BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig855

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767335.1|  PREDICTED: uncharacterized protein LOC104218515    228   4e-67   Nicotiana sylvestris
ref|XP_011082732.1|  PREDICTED: uncharacterized protein LOC105165426    221   2e-64   Sesamum indicum [beniseed]
ref|XP_006348283.1|  PREDICTED: uncharacterized protein LOC102600810    221   3e-64   Solanum tuberosum [potatoes]
ref|XP_009593456.1|  PREDICTED: uncharacterized protein LOC104090114    219   9e-64   Nicotiana tomentosiformis
ref|XP_009604315.1|  PREDICTED: uncharacterized protein LOC104099119    219   9e-64   Nicotiana tomentosiformis
ref|XP_004251882.1|  PREDICTED: uncharacterized protein LOC101257045    219   1e-63   Solanum lycopersicum
ref|XP_009766997.1|  PREDICTED: uncharacterized protein LOC104218248    219   1e-63   Nicotiana sylvestris
ref|XP_011098255.1|  PREDICTED: uncharacterized protein LOC105176...    218   4e-63   
ref|XP_011098256.1|  PREDICTED: uncharacterized protein LOC105176...    217   4e-63   Sesamum indicum [beniseed]
ref|XP_004244257.1|  PREDICTED: uncharacterized protein LOC101263533    217   9e-63   Solanum lycopersicum
ref|XP_006358955.1|  PREDICTED: uncharacterized protein LOC102579474    216   2e-62   Solanum tuberosum [potatoes]
gb|EYU44997.1|  hypothetical protein MIMGU_mgv1a003664mg                216   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_004146032.1|  PREDICTED: uncharacterized protein LOC101209298    213   3e-61   Cucumis sativus [cucumbers]
ref|XP_008463718.1|  PREDICTED: uncharacterized protein LOC103501799    212   5e-61   Cucumis melo [Oriental melon]
ref|XP_003634635.1|  PREDICTED: uncharacterized protein LOC100264164    212   6e-61   Vitis vinifera
ref|XP_010098421.1|  hypothetical protein L484_012136                   208   1e-59   Morus notabilis
ref|XP_008367769.1|  PREDICTED: uncharacterized protein LOC103431392    206   8e-59   
ref|XP_006414715.1|  hypothetical protein EUTSA_v10027329mg             196   1e-58   
gb|EPS64918.1|  sodium/calcium exchanger family protein                 204   2e-58   Genlisea aurea
ref|XP_008226453.1|  PREDICTED: uncharacterized protein LOC103326027    204   3e-58   Prunus mume [ume]
ref|XP_009340381.1|  PREDICTED: uncharacterized protein LOC103932481    203   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_009348414.1|  PREDICTED: uncharacterized protein LOC103940068    202   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_004294082.1|  PREDICTED: uncharacterized protein LOC101313777    202   2e-57   Fragaria vesca subsp. vesca
ref|XP_002282948.1|  PREDICTED: uncharacterized protein LOC100252144    202   3e-57   Vitis vinifera
ref|XP_011000241.1|  PREDICTED: uncharacterized protein LOC105107868    201   7e-57   Populus euphratica
ref|XP_007021649.1|  Sodium/calcium exchanger family protein / ca...    198   1e-56   
ref|XP_004489056.1|  PREDICTED: uncharacterized protein LOC101505490    200   2e-56   Cicer arietinum [garbanzo]
ref|XP_010519243.1|  PREDICTED: uncharacterized protein LOC104798750    200   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_007149412.1|  hypothetical protein PHAVU_005G068100g             199   2e-56   Phaseolus vulgaris [French bean]
ref|XP_002298903.2|  sodium/calcium exchanger family protein            199   3e-56   
gb|ADN33808.1|  sodium/calcium exchanger family protein                 199   4e-56   Cucumis melo subsp. melo
ref|XP_007021648.1|  Sodium/calcium exchanger family protein / ca...    198   8e-56   Theobroma cacao [chocolate]
gb|KJB45757.1|  hypothetical protein B456_007G325800                    196   1e-55   Gossypium raimondii
gb|AAF69532.1|AC008007_7  F12M16.12                                     197   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392816.1|  hypothetical protein EUTSA_v10011341mg             197   2e-55   Eutrema salsugineum [saltwater cress]
ref|NP_564623.2|  Na+/Ca 2+ exchanger-like protein                      197   2e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDY55841.1|  BnaCnng29300D                                          197   3e-55   Brassica napus [oilseed rape]
ref|XP_008367781.1|  PREDICTED: uncharacterized protein LOC103431400    197   4e-55   
ref|XP_003543222.1|  PREDICTED: uncharacterized protein LOC100809896    196   4e-55   Glycine max [soybeans]
gb|KJB45756.1|  hypothetical protein B456_007G325800                    196   6e-55   Gossypium raimondii
emb|CDY25725.1|  BnaC03g69500D                                          196   7e-55   Brassica napus [oilseed rape]
ref|XP_010535054.1|  PREDICTED: uncharacterized protein LOC104810447    195   1e-54   Tarenaya hassleriana [spider flower]
ref|XP_009144785.1|  PREDICTED: uncharacterized protein LOC103868446    195   1e-54   Brassica rapa
ref|XP_002891737.1|  sodium/calcium exchanger family protein            195   2e-54   
emb|CDY25869.1|  BnaA05g14600D                                          195   2e-54   Brassica napus [oilseed rape]
gb|KHG29939.1|  Vacuolar calcium ion transporter                        194   2e-54   Gossypium arboreum [tree cotton]
ref|XP_008226455.1|  PREDICTED: uncharacterized protein LOC103326029    194   2e-54   Prunus mume [ume]
gb|KJB13244.1|  hypothetical protein B456_002G064800                    190   3e-54   Gossypium raimondii
ref|XP_010279178.1|  PREDICTED: uncharacterized protein LOC104613162    194   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_008386231.1|  PREDICTED: uncharacterized protein LOC103448741    194   4e-54   Malus domestica [apple tree]
ref|XP_012074212.1|  PREDICTED: uncharacterized protein LOC105635...    193   6e-54   Jatropha curcas
ref|XP_010675392.1|  PREDICTED: uncharacterized protein LOC104891403    193   8e-54   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK35737.1|  hypothetical protein AALP_AA4G030000                    192   8e-54   Arabis alpina [alpine rockcress]
gb|KJB13247.1|  hypothetical protein B456_002G064800                    191   1e-53   Gossypium raimondii
emb|CDY24108.1|  BnaA06g01060D                                          193   1e-53   Brassica napus [oilseed rape]
gb|KJB13245.1|  hypothetical protein B456_002G064800                    191   2e-53   Gossypium raimondii
gb|KHG25681.1|  Vacuolar calcium ion transporter                        192   2e-53   Gossypium arboreum [tree cotton]
ref|XP_009106991.1|  PREDICTED: uncharacterized protein LOC103832685    192   2e-53   Brassica rapa
ref|XP_002279120.1|  PREDICTED: uncharacterized protein LOC100253888    191   6e-53   Vitis vinifera
gb|KJB13246.1|  hypothetical protein B456_002G064800                    190   6e-53   Gossypium raimondii
emb|CDY26003.1|  BnaC06g06210D                                          189   1e-52   Brassica napus [oilseed rape]
ref|XP_009147618.1|  PREDICTED: uncharacterized protein LOC103871140    189   1e-52   Brassica rapa
ref|XP_004294083.1|  PREDICTED: uncharacterized protein LOC101314065    189   2e-52   Fragaria vesca subsp. vesca
gb|KDO45772.1|  hypothetical protein CISIN_1g0423002mg                  184   2e-52   Citrus sinensis [apfelsine]
ref|XP_009348415.1|  PREDICTED: uncharacterized protein LOC103940069    189   3e-52   Pyrus x bretschneideri [bai li]
gb|ACY66868.1|  P20Sh148J07                                             187   9e-52   Saccharum hybrid cultivar R570
ref|XP_007021639.1|  Sodium/calcium exchanger family protein / ca...    187   5e-51   
ref|XP_007213018.1|  hypothetical protein PRUPE_ppa023026mg             184   9e-51   Prunus persica
ref|XP_008229131.1|  PREDICTED: uncharacterized protein LOC103328510    184   9e-51   Prunus mume [ume]
ref|XP_006451747.1|  hypothetical protein CICLE_v10007809mg             184   1e-50   Citrus clementina [clementine]
dbj|BAI94501.1|  sodium/calcium exchanger protein                       184   1e-50   Dianthus caryophyllus [carnation]
ref|XP_006469050.1|  PREDICTED: uncharacterized protein LOC102616350    184   1e-50   Citrus sinensis [apfelsine]
ref|XP_010060650.1|  PREDICTED: uncharacterized protein LOC104448506    183   3e-50   Eucalyptus grandis [rose gum]
ref|XP_004305436.1|  PREDICTED: uncharacterized protein LOC101295737    183   4e-50   Fragaria vesca subsp. vesca
ref|XP_002525142.1|  calcium ion binding protein, putative              182   4e-50   
ref|NP_001151543.1|  LOC100285177 precursor                             182   6e-50   Zea mays [maize]
ref|XP_008655084.1|  PREDICTED: LOC100285177 isoform X1                 182   7e-50   Zea mays [maize]
ref|XP_003565462.1|  PREDICTED: uncharacterized protein LOC100838274    182   9e-50   Brachypodium distachyon [annual false brome]
ref|XP_008362437.1|  PREDICTED: uncharacterized protein LOC103426126    181   1e-49   
ref|XP_009354324.1|  PREDICTED: uncharacterized protein LOC103945475    182   1e-49   Pyrus x bretschneideri [bai li]
emb|CDM82192.1|  unnamed protein product                                182   1e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008368645.1|  PREDICTED: uncharacterized protein LOC103432241    181   1e-49   
ref|XP_007050030.1|  Sodium/calcium exchanger family protein / ca...    179   1e-49   
ref|XP_006307086.1|  hypothetical protein CARUB_v10008672mg             181   2e-49   Capsella rubella
ref|XP_008673552.1|  PREDICTED: uncharacterized protein LOC103649588    181   2e-49   
ref|XP_010500958.1|  PREDICTED: uncharacterized protein LOC104778258    181   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004968611.1|  PREDICTED: uncharacterized protein LOC101771765    181   3e-49   Setaria italica
gb|ACY66874.1|  P20Sh095F0                                              180   3e-49   Saccharum hybrid cultivar R570
ref|XP_006446746.1|  hypothetical protein CICLE_v10018123mg             180   3e-49   
ref|XP_010052481.1|  PREDICTED: uncharacterized protein LOC104441...    180   5e-49   Eucalyptus grandis [rose gum]
ref|XP_006643900.1|  PREDICTED: uncharacterized protein LOC102712578    179   6e-49   Oryza brachyantha
dbj|BAJ93500.1|  predicted protein                                      179   7e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010462200.1|  PREDICTED: uncharacterized protein LOC104742841    179   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010479874.1|  PREDICTED: uncharacterized protein LOC104758667    179   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_007050029.1|  Sodium/calcium exchanger family protein / ca...    179   1e-48   
