLEIAVGQTAETARQFLQATSWKLEEALQLFYVGNDVGPVASAS  60

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            +S P EN  P         +G +K   +++  Q   +EVR PLPV+RD LYD A+     
Sbjct  61   HSPPTENANP----WADENAGGVKDDENKNVGQDGGEEVRAPLPVVRDTLYDDAMFYRAY  116

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGS  677
              G    E+ S++ FRNFE+EMK PGVWE+D+     A N  DNLASLY PPF LM+ GS
Sbjct  117  RTGYPPQESGSLIAFRNFEEEMKRPGVWESDQGATSTAENPRDNLASLYSPPFRLMFQGS  176

Query  678  FEKAKDAA  701
            FEKAK AA
Sbjct  177  FEKAKGAA  184



>ref|XP_003531952.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
Length=468

 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 126/195 (65%), Gaps = 13/195 (7%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+EQQ++V+SFLE+A GQ+A+TARQFLQATSWKLEEALQLF +G++GG      
Sbjct  1    MEGVLSANEQQSMVSSFLEVAQGQTAETARQFLQATSWKLEEALQLFLIGSEGGAVPLPV  60

Query  336  YSPL-------ENTAPlpdpslssisgsikgsgdesekQ-GDRDEVRPPLPVIRDVLYDT  491
              P        EN     D    S       +         D +EVRPPLPVIR+ LYD 
Sbjct  61   PPPPLLHTPPLENVDSWTDQQPLSEPRKDAAAAASESIDLNDAEEVRPPLPVIRETLYDD  120

Query  492  AVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPF  656
            A++ G       +HE  S+V FRNFE+EM+ PGVWE+++     A  S DNLASLYRPPF
Sbjct  121  AMLYGASRASHRSHEPSSLVAFRNFEEEMRQPGVWESEQGAASTAETSRDNLASLYRPPF  180

Query  657  ALMYHGSFEKAKDAA  701
             LM++G F+KAKDAA
Sbjct  181  HLMFNGPFDKAKDAA  195



>ref|XP_008456878.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456880.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456881.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
Length=450

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 124/187 (66%), Gaps = 6/187 (3%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+++Q++V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+ GVA P S
Sbjct  1    MEGVLSATDKQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEAGVAGPPS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
                  T    + S    S                DEVRPPLPVIR+ LYD A++ G   
Sbjct  61   VPSPPRTNEQINSSTDHTSNVSGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYGT-T  119

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWET-----DKASNSADNLASLYRPPFALMYHGSF  680
            MG   +E+ S + FRN + E+KH  VWE+       + NS DNLASLYRPP+ LM+ GSF
Sbjct  120  MGYLPNESGSSIGFRNLQNEVKHHDVWESGDGAASTSGNSRDNLASLYRPPYHLMFTGSF  179

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  180  EKAKGAA  186



>ref|XP_010680042.1| PREDICTED: UBX domain-containing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=454

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 124/181 (69%), Gaps = 9/181 (5%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LS +++Q++V SFLEIAVGQ+ DTA QFLQAT WKLEEA+QLFYVG++GG  A SS
Sbjct  1    MEDILSPTDKQSMVTSFLEIAVGQTVDTAHQFLQATGWKLEEAIQLFYVGHEGGEMASSS  60

Query  336  Y-SPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            Y  P+EN  PL D S S     I     E       D+VRPPLPVIR+ LYD  ++ G  
Sbjct  61   YFPPVENATPLADKSSSGSDEGIAKELSEL---NGGDDVRPPLPVIREALYDDTMLYGAT  117

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGS  677
             +G  +H   SVV FRNFE+EMKHP VWE+++  +S      DNLA+LYRPPFA+M+ GS
Sbjct  118  RVGYPSHGPSSVVAFRNFEEEMKHPAVWESEQGGSSTTESSRDNLAALYRPPFAIMHQGS  177

Query  678  F  680
            F
Sbjct  178  F  178



>ref|XP_007156392.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
 gb|ESW28386.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
Length=461

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 124/187 (66%), Gaps = 5/187 (3%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS +EQQ++V+SFLE+A GQ+A+TARQFLQATSWKLEEALQLF +G++ G   P +
Sbjct  1    MEGVLSTNEQQSMVSSFLEVAQGQTAETARQFLQATSWKLEEALQLFLIGSESGAVPPPT  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
                                    +  ES    + DEVRPPLPVIR+ LYD A++ G   
Sbjct  61   LHTPPLENVDSWTDQPPSEPRKDATASESVGLNEADEVRPPLPVIRETLYDDAMLYGASR  120

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSF  680
            +G  + E  ++V FRNFE+EM++PGVWE ++     A  S DNLASLYRPPF LM++G F
Sbjct  121  VGHRSQEPSTLVAFRNFEEEMRNPGVWEPEQGAASTAETSRDNLASLYRPPFHLMFNGPF  180

Query  681  EKAKDAA  701
            +KAKDAA
Sbjct  181  DKAKDAA  187



>ref|XP_003628976.1| UBX domain-containing protein [Medicago truncatula]
 ref|XP_003636613.1| UBX domain-containing protein [Medicago truncatula]
 gb|AET03452.1| structural constituent of ribosome protein, putative [Medicago 
truncatula]
Length=461

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 129/191 (68%), Gaps = 11/191 (6%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG---VAA  326
            M+G +S ++QQTLV SFLE+A GQ+A TARQFLQATSWKLEEALQLF +G++ G   V A
Sbjct  1    MEGMVSPTDQQTLVTSFLEVAQGQTAATARQFLQATSWKLEEALQLFLIGSETGAVPVPA  60

Query  327  PSSYS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIR  503
            P+S++ PLEN     D S  S + +   +      +G  DEVR PLPVIR+ LYD  ++ 
Sbjct  61   PASFTPPLENADGWIDQSHLSETRTDTANQSGVVNEG--DEVRAPLPVIRETLYDNVLLY  118

Query  504  GLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMY  668
            G   +G    E  S++ FRNFEQE + PGVWE ++     A +S D LASLYRPPF LM+
Sbjct  119  GGSRLGHLPQEPNSLIAFRNFEQETRRPGVWEPEQGAASTAESSQDTLASLYRPPFHLMF  178

Query  669  HGSFEKAKDAA  701
             GSF+KAK AA
Sbjct  179  TGSFDKAKSAA  189



>ref|XP_010554359.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=463

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 128/193 (66%), Gaps = 14/193 (7%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG LSAS+QQ LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFYVG++GG+   ++
Sbjct  1    MDGRLSASDQQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYVGSEGGMLPSAT  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            +S  E+             G      +E+  Q + DEVRPPLPV+R+ LY   +  G   
Sbjct  61   HSQPESN---EHVVTDQSRGGASNPVNENLTQNEADEVRPPLPVVRETLYGEPMYYGAVR  117

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----------DNLASLYRPPFAL  662
             G S HE   +V FR+F +E K PGVWE D+ ++SA           D+LASLYRPPF L
Sbjct  118  AGNSRHEPNPLVAFRDFSEEAKRPGVWEPDQGASSASASGSEVAAPRDSLASLYRPPFHL  177

Query  663  MYHGSFEKAKDAA  701
            M+ GSFE+AK AA
Sbjct  178  MFSGSFEQAKSAA  190



>ref|XP_010527851.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Tarenaya 
hassleriana]
Length=459

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 123/194 (63%), Gaps = 19/194 (10%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSAS+QQ LV+SFLEIAVGQ+ADTARQFLQATSWKLEEA+QLFYVG++GG+  PS 
Sbjct  1    MEGMLSASDQQRLVSSFLEIAVGQTADTARQFLQATSWKLEEAIQLFYVGSEGGM-LPSQ  59

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGD-RDEVRPPLPVIRDVLYDTAVIRGLP  512
               + N                    DE+  Q D  DEVRPPLPV+R+ LY  ++  G  
Sbjct  60   PQSIANPV------ADQSWWGASNIADENIPQNDASDEVRPPLPVVRETLYGDSMYYGAV  113

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----------ASNSADNLASLYRPPFA  659
              G S  E+ S+V FRNF  E K PGVWE D+            +   D+LASLYRPPF 
Sbjct  114  RPGNSGQESNSLVAFRNFGDEAKRPGVWEPDQGASSASASGSEVATPRDSLASLYRPPFH  173

Query  660  LMYHGSFEKAKDAA  701
            LM+ GSFE+AK AA
Sbjct  174  LMFSGSFEQAKSAA  187



>ref|XP_008389121.1| PREDICTED: UBX domain-containing protein 2-like isoform X2 [Malus 
domestica]
Length=442

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 121/187 (65%), Gaps = 19/187 (10%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G +SA++QQ+LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+ A ++
Sbjct  1    MEGVMSANDQQSLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMAEAA  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P EN   L D +            +E+  Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDRLADQASGVNENVALPGANENVGQFSEDEVRAPMPVIRDVLYDDMALYGAPR  120

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
               S HE              + PGVWE+D+ + S+     +NLASLYRPPF +++ GSF
Sbjct  121  ARLSQHE--------------QGPGVWESDQGATSSENATQENLASLYRPPFKILFQGSF  166

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  167  EKAKSAA  173



>ref|XP_008389120.1| PREDICTED: UBX domain-containing protein 2-like isoform X1 [Malus 
domestica]
Length=445

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 121/187 (65%), Gaps = 19/187 (10%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G +SA++QQ+LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+ A ++
Sbjct  1    MEGVMSANDQQSLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMAEAA  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P EN   L D +            +E+  Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDRLADQASGVNENVALPGANENVGQFSEDEVRAPMPVIRDVLYDDMALYGAPR  120

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
               S HE              + PGVWE+D+ + S+     +NLASLYRPPF +++ GSF
Sbjct  121  ARLSQHE--------------QGPGVWESDQGATSSENATQENLASLYRPPFKILFQGSF  166

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  167  EKAKSAA  173



>ref|XP_008389122.1| PREDICTED: UBX domain-containing protein 2-like isoform X3 [Malus 
domestica]
Length=440

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 121/187 (65%), Gaps = 19/187 (10%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G +SA++QQ+LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+ A ++
Sbjct  1    MEGVMSANDQQSLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMAEAA  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P EN   L D +            +E+  Q   DEVR P+PVIRDVLYD   + G P 
Sbjct  61   PLPTENIDRLADQASGVNENVALPGANENVGQFSEDEVRAPMPVIRDVLYDDMALYGAPR  120

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
               S HE              + PGVWE+D+ + S+     +NLASLYRPPF +++ GSF
Sbjct  121  ARLSQHE--------------QGPGVWESDQGATSSENATQENLASLYRPPFKILFQGSF  166

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  167  EKAKSAA  173



>ref|XP_002890064.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66323.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 130/200 (65%), Gaps = 26/200 (13%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLPSGT  60

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            ++ P  N     D   +   G+  G+G+E   Q D DEVR PLPV+R+ LY  +V  G  
Sbjct  61   HTQPASN-----DHVAAQSWGAATGTGNERILQNDVDEVRAPLPVVRETLYGESVYYGTM  115

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA--------------------DNL  632
             +G S  E  S++ FRNF +E K PG+WE D+  +SA                    D+L
Sbjct  116  RVGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSSASASASASASASASESASAPRDSL  175

Query  633  ASLYRPPFALMYHGSFEKAK  692
            ASLYRPPF LM+HGSFE+AK
Sbjct  176  ASLYRPPFHLMFHGSFEQAK  195



>ref|XP_010476513.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=464

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 128/191 (67%), Gaps = 16/191 (8%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+ ++Q LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDEQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGT  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            ++  E+  P      S   G+   +G++   Q D DEVR PLPV+R+ LY  +V  G   
Sbjct  61   HTLPESNDP----MASQSWGATTDTGNQRMVQNDVDEVRAPLPVVRETLYGESVYYGAMR  116

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA------------DNLASLYRPPFA  659
            +G S  E  S++ FRNF +E K PGVWE D+ ++SA            D+LASLYRPPF 
Sbjct  117  VGNSQPEPASLIAFRNFSEEPKSPGVWEPDEGASSASASASESASAPRDSLASLYRPPFH  176

Query  660  LMYHGSFEKAK  692
            LM+ GSFE AK
Sbjct  177  LMFQGSFEMAK  187



>ref|XP_010496241.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010496249.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=463

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 122/191 (64%), Gaps = 17/191 (9%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGT  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            +     T P  +  ++S S            Q D DEVR PLPV+R+ LY   V  G   
Sbjct  61   H-----TLPESNDPMASQSWGATTDTGNQRVQNDVDEVRAPLPVVRETLYGETVYYGAMR  115

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA------------DNLASLYRPPFA  659
             G S  E  S++ FRNF +E K PG+WE D+ ++SA            D+LASLYRPPF 
Sbjct  116  AGNSQPEPTSLIAFRNFSEEPKSPGIWEPDEGASSASASASESASAPRDSLASLYRPPFH  175

Query  660  LMYHGSFEKAK  692
            LM+ GSFE AK
Sbjct  176  LMFQGSFELAK  186



>ref|XP_010458959.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458960.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458961.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=457

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 126/189 (67%), Gaps = 14/189 (7%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+ ++Q LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDEQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGT  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            ++  E+  P      S   G+   +G +   Q D DEVR PLPV+R+ LY  +V  G   
Sbjct  61   HTLPESNDP----MASQSWGATTDTGTQRMVQNDVDEVRAPLPVVRETLYGESVYYGAVR  116

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA----------DNLASLYRPPFALM  665
             G S  E  S++ FRNF +E K PG+WE D+ ++SA          D+LASLYRPPF LM
Sbjct  117  GGNSQPEPTSLIAFRNFSEEPKSPGIWEPDEGASSASASESASVPRDSLASLYRPPFHLM  176

Query  666  YHGSFEKAK  692
            + GSFE AK
Sbjct  177  FQGSFEMAK  185



>emb|CDY69105.1| BnaCnng61890D [Brassica napus]
Length=454

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 119/181 (66%), Gaps = 7/181 (4%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+SEQ+ LV+SFLEIAVGQ+++TARQFL ATSWKLEEA+QLFYVG + GV  PS 
Sbjct  1    MEGMLSSSEQERLVSSFLEIAVGQTSETARQFLGATSWKLEEAIQLFYVGGEVGV-LPSG  59

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             +  + T         +              Q + DEVR PLPV+R+ LY  ++  G   
Sbjct  60   GTHTQPTV----DDPMAAQSWGAAETGNERMQNEVDEVRAPLPVVRETLYGDSMYYGATR  115

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA--DNLASLYRPPFALMYHGSFEKA  689
            +G S  E  S++ FRNF +E K PG+WE D+ + SA  D+LASLYRPPF LM HGSFE+A
Sbjct  116  VGSSQREPASLIAFRNFSEEPKSPGIWEPDEEAASAPRDSLASLYRPPFHLMLHGSFEQA  175

Query  690  K  692
            K
Sbjct  176  K  176



>ref|XP_006307428.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
 gb|EOA40326.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
Length=468

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 129/195 (66%), Gaps = 20/195 (10%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G +S+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +
Sbjct  1    MEGMVSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGT  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            ++  E+     D   +   G+   +G++   Q D DEVR PLPV+R+ LY  AV  G   
Sbjct  61   HTQPESN----DHMATQSWGAGTDTGNQGIVQSDVDEVRAPLPVVRETLYGDAVYYGAMR  116

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA----------------DNLASLYR  647
             G S  E  S++ FRNF +E K PG+WE D+ ++SA                D+LASLYR
Sbjct  117  GGNSQPEPTSLIAFRNFSEEPKSPGIWEPDEGASSASASASASASESSSAPRDSLASLYR  176

Query  648  PPFALMYHGSFEKAK  692
            PPF LM+HGSFE+AK
Sbjct  177  PPFHLMFHGSFEQAK  191



>ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 2 [Cucumis sativus]
 ref|XP_011655082.1| PREDICTED: UBX domain-containing protein 2 [Cucumis sativus]
 ref|XP_011655083.1| PREDICTED: UBX domain-containing protein 2 [Cucumis sativus]
Length=450

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 126/187 (67%), Gaps = 6/187 (3%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+++Q++V+SFLE+AVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV  P  
Sbjct  1    MEGVLSATDKQSMVSSFLEVAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVGPPP  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
                 +T    + S   IS                DEVRPPLPVIR+ LYD A++ G   
Sbjct  61   VPSPPSTNEQINSSTDHISNESGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYGT-T  119

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSF  680
            MG   +E+ S + FRN + E+KH  VW++ + +     NS DNLASLYRPP+ LM+ GSF
Sbjct  120  MGYLPNESGSSIGFRNLQNEVKHHDVWQSGEGAASTSGNSRDNLASLYRPPYHLMFTGSF  179

Query  681  EKAKDAA  701
            EKAK AA
Sbjct  180  EKAKGAA  186



>ref|XP_010935375.1| PREDICTED: UBX domain-containing protein 5 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 121/186 (65%), Gaps = 24/186 (13%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+ ALS  E+Q L++SFLEIA+GQ+ADTA QFL+AT+WKLEEA+QLFY GN+ G  A SS
Sbjct  1    MENALSPEEKQRLISSFLEIAIGQTADTAAQFLEATTWKLEEAIQLFYAGNEIGAVASSS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYD--TAVIRGL  509
              P  N +P    ++       +G+       GD DEVR PLPV RD LY   ++ IR  
Sbjct  61   LPPPVNESPSERENVVVNENVEQGA-------GD-DEVRAPLPVKRDTLYGDPSSFIRLH  112