ref|NP_001042378.1|  Os01g0212400                                       178   2e-48   
gb|EAZ04370.1|  hypothetical protein OsI_26513                          177   3e-48   Oryza sativa Indica Group [Indian rice]
gb|EEE56655.1|  hypothetical protein OsJ_06069                          176   1e-47   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD19956.1|  putative drought-induced protein RDI                   176   1e-47   Oryza sativa Japonica Group [Japonica rice]
gb|KCW69971.1|  hypothetical protein EUGRSUZ_F03285                     175   1e-47   Eucalyptus grandis [rose gum]
ref|XP_004951320.1|  PREDICTED: uncharacterized protein LOC101782315    175   3e-47   Setaria italica
ref|XP_010062838.1|  PREDICTED: uncharacterized protein LOC104450104    174   5e-47   Eucalyptus grandis [rose gum]
ref|XP_010915578.1|  PREDICTED: uncharacterized protein LOC105040648    174   1e-46   Elaeis guineensis
ref|XP_006852513.1|  PREDICTED: uncharacterized protein LOC18442228     173   1e-46   Amborella trichopoda
gb|KCW89606.1|  hypothetical protein EUGRSUZ_A01890                     173   1e-46   Eucalyptus grandis [rose gum]
ref|XP_002522155.1|  calcium ion binding protein, putative              172   2e-46   
gb|KDP31770.1|  hypothetical protein JCGZ_12231                         172   2e-46   Jatropha curcas
ref|XP_010276580.1|  PREDICTED: uncharacterized protein LOC104611295    172   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_008645573.1|  PREDICTED: uncharacterized protein LOC103626994    172   3e-46   
ref|XP_009380498.1|  PREDICTED: uncharacterized protein LOC103968880    172   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783929.1|  PREDICTED: uncharacterized protein LOC103703017    171   9e-46   
ref|XP_009405607.1|  PREDICTED: uncharacterized protein LOC103988717    171   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012079036.1|  PREDICTED: uncharacterized protein LOC105639564    169   3e-45   
ref|XP_002451861.1|  hypothetical protein SORBIDRAFT_04g008850          169   3e-45   
ref|XP_010277717.1|  PREDICTED: uncharacterized protein LOC104612...    160   5e-45   Nelumbo nucifera [Indian lotus]
ref|XP_003571165.2|  PREDICTED: uncharacterized protein LOC100833...    168   1e-44   
ref|XP_010234099.1|  PREDICTED: uncharacterized protein LOC100833...    168   1e-44   
ref|XP_010277718.1|  PREDICTED: uncharacterized protein LOC104612...    158   4e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010041151.1|  PREDICTED: uncharacterized protein LOC104430086    164   2e-43   Eucalyptus grandis [rose gum]
emb|CAN78652.1|  hypothetical protein VITISV_033128                     164   2e-43   Vitis vinifera
ref|XP_012074224.1|  PREDICTED: uncharacterized protein LOC105635748    160   6e-42   Jatropha curcas
ref|XP_012074223.1|  PREDICTED: uncharacterized protein LOC105635747    159   2e-41   
ref|XP_009409407.1|  PREDICTED: uncharacterized protein LOC103991626    157   5e-41   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP05978.1|  unnamed protein product                                144   2e-36   Coffea canephora [robusta coffee]
ref|XP_010064464.1|  PREDICTED: uncharacterized protein LOC104451526    137   4e-36   
ref|XP_007212014.1|  hypothetical protein PRUPE_ppa004833mg             143   5e-36   
ref|XP_007213956.1|  hypothetical protein PRUPE_ppa004823mg             142   7e-36   
emb|CBI20223.3|  unnamed protein product                                142   9e-36   Vitis vinifera
ref|XP_002522156.1|  calcium ion binding protein, putative              138   3e-34   
ref|XP_010279180.1|  PREDICTED: uncharacterized protein LOC104613163    137   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010052488.1|  PREDICTED: uncharacterized protein LOC104441...    136   2e-33   
gb|EMS61578.1|  hypothetical protein TRIUR3_22187                       135   2e-33   Triticum urartu
gb|AAK32813.1|AF361800_1  At1g53210/F12M16_12                           134   8e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002987555.1|  hypothetical protein SELMODRAFT_42348              131   6e-32   
gb|EPS57671.1|  hypothetical protein M569_17145                         129   3e-31   Genlisea aurea
ref|XP_002992821.1|  hypothetical protein SELMODRAFT_42349              129   4e-31   
gb|KCW67440.1|  hypothetical protein EUGRSUZ_F011933                    121   1e-30   Eucalyptus grandis [rose gum]
ref|XP_006307087.1|  hypothetical protein CARUB_v10008672mg             127   2e-30   
gb|KDP36272.1|  hypothetical protein JCGZ_09837                         127   2e-30   Jatropha curcas
ref|XP_002974272.1|  hypothetical protein SELMODRAFT_52345              127   2e-30   
gb|EMT26919.1|  hypothetical protein F775_25869                         126   4e-30   
ref|XP_002985644.1|  hypothetical protein SELMODRAFT_181929             125   1e-29   
ref|XP_002275961.1|  PREDICTED: uncharacterized protein LOC100260847    125   2e-29   Vitis vinifera
gb|ACN27225.1|  unknown                                                 123   4e-29   Zea mays [maize]
emb|CBI21945.3|  unnamed protein product                                125   6e-29   Vitis vinifera
ref|XP_010644148.1|  PREDICTED: uncharacterized protein LOC100241883    121   1e-27   Vitis vinifera
ref|XP_010277716.1|  PREDICTED: uncharacterized protein LOC104612096    121   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_001762095.1|  predicted protein                                  118   8e-27   
ref|XP_011083284.1|  PREDICTED: uncharacterized protein LOC105165819    118   1e-26   Sesamum indicum [beniseed]
ref|XP_011460765.1|  PREDICTED: uncharacterized protein LOC105350...    113   1e-26   Fragaria vesca subsp. vesca
ref|XP_007021646.1|  Sodium/calcium exchanger family protein / ca...    118   1e-26   
ref|XP_011096402.1|  PREDICTED: uncharacterized protein LOC105175...    116   2e-26   Sesamum indicum [beniseed]
ref|XP_001752917.1|  predicted protein                                  116   4e-26   
ref|XP_006594741.1|  PREDICTED: uncharacterized protein LOC100798...    116   7e-26   Glycine max [soybeans]
ref|XP_006594742.1|  PREDICTED: uncharacterized protein LOC100798...    115   8e-26   Glycine max [soybeans]
ref|XP_001755925.1|  predicted protein                                  115   1e-25   
gb|EMT05376.1|  hypothetical protein F775_06447                         113   2e-25   
ref|XP_006594743.1|  PREDICTED: uncharacterized protein LOC100798...    114   2e-25   
ref|XP_005650712.1|  hypothetical protein COCSUDRAFT_61158              113   2e-25   Coccomyxa subellipsoidea C-169
ref|XP_007021642.1|  Sodium/calcium exchanger family protein / ca...    112   3e-25   
ref|XP_007025465.1|  Sodium/calcium exchanger family protein / ca...    112   6e-25   
ref|XP_001751608.1|  predicted protein                                  112   9e-25   
ref|XP_011096401.1|  PREDICTED: uncharacterized protein LOC105175...    112   1e-24   Sesamum indicum [beniseed]
emb|CAN66793.1|  hypothetical protein VITISV_034151                     109   2e-24   Vitis vinifera
ref|XP_007149414.1|  hypothetical protein PHAVU_005G068300g             111   4e-24   Phaseolus vulgaris [French bean]
gb|ABR26205.1|  sodium/calcium exchanger protein                        107   5e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_011000236.1|  PREDICTED: uncharacterized protein LOC105107...    110   1e-23   Populus euphratica
ref|XP_008226451.1|  PREDICTED: uncharacterized protein LOC103326025    109   1e-23   Prunus mume [ume]
ref|XP_004489085.1|  PREDICTED: uncharacterized protein LOC101490110    108   1e-23   
ref|XP_002272134.1|  PREDICTED: uncharacterized protein LOC100243523    108   2e-23   
ref|XP_010060649.1|  PREDICTED: uncharacterized protein LOC104448505    108   3e-23   Eucalyptus grandis [rose gum]
ref|XP_002275985.2|  PREDICTED: uncharacterized protein LOC100255777    107   3e-23   Vitis vinifera
ref|XP_003540477.1|  PREDICTED: uncharacterized protein LOC100800452    108   3e-23   Glycine max [soybeans]
ref|XP_012092420.1|  PREDICTED: uncharacterized protein LOC105650151    107   6e-23   Jatropha curcas
emb|CAN78650.1|  hypothetical protein VITISV_033126                     106   9e-23   Vitis vinifera
ref|XP_011000239.1|  PREDICTED: uncharacterized protein LOC105107...    106   1e-22   Populus euphratica
ref|XP_011000240.1|  PREDICTED: uncharacterized protein LOC105107...    106   2e-22   Populus euphratica
ref|XP_011000235.1|  PREDICTED: uncharacterized protein LOC105107...    106   2e-22   Populus euphratica
ref|XP_007213499.1|  hypothetical protein PRUPE_ppa022096mg             105   2e-22   
emb|CBI20222.3|  unnamed protein product                                105   2e-22   Vitis vinifera
gb|EYU28049.1|  hypothetical protein MIMGU_mgv1a003825mg                105   3e-22   Erythranthe guttata [common monkey flower]
gb|KCW67437.1|  hypothetical protein EUGRSUZ_F01191                     103   4e-22   Eucalyptus grandis [rose gum]
ref|XP_011460767.1|  PREDICTED: uncharacterized protein LOC105350439    104   7e-22   Fragaria vesca subsp. vesca
ref|XP_011082730.1|  PREDICTED: uncharacterized protein LOC105165425    103   1e-21   Sesamum indicum [beniseed]
ref|XP_002962226.1|  hypothetical protein SELMODRAFT_76965              102   2e-21   
ref|XP_002965139.1|  hypothetical protein SELMODRAFT_82683              102   2e-21   
gb|KHN36865.1|  hypothetical protein glysoja_001596                     102   3e-21   Glycine soja [wild soybean]
ref|XP_009340418.1|  PREDICTED: uncharacterized protein LOC103932516    102   4e-21   Pyrus x bretschneideri [bai li]
ref|XP_002305761.1|  hypothetical protein POPTR_0004s05210g             101   5e-21   
ref|XP_009352820.1|  PREDICTED: uncharacterized protein LOC103944133    100   1e-20   
gb|ACU19365.1|  unknown                                               95.9    2e-20   Glycine max [soybeans]
ref|XP_009353170.1|  PREDICTED: uncharacterized protein LOC103944425    100   2e-20   
ref|XP_008383659.1|  PREDICTED: uncharacterized protein LOC103446347  99.8    2e-20   Malus domestica [apple tree]
gb|AFW71107.1|  hypothetical protein ZEAMMB73_054247                  94.7    4e-20   