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHG  674
            P+         SVV FRNFE+E K P VWE+D+     A+ S DNLASLYRPPFALMY G
Sbjct  113  PS---------SVVAFRNFEEESKRPAVWESDQKAASTANGSRDNLASLYRPPFALMYQG  163

Query  675  SFEKAK  692
             F+KAK
Sbjct  164  PFDKAK  169



>ref|XP_010935374.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Elaeis 
guineensis]
Length=444

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 121/186 (65%), Gaps = 24/186 (13%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+ ALS  E+Q L++SFLEIA+GQ+ADTA QFL+AT+WKLEEA+QLFY GN+ G  A SS
Sbjct  1    MENALSPEEKQRLISSFLEIAIGQTADTAAQFLEATTWKLEEAIQLFYAGNEIGAVASSS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYD--TAVIRGL  509
              P  N +P    ++       +G+       GD DEVR PLPV RD LY   ++ IR  
Sbjct  61   LPPPVNESPSERENVVVNENVEQGA-------GD-DEVRAPLPVKRDTLYGDPSSFIRLH  112

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHG  674
            P+         SVV FRNFE+E K P VWE+D+     A+ S DNLASLYRPPFALMY G
Sbjct  113  PS---------SVVAFRNFEEESKRPAVWESDQKAASTANGSRDNLASLYRPPFALMYQG  163

Query  675  SFEKAK  692
             F+KAK
Sbjct  164  PFDKAK  169



>ref|XP_006416998.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
 gb|ESQ35351.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
Length=462

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 127/196 (65%), Gaps = 22/196 (11%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+S+QQ LV+SFLEIAVGQ++DTARQFL+ATSWKLEEA+QLFYVG +GG+    +
Sbjct  1    MEGMLSSSDQQRLVSSFLEIAVGQTSDTARQFLEATSWKLEEAIQLFYVGGEGGMLPSGT  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            +     T P         + S   +G+E  +Q D DEVRPPLPV+R+ LY      G   
Sbjct  61   H-----TQP--ASDDHMAAQSWGAAGNERIQQNDVDEVRPPLPVVRETLYGGDYY-GAMR  112

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA--------------DNLASLYRPP  653
            +G S  E  S++ FRNF +E K PGVWE D+ ++SA              D+LASLYRPP
Sbjct  113  LGNSQPEPTSLIAFRNFNEEPKSPGVWEPDEGASSASASASVSETASAPRDSLASLYRPP  172

Query  654  FALMYHGSFEKAKDAA  701
            F LM HGSFE+AK  +
Sbjct  173  FHLMLHGSFEQAKTTS  188



>ref|NP_563954.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_973827.1| UBX domain-containing protein [Arabidopsis thaliana]
 sp|Q94JZ8.1|PUX7_ARATH RecName: Full=Plant UBX domain-containing protein 7; Short=PUX7 
[Arabidopsis thaliana]
 gb|AAK43884.1|AF370507_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL47388.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19997.1| AT1G14570 [Arabidopsis thaliana]
 gb|AEE29182.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29183.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=468

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 130/199 (65%), Gaps = 22/199 (11%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLQSGT  60

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            ++ P  N     D + +   G+  G+G+E     D DEVR PLPV+R+ LY  ++  G  
Sbjct  61   HTQPASN-----DDAAAQSWGAATGTGNEMILPNDVDEVRAPLPVVRETLYGESMYYGAM  115

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA----------------DNLASLY  644
             +G S  E  S++ FRNF +E K PG+WE D+  +SA                D+LASLY
Sbjct  116  RVGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSSASASASASASESASAPRDSLASLY  175

Query  645  RPPFALMYHGSFEKAKDAA  701
            RPPF LM+ GSFE+AK  +
Sbjct  176  RPPFHLMFQGSFEQAKTTS  194



>emb|CDY45269.1| BnaA06g09390D [Brassica napus]
Length=467

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 122/194 (63%), Gaps = 20/194 (10%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+SEQ+ LV+SFLEIAVGQ+++TARQFL+ATSWKLEEA+QLFYVG + GV  PS 
Sbjct  1    MEGMLSSSEQERLVSSFLEIAVGQTSETARQFLEATSWKLEEAIQLFYVGGEVGV-LPSG  59

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             +   NT P       +              Q + DEVR PLPV+R+ LY  ++  G   
Sbjct  60   GT---NTRP-TVDDPMAAQSWGAAETGNERMQNEVDEVRAPLPVVRETLYGDSMYYGGTR  115

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA---------------DNLASLYRP  650
            +G S  E  S++ FRNF +E K PG+WE D+ ++SA               D+LASLYRP
Sbjct  116  VGSSQREPASLIAFRNFSEEPKSPGIWEPDEGASSASGSASAPEAASSAPRDSLASLYRP  175

Query  651  PFALMYHGSFEKAK  692
            PF LM HGSFE+AK
Sbjct  176  PFHLMLHGSFEQAK  189



>ref|XP_009148836.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=466

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 121/193 (63%), Gaps = 19/193 (10%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+SEQ+ LV+SFLEIAVGQ+++TARQFL+ATSWKLEEA+QLFYVG + GV  PS 
Sbjct  1    MEGMLSSSEQERLVSSFLEIAVGQTSETARQFLEATSWKLEEAIQLFYVGGEVGV-LPSG  59

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             +  + T         +              Q + DEVR PLPV+R+ LY  ++  G   
Sbjct  60   GTHTQPTV----DDPMAAHSWGAAETGNERMQNEVDEVRAPLPVVRETLYGDSMYYGGTR  115

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA--------------DNLASLYRPP  653
            +G S  E  S++ FRNF +E K PG+WE D+ ++SA              D+LASLYRPP
Sbjct  116  VGSSQREPASLIAFRNFSEEPKSPGIWEPDEGASSASGSASAPEAASAPRDSLASLYRPP  175

Query  654  FALMYHGSFEKAK  692
            F LM HGSFE+AK
Sbjct  176  FHLMLHGSFEQAK  188



>ref|XP_004297788.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 118/194 (61%), Gaps = 20/194 (10%)
 Frame = +3

Query  156  MDGALSASEQQ-TLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS  332
            M+ A SA EQQ + VA F+EIA GQ+ +TAR+FLQAT W LEEALQLFYVGN+ G     
Sbjct  32   MEAASSAEEQQQSTVALFMEIAAGQTDETARRFLQATGWNLEEALQLFYVGNEAG-----  86

Query  333  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
               P+    P P    +S         +E+  Q   DEVR P+PVIRDVLYD   +    
Sbjct  87   ---PVAQPQPQPPTGNASNLAEQSSGVNENVAQYVEDEVRAPMPVIRDVLYDDVALYQAG  143

Query  513  AMGGSAHEAR------SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFA  659
             +  ++   R       V+ FRNF +E+KHPGVWE+++ + S      DNLASLYRPPF 
Sbjct  144  LLASTSPMTRLPVNESGVIAFRNFNEELKHPGVWESNEGATSTTDSSRDNLASLYRPPFK  203

Query  660  LMYHGSFEKAKDAA  701
            LM+ GSFEKAK AA
Sbjct  204  LMFQGSFEKAKSAA  217



>ref|XP_008804300.1| PREDICTED: UBX domain-containing protein 7 [Phoenix dactylifera]
Length=443

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 116/185 (63%), Gaps = 23/185 (12%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  L   E+Q L++SFLEIA GQ+AD A QFL+ATSWKLEEA+QLFY GN+ G    SS
Sbjct  1    MESVLLPEEKQRLISSFLEIAAGQTADIAAQFLEATSWKLEEAIQLFYAGNEFGAVPSSS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVIRGLP  512
              P  N  P    ++       +G+       GD DEVR PLPV RD LY D + IR  P
Sbjct  61   LPPPVNEIPSERENVEVNENVGQGA-------GD-DEVRAPLPVKRDTLYGDPSFIRLHP  112

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGS  677
            +         SVV FRNFE+E K P VWE+D+     ++ S DNLASLYRPPFALMY G+
Sbjct  113  S---------SVVAFRNFEEESKRPAVWESDQKAASTSNGSRDNLASLYRPPFALMYQGA  163

Query  678  FEKAK  692
            F+KAK
Sbjct  164  FDKAK  168



>ref|XP_011463491.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 118/194 (61%), Gaps = 20/194 (10%)
 Frame = +3

Query  156  MDGALSASEQQ-TLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS  332
            M+ A SA EQQ + VA F+EIA GQ+ +TAR+FLQAT W LEEALQLFYVGN+ G     
Sbjct  32   MEAASSAEEQQQSTVALFMEIAAGQTDETARRFLQATGWNLEEALQLFYVGNEAG-----  86

Query  333  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
               P+    P P    +S         +E+  Q   DEVR P+PVIRDVLYD   +    
Sbjct  87   ---PVAQPQPQPPTGNASNLAEQSSGVNENVAQYVEDEVRAPMPVIRDVLYDDVALYQAG  143

Query  513  AMGGSAHEAR------SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFA  659
             +  ++   R       V+ FRNF +E+KHPGVWE+++ + S      DNLASLYRPPF 
Sbjct  144  LLASTSPMTRLPVNESGVIAFRNFNEELKHPGVWESNEGATSTTDSSRDNLASLYRPPFK  203

Query  660  LMYHGSFEKAKDAA  701
            LM+ GSFEKAK AA
Sbjct  204  LMFQGSFEKAKSAA  217



>ref|XP_009401234.1| PREDICTED: UBX domain-containing protein 2 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 119/186 (64%), Gaps = 25/186 (13%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+   +A+++Q LV+SFLEIA+GQ+ +TA QFLQAT WKLEEALQLFYVGN+GG  A SS
Sbjct  1    METLPTAADKQQLVSSFLEIALGQTPETATQFLQATGWKLEEALQLFYVGNEGGGLATSS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGD-RDEVRPPLPVIRDVLY-DTAVIRGL  509
            + P    +P         S         S  QG   DEVRPPLPV R+ LY DT + R  
Sbjct  61   FPPPPTGSP---------SEQENVMSSGSLVQGALEDEVRPPLPVKRETLYGDTPLFR--  109

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHG  674
                   H++ ++V FRNF++E K   VWE++++S S      DNLASLY PPFALMY G
Sbjct  110  -------HQSSAMVAFRNFDEESKRSAVWESNESSASTANGSRDNLASLYSPPFALMYQG  162

Query  675  SFEKAK  692
            SF++AK
Sbjct  163  SFDQAK  168



>ref|XP_007052064.1| UBX domain-containing protein [Theobroma cacao]
 gb|EOX96221.1| UBX domain-containing protein [Theobroma cacao]
Length=431

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 122/187 (65%), Gaps = 16/187 (9%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+++Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV   SS
Sbjct  1    MEGILSATDEQRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVGSSS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             S     A   D      SG++    +     G  D VRPPLPV+R+ L+D A++ G   
Sbjct  61   VS---RQAENMDSWAYQNSGALNEHDNVGSTGG--DAVRPPLPVVRETLHDDAMLHGASR  115

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  680
            +G    E      FRNF++E   PGVW++D+ ++S      DNLASLYRPPF LM+ G F
Sbjct  116  LGYPPQE------FRNFDEETIRPGVWQSDEGASSTVDAPRDNLASLYRPPFHLMFQGPF  169

Query  681  EKAKDAA  701
              AK AA
Sbjct  170  RNAKAAA  176



>ref|XP_009398016.1| PREDICTED: UBX domain-containing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 105/184 (57%), Gaps = 25/184 (14%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+   +A+EQQ LV SFLEIAVGQ+A TA QFLQAT W+L+EA+QLFYVGN+ G  A SS
Sbjct  1    METVPTAAEQQQLVLSFLEIAVGQTAATATQFLQATRWRLDEAVQLFYVGNEDGGVASSS  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
              P  N  P                   S  +   DEVRPPLPV R+ LY          
Sbjct  61   LPPPINERP--------SGQVNFFGTTSSVPRPPEDEVRPPLPVKRETLY----------  102

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSF  680
              G     R V  FRNF++  K   VWE+D+     ++ S DNLASLY PPFALMY G F
Sbjct  103  --GDMPLFRPVDAFRNFDEGSKRSAVWESDESAPSTSNGSRDNLASLYSPPFALMYQGPF  160

Query  681  EKAK  692
            E+AK
Sbjct  161  EQAK  164



>gb|KHN06997.1| UBX domain-containing protein 7 [Glycine soja]
Length=494

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 100/167 (60%), Gaps = 13/167 (8%)
 Frame = +3

Query  240  ARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPL-------ENTAPlpdpslssisgs  398
            ARQFLQATSWKLEEALQLF +G++GG        P        EN     D    S    
Sbjct  55   ARQFLQATSWKLEEALQLFLIGSEGGAVPLPVPPPPLLHTPPLENVDSWTDQQPLSEPRK  114

Query  399  ikgsgdesekQ-GDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQE  575
               +         D +EVRPPLPVIR+ LYD A++ G       +HE  S+V FRNFE+E
Sbjct  115  DAAAAASESIDLNDAEEVRPPLPVIRETLYDDAMLYGASRASHRSHEPSSLVAFRNFEEE  174

Query  576  MKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
            M+ PGVWE+++     A  S DNLASLYRPPF LM++G F+KAKDAA
Sbjct  175  MRQPGVWESEQGAASTAETSRDNLASLYRPPFHLMFNGPFDKAKDAA  221



>ref|XP_009773267.1| PREDICTED: uncharacterized protein LOC104223510 [Nicotiana sylvestris]
Length=178

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 99/182 (54%), Gaps = 46/182 (25%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG +SA +QQ LV+SFLEI VGQ+ADTARQFLQ TSW LEEA+QL Y+GN+GG AA  +
Sbjct  1    MDGVISAMDQQMLVSSFLEITVGQTADTARQFLQVTSWNLEEAIQLSYIGNEGGAAASVN  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             S L N A                        GDR                         
Sbjct  61   SSQLGNDA----------------------LLGDRSLSS-------------------SG  79

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASN-----SADNLASLYRPPFALMYHGSF  680
            +GGS+ E R V P  NFE+EMK PGV E +K S      + DNLASL  PPFALMYHG F
Sbjct  80   VGGSSREPRLVAPSCNFEEEMKCPGVLEAEKRSTPTTDAAQDNLASLCHPPFALMYHGPF  139

Query  681  EK  686
            EK
Sbjct  140  EK  141



>ref|XP_007045359.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
 gb|EOY01191.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
Length=429

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 101/159 (64%), Gaps = 10/159 (6%)
 Frame = +3

Query  243  RQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAPlpdpslssisgsikgsgde  419
            R  + ATSWKL+EA+QLFYVGN+GGV A SS SP LEN       +   ++     +   
Sbjct  5    RHAVFATSWKLDEAIQLFYVGNEGGVVASSSESPALENVDSWASQNSGELNEPANDNVGS  64

Query  420  sekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWE  599
            +      D+VRPPLPV+R+ LYD  ++ G   +G    +  S V FRNF++EMK PGVWE
Sbjct  65   TGG----DDVRPPLPVVRETLYDDGMLYGASRLGYPPQQLSSSVAFRNFDEEMKRPGVWE  120

Query  600  TDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  701
            +D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  121  SDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  159



>ref|NP_001077535.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_001077536.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29184.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29185.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=447

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 119/199 (60%), Gaps = 43/199 (22%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +
Sbjct  1    MEGMLSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLQSGT  60

Query  336  YS-PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            ++ P  N     D + +   G+  G+G+E     D DEVR PLPV+R+ LY  ++  G  
Sbjct  61   HTQPASN-----DDAAAQSWGAATGTGNEMILPNDVDEVRAPLPVVRETLYGESMYYG--  113

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA----------------DNLASLY  644
                               +E K PG+WE D+  +SA                D+LASLY
Sbjct  114  -------------------EEPKSPGIWEPDEGDSSASASASASASESASAPRDSLASLY  154

Query  645  RPPFALMYHGSFEKAKDAA  701
            RPPF LM+ GSFE+AK  +
Sbjct  155  RPPFHLMFQGSFEQAKTTS  173



>ref|XP_009110537.1| PREDICTED: UBX domain-containing protein 2-like [Brassica rapa]
Length=443

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 109/187 (58%), Gaps = 23/187 (12%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG--VAAP  329
            M+  LS+ +QQ+LV+SFL+IAVGQ+A TARQFLQATSW L EA+QLFY G +GG  +A+ 
Sbjct  1    MERMLSSRDQQSLVSSFLDIAVGQTAKTARQFLQATSWNLNEAVQLFYAGGEGGSMLASG  60

Query  330  SSYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGL  509
            +   P+              S           K+ D D VR PLPV+ + LY  ++    
Sbjct  61   THTHPM-----------GRRSRRAAARARRERKRNDADGVRAPLPVVTETLYRDSMYYE-  108

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSAD------NLASLYRPPFALMYH  671
               G    E  S++ F +F +E K  GVWE D+ ++SA       +LASLYRPPF LM H
Sbjct  109  ---GNYERELASLIDFLDFSEEPKRSGVWEPDEVASSASTSGPRHSLASLYRPPFHLMTH  165

Query  672  GSFEKAK  692
            GSFE+ K
Sbjct  166  GSFEQVK  172



>gb|AFW59833.1| hypothetical protein ZEAMMB73_017157 [Zea mays]
Length=193

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 108/185 (58%), Gaps = 21/185 (11%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPL  347
            +A+E++TLV+SF+EI  GQ+ +TA QFLQ TSW LEEALQLFY+ G     AA S     
Sbjct  7    TAAEKETLVSSFIEITAGQTLETATQFLQMTSWHLEEALQLFYIDGEAAHTAAHSVDPSP  66

Query  348  ENTAPlpdpslssisgsikgsgdesekQGD----------RDEVRPPLPVIRDVLYDTAV  497
               AP    + + +  +++ +   +   GD           D+VR PLPV R+ LY   +
Sbjct  67   AAAAPSALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVREDDDVRAPLPVKRETLYGEGI  126

Query  498  IRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYH  671
            +        S     +   FRNFEQE +   VW++++  AS+S DNLASLYRPPF LM++
Sbjct  127  V--------SVMRPNASAAFRNFEQEARQSAVWDSEQNVASSSGDNLASLYRPPFPLMFN  178

Query  672  GSFEK  686
            GSF+K
Sbjct  179  GSFDK  183



>ref|XP_006855568.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Amborella 
trichopoda]
 ref|XP_011627483.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Amborella 
trichopoda]
 gb|ERN17035.1| hypothetical protein AMTR_s00044p00018360 [Amborella trichopoda]
Length=442

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 112/183 (61%), Gaps = 21/183 (11%)
 Frame = +3

Query  174  ASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGV----AAPSSYS  341
            + ++Q LVASF+E+A G+S   A QFLQAT+W+LE+A+QLF+VGNDG      A  SS+S
Sbjct  5    SDDKQILVASFMEVAGGESTKIALQFLQATNWQLEDAIQLFFVGNDGNNTNTNAESSSFS  64

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
            P + T   P         +              + VRPPLPV R+ LY  + + G   + 
Sbjct  65   PPKETNHSPLHESEQEKDAKW-----------EEYVRPPLPVKREALYADSFMYGQRTL-  112

Query  522  GSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-DNLASLYRPPFALMYHGSFEKAK-D  695
               H     V FR+FE+E K+P VW +++ ++ A DNLA+LYRPPF+LMY GSFEKAK D
Sbjct  113  ---HPPHQPVAFRDFEEEAKNPSVWGSEQGTSGARDNLAALYRPPFSLMYQGSFEKAKID  169

Query  696  AAR  704
            A+R
Sbjct  170  ASR  172



>ref|XP_011627484.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Amborella 
trichopoda]
Length=440

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 113/184 (61%), Gaps = 25/184 (14%)
 Frame = +3

Query  174  ASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGV----AAPSSYS  341
            + ++Q LVASF+E+A G+S   A QFLQAT+W+LE+A+QLF+VGNDG      A  SS+S
Sbjct  5    SDDKQILVASFMEVAGGESTKIALQFLQATNWQLEDAIQLFFVGNDGNNTNTNAESSSFS  64

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVIRGLPAM  518
            P + T   P         +              + VRPPLPV R+ LY D+ + R L   
Sbjct  65   PPKETNHSPLHESEQEKDAKW-----------EEYVRPPLPVKREALYADSFIQRTL---  110

Query  519  GGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA-DNLASLYRPPFALMYHGSFEKAK-  692
                H     V FR+FE+E K+P VW +++ ++ A DNLA+LYRPPF+LMY GSFEKAK 
Sbjct  111  ----HPPHQPVAFRDFEEEAKNPSVWGSEQGTSGARDNLAALYRPPFSLMYQGSFEKAKI  166

Query  693  DAAR  704
            DA+R
Sbjct  167  DASR  170



>gb|AEV41029.1| putative UBX domain-containing protein [Oryza minuta]
Length=463

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 115/190 (61%), Gaps = 27/190 (14%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVA---APSSYS  341
            +A+E+++LV+SFLEIA GQ+ + A QFLQ TSW LEEALQLFY+  +  +A   APS+ +
Sbjct  7    TAAEKESLVSSFLEIAAGQTPEMATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSTAA  66

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGD--------RDEVRPPLPVIRDVLYDTA-  494
                 A +   + + +  +++ +   +   GD         D+VR PLP  R+ LY  A 
Sbjct  67   AAAEAAAVAVAAAAEVEDAMRFAPPPAAALGDEMLQGLGEEDDVRAPLPTKRETLYGDAP  126

Query  495  --VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFAL  662
              V+R             S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPFAL
Sbjct  127  MVVVR-----------PNSTVAFRNFEEEARQSAVWDSEQNAASSSRDNLAALYRPPFAL  175

Query  663  MYHGSFEKAK  692
            M++G F+KAK
Sbjct  176  MFNGPFDKAK  185



>gb|AEV40978.1| putative UBX domain-containing protein [Oryza punctata]
Length=463

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 115/190 (61%), Gaps = 27/190 (14%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVA---APSSYS  341
            +A+E+++LV+SFLEIA GQ+ + A QFLQ TSW LEEALQLFY+  +  +A   APS+ +
Sbjct  7    TAAEKESLVSSFLEIAAGQTPEMATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSTAA  66

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGD--------RDEVRPPLPVIRDVLYDTA-  494
                 A +   + + +  +++ +   +   GD         D+VR PLP  R+ LY  A 
Sbjct  67   AAAEAAAVAVAAAAEVEDAMRFAPPPAAALGDEMLQGLGEEDDVRAPLPTKRETLYGDAP  126

Query  495  --VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFAL  662
              V+R             S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPFAL
Sbjct  127  MVVVR-----------PNSTVAFRNFEEEARQSAVWDSEQNAASSSRDNLAALYRPPFAL  175

Query  663  MYHGSFEKAK  692
            M++G F+KAK
Sbjct  176  MFNGPFDKAK  185



>ref|NP_001170636.1| uncharacterized protein LOC100384688 [Zea mays]
 gb|ACR34298.1| unknown [Zea mays]
 gb|AFW59832.1| hypothetical protein ZEAMMB73_017157 [Zea mays]
Length=459

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 110/187 (59%), Gaps = 21/187 (11%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPL  347
            +A+E++TLV+SF+EI  GQ+ +TA QFLQ TSW LEEALQLFY+ G     AA S     
Sbjct  7    TAAEKETLVSSFIEITAGQTLETATQFLQMTSWHLEEALQLFYIDGEAAHTAAHSVDPSP  66

Query  348  ENTAPlpdpslssisgsikgsgdesekQGD----------RDEVRPPLPVIRDVLYDTAV  497
               AP    + + +  +++ +   +   GD           D+VR PLPV R+ LY   +
Sbjct  67   AAAAPSALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVREDDDVRAPLPVKRETLYGEGI  126

Query  498  IRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYH  671
            +        S     +   FRNFEQE +   VW++++  AS+S DNLASLYRPPF LM++
Sbjct  127  V--------SVMRPNASAAFRNFEQEARQSAVWDSEQNVASSSGDNLASLYRPPFPLMFN  178

Query  672  GSFEKAK  692
            GSF+KAK
Sbjct  179  GSFDKAK  185



>tpg|DAA35439.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=461

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 110/193 (57%), Gaps = 33/193 (17%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  350
            +A+E++TLV+SFLEIA GQ+ +TA QFL  TSW LEEALQLFY+  +      S+ +P  
Sbjct  7    TAAEKETLVSSFLEIAAGQTPETATQFLLMTSWHLEEALQLFYIDGE------SALTPAH  60

Query  351  NTAPlpdpslssisgsikgsgdesekQ-----------------GDRDEVRPPLPVIRDV  479
              AP P  + +S   +  G+ +                      G+ D+VR PLPV R+ 
Sbjct  61   PVAPPPTSAAASALAAAAGAEEAMRFAPPPAAALGDAMLHGFGVGEDDDVRAPLPVKRET  120

Query  480  LYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPP  653
            LY   ++        S     +   FRNFEQE +   VW++D+   S+S DNLASLYRPP
Sbjct  121  LYGEGIV--------SVMRPNASAAFRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPP  172

Query  654  FALMYHGSFEKAK  692
            F+LM++G F+KAK
Sbjct  173  FSLMFNGPFDKAK  185



>ref|XP_002447303.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
 gb|EES11631.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
Length=463

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 109/189 (58%), Gaps = 23/189 (12%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  350
            +A+E++TLV+SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  +  + A     P  
Sbjct  7    TAAEKETLVSSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGESALGAAHPAVPPP  66

Query  351  NTAPlpdpslssisgsikg-------------sgdesekQGDRDEVRPPLPVIRDVLYDT  491
              A     +L++ +G  +              +       G+ D+VR PLPV R+ LY  
Sbjct  67   AAAAASASALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVGEDDDVRAPLPVKRETLYGE  126

Query  492  AVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALM  665
             ++        S     +   FRNFEQE +   VW++D+   S+S DNLASLYRPPF+LM
Sbjct  127  GIV--------SVMRPNASAAFRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPPFSLM  178

Query  666  YHGSFEKAK  692
            ++G F+KAK
Sbjct  179  FNGPFDKAK  187



>ref|XP_008668717.1| PREDICTED: UBX domain-containing protein 2-like [Zea mays]
Length=542

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 110/193 (57%), Gaps = 33/193 (17%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  350
            +A+E++TLV+SFLEIA GQ+ +TA QFL  TSW LEEALQLFY+  +      S+ +P  
Sbjct  88   TAAEKETLVSSFLEIAAGQTPETATQFLLMTSWHLEEALQLFYIDGE------SALTPAH  141

Query  351  NTAPlpdpslssisgsikgsgdesekQ-----------------GDRDEVRPPLPVIRDV  479
              AP P  + +S   +  G+ +                      G+ D+VR PLPV R+ 
Sbjct  142  PVAPPPTSAAASALAAAAGAEEAMRFAPPPAAALGDAMLHGFGVGEDDDVRAPLPVKRET  201

Query  480  LYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPP  653
            LY   ++        S     +   FRNFEQE +   VW++D+   S+S DNLASLYRPP
Sbjct  202  LYGEGIV--------SVMRPNASAAFRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPP  253

Query  654  FALMYHGSFEKAK  692
            F+LM++G F+KAK
Sbjct  254  FSLMFNGPFDKAK  266



>ref|XP_004960126.1| PREDICTED: UBX domain-containing protein 2-like [Setaria italica]
Length=456

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 104/195 (53%), Gaps = 42/195 (22%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDG------------  314
            +A+E++ LV+SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  +             
Sbjct  7    TAAEKEALVSSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGESALAARPAAPSAA  66

Query  315  -------GVAAPSSYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIR  473
                   GV     ++P    A             +     +    G+ D+VR PLPV R
Sbjct  67   AAMAAAAGVEEALRFAPPPAAA-------------LGDPMLQGLGVGEDDDVRAPLPVKR  113

Query  474  DVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYR  647
            + LY    +        S     + V FRNFEQE +   VW++D+   S+S DNLASLYR
Sbjct  114  ETLYGDGPV--------SVLRPSTTVAFRNFEQEARQSAVWDSDQNATSSSRDNLASLYR  165

Query  648  PPFALMYHGSFEKAK  692
            PPF+LM++G F+KAK
Sbjct  166  PPFSLMFNGPFDKAK  180



>ref|XP_010240593.1| PREDICTED: UBX domain-containing protein 7 isoform X2 [Brachypodium 
distachyon]
Length=318

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 109/192 (57%), Gaps = 26/192 (14%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
             A +A+E+  LV+SFLEIA GQ+  TA QFLQ TSW LEEA+QLFY+  DG  A  +  +
Sbjct  4    AAPTAAEKDALVSSFLEIAAGQTPHTATQFLQMTSWHLEEAVQLFYI--DGEAALAAHSA  61

Query  342  PLENTAPlpdpslssisg------------sikgsgdesekQGDRDEVRPPLPVIRDVLY  485
                ++     + +  +             +        ++QGD +EVR PLPV R+ LY
Sbjct  62   AAPASSAAALEAAALAAAEAEEGYRLAPPPAAALEDGMLQRQGDDEEVRAPLPVRRETLY  121

Query  486  -DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPF  656
             D  ++   P          S V FRNFE+E +   VW++++   S+S DNLASLYRPPF
Sbjct  122  GDVPMVVARP---------NSTVAFRNFEEEARQSAVWDSEQNATSSSRDNLASLYRPPF  172

Query  657  ALMYHGSFEKAK  692
             LM++G F+KAK
Sbjct  173  DLMFNGPFDKAK  184



>gb|EYU24728.1| hypothetical protein MIMGU_mgv1a025994mg, partial [Erythranthe 
guttata]
Length=320

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 7/98 (7%)
 Frame = +3

Query  432  GDRDEVRPPLPVIRDVLYDTAVIRG-LPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK  608
             D  +VR PLPV RDVLYD++++ G +  +G S H   SVVPFRNF++EMKHPGVWE + 
Sbjct  8    NDGSDVRAPLPVRRDVLYDSSMLYGRVQRVGDSPHATHSVVPFRNFDEEMKHPGVWEIEA  67

Query  609  ASNSA------DNLASLYRPPFALMYHGSFEKAKDAAR  704
             S+S+      DNLASLYRPPFALM+ G FEKAKD AR
Sbjct  68   GSSSSVADKTQDNLASLYRPPFALMFQGPFEKAKDNAR  105



>ref|XP_003580790.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Brachypodium 
distachyon]
Length=457

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 109/192 (57%), Gaps = 26/192 (14%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
             A +A+E+  LV+SFLEIA GQ+  TA QFLQ TSW LEEA+QLFY+  DG  A  +  +
Sbjct  4    AAPTAAEKDALVSSFLEIAAGQTPHTATQFLQMTSWHLEEAVQLFYI--DGEAALAAHSA  61

Query  342  PLENTAPlpdpslssisg------------sikgsgdesekQGDRDEVRPPLPVIRDVLY  485
                ++     + +  +             +        ++QGD +EVR PLPV R+ LY
Sbjct  62   AAPASSAAALEAAALAAAEAEEGYRLAPPPAAALEDGMLQRQGDDEEVRAPLPVRRETLY  121

Query  486  -DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPF  656
             D  ++   P          S V FRNFE+E +   VW++++   S+S DNLASLYRPPF
Sbjct  122  GDVPMVVARP---------NSTVAFRNFEEEARQSAVWDSEQNATSSSRDNLASLYRPPF  172

Query  657  ALMYHGSFEKAK  692
             LM++G F+KAK
Sbjct  173  DLMFNGPFDKAK  184



>gb|AEV41122.1| putative UBX domain-containing protein [Oryza officinalis]
Length=464

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 112/192 (58%), Gaps = 29/192 (15%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  350
            +A+E+++LV+SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  +  +AA  + SP  
Sbjct  7    TAAEKESLVSSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSPAA  66

Query  351  NTAPlpdpslssisgsikgsgde-----------sekQG--DRDEVRPPLPVIRDVLYDT  491
              A     +++  + +                     QG  + D+VR PLP  R+ LY  
Sbjct  67   AAAAAEAAAVAVAAAAEVEDAMRFAPPPAAALGDGMLQGLGEEDDVRAPLPTKRETLYGD  126

Query  492  A---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPF  656
            A   V+R             S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPF
Sbjct  127  APMVVVR-----------PNSTVAFRNFEEEARQSAVWDSEQNAASSSRDNLAALYRPPF  175

Query  657  ALMYHGSFEKAK  692
            ALM++G F+KAK
Sbjct  176  ALMFNGPFDKAK  187



>emb|CAE02831.2| OSJNBa0043A12.36 [Oryza sativa Japonica Group]
 emb|CAH67698.1| H0624F09.6 [Oryza sativa Indica Group]
 dbj|BAG93324.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78226.1| hypothetical protein OsI_17866 [Oryza sativa Indica Group]
Length=459

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 110/191 (58%), Gaps = 30/191 (16%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  350
            + +E+++LV SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  DG  A  +  +P  
Sbjct  7    TEAEKESLVTSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYI--DGEAALAAHPAPSP  64

Query  351  NTAPlpdpslssisgsikgsgd------------esekQGDRDEVRPPLPVIRDVLYDTA  494
              A     +  + +  ++ +                +  G+ ++VR PLP  R+ LY  A
Sbjct  65   AAAAEAAAAAVAAAAEVEDAMRFAPPPAAALGDGMLQGLGEEEDVRAPLPTKRETLYGDA  124

Query  495  ---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFA  659
               V+R             S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPFA
Sbjct  125  PMVVVR-----------PNSTVAFRNFEEESRQSAVWDSEQNAASSSRDNLAALYRPPFA  173