ref|XP_011027727.1|  PREDICTED: uncharacterized protein LOC105127...  97.4    5e-20   Populus euphratica
ref|XP_007214217.1|  hypothetical protein PRUPE_ppa023212mg           98.6    5e-20   
gb|EYU26347.1|  hypothetical protein MIMGU_mgv1a002045mg              99.0    7e-20   Erythranthe guttata [common monkey flower]
ref|XP_002979758.1|  hypothetical protein SELMODRAFT_177778           95.5    1e-19   
gb|KHN28092.1|  hypothetical protein glysoja_007824                   97.8    1e-19   Glycine soja [wild soybean]
ref|XP_002298902.2|  hypothetical protein POPTR_0001s38430g           97.8    1e-19   
ref|XP_011027724.1|  PREDICTED: uncharacterized protein LOC105127...  97.4    1e-19   Populus euphratica
emb|CDP05977.1|  unnamed protein product                              97.4    2e-19   Coffea canephora [robusta coffee]
gb|EYU43357.1|  hypothetical protein MIMGU_mgv1a003865mg              95.1    4e-19   Erythranthe guttata [common monkey flower]
gb|KCW67430.1|  hypothetical protein EUGRSUZ_F01186                   96.7    4e-19   Eucalyptus grandis [rose gum]
ref|XP_008225191.1|  PREDICTED: uncharacterized protein LOC103324855  95.9    5e-19   Prunus mume [ume]
ref|XP_008386229.1|  PREDICTED: uncharacterized protein LOC103448738  96.3    5e-19   
gb|EYU43358.1|  hypothetical protein MIMGU_mgv1a003865mg              94.7    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_006370033.1|  hypothetical protein POPTR_0001s38420g           94.0    3e-18   
gb|EMS45634.1|  hypothetical protein TRIUR3_11261                     91.3    7e-18   Triticum urartu
ref|XP_005839482.1|  hypothetical protein GUITHDRAFT_159252           91.7    9e-18   Guillardia theta CCMP2712
ref|XP_009352959.1|  PREDICTED: uncharacterized protein LOC103944258  91.7    1e-17   
gb|EYU44996.1|  hypothetical protein MIMGU_mgv1a025835mg              91.7    2e-17   Erythranthe guttata [common monkey flower]
gb|ACN36915.1|  unknown                                               90.5    2e-17   Zea mays [maize]
ref|XP_011000237.1|  PREDICTED: uncharacterized protein LOC105107...  90.1    6e-17   Populus euphratica
ref|XP_002522528.1|  conserved hypothetical protein                   88.6    1e-16   
emb|CAN66375.1|  hypothetical protein VITISV_037549                   88.2    4e-16   Vitis vinifera
emb|CDY27823.1|  BnaC09g28500D                                        81.6    6e-16   Brassica napus [oilseed rape]
ref|XP_010101519.1|  hypothetical protein L484_008850                 86.3    8e-16   
gb|EMT26603.1|  hypothetical protein F775_16568                       83.6    9e-16   
ref|XP_004293919.1|  PREDICTED: uncharacterized protein LOC101312324  86.3    1e-15   Fragaria vesca subsp. vesca
ref|XP_008371442.1|  PREDICTED: uncharacterized protein LOC103434855  85.1    2e-15   
ref|XP_008383883.1|  PREDICTED: uncharacterized protein LOC103446524  83.6    6e-15   
ref|XP_009352958.1|  PREDICTED: uncharacterized protein LOC103944256  83.2    9e-15   
gb|EYU44995.1|  hypothetical protein MIMGU_mgv1a002795mg              82.8    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_010058976.1|  PREDICTED: uncharacterized protein LOC104446874  82.4    2e-14   Eucalyptus grandis [rose gum]
emb|CDY43114.1|  BnaC05g36630D                                        75.9    2e-14   Brassica napus [oilseed rape]
gb|AFK39630.1|  unknown                                               77.0    3e-14   Lotus japonicus
gb|KEH38644.1|  calcium ion-binding protein, putative                 75.9    9e-14   Medicago truncatula
ref|XP_002522529.1|  calmodulin, putative                             80.5    9e-14   
emb|CAN66796.1|  hypothetical protein VITISV_034154                   77.4    9e-14   Vitis vinifera
ref|XP_002500016.1|  Ca2+:Cation antiporter family                    80.1    9e-14   Micromonas commoda
ref|XP_009605371.1|  PREDICTED: uncharacterized protein LOC104099939  80.1    1e-13   Nicotiana tomentosiformis
gb|KDP21053.1|  hypothetical protein JCGZ_21524                       79.3    2e-13   Jatropha curcas
ref|XP_006340117.1|  PREDICTED: uncharacterized protein LOC102587762  79.0    3e-13   
emb|CAN78275.1|  hypothetical protein VITISV_037788                   78.2    4e-13   Vitis vinifera
gb|KIY91568.1|  hypothetical protein MNEG_16396                       74.3    4e-13   Monoraphidium neglectum
ref|XP_002113975.1|  hypothetical protein TRIADDRAFT_57950            77.4    7e-13   Trichoplax adhaerens
ref|XP_642144.1|  hypothetical protein DDB_G0278609                   77.4    8e-13   Dictyostelium discoideum AX4
gb|EYU28050.1|  hypothetical protein MIMGU_mgv1a023246mg              75.9    2e-12   Erythranthe guttata [common monkey flower]
ref|XP_009803286.1|  PREDICTED: uncharacterized protein LOC104248681  75.9    3e-12   Nicotiana sylvestris
ref|XP_003288984.1|  hypothetical protein DICPUDRAFT_153287           75.5    3e-12   Dictyostelium purpureum
emb|CDY09702.1|  BnaC07g33590D                                        70.9    5e-12   Brassica napus [oilseed rape]
gb|KCW44589.1|  hypothetical protein EUGRSUZ_L01893                   74.3    5e-12   Eucalyptus grandis [rose gum]
tpg|DAA52870.1|  TPA: hypothetical protein ZEAMMB73_004216            70.1    1e-11   
ref|XP_004361492.1|  hypothetical protein DFA_05775                   73.6    1e-11   Cavenderia fasciculata
ref|XP_011096404.1|  PREDICTED: uncharacterized protein LOC105175608  73.6    2e-11   Sesamum indicum [beniseed]
ref|XP_004233846.1|  PREDICTED: uncharacterized protein LOC101251749  73.6    2e-11   Solanum lycopersicum
ref|XP_001627159.1|  predicted protein                                73.2    2e-11   Nematostella vectensis
gb|EFA85983.1|  hypothetical protein PPL_01216                        70.9    1e-10   Heterostelium album PN500
gb|AFW71108.1|  hypothetical protein ZEAMMB73_635590                  67.4    1e-10   
gb|AAL32034.1|AF439275_1  drought-induced protein RDI                 67.0    1e-10   Retama raetam [retem]
ref|XP_010317432.1|  PREDICTED: uncharacterized protein LOC101254...  70.9    1e-10   Solanum lycopersicum
ref|XP_009629500.1|  PREDICTED: uncharacterized protein LOC104119642  70.9    1e-10   Nicotiana tomentosiformis
ref|XP_004234097.2|  PREDICTED: uncharacterized protein LOC101254...  70.1    2e-10   Solanum lycopersicum
gb|KEH38650.1|  calcium-binding EF-hand protein                       68.9    3e-10   Medicago truncatula
gb|EPS72526.1|  sodium/calcium exchanger protein                      64.7    5e-10   Genlisea aurea
ref|XP_003386706.1|  PREDICTED: uncharacterized protein LOC100632705  68.6    5e-10   Amphimedon queenslandica
ref|XP_006343216.1|  PREDICTED: uncharacterized protein LOC102593213  68.2    9e-10   Solanum tuberosum [potatoes]
ref|XP_011096403.1|  PREDICTED: uncharacterized protein LOC105175606  67.8    1e-09   
ref|XP_003057911.1|  predicted protein                                67.4    1e-09   Micromonas pusilla CCMP1545
dbj|GAM24148.1|  hypothetical protein SAMD00019534_073230             66.6    2e-09   Acytostelium subglobosum LB1
ref|XP_010058973.1|  PREDICTED: uncharacterized protein LOC104446871  65.1    8e-09   
gb|KCW74040.1|  hypothetical protein EUGRSUZ_E02663                   64.7    1e-08   Eucalyptus grandis [rose gum]
gb|KEH38643.1|  calcium-binding EF-hand protein                       64.3    1e-08   Medicago truncatula
ref|XP_009603995.1|  PREDICTED: uncharacterized protein LOC104098869  63.9    1e-08   
ref|XP_004357876.1|  hypothetical protein DFA_00160                   64.3    1e-08   Cavenderia fasciculata
ref|XP_007149413.1|  hypothetical protein PHAVU_005G068200g           63.9    2e-08   Phaseolus vulgaris [French bean]
gb|EFA82832.1|  hypothetical protein PPL_04527                        63.5    2e-08   Heterostelium album PN500
ref|XP_002276006.2|  PREDICTED: uncharacterized protein LOC100250594  61.6    9e-08   
gb|KIY94308.1|  hypothetical protein MNEG_13653                       61.2    9e-08   Monoraphidium neglectum
emb|CAN78651.1|  hypothetical protein VITISV_033127                   61.6    1e-07   Vitis vinifera
gb|ADC80445.1|  putative methyltransferase                            57.8    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_008366059.1|  PREDICTED: uncharacterized protein LOC103429706  58.9    3e-07   
ref|XP_011027726.1|  PREDICTED: uncharacterized protein LOC105127...  60.1    4e-07   Populus euphratica
ref|XP_009141357.1|  PREDICTED: uncharacterized protein LOC103865312  58.5    1e-06   Brassica rapa
emb|CAN69279.1|  hypothetical protein VITISV_023274                   58.2    1e-06   Vitis vinifera
ref|XP_010089436.1|  hypothetical protein L484_002737                 56.2    2e-06   
ref|XP_008358657.1|  PREDICTED: uncharacterized protein LOC103422380  57.8    2e-06   
gb|EMS60382.1|  hypothetical protein TRIUR3_19684                     55.1    3e-06   Triticum urartu
ref|XP_010460672.1|  PREDICTED: uncharacterized protein LOC104741492  56.2    6e-06   
ref|XP_010499420.1|  PREDICTED: uncharacterized protein LOC104776935  55.5    1e-05   
emb|CDY34082.1|  BnaA09g27080D                                        55.5    1e-05   
ref|XP_009113633.1|  PREDICTED: uncharacterized protein LOC103838933  54.7    2e-05   
ref|XP_010478257.1|  PREDICTED: uncharacterized protein LOC104757229  53.9    4e-05   
ref|XP_010549555.1|  PREDICTED: uncharacterized protein LOC104820693  53.5    6e-05   
emb|CDY37675.1|  BnaA04g19930D                                        53.5    6e-05   
ref|XP_011087014.1|  PREDICTED: uncharacterized protein LOC105168577  53.1    6e-05   
gb|AAF24539.2|AC007508_2  F1K23.2                                     53.1    9e-05   
emb|CDY64851.1|  BnaCnng45370D                                        52.8    1e-04   
gb|EJK62281.1|  hypothetical protein THAOC_17107                      52.4    2e-04   
gb|KFK44727.1|  hypothetical protein AALP_AA1G295000                  51.2    3e-04   
emb|CCI40171.1|  unnamed protein product                              51.6    3e-04   
ref|NP_174197.2|  EF-hand, calcium binding motif-containing protein   50.8    5e-04   
ref|XP_009517896.1|  hypothetical protein PHYSODRAFT_349569           50.8    5e-04   
gb|ETO25801.1|  hypothetical protein RFI_11337                        50.1    8e-04   
emb|CCA15196.1|  Ca2 :Cation Antiporter (CaCA) Family putative        50.1    0.001   