Query  660  LMYHGSFEKAK  692
            LM++G F+KAK
Sbjct  174  LMFNGPFDKAK  184



>dbj|BAK05667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=453

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 110/188 (59%), Gaps = 26/188 (14%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  350
            + +E+  LV+SFLEIA GQ+  TA QFLQ TSW LEEALQLFY+  DG  A   ++ P++
Sbjct  7    TPAERDALVSSFLEIAAGQTPHTAAQFLQMTSWHLEEALQLFYI--DGEAALAGAHPPVQ  64

Query  351  NTAPlpdpslssisg-----------sikgsgdesekQGDRDEVRPPLPVIRDVLY-DTA  494
            + A     + ++ +            +        +  GD D+VR PLPV R+ LY DT 
Sbjct  65   SAAEAALAAAAAAAEVEEGFRYHPPPAAALEDGMLQGLGDDDDVRAPLPVRRETLYGDTP  124

Query  495  VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMY  668
             I   P    +A +A     FRNFE+E +    W++++   S+S+D LASLYRPPF LM+
Sbjct  125  TIIARP----NATDA-----FRNFEEEARQ-SAWDSEQNATSSSSDKLASLYRPPFDLMF  174

Query  669  HGSFEKAK  692
            +G F+KAK
Sbjct  175  NGPFDKAK  182



>gb|KGN50781.1| hypothetical protein Csa_5G259710 [Cucumis sativus]
Length=174

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 0/117 (0%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+G LSA+++Q++V+SFLE+AVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV  P  
Sbjct  1    MEGVLSATDKQSMVSSFLEVAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVGPPP  60

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG  506
                 +T    + S   IS                DEVRPPLPVIR+ LYD A++ G
Sbjct  61   VPSPPSTNEQINSSTDHISNESGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYG  117



>ref|XP_001758899.1| predicted protein [Physcomitrella patens]
 gb|EDQ76405.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 107/192 (56%), Gaps = 13/192 (7%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  LS  E+Q ++  F++I VG+SAD ARQFLQAT W L EA+QL++  N+    A + 
Sbjct  1    METTLSDWEEQLVMLEFMDI-VGESADRARQFLQATGWLLNEAVQLYFAENNEVGGANND  59

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDE-VRPPLPVIRDVLY-DTAVIRGL  509
             +    +AP+     +  S    GS   +++ GD +  VRPPLPV R+ LY D    R  
Sbjct  60   LAAPVVSAPVLPEQATLGSSLDPGSSTVNDRNGDNENYVRPPLPVKREALYEDMLQARVH  119

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS--------NSADNLASLYRPPFALM  665
             A+   +H    V PFRNFE E      W   +AS        +S D+LA+LYRPPF  M
Sbjct  120  QAVQYPSHSF--VDPFRNFEDEANQQSSWGAGEASTHVGSAGGSSRDSLAALYRPPFVFM  177

Query  666  YHGSFEKAKDAA  701
            + G+FE+AK  A
Sbjct  178  FQGTFEQAKTEA  189



>gb|AAF63167.1|AC010657_3 T5E21.7 [Arabidopsis thaliana]
Length=514

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%), Gaps = 6/115 (5%)
 Frame = +3

Query  168  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-P  344
            LS+ +QQ LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +++ P
Sbjct  2    LSSGDQQRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLQSGTHTQP  61

Query  345  LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGL  509
              N     D + +   G+  G+G+E     D DEVR PLPV+R+ LY  ++  GL
Sbjct  62   ASN-----DDAAAQSWGAATGTGNEMILPNDVDEVRAPLPVVRETLYGESMYYGL  111


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 16/78 (21%)
 Frame = +3

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA----------------DNLASLYR  647
            +G S  E  S++ FRNF +E K PG+WE D+  +SA                D+LASLYR
Sbjct  168  VGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSSASASASASASESASAPRDSLASLYR  227

Query  648  PPFALMYHGSFEKAKDAA  701
            PPF LM+ GSFE+AK  +
Sbjct  228  PPFHLMFQGSFEQAKTTS  245



>ref|XP_009759130.1| PREDICTED: UBX domain-containing protein 7-like [Nicotiana sylvestris]
Length=377

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 95/181 (52%), Gaps = 44/181 (24%)
 Frame = +3

Query  177  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENT  356
            S QQ L++SFLEIA+ Q+ADTARQFLQ T W LEEA+QLFY  N+  V  PS        
Sbjct  3    SYQQMLISSFLEIAIDQTADTARQFLQTTKWNLEEAIQLFY--NNELVDNPS--------  52

Query  357  APlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLY---DTAVIRGLPAMGGS  527
                               D+ +   D D+VRPPL V R+V+Y   +T    G      S
Sbjct  53   -------------LNGDDDDDDDDDDDDDDVRPPLHVEREVIYGHNNTVQYNG----NSS  95

Query  528  AHEARSVVPFRNFEQEM--KHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
            +H         NF+ E+  +   VW  ++     DNLAS+YRPPFAL+Y+G F  A D A
Sbjct  96   SH---------NFDDEILSRLGDVWRVEERD---DNLASMYRPPFALIYNGPFNNAIDTA  143

Query  702  R  704
            +
Sbjct  144  K  144



>ref|XP_010527852.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Tarenaya 
hassleriana]
Length=405

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 11/98 (11%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK----  608
            DEVRPPLPV+R+ LY  ++  G    G S  E+ S+V FRNF  E K PGVWE D+    
Sbjct  36   DEVRPPLPVVRETLYGDSMYYGAVRPGNSGQESNSLVAFRNFGDEAKRPGVWEPDQGASS  95

Query  609  -------ASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
                    +   D+LASLYRPPF LM+ GSFE+AK AA
Sbjct  96   ASASGSEVATPRDSLASLYRPPFHLMFSGSFEQAKSAA  133



>ref|XP_008801336.1| PREDICTED: UBX domain-containing protein 2-like [Phoenix dactylifera]
Length=340

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 90/177 (51%), Gaps = 50/177 (28%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLE  350
            S+SE+Q L++SFLEIA G S+D A ++LQAT+W+LE+A +LF+ G + G A         
Sbjct  6    SSSEKQVLISSFLEIATGFSSDAAIKYLQATNWRLEDAFELFFAGGEPGTA---------  56

Query  351  NTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSA  530
                                   S+ +   D V+PP+P+ R+VLY  A     P++    
Sbjct  57   ----------------------FSDDRARDDGVQPPIPLKREVLYGPA-----PSLPSQC  89

Query  531  HEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
             +A S               VW+++   ++   LASL+RPP  L+YHGSF  AK AA
Sbjct  90   FDAES--------------SVWKSEGGESNCSILASLFRPPSCLIYHGSFHDAKVAA  132



>ref|XP_009601783.1| PREDICTED: uncharacterized protein LOC104097000 isoform X1 [Nicotiana 
tomentosiformis]
Length=369

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            MDG +SA++QQ LV+SFLEIAVGQ+A+TARQFLQATSW LEEA+QL Y+GN+GG AA  +
Sbjct  1    MDGVISATDQQMLVSSFLEIAVGQNANTARQFLQATSWNLEEAIQLSYIGNEGGAAASVN  60

Query  336  YSPLENTA  359
               L N A
Sbjct  61   SPQLGNDA  68


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +3

Query  534  EARSVVPFRNFEQEMKHPGVWETDKASN-----SADNLASLYRPPFALMYHGSFEK  686
            E R V P  NFE+EMK PGV E +K S      + DNLASL  PPFALMYHG FEK
Sbjct  86   EPRLVAPSCNFEEEMKRPGVLEAEKRSTPTTDAAQDNLASLCHPPFALMYHGPFEK  141



>ref|XP_006343881.1| PREDICTED: UBX domain-containing protein 7-like [Solanum tuberosum]
Length=424

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 86/178 (48%), Gaps = 43/178 (24%)
 Frame = +3

Query  177  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG---VAAPSSYSPL  347
            S Q  L++SFL+IAV Q+ DTAR+FLQAT W LEEA+Q F+ GN+ G    A   +YSPL
Sbjct  34   SSQDMLISSFLDIAVDQTVDTAREFLQATKWNLEEAIQRFFSGNNNGGAEAAESFNYSPL  93

Query  348  ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGS  527
                P    S                   D D+VR PLPV R+VLY            G 
Sbjct  94   IEDNPTLWESE------------------DDDDVRLPLPVRREVLYGEN--------SGL  127

Query  528  AHEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
              + R  +    F+              S   + L+ L+RPP+ L+Y+G F+ AK+A 
Sbjct  128  YEDEREQISSSTFD--------------SYDNNTLSVLFRPPYELLYNGPFDHAKEAG  171



>ref|XP_010325366.1| PREDICTED: LOW QUALITY PROTEIN: UBX domain-containing protein 
7-like [Solanum lycopersicum]
Length=375

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 85/173 (49%), Gaps = 42/173 (24%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS---SYSPLENTAP  362
            L++SFL+IAV Q+ DTAR+FLQAT+W LEEA+Q F+ GN+ G  A +   +YSPL    P
Sbjct  4    LISSFLDIAVDQTVDTAREFLQATNWNLEEAIQRFFSGNNNGATAAAESFNYSPLIENTP  63

Query  363  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  542
                                E + D D+V  P PV R+V Y            G   + R
Sbjct  64   -----------------TLREWEDDDDDVHLPSPVRREVFYGET--------SGLYEDER  98

Query  543  SVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
              +    F            D  SN+A  L+ L+RPP+  +Y+G F+ AK+A 
Sbjct  99   DQISSSTF------------DSYSNNA--LSDLFRPPYEFLYNGPFDHAKEAG  137



>ref|XP_010253434.1| PREDICTED: UBX domain-containing protein 7-like [Nelumbo nucifera]
Length=361

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 85/182 (47%), Gaps = 67/182 (37%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  + + E+ TLV+SFL I VGQSA TA QFL+AT W LEEA++LFY G          
Sbjct  1    MENTVVSGEKDTLVSSFLGIVVGQSAQTAIQFLEATGWNLEEAIRLFYAGL---------  51

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
                                              +D VRPPLPV R+ L D         
Sbjct  52   ----------------------------------QDNVRPPLPVKREKLCD---------  68

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKD  695
                  E+   +P RN      H  VWE+ ++ +S  +LASLYRPP  L+Y G+F +AK 
Sbjct  69   ------ESDHPMP-RN------HSNVWESGRSHSS--DLASLYRPPVELLYQGTFHEAKG  113

Query  696  AA  701
             A
Sbjct  114  EA  115



>ref|XP_006414812.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
 gb|ESQ56265.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
Length=394

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 86/180 (48%), Gaps = 34/180 (19%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPS  332
            M  A S   QQ L++SF+EIAVGQ+ +TA QFL+ATSW LE+A+ LF V G +  ++ P 
Sbjct  2    MATATSDDHQQRLISSFIEIAVGQTIETALQFLKATSWNLEDAINLFLVHGQNQTLSYPQ  61

Query  333  SYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLP  512
            + S                               + +++ PPLP IRD LYD++ +    
Sbjct  62   NSS-----------------------EQYWSDNQEEEQIHPPLPSIRDTLYDSSSMHHQT  98

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAK  692
             +     E        + +QE    G        +    L++LYRPP  L++ GSFE AK
Sbjct  99   TVQVGPEE------IWDLKQEPSDSG----SVVGSEGSRLSTLYRPPLKLLFQGSFEDAK  148



>tpg|DAA35438.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=426

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 85/163 (52%), Gaps = 33/163 (20%)
 Frame = +3

Query  261  TSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsikgsgdesekQ---  431
            TSW LEEALQLFY+  +      S+ +P    AP P  + +S   +  G+ +        
Sbjct  2    TSWHLEEALQLFYIDGE------SALTPAHPVAPPPTSAAASALAAAAGAEEAMRFAPPP  55

Query  432  --------------GDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFE  569
                          G+ D+VR PLPV R+ LY   ++        S     +   FRNFE
Sbjct  56   AAALGDAMLHGFGVGEDDDVRAPLPVKRETLYGEGIV--------SVMRPNASAAFRNFE  107

Query  570  QEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFEKAK  692
            QE +   VW++D+   S+S DNLASLYRPPF+LM++G F+KAK
Sbjct  108  QEARQSAVWDSDQNATSSSGDNLASLYRPPFSLMFNGPFDKAK  150



>ref|XP_009599661.1| PREDICTED: UBX domain-containing protein 7 homolog [Nicotiana 
tomentosiformis]
Length=367

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 88/180 (49%), Gaps = 52/180 (29%)
 Frame = +3

Query  177  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENT  356
            S QQ LV+SFLEIAV Q+ADTAR+FLQ TSW LEEA+QLFY  N+  V  PS     +N 
Sbjct  3    SYQQMLVSSFLEIAVDQTADTARRFLQTTSWNLEEAIQLFY--NNELVHNPSLNGAADNW  60

Query  357  APlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG-GSAH  533
                  ++                                  ++ AV    P +G GS+H
Sbjct  61   GQYDGDNVDDDD------------------------------HNIAV----PYIGNGSSH  86

Query  534  EARSVVPFRNFEQEM--KHPG-VWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                     N E ++    PG VW  ++     DNL+S+YRPPFAL+Y+G F  A D A+
Sbjct  87   ---------NLENKILSSRPGDVWRVEERD---DNLSSMYRPPFALLYNGPFNNAIDTAK  134



>emb|CDX84023.1| BnaC08g16220D [Brassica napus]
Length=458

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 97/191 (51%), Gaps = 21/191 (11%)
 Frame = +3

Query  168  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPL  347
            LS+ +QQ LV+SFL+IAVGQ+A+TARQFLQ+  ++ +E  Q   + N    +      P 
Sbjct  2    LSSRDQQRLVSSFLDIAVGQTAETARQFLQSRRYERKEFFQTDLLKNRSMRSKNRRRLPH  61

Query  348  ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDT------AVIRGL  509
            +  + +        +                + V+  L  +R+ LY        ++  G 
Sbjct  62   KEKSSIRYCLEIFRTLKTTNIATSWNLN---EAVQ--LFYVRETLYGDPMYYGDSMYFGY  116

Query  510  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA----------DNLASLYRPPFA  659
              +G    E  S++ F +F +E K PGVWE D+ ++SA           +LASLYRPPF 
Sbjct  117  TMLGNYERELVSLIDFLDFSEEPKRPGVWEPDEVASSASASASTSGPRHSLASLYRPPFH  176

Query  660  LMYHGSFEKAK  692
            LM HGSFE+AK
Sbjct  177  LMTHGSFEQAK  187



>gb|KDO53545.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=342

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 5/62 (8%)
 Frame = +3

Query  531  HEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKD  695
            HE  S++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSFEKAKD
Sbjct  13   HEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKD  72

Query  696  AA  701
            AA
Sbjct  73   AA  74



>ref|XP_008342902.1| PREDICTED: LOW QUALITY PROTEIN: membrane-associated progesterone 
receptor component 1-like [Malus domestica]
Length=249

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNS  620
            DEVR P+PVIRDVL+D   + G P    S  +  SV+ FRNFE+EMKHPGV E+D+   S
Sbjct  41   DEVRXPMPVIRDVLFDDMSLYGAPRARFS--QQGSVIAFRNFEEEMKHPGVXESDQGDTS  98

Query  621  A-----DNLASLYRPPFAL  662
            +     DNLASLYRPP  L
Sbjct  99   SANAVQDNLASLYRPPVQL  117



>ref|XP_009139538.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=427

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 85/181 (47%), Gaps = 39/181 (22%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            +QQ L++SF+EIA+GQ+ DTA QFL+ TSW LEEA+ LF +  +       + + L  + 
Sbjct  4    DQQKLISSFMEIAIGQTKDTAIQFLKETSWNLEEAINLFLIHRENQPQRQQNATELHRS-  62

Query  360  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  539
                                     + + + PPLP IRD LYD++ +   P         
Sbjct  63   ----------------------DYQEEEHIPPPLPSIRDTLYDSSYMYQTPVQ-------  93

Query  540  RSVVPFRNFEQEMKHPGVWETD-------KASNSADNLASLYRPPFALMYHGSFEKAKDA  698
              V P   ++ E +     +TD       + S     L+SLYR P  L++ G+FE+AK  
Sbjct  94   --VCPEEIWDAESEPSEDSDTDVGPDSKPEPSEEPRRLSSLYRAPLKLLFQGTFEEAKST  151

Query  699  A  701
            +
Sbjct  152  S  152



>gb|KDO48110.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=312

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 83/177 (47%), Gaps = 54/177 (31%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+    AP SYS L   A
Sbjct  7    DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATAPPSYSALAENA  66

Query  360  PlpdpslssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSA  530
                              D++   G +D   EV  P P  +D+ Y+ A            
Sbjct  67   --------------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA------------  99

Query  531  HEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
                                         S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  100  ------------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  132



>gb|KDO48111.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=305

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 83/177 (47%), Gaps = 54/177 (31%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+    AP SYS L   A
Sbjct  7    DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATAPPSYSALAENA  66

Query  360  PlpdpslssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSA  530
                              D++   G +D   EV  P P  +D+ Y+ A            
Sbjct  67   --------------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA------------  99