>ref|XP_009767335.1| PREDICTED: uncharacterized protein LOC104218515 [Nicotiana sylvestris]
Length=568

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            S DL+SDG VH  G  S VLRL  ++  EE CEQSYGFLPCT TALGN+FLI+VYGYLMF
Sbjct  25   SGDLISDG-VH--GRDSDVLRLDRISAAEENCEQSYGFLPCTKTALGNVFLIIVYGYLMF  81

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
            LAATYLSSGSELLLEILGPGLIGGLFLP+LGALPDAMLILVSG+SGS A AQSQVSVGMG
Sbjct  82   LAATYLSSGSELLLEILGPGLIGGLFLPMLGALPDAMLILVSGISGSTAAAQSQVSVGMG  141

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            LLAGSTVML+TVIWGTC +VGKCDIQN+VAVDLKDTK FSLTGSGV+TDVWTS+AA+IMA
Sbjct  142  LLAGSTVMLITVIWGTCCIVGKCDIQNSVAVDLKDTKGFSLTGSGVSTDVWTSHAAMIMA  201



>ref|XP_011082732.1| PREDICTED: uncharacterized protein LOC105165426 [Sesamum indicum]
Length=567

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 164/186 (88%), Gaps = 6/186 (3%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I D+S DLVSDG VHS+ +    LRL      EETCEQ+YGF+PCT+TALGNLFLILV
Sbjct  26   RFIADQS-DLVSDG-VHSS-KLPNFLRL---YAAEETCEQTYGFMPCTSTALGNLFLILV  79

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLMFLAATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGSV  AQSQ
Sbjct  80   YGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGSVETAQSQ  139

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI N VAVD +DTK FSLTGSG++TD+WTSY
Sbjct  140  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIVNHVAVDSQDTKGFSLTGSGISTDIWTSY  199

Query  653  AAIIMA  670
            A IIMA
Sbjct  200  AGIIMA  205



>ref|XP_006348283.1| PREDICTED: uncharacterized protein LOC102600810 [Solanum tuberosum]
Length=589

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 167/195 (86%), Gaps = 11/195 (6%)
 Frame = +2

Query  113  RLIVDRSS-DLVSDGGVH--------SAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTA  265
            R+IVD+SS DLVSDG VH        S G    V+ L   AP EE CEQSYGFLPCT TA
Sbjct  29   RVIVDQSSSDLVSDG-VHGGGGRNSSSIGRERRVISL-FAAPVEEACEQSYGFLPCTKTA  86

Query  266  LGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLS  445
            LGN+FLI+VYGYLMF AATYLSSGSELLLEILGPGLIGGLFLPILGALPDAMLILVSG++
Sbjct  87   LGNVFLIIVYGYLMFSAATYLSSGSELLLEILGPGLIGGLFLPILGALPDAMLILVSGIT  146

Query  446  GSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSG  625
            GS AEAQSQVSVG+GLLAGSTVMLLTVIWGTC +VGKCDI+N+ AVDLKDTK  SLTGSG
Sbjct  147  GSAAEAQSQVSVGIGLLAGSTVMLLTVIWGTCCIVGKCDIENSTAVDLKDTKGLSLTGSG  206

Query  626  VTTDVWTSYAAIIMA  670
            VTTD+WTSYAA+IMA
Sbjct  207  VTTDIWTSYAAMIMA  221



>ref|XP_009593456.1| PREDICTED: uncharacterized protein LOC104090114 [Nicotiana tomentosiformis]
Length=564

 Score =   219 bits (558),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 158/178 (89%), Gaps = 4/178 (2%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRLGVL-APEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
             +SDG VH  G  S VLRL  + A EE TCEQSYGFLPCT TALGN+FLI+VYGYLMFLA
Sbjct  23   FISDG-VH--GRDSDVLRLDRISAAEESTCEQSYGFLPCTKTALGNVFLIIVYGYLMFLA  79

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  496
            ATYLSSGSE LLEILGPGLIGGLFLP+LGALPDAMLILVSG+SGS A AQSQVSVGMGLL
Sbjct  80   ATYLSSGSEFLLEILGPGLIGGLFLPVLGALPDAMLILVSGISGSTAAAQSQVSVGMGLL  139

Query  497  AGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            AGSTVML+TVIWGTC +VGKCDIQN+ A+DLKDTK FSLTGSGV+TDVWTS+AA IMA
Sbjct  140  AGSTVMLITVIWGTCCIVGKCDIQNSAAIDLKDTKGFSLTGSGVSTDVWTSHAATIMA  197



>ref|XP_009604315.1| PREDICTED: uncharacterized protein LOC104099119 [Nicotiana tomentosiformis]
Length=574

 Score =   219 bits (559),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 165/189 (87%), Gaps = 6/189 (3%)
 Frame = +2

Query  113  RLIVDR-SSDLVSDG--GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFL  283
            R+I D+ SSDLVSDG  GV S G   G++ L   A  EE CEQSYGFLPCT TALGN+FL
Sbjct  22   RVISDQPSSDLVSDGVRGVDS-GREKGIISL--FAETEEACEQSYGFLPCTKTALGNVFL  78

Query  284  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  463
            I+VYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLP LGALPDAMLILVSG+SG+ A A
Sbjct  79   IVVYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLPALGALPDAMLILVSGVSGTAAAA  138

Query  464  QSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVW  643
            QSQVSVG+GLLAGSTVMLLT IWGTC +VGKCDIQN+VAVDL+DTK  SLTGSGVTTD+W
Sbjct  139  QSQVSVGIGLLAGSTVMLLTAIWGTCCIVGKCDIQNSVAVDLRDTKGLSLTGSGVTTDIW  198

Query  644  TSYAAIIMA  670
            TSYAA+IMA
Sbjct  199  TSYAAMIMA  207



>ref|XP_004251882.1| PREDICTED: uncharacterized protein LOC101257045 [Solanum lycopersicum]
Length=578

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 163/189 (86%), Gaps = 4/189 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSA-GEGSGVLRL--GVLAPEEETCEQSYGFLPCTTTALGNLFL  283
            R I D S+ ++SDG VHS  G    +LRL       EEE+CEQSYGFLPCT TALGN+FL
Sbjct  24   RFISDDSAGVISDG-VHSEIGRDLEILRLDRNFAGGEEESCEQSYGFLPCTKTALGNVFL  82

Query  284  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  463
            ILVYGYLMFL ATYLSSGSELLLEILGPG+IGGLFLP+LGALPDAMLILVSG+SGS A A
Sbjct  83   ILVYGYLMFLGATYLSSGSELLLEILGPGIIGGLFLPVLGALPDAMLILVSGISGSTAAA  142

Query  464  QSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVW  643
            QSQVSVGMGLLAGSTVML+TVIWGTC +VGKCDIQN+VAVD+KDT  FSLTGSGV+TD+W
Sbjct  143  QSQVSVGMGLLAGSTVMLITVIWGTCCIVGKCDIQNSVAVDMKDTNGFSLTGSGVSTDIW  202

Query  644  TSYAAIIMA  670
            TS+AA IMA
Sbjct  203  TSHAATIMA  211



>ref|XP_009766997.1| PREDICTED: uncharacterized protein LOC104218248 [Nicotiana sylvestris]
Length=574

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 165/189 (87%), Gaps = 6/189 (3%)
 Frame = +2

Query  113  RLIVDR-SSDLVSDGGVH--SAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFL  283
            R+I D+ SSDLVSDG VH  S+G   G++ L   A  EE CEQSYGFLPCT TALGN+FL
Sbjct  22   RVISDQPSSDLVSDG-VHGGSSGREHGIISL--FAETEEACEQSYGFLPCTKTALGNVFL  78

Query  284  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  463
            I+VYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLP LGALPDAMLILVSG+SG+ A A
Sbjct  79   IVVYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLPALGALPDAMLILVSGVSGTAAAA  138

Query  464  QSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVW  643
            Q QVSVG+GLLAGSTVMLLT IWGTC +VGKCDIQN+VAVDL+DTK  S+TGSGVTTD+W
Sbjct  139  QGQVSVGIGLLAGSTVMLLTAIWGTCCIVGKCDIQNSVAVDLRDTKGLSMTGSGVTTDIW  198

Query  644  TSYAAIIMA  670
            TSYAA+IMA
Sbjct  199  TSYAAMIMA  207



>ref|XP_011098255.1| PREDICTED: uncharacterized protein LOC105176958 isoform X1 [Sesamum 
indicum]
Length=576

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 163/186 (88%), Gaps = 4/186 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I D+S DL+SD  V  A +   +LRL      EE CE++YGF+PCT+TALGNLFLILV
Sbjct  24   RRIRDQS-DLISDDVVVGASKFPPLLRLPA---AEEVCEETYGFMPCTSTALGNLFLILV  79

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLMFLAATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS   AQSQ
Sbjct  80   YGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGSRETAQSQ  139

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVMLLT+IWGTC++VGKCDI+N+VAVD KDTKAFSL GSG++TD+WTSY
Sbjct  140  VSVGMGLLAGSTVMLLTLIWGTCIIVGKCDIENSVAVDSKDTKAFSLAGSGISTDIWTSY  199