Query  531  HEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
                                         S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  100  ------------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  132



>ref|XP_006480638.1| PREDICTED: UBX domain-containing protein 7-like isoform X4 [Citrus 
sinensis]
Length=212

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 82/177 (46%), Gaps = 54/177 (31%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A
Sbjct  26   DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA  85

Query  360  PlpdpslssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSA  530
                              D++   G +D   EV  P P  +D+ Y+ A            
Sbjct  86   --------------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA------------  118

Query  531  HEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
                                         S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  119  ------------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  151



>ref|XP_006480637.1| PREDICTED: UBX domain-containing protein 7-like isoform X3 [Citrus 
sinensis]
Length=275

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 82/177 (46%), Gaps = 54/177 (31%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A
Sbjct  7    DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA  66

Query  360  PlpdpslssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSA  530
                              D++   G +D   EV  P P  +D+ Y+ A            
Sbjct  67   --------------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA------------  99

Query  531  HEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
                                         S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  100  ------------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  132



>ref|XP_006480635.1| PREDICTED: UBX domain-containing protein 7-like isoform X1 [Citrus 
sinensis]
Length=294

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 82/177 (46%), Gaps = 54/177 (31%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A
Sbjct  26   DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA  85

Query  360  PlpdpslssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSA  530
                              D++   G +D   EV  P P  +D+ Y+ A            
Sbjct  86   --------------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA------------  118

Query  531  HEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
                                         S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  119  ------------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  151



>ref|XP_006480636.1| PREDICTED: UBX domain-containing protein 7-like isoform X2 [Citrus 
sinensis]
Length=278

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 82/177 (46%), Gaps = 54/177 (31%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            ++++ ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A
Sbjct  26   DKESRISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA  85

Query  360  PlpdpslssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSA  530
                              D++   G +D   EV  P P  +D+ Y+ A            
Sbjct  86   --------------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA------------  118

Query  531  HEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
                                         S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  119  ------------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  151



>ref|XP_006653862.1| PREDICTED: UBX domain-containing protein 2-like [Oryza brachyantha]
Length=380

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 10/88 (11%)
 Frame = +3

Query  435  DRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--  608
            + ++VR PLPV R+ LY  A     PA+    H   S V FRNFE+E +   VW++++  
Sbjct  24   EEEDVRAPLPVKRETLYGDA-----PAV---VHRPNSTVAFRNFEEEARQSAVWDSEQNA  75

Query  609  ASNSADNLASLYRPPFALMYHGSFEKAK  692
            AS+S DNLA+LYRPPFALM++G F+KAK
Sbjct  76   ASSSRDNLAALYRPPFALMFNGPFDKAK  103



>ref|XP_009601784.1| PREDICTED: uncharacterized protein LOC104097000 isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            LV+SFLEIAVGQ+ADT RQFLQATSW LEEA+QL Y+GN+GG AA  +   L N A
Sbjct  2    LVSSFLEIAVGQTADTVRQFLQATSWNLEEAIQLSYIGNEGGAAASVNSPQLGNDA  57


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +3

Query  534  EARSVVPFRNFEQEMKHPGVWETDKASN-----SADNLASLYRPPFALMYHGSFEK  686
            E R V P  NFE+EMK PGV E +K S      + DNLASL  PPFALMYHG FEK
Sbjct  75   EPRLVAPSCNFEEEMKRPGVLEAEKRSTPTTDAAQDNLASLCHPPFALMYHGPFEK  130



>emb|CDY01207.1| BnaA04g06120D [Brassica napus]
Length=789

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 53/175 (30%), Positives = 81/175 (46%), Gaps = 53/175 (30%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            +QQ L++SF+EIA+GQ+ DTA QFL+ TSW LEEA+ LF +  +                
Sbjct  4    DQQKLISSFMEIAIGQTKDTAIQFLKETSWNLEEAINLFLIHREN---------------  48

Query  360  PlpdpslssisgsikgsgdesekQGDRDE-VRPPLPVIRDVLYDTAVIRGLPAMGGSAHE  536
                                   Q  ++E + PPLP IRD LYD++ +   P        
Sbjct  49   -----------------------QPQQEEHIPPPLPSIRDTLYDSSYMYQTPV-------  78

Query  537  ARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
               V P   ++ E +      ++ +      L+SLYR P  L++ G+FE+AK  +
Sbjct  79   --QVCPEEIWDAESE-----PSEDSDTDPRRLSSLYRAPLKLLFQGTFEEAKSTS  126


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  183  QQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV  302
            QQ L++SF E+AVGQ+ +T  QFL+  +W LEEA+  F+V
Sbjct  449  QQNLISSFTEVAVGQTMETVIQFLETANWNLEEAINHFFV  488



>gb|EEE61882.1| hypothetical protein OsJ_16574 [Oryza sativa Japonica Group]
Length=421

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 16/92 (17%)
 Frame = +3

Query  432  GDRDEVRPPLPVIRDVLYDTA---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWET  602
            G+ ++VR PLP  R+ LY  A   V+R             S V FRNFE+E +   VW++
Sbjct  104  GEEEDVRAPLPTKRETLYGDAPMVVVR-----------PNSTVAFRNFEEESRQSAVWDS  152

Query  603  DK--ASNSADNLASLYRPPFALMYHGSFEKAK  692
            ++  AS+S DNLA+LYRPPFALM++G F+KAK
Sbjct  153  EQNAASSSRDNLAALYRPPFALMFNGPFDKAK  184



>gb|AIE88273.1| hypothetical protein OG_BBa0063K01.4 [Oryza glaberrima]
Length=540

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 16/92 (17%)
 Frame = +3

Query  432  GDRDEVRPPLPVIRDVLYDTA---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWET  602
            G+ ++VR PLP  R+ LY  A   V+R             S V FRNFE+E +   VW++
Sbjct  185  GEEEDVRAPLPTKRETLYGDAPMVVVR-----------PNSTVAFRNFEEESRQSAVWDS  233

Query  603  DK--ASNSADNLASLYRPPFALMYHGSFEKAK  692
            ++  AS+S DNLA+LYRPPFALM++G F+KAK
Sbjct  234  EQNAASSSRDNLAALYRPPFALMFNGPFDKAK  265



>ref|XP_006414811.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
 gb|ESQ56264.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
Length=448

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 86/180 (48%), Gaps = 35/180 (19%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+   S   QQ L+++F+EIAVGQ+ +TA+ FL+ T+W LEEA+ LF +        P S
Sbjct  1    METTTSDLHQQKLISTFMEIAVGQTKETAQLFLKTTNWNLEEAINLFLIDRKN---KPLS  57

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
            Y                       S     ++ + +++  PL   RD LY ++ IR  P 
Sbjct  58   Y---------------------HNSYLSDYQEEEEEQIPLPLSSTRDTLYGSSSIRRTPV  96

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKAK  692
                      V P   +  + + P   ++D    S ++ L+SLYRPP  L++ GSFE AK
Sbjct  97   Q---------VRPEEIWNSKTE-PSDSDSDSVVGSKESKLSSLYRPPLKLLFKGSFEDAK  146



>gb|EMT10976.1| hypothetical protein F775_30110 [Aegilops tauschii]
Length=396

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 13/90 (14%)
 Frame = +3

Query  432  GDRDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK  608
            GD D+VR PLPV R+ LY DT +I   P          + V FRNFE+E +    W++++
Sbjct  43   GDDDDVRAPLPVRRETLYGDTPMIVTRP---------NATVAFRNFEEEARQ-SAWDSEQ  92

Query  609  --ASNSADNLASLYRPPFALMYHGSFEKAK  692
               S+S DNLASLYRPPF LM++G F+KAK
Sbjct  93   NATSSSRDNLASLYRPPFDLMFNGPFDKAK  122



>gb|EMS63720.1| UBX domain-containing protein 7 [Triticum urartu]
Length=454

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 13/90 (14%)
 Frame = +3

Query  432  GDRDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK  608
            GD D+VR PLPV R+ LY DT +I   P          + V FRNFE+E +    W++++
Sbjct  101  GDEDDVRAPLPVRRETLYGDTPMIVTRP---------NATVAFRNFEEEARQ-SAWDSEQ  150

Query  609  --ASNSADNLASLYRPPFALMYHGSFEKAK  692
               S+S DNLASLYRPPF LM++G F+KAK
Sbjct  151  NATSSSRDNLASLYRPPFDLMFNGPFDKAK  180



>ref|XP_003604178.1| UBX domain-containing protein [Medicago truncatula]
 gb|ACJ84042.1| unknown [Medicago truncatula]
 gb|AES86375.1| UBX domain protein [Medicago truncatula]
Length=286

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 79/177 (45%), Gaps = 73/177 (41%)
 Frame = +3

Query  177  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENT  356
            ++++TLV+ FLEIA GQ+A TA+ FLQATSW LEEAL+LF  G         +  PL +T
Sbjct  10   TDEETLVSYFLEIARGQTAATAKHFLQATSWNLEEALKLFLSG---------TKPPLMDT  60

Query  357  APlpdpslssisgsikgsgdesekQGDRDEVRP--PLPVIRDVLYDTAVIRGLPAMGGSA  530
            A                           +++ P  PLP+I++ L                
Sbjct  61   A---------------------------NQIDPSSPLPLIKETL----------------  77

Query  531  HEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
                        E E       E+DK       LA LY PPF LM++GSF KAK AA
Sbjct  78   ------------ESEQGASSTSESDK-------LAYLYHPPFHLMFNGSFIKAKFAA  115



>emb|CDY68911.1| BnaAnng28760D [Brassica napus]
Length=385

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 10/92 (11%)
 Frame = +3

Query  435  DRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS  614
            D D VR PLPV+ + LY  ++      +G    E  S++ F +F +E K  GVWE D+  
Sbjct  30   DADGVRAPLPVVTETLYRDSMYY----VGNYERELASLIDFIDFSEEPKRSGVWEPDEVG  85

Query  615  NSA------DNLASLYRPPFALMYHGSFEKAK  692
            +SA      ++LASLYRPPF LM HGSFE+ K
Sbjct  86   SSASTSGPRNSLASLYRPPFHLMTHGSFEQVK  117



>ref|XP_006446591.1| hypothetical protein CICLE_v10017670mg [Citrus clementina]
 gb|ESR59831.1| hypothetical protein CICLE_v10017670mg [Citrus clementina]
Length=369

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 85/186 (46%), Gaps = 64/186 (34%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            +++++++SFLEI  GQ+ +TA + L AT+W L+EA+ L +  N   +    +   ++   
Sbjct  9    QRKSVISSFLEITNGQTEETAVKILNATNWNLDEAI-LRFNNNSNNIDEDENEVEVD---  64

Query  360  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  539
                                       DEVRPPLPV++D L                   
Sbjct  65   -------------------------IEDEVRPPLPVVKDTL-------------------  80

Query  540  RSVVPFRNFEQEMKHPGVWETDKASN------------SADNLASLYRPPFALMYHGSFE  683
                 +  + Q+ K+P VWE++  S             + +NLASLYRPP  LM++GSFE
Sbjct  81   ---CYYPQYYQQ-KNPEVWESEDNSEVWGSEEPSDNKNNNNNLASLYRPPVDLMFNGSFE  136

Query  684  KAKDAA  701
            KAKD  
Sbjct  137  KAKDVG  142



>ref|XP_006470475.1| PREDICTED: UBX domain-containing protein 7-like [Citrus sinensis]
Length=397

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 82/186 (44%), Gaps = 64/186 (34%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            +++ +++SFLEI  GQ+ +TA + L AT+W L+EA+  F   N+        Y       
Sbjct  9    QRKRVISSFLEITNGQTEETAVKILNATNWNLDEAILRF--NNNSNNIDEDEYE------  60

Query  360  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  539
                                  +    DEVRPPLPV++D L                   
Sbjct  61   ---------------------VEVDIEDEVRPPLPVVKDTL-------------------  80

Query  540  RSVVPFRNFEQEMKHPGVWETDKASN------------SADNLASLYRPPFALMYHGSFE  683
                 +  + Q+ K+P VWE++  S             + +NLASLYRPP  LM++GSFE
Sbjct  81   ---CYYPQYYQQ-KNPEVWESEDNSEVWGSEEPSDNKNNNNNLASLYRPPVDLMFNGSFE  136

Query  684  KAKDAA  701
            KAKD  
Sbjct  137  KAKDVG  142



>sp|P0DKI4.1|PUX14_ARATH RecName: Full=Putative plant UBX domain-containing protein 14; 
Short=PUX14 [Arabidopsis thaliana]
Length=417

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 84/181 (46%), Gaps = 55/181 (30%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+ A    +Q+ L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +        P  
Sbjct  1    METATRTHQQRKLISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLIARRN----PHH  56

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLP  512
            +                               G  +E+ P PLP  ++ LYD       P
Sbjct  57   H------------------------------HG--EELVPLPLPSKKNTLYDYD-----P  79

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKA  689
             M  S + + +V P            +W+ +  S  +D+ L+SLYRPP +L +HGSFE A
Sbjct  80   FM--SHNTSVAVCP----------EEIWDDESTSEESDSRLSSLYRPPPSLFFHGSFEDA  127

Query  690  K  692
            K
Sbjct  128  K  128



>gb|KDO55137.1| hypothetical protein CISIN_1g036413mg [Citrus sinensis]
Length=346

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 82/186 (44%), Gaps = 64/186 (34%)
 Frame = +3

Query  180  EQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  359
            +++ +++SFLEI  GQ+ +TA + L AT+W L++A+  F   N+        Y       
Sbjct  9    QRKRVISSFLEITNGQTEETALKILNATNWNLDKAILRF--NNNSNNIDEDEYE------  60

Query  360  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  539
                                  +    DEVRPPLPV++D L                   
Sbjct  61   ---------------------VEVDIEDEVRPPLPVVKDTL-------------------  80

Query  540  RSVVPFRNFEQEMKHPGVWETDKASN------------SADNLASLYRPPFALMYHGSFE  683
                 +  + Q+ K+P VWE++  S             + +NLASLYRPP  LM++GSFE
Sbjct  81   ---CYYPQYYQQ-KNPEVWESEDNSEVWGSEEPSDNKNNNNNLASLYRPPVDLMFNGSFE  136

Query  684  KAKDAA  701
            KAKD  
Sbjct  137  KAKDVG  142



>ref|NP_193161.3| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83401.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=821

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 54/181 (30%), Positives = 85/181 (47%), Gaps = 55/181 (30%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+ A    +Q+ L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +         + 
Sbjct  1    METATRTHQQRKLISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLI---------AR  51

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLP  512
             +P  +                             +E+ P PLP  ++ LYD       P
Sbjct  52   RNPHHHHG---------------------------EELVPLPLPSKKNTLYDYD-----P  79

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKA  689
             M  S + + +V P            +W+ +  S  +D+ L+SLYRPP +L +HGSFE A
Sbjct  80   FM--SHNTSVAVCP----------EEIWDDESTSEESDSRLSSLYRPPPSLFFHGSFEDA  127

Query  690  K  692
            K
Sbjct  128  K  128



>ref|NP_001190727.1| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83402.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=815

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 54/181 (30%), Positives = 85/181 (47%), Gaps = 55/181 (30%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+ A    +Q+ L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +         + 
Sbjct  1    METATRTHQQRKLISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLI---------AR  51

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLP  512
             +P  +                             +E+ P PLP  ++ LYD       P
Sbjct  52   RNPHHHHG---------------------------EELVPLPLPSKKNTLYDYD-----P  79

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKA  689
             M  S + + +V P            +W+ +  S  +D+ L+SLYRPP +L +HGSFE A
Sbjct  80   FM--SHNTSVAVCP----------EEIWDDESTSEESDSRLSSLYRPPPSLFFHGSFEDA  127

Query  690  K  692
            K
Sbjct  128  K  128



>emb|CAB10204.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78467.1| hypothetical protein [Arabidopsis thaliana]
Length=724

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 54/181 (30%), Positives = 85/181 (47%), Gaps = 55/181 (30%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+ A    +Q+ L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +         + 
Sbjct  1    METATRTHQQRKLISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLI---------AR  51

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLP  512
             +P  +                             +E+ P PLP  ++ LYD       P
Sbjct  52   RNPHHHHG---------------------------EELVPLPLPSKKNTLYDYD-----P  79

Query  513  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKA  689
             M  S + + +V P            +W+ +  S  +D+ L+SLYRPP +L +HGSFE A
Sbjct  80   FM--SHNTSVAVCP----------EEIWDDESTSEESDSRLSSLYRPPPSLFFHGSFEDA  127

Query  690  K  692
            K
Sbjct  128  K  128



>ref|XP_006414754.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
 gb|ESQ56207.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
Length=388

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 73/159 (46%), Gaps = 36/159 (23%)
 Frame = +3

Query  222  GQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             Q+ +TA+QFL+ATSW LE+A+ LF V G +  ++ P + S                   
Sbjct  2    SQTIETAQQFLKATSWNLEDAINLFLVHGQNKTLSYPQNSS-------------------  42