Query  653  AAIIMA  670
            A+IIMA
Sbjct  200  ASIIMA  205



>ref|XP_011098256.1| PREDICTED: uncharacterized protein LOC105176958 isoform X2 [Sesamum 
indicum]
Length=569

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 163/186 (88%), Gaps = 4/186 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I D+S DL+SD  V  A +   +LRL      EE CE++YGF+PCT+TALGNLFLILV
Sbjct  24   RRIRDQS-DLISDDVVVGASKFPPLLRLPA---AEEVCEETYGFMPCTSTALGNLFLILV  79

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLMFLAATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS   AQSQ
Sbjct  80   YGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGSRETAQSQ  139

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVMLLT+IWGTC++VGKCDI+N+VAVD KDTKAFSL GSG++TD+WTSY
Sbjct  140  VSVGMGLLAGSTVMLLTLIWGTCIIVGKCDIENSVAVDSKDTKAFSLAGSGISTDIWTSY  199

Query  653  AAIIMA  670
            A+IIMA
Sbjct  200  ASIIMA  205



>ref|XP_004244257.1| PREDICTED: uncharacterized protein LOC101263533 [Solanum lycopersicum]
Length=589

 Score =   217 bits (552),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 165/195 (85%), Gaps = 11/195 (6%)
 Frame = +2

Query  113  RLIVDRSS-DLVSDGGVH--------SAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTA  265
            R+IVD+SS DL+SDG VH        S G   G++ L   AP EE CEQSYGFLPCT TA
Sbjct  29   RVIVDQSSSDLISDG-VHGGGGRNSTSIGRERGIISL-FAAPVEEACEQSYGFLPCTKTA  86

Query  266  LGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLS  445
            LGN+FLI+VYGYLMF AATYLSSGSELLLEILGPGLIGGLFLPILGALPDAMLILVSG++
Sbjct  87   LGNVFLIVVYGYLMFTAATYLSSGSELLLEILGPGLIGGLFLPILGALPDAMLILVSGIT  146

Query  446  GSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSG  625
            GS AEAQSQVSVG+GLLAGSTVMLLT IWGTC  VGKCDI N++AVDLKDTK  S TGSG
Sbjct  147  GSAAEAQSQVSVGIGLLAGSTVMLLTAIWGTCCTVGKCDIVNSIAVDLKDTKGLSFTGSG  206

Query  626  VTTDVWTSYAAIIMA  670
            V+TD+WTSYAA+IMA
Sbjct  207  VSTDIWTSYAAMIMA  221



>ref|XP_006358955.1| PREDICTED: uncharacterized protein LOC102579474 [Solanum tuberosum]
Length=577

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 162/189 (86%), Gaps = 4/189 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSA-GEGSGVLRLG--VLAPEEETCEQSYGFLPCTTTALGNLFL  283
            R  +  S  L+SDG VHS  G    +LRL       EEE+CEQSYGF+PCT TALGN+FL
Sbjct  23   RRFISDSGGLISDG-VHSEIGRDLEILRLDRDFAGGEEESCEQSYGFMPCTKTALGNVFL  81

Query  284  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  463
            ILVYGYLMFL ATYLSSGSELLLEILGPG+IGGLFLP+LGALPDAMLILVSG+SGS A A
Sbjct  82   ILVYGYLMFLGATYLSSGSELLLEILGPGIIGGLFLPVLGALPDAMLILVSGISGSTAAA  141

Query  464  QSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVW  643
            QSQVSVGMGLLAGSTVML+T+IWGTC +VGKCDIQN+VAVD+KDT+ FSLTGSGV+TD+W
Sbjct  142  QSQVSVGMGLLAGSTVMLITIIWGTCCIVGKCDIQNSVAVDMKDTRGFSLTGSGVSTDIW  201

Query  644  TSYAAIIMA  670
            TS+AA IMA
Sbjct  202  TSHAATIMA  210



>gb|EYU44997.1| hypothetical protein MIMGU_mgv1a003664mg [Erythranthe guttata]
Length=571

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 158/186 (85%), Gaps = 5/186 (3%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I D+  DLVSDG V      S V     L   EETCEQ+YGFLPCT+T LGNLFLILV
Sbjct  26   RFISDQP-DLVSDGVVRE----SKVPHFLRLHAAEETCEQTYGFLPCTSTGLGNLFLILV  80

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLMFLAATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSGSV  AQSQ
Sbjct  81   YGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSVETAQSQ  140

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVML+TVIWGTC++VGKCDI+N +A+D +DTK  SLTGSG+TTDVWTSY
Sbjct  141  VSVGMGLLAGSTVMLITVIWGTCIIVGKCDIENDLAIDSRDTKGLSLTGSGITTDVWTSY  200

Query  653  AAIIMA  670
            A IIMA
Sbjct  201  AGIIMA  206



>ref|XP_004146032.1| PREDICTED: uncharacterized protein LOC101209298 [Cucumis sativus]
 gb|KGN55087.1| hypothetical protein Csa_4G628350 [Cucumis sativus]
Length=589

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 159/181 (88%), Gaps = 6/181 (3%)
 Frame = +2

Query  137  DLVSDGGVHSAGEGSGVLRLGVL----APEEETCEQSYGFLPCTTTALGNLFLILVYGYL  304
            DLVSDG ++   E S  L L  L    APEEE+CEQSYGFLPCTTTALGNLFLI+VYGYL
Sbjct  41   DLVSDG-INGLQEPS-YLHLNTLSSLSAPEEESCEQSYGFLPCTTTALGNLFLIIVYGYL  98

Query  305  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  484
            MFLAATYLS+GSELLLEILGPG++GGLFLP LGALPDAMLILVSGL+GS   AQSQVSVG
Sbjct  99   MFLAATYLSTGSELLLEILGPGIVGGLFLPALGALPDAMLILVSGLAGSAEVAQSQVSVG  158

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGSTVMLLT+IWGTCV+VGKCD+Q++VA+D +DTK FSLT SGV+TD+WTSYAA I
Sbjct  159  MGLLAGSTVMLLTLIWGTCVIVGKCDLQDSVAIDSQDTKGFSLTESGVSTDIWTSYAARI  218

Query  665  M  667
            M
Sbjct  219  M  219



>ref|XP_008463718.1| PREDICTED: uncharacterized protein LOC103501799 [Cucumis melo]
Length=590

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 158/181 (87%), Gaps = 6/181 (3%)
 Frame = +2

Query  137  DLVSDGGVHSAGEGSGVLRLGVL----APEEETCEQSYGFLPCTTTALGNLFLILVYGYL  304
            DLVSDG V+   E S  L L  L    APEEE+CEQSYGFLPCTTTALGNLFLI+VYGYL
Sbjct  42   DLVSDG-VNELQEPS-YLHLNTLSSFSAPEEESCEQSYGFLPCTTTALGNLFLIIVYGYL  99

Query  305  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  484
            MFLAA YLS+GSELLLEILGPG++GGLFLP LGALPDAMLILVSGL+GS   AQSQVSVG
Sbjct  100  MFLAAKYLSTGSELLLEILGPGIVGGLFLPALGALPDAMLILVSGLAGSAEVAQSQVSVG  159

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGSTVMLLT+IWGTCV+VGKCD+Q++VA+D +DTK FSLT SGV+TD+WTSYAA I
Sbjct  160  MGLLAGSTVMLLTLIWGTCVIVGKCDLQDSVAIDSQDTKGFSLTESGVSTDIWTSYAARI  219

Query  665  M  667
            M
Sbjct  220  M  220



>ref|XP_003634635.1| PREDICTED: uncharacterized protein LOC100264164 [Vitis vinifera]
 emb|CBI20221.3| unnamed protein product [Vitis vinifera]
Length=580

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 162/189 (86%), Gaps = 5/189 (3%)
 Frame = +2

Query  113  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAP--EEETCEQSYGFLPCTTTALGNLF  280
            R+I +R+S   LVSDG VH   +GS  L L   +     ++C+Q+YGF+PCTTT +GNLF
Sbjct  24   RVISNRTSSTGLVSDG-VHDHRDGSPYLLLRSFSAVSASDSCDQTYGFMPCTTTTVGNLF  82

Query  281  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  460
            LILVYGYLMFLAATYLSSGSELLLE+LGPGL+GGL LPILGALPDAMLILVSGLSGS   
Sbjct  83   LILVYGYLMFLAATYLSSGSELLLELLGPGLVGGLLLPILGALPDAMLILVSGLSGSTET  142

Query  461  AQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDV  640
            AQSQVSVGMGLLAGSTVMLLT+IWGTCV+VGKCD+Q++VA D +DTK FSLTGSGV+TD+
Sbjct  143  AQSQVSVGMGLLAGSTVMLLTIIWGTCVIVGKCDLQDSVAKDSQDTKGFSLTGSGVSTDI  202

Query  641  WTSYAAIIM  667
            WTSYAAIIM
Sbjct  203  WTSYAAIIM  211



>ref|XP_010098421.1| hypothetical protein L484_012136 [Morus notabilis]
 gb|EXB75012.1| hypothetical protein L484_012136 [Morus notabilis]
Length=578

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 160/192 (83%), Gaps = 7/192 (4%)
 Frame = +2

Query  113  RLIVDRSS--DLVSDGGVHSAGEG-SGVLRLGVLAPE---EETCEQSYGFLPCTTTALGN  274
            R I D+SS  DLVS+G +H   E     LRL     +   E TCEQSYGFLPCTTTALGN
Sbjct  20   RFISDQSSQSDLVSNG-LHDLREAQPSFLRLNAALSDFGAESTCEQSYGFLPCTTTALGN  78

Query  275  LFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSV  454
            LFLILVYGYLMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS 
Sbjct  79   LFLILVYGYLMFTAATYLSNGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGSA  138

Query  455  AEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTT  634
              AQSQVSVGMGLLAGSTV+LLTVIWGTC++VGKCDI+ +VA D KDTK FSL GSGV+T
Sbjct  139  ETAQSQVSVGMGLLAGSTVLLLTVIWGTCIIVGKCDIEGSVARDGKDTKGFSLIGSGVST  198

Query  635  DVWTSYAAIIMA  670
            D+WTSYAA IMA
Sbjct  199  DIWTSYAARIMA  210



>ref|XP_008367769.1| PREDICTED: uncharacterized protein LOC103431392 [Malus domestica]
Length=586

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 155/182 (85%), Gaps = 3/182 (2%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  301
            SSDL+SDG  H     +    L     L+ E+ TCEQ+YGFLPCTTT +GNLFLILVYGY
Sbjct  35   SSDLISDGVHHHHRSHTFAPYLTLKNALSAEDSTCEQTYGFLPCTTTVIGNLFLILVYGY  94

Query  302  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  481
            LM+LAATYLS+GSE+LLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+   AQSQVSV
Sbjct  95   LMYLAATYLSNGSEMLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSV  154

Query  482  GMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAI  661
            GMGLLAGSTVMLLTVIWG+CV+VGKCDI+ +VA+D KDTK  SLTGSGV+TD+WTSYAA 
Sbjct  155  GMGLLAGSTVMLLTVIWGSCVIVGKCDIEGSVAIDNKDTKGLSLTGSGVSTDIWTSYAAT  214

Query  662  IM  667
            IM
Sbjct  215  IM  216



>ref|XP_006414715.1| hypothetical protein EUTSA_v10027329mg, partial [Eutrema salsugineum]
 gb|ESQ56168.1| hypothetical protein EUTSA_v10027329mg, partial [Eutrema salsugineum]
Length=220

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 154/185 (83%), Gaps = 6/185 (3%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSG-VLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVY  295
            S+ L+SDG +     GSG V++  V AP    +EE CEQ+YGF+PCT TALGN+FLILVY
Sbjct  14   STGLISDG-IDGGNLGSGSVIKTVVSAPPDEEKEEACEQTYGFMPCTKTALGNVFLILVY  72

Query  296  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  475
            G+LMF AATYLS+ SELLL+ILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQV
Sbjct  73   GFLMFTAATYLSARSELLLKILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQV  132

Query  476  SVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYA  655
            SVGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV  +DTK FSL  SGVT DVWTSYA
Sbjct  133  SVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVKNQDTKRFSLKDSGVTVDVWTSYA  192

Query  656  AIIMA  670
            A IMA
Sbjct  193  ARIMA  197



>gb|EPS64918.1| sodium/calcium exchanger family protein, partial [Genlisea aurea]
Length=519

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +2

Query  215  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  394
            EE+CEQ+YGFLPCT+TALGNLFLILVYGYLMF AA YLSSGSELLLEILGPG++GGLFLP
Sbjct  2    EESCEQTYGFLPCTSTALGNLFLILVYGYLMFSAARYLSSGSELLLEILGPGIVGGLFLP  61

Query  395  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNA  574
            ILGALPDAMLILVSGLSGSV  AQSQVSVG+GLLAGSTVMLLTVIWG+C++VGKCDI+N+
Sbjct  62   ILGALPDAMLILVSGLSGSVETAQSQVSVGIGLLAGSTVMLLTVIWGSCILVGKCDIENS  121

Query  575  VAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            +A+D KDTK F+LTGSGVTTD+WTSYA IIMA
Sbjct  122  IAIDSKDTKGFNLTGSGVTTDIWTSYAGIIMA  153



>ref|XP_008226453.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
 ref|XP_008226454.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
Length=579

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = +2

Query  113  RLIVDR---SSDLVSDGGVHSAGE-GSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNL  277
            R I D    S DL+SDG  H         L L   + + E TC+Q+YGFLPCTTT LGNL
Sbjct  22   RFISDTQAASQDLISDGVHHHLSHIPRSYLTLNPYSVDAESTCDQTYGFLPCTTTVLGNL  81

Query  278  FLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVA  457
            FLILVYGYLM+LAATYLS+GSE+LLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+  
Sbjct  82   FLILVYGYLMYLAATYLSNGSEMLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTTE  141

Query  458  EAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTD  637
             AQSQVSVGMGLLAGSTVMLLTVIWG+CV+VGKCDI+N++A+D KDTK  SLTGSGV+TD
Sbjct  142  TAQSQVSVGMGLLAGSTVMLLTVIWGSCVLVGKCDIENSIAIDNKDTKGLSLTGSGVSTD  201

Query  638  VWTSYAAIIMA  670
            +WTSYAA IMA
Sbjct  202  IWTSYAARIMA  212



>ref|XP_009340381.1| PREDICTED: uncharacterized protein LOC103932481 [Pyrus x bretschneideri]
Length=585

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +2

Query  116  LIVDRSSDLVSDGGVHSAGEGSGVLRLG-VLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
             I  +S DL+SDG  H +   +  L L    +  + TC+Q+YGFLPCTTT +GNLFLILV
Sbjct  31   FIPSKSPDLISDGVHHRSHSFAPYLALNNSFSAADSTCDQTYGFLPCTTTVIGNLFLILV  90

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLM+LAATYLS GSELLLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+   AQSQ
Sbjct  91   YGYLMYLAATYLSHGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTTETAQSQ  150

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVML++VIWG+CV VGKCDI+ +VA+D +DTK FS+TGSGV+TD+WT+Y
Sbjct  151  VSVGMGLLAGSTVMLISVIWGSCVFVGKCDIEESVAIDNRDTKGFSITGSGVSTDIWTTY  210

Query  653  AAIIM  667
            AA+IM
Sbjct  211  AAMIM  215



>ref|XP_009348414.1| PREDICTED: uncharacterized protein LOC103940068 [Pyrus x bretschneideri]
 ref|XP_009348417.1| PREDICTED: uncharacterized protein LOC103940071 [Pyrus x bretschneideri]
Length=549

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            ++SDG  H     +    L     L+ E+ TCEQ+YGFLPCTTT +GNLFLILVYGYLM+
Sbjct  1    MISDGAHHHHRSHTFAPYLTLKNALSAEDSTCEQTYGFLPCTTTVIGNLFLILVYGYLMY  60

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
            LAATYLS+GSELLLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+   AQSQVSVGMG
Sbjct  61   LAATYLSNGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMG  120

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            LLAGSTVMLLTVIWG+CV+VGKCDIQ +VA+D KDTK  SLTGSGV+TD+WTSYAA IM
Sbjct  121  LLAGSTVMLLTVIWGSCVIVGKCDIQGSVAMDNKDTKRLSLTGSGVSTDIWTSYAATIM  179



>ref|XP_004294082.1| PREDICTED: uncharacterized protein LOC101313777 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 153/180 (85%), Gaps = 3/180 (2%)
 Frame = +2

Query  137  DLVSDGGVHSAGEGSGVLRLGV--LAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            DL+SDG VH +G  S  L L    L   E TC+++YGFLPCTTT LGNLFLILVYG LM+
Sbjct  32   DLLSDG-VHRSGTSSSFLTLHRPSLLKAESTCDETYGFLPCTTTVLGNLFLILVYGALMY  90

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
             AATYLS GSELLLEILGPG+IGGLFLPILGALPDAMLILVSGLSGS   AQ QVSVGMG
Sbjct  91   TAATYLSHGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGSTETAQDQVSVGMG  150

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            LLAGSTVML+TV+WG+CV++GKCDI+N +A D KDTK FSLTGSGV+TD+WTSY+AIIMA
Sbjct  151  LLAGSTVMLITVVWGSCVIIGKCDIENGIARDNKDTKGFSLTGSGVSTDIWTSYSAIIMA  210



>ref|XP_002282948.1| PREDICTED: uncharacterized protein LOC100252144 [Vitis vinifera]
Length=579

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 161/189 (85%), Gaps = 5/189 (3%)
 Frame = +2

Query  113  RLIVDR--SSDLVSDGGVHSAGEGSGVLRLGVLAP--EEETCEQSYGFLPCTTTALGNLF  280
            R+I +R  S+DLVSD   H    GS  L L   +     ++C+Q+YGF+PCTTT +GNLF
Sbjct  24   RVISNRTLSTDLVSDD-FHDHRNGSPYLLLRSFSAVSASDSCDQTYGFMPCTTTIVGNLF  82

Query  281  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  460
            LI+VYGYLMFLAATYLSSGSELLLEILGPGL+GGL +PILGALPDA+LILVSGLSGS   
Sbjct  83   LIVVYGYLMFLAATYLSSGSELLLEILGPGLVGGLIVPILGALPDAILILVSGLSGSTET  142

Query  461  AQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDV  640
            AQSQVSVGMGLLAGSTV+LLT++WG+CV+VGKCD+Q++VA DL+DTK FSLTGSGV+TD+
Sbjct  143  AQSQVSVGMGLLAGSTVILLTIMWGSCVIVGKCDLQDSVAKDLQDTKGFSLTGSGVSTDI  202

Query  641  WTSYAAIIM  667
            WTSYAAIIM
Sbjct  203  WTSYAAIIM  211



>ref|XP_011000241.1| PREDICTED: uncharacterized protein LOC105107868 [Populus euphratica]
Length=589

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 154/186 (83%), Gaps = 7/186 (4%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGE----GSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYG  298
             SD +SDG VH+        S    L + +  EETCEQ+YGFLPCTTT +GNLFLILVYG
Sbjct  35   PSDPISDG-VHNNQSLNQTTSSPFHLALKSSAEETCEQTYGFLPCTTTVIGNLFLILVYG  93

Query  299  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  478
            YLMFLAATYLSSGSELLL+ILGPG+IGGLFLP+LGALPDA+LILVSGLSGS   AQSQVS
Sbjct  94   YLMFLAATYLSSGSELLLQILGPGIIGGLFLPVLGALPDALLILVSGLSGSTETAQSQVS  153

Query  479  VGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNA--VAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VGMGLLAGSTVMLLTVIWG+CVVVGKCD++     A+D KDTK FSLTGSGVTTD+WT Y
Sbjct  154  VGMGLLAGSTVMLLTVIWGSCVVVGKCDMRETENSAIDRKDTKRFSLTGSGVTTDIWTCY  213

Query  653  AAIIMA  670
            AA IMA
Sbjct  214  AARIMA  219



>ref|XP_007021649.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
 gb|EOY13174.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
Length=452

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I  R S  DLVSDG   S  +    L L  LA  EE+CEQ+YGFLPCTTTALGNLFLI
Sbjct  24   RFITGRPSPTDLVSDG--ISTVKNPPYLLLKPLASAEESCEQTYGFLPCTTTALGNLFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYG LMFLAATYLS+GSELLL+ILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGCLMFLAATYLSNGSELLLQILGPGIVGGLFLPILGALPDAMLILVSGLSGTTETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            SQVSVGMGLLAGSTVMLLTVIWG+CVVVG+CD++++VAVD   TK FSLT +GV+TD+WT
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDLRDSVAVDGTITKGFSLTETGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAARIMA  209



>ref|XP_004489056.1| PREDICTED: uncharacterized protein LOC101505490 [Cicer arietinum]
Length=583

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 155/179 (87%), Gaps = 10/179 (6%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            + DLVSDG        S VLRL     +E TCE++YGFLPCTTT LGNLFLILVYG+LM+
Sbjct  45   TPDLVSDGW-------SNVLRLPT---DESTCEETYGFLPCTTTILGNLFLILVYGFLMY  94