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEM  578
                        +  ++ PPLP IRD LYD++ +   P +     E        + +QE 
Sbjct  43   ----EQYWSDYQEEQQIPPPLPSIRDTLYDSSSMYHQPPVQVGPEE------IWDLKQEA  92

Query  579  KHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKAK  692
               G         S D+ L+SLYRPP  L++ GSFE AK
Sbjct  93   SDSG-----SVVGSEDSRLSSLYRPPLKLLFQGSFEYAK  126



>ref|NP_001054216.1| Os04g0670800 [Oryza sativa Japonica Group]
 dbj|BAF16130.1| Os04g0670800, partial [Oryza sativa Japonica Group]
Length=331

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 2/52 (4%)
 Frame = +3

Query  543  SVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFEKAK  692
            S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPFALM++G F+KAK
Sbjct  5    STVAFRNFEEESRQSAVWDSEQNAASSSRDNLAALYRPPFALMFNGPFDKAK  56



>gb|KEH28537.1| UBX domain protein [Medicago truncatula]
Length=259

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 76/178 (43%), Gaps = 56/178 (31%)
 Frame = +3

Query  174  ASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN--DGGVAAPSSYSPL  347
            + +++TL++ FL  A  Q+ DTA  FLQA++W LEEAL  +  G+  D  +      S L
Sbjct  4    SDKEETLISIFLNTARPQNDDTAIHFLQASNWDLEEALHCYLSGDYDDQAILLSDRGSRL  63

Query  348  ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGS  527
             + +P                           E R  LP I                   
Sbjct  64   GHISP---------------------------EKRNSLPYI-------------------  77

Query  528  AHEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
              E     P R +E E+   G   +   S+  DNLASLYRPPF L++ GSF KAK AA
Sbjct  78   VQE-----PTRVWETEL---GATTSTAESSRQDNLASLYRPPFHLLFDGSFYKAKSAA  127



>gb|KGN50782.1| hypothetical protein Csa_5G259720 [Cucumis sativus]
Length=164

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSF  680
            MG   +E+ S + FRN + E+KH  VW++ + +     NS DNLASLYRPP+ LM+ GSF
Sbjct  1    MGYLPNESGSSIGFRNLQNEVKHHDVWQSGEGAASTSGNSRDNLASLYRPPYHLMFTGSF  60

Query  681  EK  686
            EK
Sbjct  61   EK  62



>ref|XP_003604169.1| UBX domain-containing protein [Medicago truncatula]
 gb|AES86366.1| UBX domain protein [Medicago truncatula]
Length=320

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 76/178 (43%), Gaps = 56/178 (31%)
 Frame = +3

Query  174  ASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN--DGGVAAPSSYSPL  347
            + +++TL++ FL  A  Q+ DTA  FLQA++W LEEAL  +  G+  D  +      S L
Sbjct  4    SDKEETLISIFLNTARPQNDDTAIHFLQASNWDLEEALHCYLSGDYDDQAILLSDRGSRL  63

Query  348  ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGS  527
             + +P                           E R  LP I                   
Sbjct  64   GHISP---------------------------EKRNSLPYI-------------------  77

Query  528  AHEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
              E     P R +E E+   G   +   S+  DNLASLYRPPF L++ GSF KAK AA
Sbjct  78   VQE-----PTRVWETEL---GATTSTAESSRQDNLASLYRPPFHLLFDGSFYKAKSAA  127



>gb|KEH28538.1| UBX domain protein [Medicago truncatula]
Length=305

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 75/178 (42%), Gaps = 56/178 (31%)
 Frame = +3

Query  174  ASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN--DGGVAAPSSYSPL  347
            + +++TL++ FL  A  Q+ DTA  FLQA++W LEEAL  +  G+  D  +      S L
Sbjct  4    SDKEETLISIFLNTARPQNDDTAIHFLQASNWDLEEALHCYLSGDYDDQAILLSDRGSRL  63

Query  348  ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGS  527
             + +P                           E R  LP I                   
Sbjct  64   GHISP---------------------------EKRNSLPYIVQE----------------  80

Query  528  AHEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
                    P R +E E+   G   +   S+  DNLASLYRPPF L++ GSF KAK AA
Sbjct  81   --------PTRVWETEL---GATTSTAESSRQDNLASLYRPPFHLLFDGSFYKAKSAA  127



>gb|KFK22408.1| hypothetical protein AALP_AAs65522U000100 [Arabis alpina]
Length=377

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 75/167 (45%), Gaps = 37/167 (22%)
 Frame = +3

Query  174  ASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLEN  353
             S+Q  L+++F+EIAVG S +TA  FL+AT+W LE+A+ LF +      A   SY   EN
Sbjct  5    TSDQDKLISTFVEIAVGHSIETAILFLKATNWNLEDAINLFLIHRSNHQAL--SY---EN  59

Query  354  TAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAH  533
            +               +     S    D +++  PLP  RD LYD       P+M     
Sbjct  60   SL--------------EQYHYHSNNSQDEEQIPLPLPSRRDTLYDD------PSMC----  95

Query  534  EARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHG  674
                    RN    +    +W++   S     L+SL+RPP  L++  
Sbjct  96   --------RNTSVPVCPEQIWDSMTPSGPCSKLSSLFRPPIDLLFKA  134



>gb|AEV41076.1| putative UBX domain-containing protein [Oryza minuta]
Length=402

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +3

Query  171  SASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV  302
            +A+E+++LV+SFLEIA GQ+ +TA QFLQ TSW LEE LQLFY+
Sbjct  7    TAAEKESLVSSFLEIAAGQTPETATQFLQMTSWHLEEPLQLFYI  50



>ref|XP_010519462.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=357

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 6/66 (9%)
 Frame = +3

Query  168  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN------DGGVAAP  329
            +S +EQ+ LV+SFLEI VG++  TAR+FLQATSW L EA+ LFY GN      +  V AP
Sbjct  2    MSENEQRRLVSSFLEITVGETVTTARRFLQATSWNLGEAVLLFYSGNQKDHVEEDEVNAP  61

Query  330  SSYSPL  347
              + P+
Sbjct  62   LMHDPM  67



>ref|XP_002868299.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44558.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=694

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 84/180 (47%), Gaps = 60/180 (33%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+ A SA++ Q L++SFL+I VGQS + A QFL+AT+W LE+A+ LF +           
Sbjct  1    MESATSANQLQ-LISSFLDITVGQSVEIALQFLKATNWHLEDAINLFLIAR---------  50

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
                 N  P                          ++V  PLP + D LYD++ +R   +
Sbjct  51   ----RNPNP--------------------------EQVPLPLPSMMDTLYDSS-MRHNTS  79

Query  516  MGGSAHEARSVVPFRNFEQEMKHPGVWE-TDKASNSADNLASLYRPPFALMYHGSFEKAK  692
            +  S  +                  +W+ T + S S   L+SLYRPP +L +HGSFE AK
Sbjct  80   VAVSPED------------------IWDSTSEESESYSRLSSLYRPPPSLFFHGSFEDAK  121



>ref|XP_007222574.1| hypothetical protein PRUPE_ppa008429mg [Prunus persica]
 gb|EMJ23773.1| hypothetical protein PRUPE_ppa008429mg [Prunus persica]
Length=332

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +3

Query  558  RNFEQEMKHPGVWE-----TDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
            ++F    +HPGVWE     T  A  + DNLASLYRPPF L++ GSFEKAK AA
Sbjct  12   QDFHNMNRHPGVWESGQGATSSAETARDNLASLYRPPFKLLFQGSFEKAKGAA  64



>ref|XP_010436606.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=358

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  153  RMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS  332
            ++DG +   +Q  L++SFLEIAVGQ+ +TAR FLQ + W +  A+ LF + N+     PS
Sbjct  17   QLDGTIDLCDQDQLISSFLEIAVGQTTETARGFLQTSGWNINVAIDLFLITNNTYSPPPS  76



>ref|XP_010445452.1| PREDICTED: UBX domain-containing protein 7 [Camelina sativa]
Length=430

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  153  RMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG  317
            ++DG +   +Q  L++SFLEIAVGQ+ +TAR FLQ + W +  A+ LF + N+  
Sbjct  17   QLDGTIDLCDQDQLISSFLEIAVGQTTETARVFLQTSGWNINVAIDLFLITNNNN  71



>ref|XP_005643712.1| hypothetical protein COCSUDRAFT_59648 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19168.1| hypothetical protein COCSUDRAFT_59648 [Coccomyxa subellipsoidea 
C-169]
Length=440

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (48%), Gaps = 26/173 (15%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  371
            ++A+F +I  G    TA+  L+AT++ LE+A+ LF+  +     + S  +    +AP+  
Sbjct  4    VMANFTDI-TGADHSTAQGLLEATNYDLEQAVGLFFATHGEAAGSASGAAHSHPSAPMDT  62

Query  372  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEARSV  548
                                   + VRPPLP +RD LY +T   RG  A G  +H+ + V
Sbjct  63   GGGPMPHPM-------------EEHVRPPLPAVRDRLYGETFTSRG--ASGSQSHQ-QEV  106

Query  549  VPFRNFEQEMKHPGVWETDKASNSADN--LASLYRPPFALMYHGSFEKAKDAA  701
              FR+F+ E          +A   ++   LA L+ PP  LM+ G+ E+AK AA
Sbjct  107  QAFRDFKAETS------KSRAGGKSNQPGLAGLFEPPHDLMFKGTLEEAKAAA  153



>ref|XP_010450078.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=432

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +3

Query  153  RMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG  317
            ++DG +   + Q L++SFLEIAVGQ+ +TAR FLQ + W + EA+ LF + N+  
Sbjct  17   QLDGTMDLWQDQ-LISSFLEIAVGQTTETARGFLQTSGWNINEAIDLFLITNNNN  70



>ref|XP_005796061.1| PREDICTED: UBX domain-containing protein 7-like [Xiphophorus 
maculatus]
Length=526

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 83/189 (44%), Gaps = 39/189 (21%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G  SA E   L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A   S S
Sbjct  5    GDTSAPEANGLIQQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGMAEEPSTS  61

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
                 +    P                      DEVR P+P  +D+L +   + G+P   
Sbjct  62   SSSAASSSRAPPT--------------------DEVRAPIPQKQDILVEPEPLFGVPKR-  100

Query  522  GSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGS  677
                 ARS+   FR+F       EQE+++ G    DK  ++   LA L+RPP  LM+ GS
Sbjct  101  --RRPARSIFDGFRDFQTETIRQEQELRNGGT--VDKKLST---LADLFRPPIELMHKGS  153

Query  678  FEKAKDAAR  704
            FE AKD  +
Sbjct  154  FETAKDCGQ  162



>ref|XP_007884078.1| PREDICTED: UBX domain-containing protein 7 isoform X5 [Callorhinchus 
milii]
Length=494

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 87/191 (46%), Gaps = 41/191 (21%)
 Frame = +3

Query  159  DGALSA-SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            DGA SA S  Q L+  F  I  G S    +  L+A +  LE A+ ++  G  GG+A   S
Sbjct  6    DGAGSAGSALQGLIRQFTAI-TGASESVGKHILEACNNNLEMAVTMYLDG--GGIAEEPS  62

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             S    +A  P                       +DEVR P+P  +D+L +   + G P 
Sbjct  63   TSTAGTSASRPPA---------------------QDEVRAPIPQKQDILVEPEPLFGAPK  101

Query  516  MGGSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYH  671
                   ARS+   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ 
Sbjct  102  ---RRRPARSIFDGFRDFQTETIRQEQELRNGG--PVDKKLTT---LADLFRPPIDLMHK  153

Query  672  GSFEKAKDAAR  704
            GSFE AK++ +
Sbjct  154  GSFETAKESGQ  164



>ref|XP_006285935.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
 gb|EOA18833.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
Length=436

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  153  RMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  311
            R+D A+    +   V SFLEIAVG++ +TAR+FLQ T WK++EA+ L+   N+
Sbjct  21   RIDEAIDLFRKNEQVTSFLEIAVGETRETARRFLQRTDWKIDEAINLYLTNNN  73



>gb|KFK22146.1| hypothetical protein AALP_AAs62910U000300 [Arabis alpina]
Length=408

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 10/77 (13%)
 Frame = +3

Query  135  SAFS-LPRMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  311
            S FS L    G ++      L++SFLE AVGQ+ +TAR FLQ T+W +EEA+ L+ + N+
Sbjct  3    STFSELSNRTGHVALPTNDQLISSFLETAVGQTVETARTFLQTTNWNIEEAINLYLMNNN  62

Query  312  ---------GGVAAPSS  335
                       VAAP S
Sbjct  63   YDSSLYHDYNQVAAPRS  79



>ref|XP_007884019.1| PREDICTED: UBX domain-containing protein 7 isoform X4 [Callorhinchus 
milii]
Length=499

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 82/191 (43%), Gaps = 36/191 (19%)
 Frame = +3

Query  159  DGALSA-SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            DGA SA S  Q L+  F  I  G S    +  L+A +  LE A+ ++  G  GG+A   S
Sbjct  6    DGAGSAGSALQGLIRQFTAI-TGASESVGKHILEACNNNLEMAVTMYLDG--GGIAEEPS  62

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
             S    +A  P                       +DEVR P+P  +D+L +   + G P 
Sbjct  63   TSTAGTSASRPPA---------------------QDEVRAPIPQKQDILVEPEPLFGAPK  101

Query  516  MGGSAHEARSVVP-FRNFEQEMKHPGVWETDK-------ASNSADNLASLYRPPFALMYH  671
                   ARS+   FR+F+ E      +  ++              LA L+RPP  LM+ 
Sbjct  102  ---RRRPARSIFDGFRDFQTETSEYCCFRQEQELRNGGPVDKKLTTLADLFRPPIDLMHK  158

Query  672  GSFEKAKDAAR  704
            GSFE AK++ +
Sbjct  159  GSFETAKESGQ  169



>ref|XP_002874517.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50776.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 84/187 (45%), Gaps = 51/187 (27%)
 Frame = +3

Query  156  MDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  335
            M+  L + +++  + SF E A G++++TA Q L+ +S+  EE    +++  D        
Sbjct  1    MERKLRSEDEKRFLDSFFETADGKTSETASQILKKSSFYYEEK---YWILEDS-------  50

Query  336  YSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
               ++   P                      Q  +++++P   +  D   D    +   A
Sbjct  51   ---MQLCYPQIPE------------------QTLKEDIQP---MSSD---DNVPAQSFGA  83

Query  516  M--GGSAHEARSVVPFRNFEQEMKHPGVWETD------KASNSADNLASLYRPPFALMYH  671
            M  G S H+   ++  RNF +      +W  D       AS S  +LASLYRPPF LM+H
Sbjct  84   MTVGISQHQPDCLIANRNFSE------IWGLDMDAFSPSASASKRSLASLYRPPFHLMFH  137

Query  672  GSFEKAK  692
            GSFE+AK
Sbjct  138  GSFEQAK  144



>ref|XP_005303673.1| PREDICTED: UBX domain-containing protein 7 [Chrysemys picta bellii]
Length=489

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 85/190 (45%), Gaps = 42/190 (22%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSY  338
            G+ ++S  + L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A  PS+ 
Sbjct  6    GSAASSALKGLIQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS  62

Query  339  SPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAM  518
            S   +T                            DEVR P+P  +++L +   + G P  
Sbjct  63   SAAVSTVRPDT----------------------EDEVRAPIPQKQEILVEPEPLFGAPK-  99

Query  519  GGSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHG  674
                  ARS+   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ G
Sbjct  100  --RRRPARSIFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKG  152

Query  675  SFEKAKDAAR  704
            SFE AK+  +
Sbjct  153  SFETAKECGQ  162



>emb|CDY12746.1| BnaC04g28950D [Brassica napus]
Length=421

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +3

Query  150  PRMDGALSASEQQ--TLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVA  323
            PR     S  +Q    L++SFLE+AVGQ+ +TA++FL+ T+W +EE++ LF + N+   A
Sbjct  31   PRTLSTNSIEQQHDDQLISSFLEVAVGQTVETAKRFLETTNWNIEESINLFLLRNNYDHA  90

Query  324  APSS  335
            A  S
Sbjct  91   AEES  94



>ref|XP_004079303.2| PREDICTED: UBX domain-containing protein 7 [Oryzias latipes]
Length=522

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 82/189 (43%), Gaps = 39/189 (21%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G  SA     L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A   S S
Sbjct  14   GDTSAPGVNGLIQQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS  70

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
                 +    P                      DEVR P+P  +D+L +   + G+P   
Sbjct  71   SSSAASSSRAPPT--------------------DEVRAPIPQKQDILVEPEPLFGVPK--  108

Query  522  GSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGS  677
                 ARS+   FR+F       EQE+++ G    DK  ++   LA L+RPP  LM+ GS
Sbjct  109  -RRRPARSIFDGFRDFQTETIRQEQELRNGGT--VDKKLST---LADLFRPPIELMHKGS  162

Query  678  FEKAKDAAR  704
            FE AKD  +
Sbjct  163  FETAKDCGQ  171



>gb|KFO81222.1| UBX domain-containing protein 7, partial [Cuculus canorus]
Length=467