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
             AAT+LS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS   AQSQVSVGMG
Sbjct  95   TAATFLSNGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGSTETAQSQVSVGMG  154

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            LLAGSTV+LLT+IWGTCV+VGKCDI++++A+D +DT+ FSLTGSGV+TD+WTSYAA IM
Sbjct  155  LLAGSTVLLLTIIWGTCVIVGKCDIEDSIAIDSQDTRGFSLTGSGVSTDIWTSYAARIM  213



>ref|XP_010519243.1| PREDICTED: uncharacterized protein LOC104798750 [Tarenaya hassleriana]
Length=587

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 159/193 (82%), Gaps = 8/193 (4%)
 Frame = +2

Query  113  RLIVDRSSD--LVSDGGVH--SAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALG  271
            R +  R S   L+SDG VH  S  EGS +  +   AP   EEE CEQ+YGF+PCT TALG
Sbjct  24   RFVAVRPSSTGLISDG-VHDGSGDEGSVIETVVSAAPAEVEEEVCEQTYGFMPCTKTALG  82

Query  272  NLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGS  451
            N+FLILVYGYLMF AA YLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+
Sbjct  83   NVFLILVYGYLMFTAAKYLSNGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGT  142

Query  452  VAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVT  631
               AQSQVSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++++AV+ +DTK F LTGSGVT
Sbjct  143  PETAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNGQDTKGFHLTGSGVT  202

Query  632  TDVWTSYAAIIMA  670
             D+WTSYAA IMA
Sbjct  203  VDIWTSYAARIMA  215



>ref|XP_007149412.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
 gb|ESW21406.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
Length=576

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            S D +SDG  +++ EG  +LRL      E +CEQ+YGFLPCTTT LGNLFLIL+YG+LMF
Sbjct  30   SRDPLSDGVSNNSWEG--LLRLPSAITVESSCEQTYGFLPCTTTVLGNLFLILIYGFLMF  87

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
             AAT+LS GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQSQVSVGMG
Sbjct  88   KAATFLSGGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKETAQSQVSVGMG  147

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            LLAGSTV+LLT+IWGTCV+VGKCDI++++A+D +DT+ FSLTGSGV+TD+WTSY+A IM
Sbjct  148  LLAGSTVLLLTIIWGTCVIVGKCDIEDSIAIDSQDTRGFSLTGSGVSTDIWTSYSARIM  206



>ref|XP_002298903.2| sodium/calcium exchanger family protein [Populus trichocarpa]
 gb|EEE83708.2| sodium/calcium exchanger family protein [Populus trichocarpa]
Length=582

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 156/186 (84%), Gaps = 7/186 (4%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEG---SGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  301
             SDL+SDG +++       S    L + +  EETCEQ+YGFLPCTTT +GNLFLILVYGY
Sbjct  37   PSDLISDGVLNNQSLNQTTSSPFHLALKSSAEETCEQTYGFLPCTTTVIGNLFLILVYGY  96

Query  302  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  481
            LMF AATYLSSGSELLL+ILGPG+IGGLFLP+LGALPDA+LILVSGLSGS   AQSQVSV
Sbjct  97   LMFFAATYLSSGSELLLQILGPGIIGGLFLPVLGALPDALLILVSGLSGSTETAQSQVSV  156

Query  482  GMGLLAGSTVMLLTVIWGTCVVVGKCDI---QNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            GMGLLAGSTVMLLTVIWG+CVVVGKCD+   +N+ A+D KDTK FSLTGSGV+TD+WT Y
Sbjct  157  GMGLLAGSTVMLLTVIWGSCVVVGKCDMSETENS-AIDRKDTKRFSLTGSGVSTDIWTCY  215

Query  653  AAIIMA  670
            AA IMA
Sbjct  216  AARIMA  221



>gb|ADN33808.1| sodium/calcium exchanger family protein [Cucumis melo subsp. 
melo]
Length=585

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 153/181 (85%), Gaps = 11/181 (6%)
 Frame = +2

Query  137  DLVSDGGVHSAGEGSGVLRLGVL----APEEETCEQSYGFLPCTTTALGNLFLILVYGYL  304
            DLVSDG V+   E S  L L  L    APEEE+CEQSYGFLPCTTTALGNLFLI+VYGYL
Sbjct  42   DLVSDG-VNELQEPS-YLHLNTLSSFSAPEEESCEQSYGFLPCTTTALGNLFLIIVYGYL  99

Query  305  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  484
            MFLAA YLS+GSELLLEILGPG++GGLFLP LGALPDAMLIL     GS   AQSQVSVG
Sbjct  100  MFLAAKYLSTGSELLLEILGPGIVGGLFLPALGALPDAMLIL-----GSAEVAQSQVSVG  154

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGSTVMLLT+IWGTCV+VGKCD+Q++VA+D +DTK FSLT SGV+TD+WTSYAA I
Sbjct  155  MGLLAGSTVMLLTLIWGTCVIVGKCDLQDSVAIDSQDTKGFSLTESGVSTDIWTSYAARI  214

Query  665  M  667
            M
Sbjct  215  M  215



>ref|XP_007021648.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOY13173.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=578

 Score =   198 bits (504),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I  R S  DLVSDG   S  +    L L  LA  EE+CEQ+YGFLPCTTTALGNLFLI
Sbjct  24   RFITGRPSPTDLVSDG--ISTVKNPPYLLLKPLASAEESCEQTYGFLPCTTTALGNLFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYG LMFLAATYLS+GSELLL+ILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGCLMFLAATYLSNGSELLLQILGPGIVGGLFLPILGALPDAMLILVSGLSGTTETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            SQVSVGMGLLAGSTVMLLTVIWG+CVVVG+CD++++VAVD   TK FSLT +GV+TD+WT
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDLRDSVAVDGTITKGFSLTETGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAARIMA  209



>gb|KJB45757.1| hypothetical protein B456_007G325800 [Gossypium raimondii]
Length=511

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 154/188 (82%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I   SS  DLVSDG   S  +    L L  L   EE+CEQ+YGFLPCTTT LGNLFLI
Sbjct  24   RFITGPSSPTDLVSDGI--STVKNPPFLSLKPLFSAEESCEQTYGFLPCTTTVLGNLFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYGYLMFLAATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMFLAATYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGTAETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
             QVSVGMGLLAGSTVMLLTVIWG+CVVVG+CDI+++VAVD   TK F LT +GV+TD+WT
Sbjct  142  DQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDIRDSVAVDGTITKGFHLTETGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAASIMA  209



>gb|AAF69532.1|AC008007_7 F12M16.12 [Arabidopsis thaliana]
Length=574

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 158/186 (85%), Gaps = 7/186 (4%)
 Frame = +2

Query  131  SSDLVSDG---GVHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLFLILV  292
            S+ L+SDG   G + AG GS V++  V AP   +EE CEQ+YGF+PCT TALGN+FLILV
Sbjct  30   STSLISDGIDGGSNLAGSGS-VIKSVVSAPAEEKEEACEQTYGFMPCTKTALGNVFLILV  88

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQ
Sbjct  89   YGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQ  148

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++++AV+ +DTK F L  SGVT D+WTSY
Sbjct  149  VSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVDIWTSY  208

Query  653  AAIIMA  670
            AA IMA
Sbjct  209  AARIMA  214



>ref|XP_006392816.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
 gb|ESQ30102.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
Length=585

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 156/185 (84%), Gaps = 6/185 (3%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSG-VLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVY  295
            S+ L+SDG +     GSG V++  V AP    +EE CEQ+YGF+PCT TALGN+FLILVY
Sbjct  30   STGLISDG-IDGGNPGSGSVIKTVVSAPPAEEKEEACEQTYGFMPCTKTALGNVFLILVY  88

Query  296  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  475
            G+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQV
Sbjct  89   GFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQV  148

Query  476  SVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYA  655
            SVGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV+ +DTK FSL  SGVT DVWTSYA
Sbjct  149  SVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNNQDTKRFSLKDSGVTVDVWTSYA  208

Query  656  AIIMA  670
            A IMA
Sbjct  209  ARIMA  213



>ref|NP_564623.2| Na+/Ca 2+ exchanger-like protein [Arabidopsis thaliana]
 gb|AAM20402.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32908.1| sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Arabidopsis thaliana]
Length=585

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 158/186 (85%), Gaps = 7/186 (4%)
 Frame = +2

Query  131  SSDLVSDG---GVHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLFLILV  292
            S+ L+SDG   G + AG GS V++  V AP   +EE CEQ+YGF+PCT TALGN+FLILV
Sbjct  30   STSLISDGIDGGSNLAGSGS-VIKSVVSAPAEEKEEACEQTYGFMPCTKTALGNVFLILV  88

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQ
Sbjct  89   YGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQ  148

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++++AV+ +DTK F L  SGVT D+WTSY
Sbjct  149  VSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVDIWTSY  208

Query  653  AAIIMA  670
            AA IMA
Sbjct  209  AARIMA  214



>emb|CDY55841.1| BnaCnng29300D [Brassica napus]
Length=585

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVYG  298
            S+DL+SDG    + +   ++R  V AP    +EE CEQ+YGF+PCT TALGN+FLILVYG
Sbjct  30   SADLISDGISGGSLDSGTIIRTVVSAPPAEEKEEACEQTYGFMPCTKTALGNVFLILVYG  89

Query  299  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  478
            +LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQVS
Sbjct  90   FLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQVS  149

Query  479  VGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAA  658
            VGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV+ +DTK F L  SGVT DVWTSYAA
Sbjct  150  VGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDDIAVNNQDTKGFHLKDSGVTVDVWTSYAA  209

Query  659  IIMA  670
             IMA
Sbjct  210  RIMA  213



>ref|XP_008367781.1| PREDICTED: uncharacterized protein LOC103431400 [Malus domestica]
Length=609

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 154/181 (85%), Gaps = 7/181 (4%)
 Frame = +2

Query  143  VSDGGVHSAGEGSGVL-----RLGVLAPEEE-TCEQSYGFLPCTTTALGNLFLILVYGYL  304
            VSDG VH     S V      R G +A E E  CE++YGFLPCT + LGNLFLILVYGYL
Sbjct  67   VSDG-VHRRSNNSTVPYLTLNRPGDIATEAEGECEETYGFLPCTDSVLGNLFLILVYGYL  125

Query  305  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  484
            M+LAATYLS+GSELLLEILGPG++GGLFLP+LG+LPDA+LILVSGLSGS   AQSQVSVG
Sbjct  126  MYLAATYLSNGSELLLEILGPGIVGGLFLPVLGSLPDAILILVSGLSGSKETAQSQVSVG  185