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 76/169 (45%), Gaps = 39/169 (23%)
 Frame = +3

Query  222  GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  401
            G S    R  L+A +  LE A+ +F  G  GG+A   S S    +A              
Sbjct  3    GASESVGRHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSA--------------  46

Query  402  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  566
                    +    DEVRPP+P  +++L +   + G P        ARS+   FR+F    
Sbjct  47   -------VRPHTEDEVRPPIPPKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  96

Query  567  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
               EQE+++ G    DK   +   LA+L+RPP  LM+ GSFE AK+  +
Sbjct  97   IRQEQELRNGGA--VDKKLTT---LAALFRPPIDLMHKGSFETAKECGQ  140



>ref|XP_006414759.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
 gb|ESQ56212.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
Length=418

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query  165  ALSASEQ-QTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  311
            ALS  E+   L++SFLEIAVGQ+ +TA +FL+ T+W +EEA+ LF   N+
Sbjct  35   ALSMDERYDKLISSFLEIAVGQTVETATRFLETTNWNIEEAINLFLFDNN  84



>ref|XP_010792284.1| PREDICTED: UBX domain-containing protein 7 [Notothenia coriiceps]
Length=292

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  596
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPK---RRRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  597  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_009566058.1| PREDICTED: UBX domain-containing protein 7 [Cuculus canorus]
Length=474

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 76/169 (45%), Gaps = 39/169 (23%)
 Frame = +3

Query  222  GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  401
            G S    R  L+A +  LE A+ +F  G  GG+A   S S    +A              
Sbjct  10   GASESVGRHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSA--------------  53

Query  402  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  566
                    +    DEVRPP+P  +++L +   + G P        ARS+   FR+F    
Sbjct  54   -------VRPHTEDEVRPPIPPKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  103

Query  567  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
               EQE+++ G    DK   +   LA+L+RPP  LM+ GSFE AK+  +
Sbjct  104  IRQEQELRNGGA--VDKKLTT---LAALFRPPIDLMHKGSFETAKECGQ  147



>ref|XP_005721383.1| PREDICTED: UBX domain-containing protein 7-like [Pundamilia nyererei]
 ref|XP_005912846.1| PREDICTED: UBX domain-containing protein 7-like [Haplochromis 
burtoni]
Length=528

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 83/189 (44%), Gaps = 39/189 (21%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G  SA     L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A   S S
Sbjct  5    GDTSAPGVNGLIQQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS  61

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
                                  S   S +    DEVR P+P  +D+L +   + G+P   
Sbjct  62   --------------------TSSAASSSRAPSTDEVRAPIPQKQDILVEPEPLFGVPKR-  100

Query  522  GSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGS  677
                 ARS+   FR+F       EQE+++ G    DK  ++   LA L+RPP  LM+ GS
Sbjct  101  --RRPARSIFDGFRDFQTETIRQEQELRNGGT--VDKKLST---LADLFRPPIELMHKGS  153

Query  678  FEKAKDAAR  704
            FE AKD  +
Sbjct  154  FETAKDCGQ  162



>ref|XP_010741940.1| PREDICTED: LOW QUALITY PROTEIN: UBX domain-containing protein 
7 [Larimichthys crocea]
Length=527

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 83/189 (44%), Gaps = 39/189 (21%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G  SA     L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A   S S
Sbjct  5    GDTSAPGVNGLIQQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS  61

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
                                  S   S +    DEVR P+P  +D+L +   + G+P   
Sbjct  62   --------------------SSSAASSSRAPPSDEVRAPIPQKQDILVEPEPLFGVPK--  99

Query  522  GSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGS  677
                 ARS+   FR+F       EQE+++ G    DK  ++   LA L+RPP  LM+ GS
Sbjct  100  -RRRPARSIFDGFRDFQTETIRQEQELRNGGT--VDKKLST---LADLFRPPIELMHKGS  153

Query  678  FEKAKDAAR  704
            FE AKD  +
Sbjct  154  FETAKDCGQ  162



>ref|XP_007431490.1| PREDICTED: UBX domain-containing protein 7 isoform X1 [Python 
bivittatus]
Length=488

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 80/181 (44%), Gaps = 44/181 (24%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYS-PLENTAPl  365
            L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A  PS+ S  + N  P 
Sbjct  16   LIQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSASVSNLRPH  72

Query  366  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  545
                                     DEVR P+P  +++L +   + G P        ARS
Sbjct  73   T-----------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARS  106

Query  546  VVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
            +   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  
Sbjct  107  IFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECG  161

Query  702  R  704
            +
Sbjct  162  Q  162



>ref|XP_007559513.1| PREDICTED: UBX domain-containing protein 7 [Poecilia formosa]
Length=526

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  596
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  597  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_008432356.1| PREDICTED: UBX domain-containing protein 7 [Poecilia reticulata]
Length=526

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  596
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  597  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_001373967.2| PREDICTED: UBX domain-containing protein 7 [Monodelphis domestica]
Length=489

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 84/191 (44%), Gaps = 44/191 (23%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G+ ++S  + L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S
Sbjct  6    GSAASSALKGLIQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS  62

Query  342  P--LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPA  515
               + +  P                          DEVR P+P  +++L +   + G P 
Sbjct  63   SAGVSSVRPHT-----------------------EDEVRAPIPQKQEILVEPEPLFGAPK  99

Query  516  MGGSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYH  671
                   ARS+   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ 
Sbjct  100  ---RRRPARSIFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHK  151

Query  672  GSFEKAKDAAR  704
            GSFE AK+  +
Sbjct  152  GSFETAKECGQ  162



>ref|XP_008332241.1| PREDICTED: UBX domain-containing protein 7 [Cynoglossus semilaevis]
Length=539

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  596
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGA-  130

Query  597  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_004542734.1| PREDICTED: UBX domain-containing protein 7-like [Maylandia zebra]
Length=528

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  596
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  597  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_005151293.1| PREDICTED: UBX domain-containing protein 7 [Melopsittacus undulatus]
Length=479

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 77/178 (43%), Gaps = 39/178 (22%)
 Frame = +3

Query  195  VASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdp  374
             + F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P  
Sbjct  6    CSVFTSIITGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT  63

Query  375  slssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP  554
                                  DEVR P+P  +++L +   + G P        ARS+  
Sbjct  64   ---------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFD  99

Query  555  -FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
             FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  100  GFRDFQTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  152



>ref|XP_004373649.1| PREDICTED: UBX domain-containing protein 7 [Trichechus manatus 
latirostris]
Length=489

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 85/190 (45%), Gaps = 42/190 (22%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSY  338
            G+ ++S  + L+  F  I  G S    +  L+A S  LE A+ +F  G  GG+A  PS+ 
Sbjct  6    GSAASSALKGLIQQFTAI-TGASESVGKHMLEACSNNLEMAVTMFLDG--GGIAEEPSTS  62

Query  339  SPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAM  518
            S   +T                            +EVR P+P  +++L +   + G P  
Sbjct  63   SASVSTGRPHA----------------------EEEVRAPIPQKQEILVEPEPLFGAPK-  99

Query  519  GGSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHG  674
                  ARS+   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ G
Sbjct  100  --RRRPARSIFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKG  152

Query  675  SFEKAKDAAR  704
            SFE AK+  +
Sbjct  153  SFETAKECGQ  162



>ref|XP_003438186.2| PREDICTED: UBX domain-containing protein 7 [Oreochromis niloticus]
Length=540

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  596
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  87   DEVRAPIPQKQDILVEPEPLFGVPK---RRRPARSIFDGFRDFQTETIRQEQELRNGGT-  142

Query  597  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  143  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  174



>ref|XP_006786563.1| PREDICTED: UBX domain-containing protein 7-like [Neolamprologus 
brichardi]
Length=543

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  596
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  87   DEVRAPIPQKQDILVEPEPLFGVPK---RRRPARSIFDGFRDFQTETIRQEQELRNGGT-  142

Query  597  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  143  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  174



>ref|XP_002886675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62934.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = +3

Query  168  LSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV---GNDGGVAAPSSY  338
            + +  Q+ LV+SFLEIAV Q+ +TA + L AT+WK+EEA+ LF++    N      PS  
Sbjct  1    MESDHQRKLVSSFLEIAVDQTVETAIKCLNATNWKVEEAINLFFLIDRRNQSSTQKPSDS  60

Query  339  S  341
            S
Sbjct  61   S  61



>ref|XP_010022496.1| PREDICTED: UBX domain-containing protein 7, partial [Nestor notabilis]
Length=413

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 76/175 (43%), Gaps = 39/175 (22%)
 Frame = +3

Query  204  FLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpsls  383
            F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P     
Sbjct  23   FSSIITGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT---  77

Query  384  sisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FR  560
                               DEVR P+P  +++L +   + G P        ARS+   FR
Sbjct  78   ------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFR  116

Query  561  NF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
            +F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  117  DFQTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  166



>ref|XP_003978227.1| PREDICTED: UBX domain-containing protein 7 [Takifugu rubripes]
Length=533

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 77/173 (45%), Gaps = 18/173 (10%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  371
            L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A            P   
Sbjct  15   LIRQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIA----------EEPSTS  61

Query  372  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  551
             S S+ S S   S   S +    DEVR P+P  +D+L +   + G+P        ARS+ 
Sbjct  62   TSTSTSSSSSSSSAASSSRAPPTDEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIF  118

Query  552  P-FRNFEQE-MKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              FR+F+ E ++                LA L+RPP  LM+ GSFE AKD  +
Sbjct  119  DGFRDFQTETIRQEQELRNGTVDKKLSTLADLFRPPIELMHKGSFETAKDCGQ  171



>ref|XP_007537896.1| PREDICTED: UBX domain-containing protein 7 isoform X1 [Erinaceus 
europaeus]
Length=489

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 83/189 (44%), Gaps = 40/189 (21%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G  ++S  + L+  F  I  G S    +  L+A S  LE A+ +F  G  GG+A   S S
Sbjct  6    GPAASSALKGLIQQFTAI-TGASESVGKHMLEACSNNLEMAVTMFLDG--GGIAEEPSTS  62

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
                +A  P                        +EVR P+P  +++L +   + G P   
Sbjct  63   SASVSAGRPHT---------------------EEEVRAPIPQKQEILVEPEPLFGAPK--  99

Query  522  GSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGS  677
                 ARS+   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GS
Sbjct  100  -RRRPARSIFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGS  153

Query  678  FEKAKDAAR  704
            FE AK+  +
Sbjct  154  FETAKECGQ  162



>gb|KFP66219.1| UBX domain-containing protein 7, partial [Cariama cristata]
Length=419

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 53/98 (54%), Gaps = 16/98 (16%)
 Frame = +3

Query  435  DRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPG  590
            DRDEVR P+P  +++L +   + G P        ARS+   FR+F       EQE+++ G
Sbjct  3    DRDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTETIRQEQELRNGG  59

Query  591  VWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  60   A--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  92



>ref|XP_008283973.1| PREDICTED: UBX domain-containing protein 7 [Stegastes partitus]
Length=539

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 82/189 (43%), Gaps = 39/189 (21%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G  SA     L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A   S S
Sbjct  17   GDTSAPGVNGLIQQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS  73

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
                 +    P                      DEVR P+P  +D+L +   + G+P   
Sbjct  74   SSSAASSSRAPPT--------------------DEVRAPIPQKQDILVEPEPLFGVPKR-  112

Query  522  GSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGS  677
                 ARS+   FR+F       EQE+++ G    DK  ++   LA L+RPP  LM+ GS
Sbjct  113  --RRPARSIFDGFRDFQTETIRQEQELRNGGT--VDKKLST---LADLFRPPIELMHKGS  165

Query  678  FEKAKDAAR  704
            FE AK+  +
Sbjct  166  FETAKECGQ  174



>ref|XP_006124906.1| PREDICTED: UBX domain-containing protein 7, partial [Pelodiscus 
sinensis]
Length=481

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 76/172 (44%), Gaps = 43/172 (25%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP--LENTAPlpdpslssis  392
            +G S    +  L+A +  LE A+ +F  G  GG+A   S S   + N  P          
Sbjct  16   IGASESVGQHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSNVRPHT--------  65

Query  393  gsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-  566
                            +EVR P+P  +++L +   + G+P        ARS+   FR+F 
Sbjct  66   ---------------EEEVRAPIPQKQEILVEPEPLFGVPK---RRRPARSIFDGFRDFQ  107

Query  567  ------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                  EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  108  TETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  154



>emb|CAG07636.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=472

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 72/173 (42%), Gaps = 28/173 (16%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  371
            L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A   S S     +    
Sbjct  16   LIRQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSSSAASSSRA  72

Query  372  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  551
            P                      DEVR P+P  +D+L +   + G+P        ARS+ 
Sbjct  73   PPT--------------------DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIF  109

Query  552  P-FRNFEQE-MKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              FR+F+ E ++                LA L+RPP  LM+ GSFE AKD  +
Sbjct  110  DGFRDFQTETIRQEQELRNGTVDKKLSTLADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_006010569.1| PREDICTED: UBX domain-containing protein 7 [Latimeria chalumnae]
Length=473

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 46/180 (26%)
 Frame = +3

Query  165  ALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP  344
            A S++  + LV  F+ I  G + +  +  L+A S+ LE A+ ++  G  GG+A   S S 
Sbjct  7    AASSARLKGLVQQFIAI-TGANENVGKHMLEACSYNLEMAVTMYLDG--GGIAEEPSTSS  63

Query  345  LENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGG  524
               +A     +                     DEVR P+P  +D+L ++  +        
Sbjct  64   AGTSAASLPLA--------------------EDEVRAPIPQKQDILVESEPL--------  95

Query  525  SAHEARSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                      F   EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   ----------FIRQEQELRNGGA--IDKKLTT---LADLFRPPIELMHKGSFETAKETGQ  140



>ref|XP_003218371.1| PREDICTED: UBX domain-containing protein 7 [Anolis carolinensis]
Length=488

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 80/181 (44%), Gaps = 44/181 (24%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYS-PLENTAPl  365
            L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A  PS+ S  + N  P 
Sbjct  16   LLQQFTAI-TGATESIGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSASVSNLRPH  72

Query  366  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  545
                                     DEVR P+P  +++L +   + G P        ARS
Sbjct  73   T-----------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARS  106

Query  546  VVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
            +   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  
Sbjct  107  IFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECG  161

Query  702  R  704
            +
Sbjct  162  Q  162



>ref|XP_009139540.1| PREDICTED: UBX domain-containing protein 7-like [Brassica rapa]
Length=412

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  311
            L++SFLE+AVGQ+ +TA++FL+ T+W ++E++ LF + N+
Sbjct  48   LISSFLEVAVGQTVETAKRFLETTNWNIDESINLFLLRNN  87



>sp|P0DKI5.1|PUX16_ARATH RecName: Full=Plant UBX domain-containing protein 16; Short=PUX16 
[Arabidopsis thaliana]
Length=415

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  153  RMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN  308
            ++D  +    Q  L++SFLEIAV Q+A+TAR  LQ T W +++A+ LF   N
Sbjct  19   QLDEEIVLFRQDQLISSFLEIAVDQTAETARILLQTTDWNIDQAVNLFLTNN  70



>ref|XP_005529566.1| PREDICTED: UBX domain-containing protein 7 [Pseudopodoces humilis]
Length=507

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  371
            LV  F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A    
Sbjct  34   LVQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSA----  86

Query  372  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  551
                              +    DEVR P+P  +++L +   + G P        ARS+ 
Sbjct  87   -----------------VRPHPEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIF  126

Query  552  P-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  127  DGFRDFQTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  180



>ref|XP_008499110.1| PREDICTED: UBX domain-containing protein 7, partial [Calypte 
anna]
Length=466

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A S  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  1    TGASESVGKHMLEACSNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  50

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  51   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  94

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  95   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  139



>gb|KFP06318.1| UBX domain-containing protein 7, partial [Calypte anna]
Length=467

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A S  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  2    TGASESVGKHMLEACSNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  51

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  52   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  95

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  140



>ref|XP_422667.3| PREDICTED: UBX domain-containing protein 7 isoform X2 [Gallus 
gallus]
Length=597

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  371
            L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A    
Sbjct  124  LIQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSA----  176

Query  372  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  551
                              +    DEVR P+P  +++L +   + G P        ARS+ 
Sbjct  177  -----------------VRPHTEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIF  216

Query  552  P-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
              FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  217  DGFRDFQTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  270



>gb|EMC77931.1| UBX domain-containing protein 7, partial [Columba livia]
Length=468

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 75/171 (44%), Gaps = 39/171 (23%)
 Frame = +3

Query  216  AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  395
            A G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P         
Sbjct  2    AAGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT-------  52

Query  396  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  566
                           DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  53   --------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  95

Query  567  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010157159.1| PREDICTED: UBX domain-containing protein 7, partial [Eurypyga 
helias]
Length=475

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 73/170 (43%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  10   TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  59

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  R++L +     G P        ARS+   FR+F   
Sbjct  60   -------------EDEVRAPIPQKREILVEPEPFFGAPK---RRRPARSIFDGFRDFQTE  103

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  104  TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  148



>gb|KFW11978.1| UBX domain-containing protein 7, partial [Eurypyga helias]
Length=468

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 73/170 (43%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  R++L +     G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKREILVEPEPFFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010490003.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=320

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  177  SEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV  302
            +E   L+ASF+EI+ GQ+  TA QFL+ATSW LE+A+ LF +
Sbjct  3    NETSELIASFIEISGGQTEKTAFQFLEATSWNLEDAVNLFLI  44



>ref|XP_009939092.1| PREDICTED: UBX domain-containing protein 7 [Opisthocomus hoazin]
Length=526

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 77/171 (45%), Gaps = 41/171 (24%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYSPLENTAPlpdpslssisg  395
             G S    +  L+A +  LE A+ +F  G  GG+A  PS+ S   +T             
Sbjct  61   TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSTV------------  106

Query  396  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  566
                      +  + DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  107  ----------RPHNEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  153

Query  567  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  154  ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  199



>ref|XP_009995047.1| PREDICTED: UBX domain-containing protein 7 [Chaetura pelagica]
 gb|KFU88936.1| UBX domain-containing protein 7 [Chaetura pelagica]
Length=467

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 75/169 (44%), Gaps = 39/169 (23%)
 Frame = +3

Query  222  GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  401
            G S   A+  L+A +  LE A+ +F  G  GG+A   S S    +A  P           
Sbjct  3    GASESVAKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT---------  51

Query  402  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  566
                         DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  52   ------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  96

Query  567  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  140



>gb|KFR15588.1| UBX domain-containing protein 7, partial [Opisthocomus hoazin]
Length=468

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 77/171 (45%), Gaps = 41/171 (24%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYSPLENTAPlpdpslssisg  395
             G S    +  L+A +  LE A+ +F  G  GG+A  PS+ S   +T             
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSTV------------  48

Query  396  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  566
                      +  + DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  49   ----------RPHNEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  95

Query  567  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>emb|CDY01206.1| BnaA04g06130D [Brassica napus]
Length=412

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN  308
            L++SFLE+AVGQ+ +TA+ FL+ T+W ++E++ LF + N
Sbjct  48   LISSFLEVAVGQTVETAKTFLETTNWNIDESINLFLLRN  86



>ref|XP_646734.1| UAS domain-containing protein [Dictyostelium discoideum AX4]
 sp|Q55BU7.1|UBXN7_DICDI RecName: Full=UBX domain-containing protein 7 homolog [Dictyostelium 
discoideum]
 gb|EAL72529.1| UAS domain-containing protein [Dictyostelium discoideum AX4]
Length=503

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 73/170 (43%), Gaps = 18/170 (11%)
 Frame = +3

Query  192  LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  371
            ++++FL I     +  A   L+  +W +E ++  F+  ND     PS      N  P   
Sbjct  6    ILSNFLSITGCDDSSLATTILENNNWDVERSVDFFFTMND-----PS------NVKPTTS  54

Query  372  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  551
               +S   +   S   SE   + DE R P+P   D L D       P       +     
Sbjct  55   SKKTSSPPTASSSSASSEFDYNEDEFRDPIPQKMDKLVDHYY---QPTQRSYQKQTNVFE  111

Query  552  PFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  701
             FR+FE+E    G+   DKA+    +L+ L++PP  ++  G+F++ K  A
Sbjct  112  AFRDFEKER---GI-NQDKATEKQKSLSELFKPPLDILTFGTFDEIKKMA  157



>ref|XP_010519525.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=324

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  165  ALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFY  299
             LS SE+  LV+SFL  A+GQ+ + AR FLQA SW L+EAL  F+
Sbjct  5    TLSESERLRLVSSFLGFAIGQTPEAARWFLQAKSWNLDEALFFFF  49



>gb|KFW91268.1| UBX domain-containing protein 7, partial [Phalacrocorax carbo]
Length=470

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 43/172 (25%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA--PSSYSPLENTAPlpdpslssis  392
             G S    +  L+A +  LE A+ +F    DGGV A  PS+ S                 
Sbjct  5    TGASESVGKHMLEACNNNLEMAVTMFL---DGGVIAEEPSTSS-----------------  44

Query  393  gsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-  566
                 +G  + +  + DEVR P+P  +++L +   + G P        ARS+   FR+F 
Sbjct  45   -----AGVSAVRPHNEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQ  96

Query  567  ------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                  EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  143



>ref|XP_009503466.1| PREDICTED: UBX domain-containing protein 7, partial [Phalacrocorax 
carbo]
Length=469

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 43/172 (25%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA--PSSYSPLENTAPlpdpslssis  392
             G S    +  L+A +  LE A+ +F    DGGV A  PS+ S                 
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFL---DGGVIAEEPSTSS-----------------  43

Query  393  gsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-  566
                 +G  + +  + DEVR P+P  +++L +   + G P        ARS+   FR+F 
Sbjct  44   -----AGVSAVRPHNEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQ  95

Query  567  ------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                  EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   TETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_009642777.1| PREDICTED: UBX domain-containing protein 7 [Egretta garzetta]
Length=493

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 76/173 (44%), Gaps = 39/173 (23%)
 Frame = +3

Query  210  EIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssi  389
            ++  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P       
Sbjct  25   KLGRGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT-----  77

Query  390  sgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF  566
                             DEVR P+P  +++L +   + G P        ARS+   FR+F
Sbjct  78   ----------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDF  118

Query  567  -------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                   EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  119  QTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  166



>gb|KFQ45369.1| UBX domain-containing protein 7, partial [Nestor notabilis]
Length=388

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  2    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  51

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  52   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  95

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  140



>ref|XP_005050918.1| PREDICTED: UBX domain-containing protein 7 [Ficedula albicollis]
Length=645

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 75/171 (44%), Gaps = 39/171 (23%)
 Frame = +3

Query  216  AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  395
            A G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A            
Sbjct  179  ASGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSA------------  224

Query  396  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  566
                      +    DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  225  ---------VRPHPEDEVRAPIPQKQEILVEPEPLFGAPKR---RRPARSIFDGFRDFQT  272

Query  567  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  273  ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  318



>dbj|BAC85247.1| unnamed protein product [Homo sapiens]
Length=212

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 83/189 (44%), Gaps = 40/189 (21%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G+ ++S  + L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S
Sbjct  6    GSAASSALKGLIQQFTTI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS  62

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
                +   P                        +EVR P+P  +++L +   + G P   
Sbjct  63   SASVSTVRPHT---------------------EEEVRAPIPQKQEILVEPEPLFGAPK--  99

Query  522  GSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGS  677
                 ARS+   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GS
Sbjct  100  -RRRPARSIFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGS  153

Query  678  FEKAKDAAR  704
            FE AK+  +
Sbjct  154  FETAKECGQ  162



>ref|XP_009139539.1| PREDICTED: UBX domain-containing protein 2-like [Brassica rapa]
Length=387

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  183  QQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  311
            QQ L++SF E+AVGQ+ +T  QFL+  +W LEEA+  F+V ++
Sbjct  62   QQKLISSFTEVAVGQTMETVIQFLETANWNLEEAINHFFVESN  104



>ref|XP_009584874.1| PREDICTED: UBX domain-containing protein 7, partial [Fulmarus 
glacialis]
Length=469

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  53

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFP20656.1| UBX domain-containing protein 7, partial [Egretta garzetta]
Length=468

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFO08321.1| UBX domain-containing protein 7, partial [Balearica regulorum 
gibbericeps]
Length=468

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010311687.1| PREDICTED: UBX domain-containing protein 7, partial [Balearica 
regulorum gibbericeps]
Length=469

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  53

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFV98068.1| UBX domain-containing protein 7, partial [Fulmarus glacialis]
Length=468

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFZ68476.1| UBX domain-containing protein 7, partial [Podiceps cristatus]
Length=468

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFW86225.1| UBX domain-containing protein 7, partial [Manacus vitellinus]
Length=468

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 74/169 (44%), Gaps = 39/169 (23%)
 Frame = +3

Query  222  GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  401
            G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P           
Sbjct  4    GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAARPHT---------  52

Query  402  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  566
                         DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  53   ------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  97

Query  567  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFQ00398.1| UBX domain-containing protein 7, partial [Haliaeetus albicilla]
Length=468

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_008928489.1| PREDICTED: UBX domain-containing protein 7, partial [Manacus 
vitellinus]
Length=469

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 74/169 (44%), Gaps = 39/169 (23%)
 Frame = +3

Query  222  GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  401
            G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P           
Sbjct  5    GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAARPHT---------  53

Query  402  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  566
                         DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  54   ------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  98

Query  567  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  99   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>emb|CDQ70866.1| unnamed protein product [Oncorhynchus mykiss]
Length=541

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 46/91 (51%), Gaps = 6/91 (7%)
 Frame = +3

Query  441  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNFEQEM--KHPGVWETDKA  611
            DEVR P+P  +D+L +   + G P        ARS+   FR+F+ E   +   +     A
Sbjct  77   DEVRAPIPQKQDILVEPEPMFGAPKR---RRPARSIFDGFRDFQTETIRQEQELRNGSAA  133

Query  612  SNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                  LA L+RPP  LM+ GSFE AKD  +
Sbjct  134  DKKLSTLADLFRPPVELMHKGSFETAKDCGQ  164



>gb|EOA95320.1| UBX domain-containing protein 7, partial [Anas platyrhynchos]
Length=468

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 74/173 (43%), Gaps = 43/173 (25%)
 Frame = +3

Query  216  AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP--LENTAPlpdpslssi  389
              G S    +  L+A +  LE A+ +F  G  GG+A   S S   + +  P         
Sbjct  2    VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSSVRPHT-------  52

Query  390  sgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF  566
                             DEVR P+P  +++L +   + G P        ARS+   FR+F
Sbjct  53   ----------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDF  93

Query  567  -------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                   EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  94   QTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010130823.1| PREDICTED: UBX domain-containing protein 7, partial [Buceros 
rhinoceros silvestris]
Length=469

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 74/171 (43%), Gaps = 39/171 (23%)
 Frame = +3

Query  216  AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  395
              G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P         
Sbjct  3    VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT-------  53

Query  396  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  566
                           DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  54   --------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  96

Query  567  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFV57093.1| UBX domain-containing protein 7, partial [Tyto alba]
Length=468

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVQPHA--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFP92412.1| UBX domain-containing protein 7, partial [Apaloderma vittatum]
Length=469

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_005028141.1| PREDICTED: UBX domain-containing protein 7 [Anas platyrhynchos]
Length=478

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 74/173 (43%), Gaps = 43/173 (25%)
 Frame = +3

Query  216  AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP--LENTAPlpdpslssi  389
              G S    +  L+A +  LE A+ +F  G  GG+A   S S   + +  P         
Sbjct  12   VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSSVRPHT-------  62

Query  390  sgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF  566
                             DEVR P+P  +++L +   + G P        ARS+   FR+F
Sbjct  63   ----------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDF  103

Query  567  -------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                   EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  104  QTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  151



>gb|KFO87511.1| UBX domain-containing protein 7, partial [Buceros rhinoceros 
silvestris]
Length=467

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 74/171 (43%), Gaps = 39/171 (23%)
 Frame = +3

Query  216  AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  395
              G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P         
Sbjct  1    VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT-------  51

Query  396  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  566
                           DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  52   --------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  94

Query  567  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  95   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  140



>gb|KFV14929.1| UBX domain-containing protein 7, partial [Pterocles gutturalis]
Length=468

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFQ95214.1| UBX domain-containing protein 7, partial [Nipponia nippon]
Length=468

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010559592.1| PREDICTED: UBX domain-containing protein 7, partial [Haliaeetus 
leucocephalus]
Length=469

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFP38427.1| UBX domain-containing protein 7, partial [Chlamydotis macqueenii]
Length=468

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 74/171 (43%), Gaps = 39/171 (23%)
 Frame = +3

Query  216  AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  395
              G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P         
Sbjct  2    VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT-------  52

Query  396  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  566
                           DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  53   --------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  95

Query  567  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_005241643.1| PREDICTED: UBX domain-containing protein 7, partial [Falco peregrinus]
 ref|XP_005437208.1| PREDICTED: UBX domain-containing protein 7, partial [Falco cherrug]
Length=469

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_011593203.1| PREDICTED: UBX domain-containing protein 7 isoform X1 [Aquila 
chrysaetos canadensis]
Length=470

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  5    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  54

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  55   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  98

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  99   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  143



>ref|XP_009875011.1| PREDICTED: UBX domain-containing protein 7, partial [Apaloderma 
vittatum]
Length=470

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFP51814.1| UBX domain-containing protein 7, partial [Cathartes aura]
Length=468

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_009912522.1| PREDICTED: UBX domain-containing protein 7 isoform X1 [Haliaeetus 
albicilla]
 ref|XP_011593205.1| PREDICTED: UBX domain-containing protein 7 isoform X3 [Aquila 
chrysaetos canadensis]
Length=422

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 16/97 (16%)
 Frame = +3

Query  438  RDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGV  593
            RDEVR P+P  +++L +   + G P        ARS+   FR+F       EQE+++ G 
Sbjct  7    RDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTETIRQEQELRNGGA  63

Query  594  WETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
               DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  64   --VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  95



>gb|KFM11413.1| UBX domain-containing protein 7, partial [Aptenodytes forsteri]
Length=468

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010081335.1| PREDICTED: UBX domain-containing protein 7, partial [Pterocles 
gutturalis]
Length=469

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_009897769.1| PREDICTED: UBX domain-containing protein 7 [Picoides pubescens]
Length=516

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 84/194 (43%), Gaps = 46/194 (24%)
 Frame = +3

Query  147  LPRMDGALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA  326
            LPR     SA  ++ L+A       G S    +  L+A +  LE A+ +F  G  GG+A 
Sbjct  34   LPRPTLLRSAPARRRLLA-------GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAE  84

Query  327  PSSYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG  506
              S S    +A  P                        DEVR P+P  +++L +   + G
Sbjct  85   EPSTSSAGVSAVRPHA---------------------EDEVRAPIPQKQEILVEPEPLFG  123

Query  507  LPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFAL  662
             P        ARS+   FR+F       EQE+++ G    DK   +   LA L+RPP  L
Sbjct  124  APK---RRRPARSIFDGFRDFQTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDL  175

Query  663  MYHGSFEKAKDAAR  704
            M+ GSFE AK+  +
Sbjct  176  MHKGSFETAKECGQ  189



>ref|XP_009969814.1| PREDICTED: UBX domain-containing protein 7, partial [Tyto alba]
Length=469

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVQPHA--------  53

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_009283288.1| PREDICTED: UBX domain-containing protein 7 [Aptenodytes forsteri]
Length=473

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  8    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  57

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  58   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  101

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  102  TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  146



>gb|KFW66282.1| UBX domain-containing protein 7, partial [Pygoscelis adeliae]
Length=468

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_005344897.1| PREDICTED: UBX domain-containing protein 7 [Microtus ochrogaster]
Length=489

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 85/189 (45%), Gaps = 40/189 (21%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G+ ++S  + L+  F+ I  G S    +  L+A +  LE A+ +F  G  GG+A   S S
Sbjct  6    GSAASSALKGLIQQFMAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS  62

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
                +A  P                        +EVR P+P  +++L +   + G P   
Sbjct  63   SASVSAVRPHT---------------------EEEVRAPIPQKQEILVEPEPLFGAPK--  99

Query  522  GSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGS  677
                 ARS+   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GS
Sbjct  100  -RRRPARSIFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGS  153

Query  678  FEKAKDAAR  704
            FE AK+  +
Sbjct  154  FETAKECGQ  162



>ref|XP_010290507.1| PREDICTED: UBX domain-containing protein 7, partial [Phaethon 
lepturus]
Length=469

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_009321171.1| PREDICTED: UBX domain-containing protein 7 [Pygoscelis adeliae]
Length=473

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  8    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  57

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  58   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  101

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  102  TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  146



>gb|KFV66581.1| UBX domain-containing protein 7, partial [Picoides pubescens]
Length=468

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHA--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFQ80041.1| UBX domain-containing protein 7, partial [Phaethon lepturus]
Length=468

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +3

Query  219  VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  398
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  399  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  566
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  567  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  704
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_008836748.1| PREDICTED: UBX domain-containing protein 7 [Nannospalax galili]
Length=489

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 84/189 (44%), Gaps = 40/189 (21%)
 Frame = +3

Query  162  GALSASEQQTLVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS  341
            G+ ++S  + L+  F+ I  G S    +  L+A +  LE A+ +F  G  GG+A   S S
Sbjct  6    GSAASSALKGLIQQFMAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS  62

Query  342  PLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  521
                +   P                        +EVR P+P  +++L +   + G P   
Sbjct  63   SASVSTVRPHT---------------------EEEVRAPIPQKQEILVEPEPLFGAPK--  99

Query  522  GSAHEARSVVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGS  677
                 ARS+   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GS
Sbjct  100  -RRRPARSIFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGS  153

Query  678  FEKAKDAAR  704
            FE AK+  +
Sbjct  154  FETAKECGQ  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1253469667140