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGSTV++LT+IWG+CVVVGKCDI+N+VA+D KDTK FSLTGSGV+TD+WTSYAA I
Sbjct  186  MGLLAGSTVLILTLIWGSCVVVGKCDIRNSVAIDNKDTKGFSLTGSGVSTDIWTSYAARI  245

Query  665  M  667
            M
Sbjct  246  M  246



>ref|XP_003543222.1| PREDICTED: uncharacterized protein LOC100809896 [Glycine max]
 gb|KHN36868.1| hypothetical protein glysoja_001599 [Glycine soja]
Length=579

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = +2

Query  137  DLVSDGGVHSAG-EGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFL  313
            D VSDG   ++G +   +LRL      E  CEQ+YGFLPCTTT LGNLFLI+VYG+LMF 
Sbjct  32   DPVSDGFAAASGSKWQSILRLPTALTGESVCEQTYGFLPCTTTVLGNLFLIIVYGFLMFK  91

Query  314  AATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGL  493
            AAT+LS GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQSQVSVGMGL
Sbjct  92   AATFLSGGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKEVAQSQVSVGMGL  151

Query  494  LAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            LAGST +LLT+IWGTCV+VGKCDI+ ++A+D +DT+ FSLTGSGV+TD+WTSYAA IM
Sbjct  152  LAGSTTLLLTIIWGTCVIVGKCDIEGSIAIDSRDTRGFSLTGSGVSTDIWTSYAARIM  209



>gb|KJB45756.1| hypothetical protein B456_007G325800 [Gossypium raimondii]
Length=578

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 154/188 (82%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I   SS  DLVSDG   S  +    L L  L   EE+CEQ+YGFLPCTTT LGNLFLI
Sbjct  24   RFITGPSSPTDLVSDG--ISTVKNPPFLSLKPLFSAEESCEQTYGFLPCTTTVLGNLFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYGYLMFLAATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMFLAATYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGTAETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
             QVSVGMGLLAGSTVMLLTVIWG+CVVVG+CDI+++VAVD   TK F LT +GV+TD+WT
Sbjct  142  DQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDIRDSVAVDGTITKGFHLTETGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAASIMA  209



>emb|CDY25725.1| BnaC03g69500D [Brassica napus]
Length=581

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            S+DL+SDG        S  +   V++ EEE CEQ+YGF+PCT TALGN+FLILVYG+LMF
Sbjct  30   STDLISDGVNGEPLINSRSIIKTVVSAEEEACEQTYGFMPCTKTALGNVFLILVYGFLMF  89

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
             AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ+QVSVGMG
Sbjct  90   TAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQTQVSVGMG  149

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            LLAGSTVMLLTVIWGTC VVGKCD+++++AV+ +DTK F L  SGVT DVWTSYAA IMA
Sbjct  150  LLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVDVWTSYAARIMA  209



>ref|XP_010535054.1| PREDICTED: uncharacterized protein LOC104810447 [Tarenaya hassleriana]
Length=573

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 154/189 (81%), Gaps = 11/189 (6%)
 Frame = +2

Query  113  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAP-EEETCEQSYGFLPCTTTALGNLFL  283
            R I  R S   LV DGG         ++   V AP EEE CEQ+YGF+PCT TALGN+FL
Sbjct  20   RFITARPSSTGLVYDGG--------SIIETVVSAPAEEEACEQTYGFMPCTKTALGNVFL  71

Query  284  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  463
            I+VYG+LMF AA YLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   A
Sbjct  72   IIVYGFLMFTAAKYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGTPETA  131

Query  464  QSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVW  643
            QSQVSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++++AV+ +DTK F LTGSGVT D+W
Sbjct  132  QSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNGQDTKGFHLTGSGVTVDIW  191

Query  644  TSYAAIIMA  670
            TSYAA IMA
Sbjct  192  TSYAARIMA  200



>ref|XP_009144785.1| PREDICTED: uncharacterized protein LOC103868446 [Brassica rapa]
Length=585

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVYG  298
            S+DL+SDG    + +   V++  V AP    +EE CEQ+YGF+PCT TALGN+FLILVYG
Sbjct  30   SADLISDGISGGSLDSGSVIKTVVSAPPAEEKEEACEQTYGFMPCTKTALGNVFLILVYG  89

Query  299  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  478
            +LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQVS
Sbjct  90   FLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQVS  149

Query  479  VGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAA  658
            VGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +A++ +DTK F L  SGVT DVWTSYAA
Sbjct  150  VGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIALNNQDTKGFHLKDSGVTVDVWTSYAA  209

Query  659  IIMA  670
             IMA
Sbjct  210  RIMA  213



>ref|XP_002891737.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67996.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 155/186 (83%), Gaps = 6/186 (3%)
 Frame = +2

Query  131  SSDLVSDG---GVHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLFLILV  292
            S+ L+SDG   G +  G    V++  V AP   +EE CEQ+YGF+PCT TALGN+FLILV
Sbjct  30   STSLISDGIDGGSNLDGGSGSVIKTVVSAPAEEKEEACEQTYGFMPCTKTALGNVFLILV  89

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQ
Sbjct  90   YGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQ  149

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++++AV+ +DTK F L  SGVT D+WTSY
Sbjct  150  VSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVDIWTSY  209

Query  653  AAIIMA  670
            AA IMA
Sbjct  210  AARIMA  215



>emb|CDY25869.1| BnaA05g14600D [Brassica napus]
Length=585

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVYG  298
            S+DL+SDG    + +   +++  V AP    +EE CEQ+YGF+PCT TALGN+FLILVYG
Sbjct  30   SADLISDGISGGSLDSGSIIKTVVSAPPAEEKEEACEQTYGFMPCTKTALGNVFLILVYG  89

Query  299  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  478
            +LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQVS
Sbjct  90   FLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQVS  149

Query  479  VGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAA  658
            VGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +A++ +DTK F L  SGVT DVWTSYAA
Sbjct  150  VGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIALNNQDTKGFHLKDSGVTVDVWTSYAA  209

Query  659  IIMA  670
             IMA
Sbjct  210  RIMA  213



>gb|KHG29939.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 153/188 (81%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I   SS  DL SDG   S  +    L L  L   EE+CEQ+YGFLPCTTT LGNLFLI
Sbjct  24   RFITGPSSPTDLFSDG--ISTVKNPPFLSLKPLFSAEESCEQTYGFLPCTTTVLGNLFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYGYLMFLAATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMFLAATYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGTAETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
             QVSVGMGLLAGSTVMLLTVIWG+CVVVG+CDI+++VAVD   TK F LT +GV+TD+WT
Sbjct  142  DQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDIRDSVAVDGTITKGFHLTETGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAASIMA  209



>ref|XP_008226455.1| PREDICTED: uncharacterized protein LOC103326029 [Prunus mume]
Length=592

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 6/182 (3%)
 Frame = +2

Query  140  LVSDG---GVHSAGEGSGVLRL--GVLAPEEE-TCEQSYGFLPCTTTALGNLFLILVYGY  301
            ++SDG   G H++      L+L  G L+ E +  CE++YGFLPCT + LGNLFLILVYGY
Sbjct  42   VISDGVHVGPHNSTAPHLALKLLNGSLSAEADGACEETYGFLPCTRSVLGNLFLILVYGY  101

Query  302  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  481
            LM+LAATYLS+GSELLLEILGPG++GGLFLPILG+LPDA+LILVSGLSGS   AQSQVSV
Sbjct  102  LMYLAATYLSNGSELLLEILGPGIVGGLFLPILGSLPDAILILVSGLSGSTETAQSQVSV  161

Query  482  GMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAI  661
            GMGLLAGSTV++LT+IWG+CVVVGKCDIQN+VA+D +DTK FSLTGSGV+TD+WTSYAA 
Sbjct  162  GMGLLAGSTVLILTLIWGSCVVVGKCDIQNSVAIDNEDTKGFSLTGSGVSTDIWTSYAAR  221

Query  662  IM  667
            IM
Sbjct  222  IM  223



>gb|KJB13244.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=396

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I  R S   LVSDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTGLVSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            SQVSVGMGLLAGSTVMLLTVIWG+C++VG+CD+ ++VA+D  +TK F+L  SGV+TD+WT
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAARIMA  209



>ref|XP_010279178.1| PREDICTED: uncharacterized protein LOC104613162 [Nelumbo nucifera]
Length=577

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 156/186 (84%), Gaps = 3/186 (2%)
 Frame = +2

Query  113  RLIVDRS-SDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  289
            R I + S SDLVSDG +++A   S +L +  L    E+CE +YGFLPCTTT +GNLFLI+
Sbjct  26   RFITESSHSDLVSDG-INNAQTKSPLLLIKRLR-ASESCENTYGFLPCTTTVVGNLFLII  83

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
            VYGYLMFLAA+YLS GSELLL ILGPGLIGGLFLPILGALPDAMLILVSGLSGS   AQS
Sbjct  84   VYGYLMFLAASYLSDGSELLLAILGPGLIGGLFLPILGALPDAMLILVSGLSGSKETAQS  143

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTS  649
            QV VGMGLLAGSTVMLLT++WG+CVVVGKCDI+ ++AVD +DTK  SL GSG++TD+WTS
Sbjct  144  QVLVGMGLLAGSTVMLLTLLWGSCVVVGKCDIEESIAVDSQDTKRLSLVGSGISTDIWTS  203

Query  650  YAAIIM  667
            YAA IM
Sbjct  204  YAARIM  209



>ref|XP_008386231.1| PREDICTED: uncharacterized protein LOC103448741 [Malus domestica]
Length=584

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = +2

Query  116  LIVDRSSDLVSDGGVHSAGEGSGVLRLG-VLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
             I   S  L+SDG  H +   +  L L    +  + TC+Q+YGFLPCTTT +GNLFLILV
Sbjct  30   FIHSTSPGLISDGVHHRSHSFAPYLALNNSFSAADSTCDQTYGFLPCTTTVIGNLFLILV  89

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLM+ AATYLS+GSELLLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+   AQSQ
Sbjct  90   YGYLMYSAATYLSNGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTTETAQSQ  149

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVML++VIWG+CV VGKCDI+ +VA+D +DTK FS+TGSGV+TD+WT+Y
Sbjct  150  VSVGMGLLAGSTVMLISVIWGSCVFVGKCDIEGSVAIDNRDTKGFSITGSGVSTDIWTTY  209

Query  653  AAIIM  667
            AA+IM
Sbjct  210  AAMIM  214



>ref|XP_012074212.1| PREDICTED: uncharacterized protein LOC105635736 isoform X1 [Jatropha 
curcas]
 ref|XP_012074213.1| PREDICTED: uncharacterized protein LOC105635736 isoform X2 [Jatropha 
curcas]
 gb|KDP36271.1| hypothetical protein JCGZ_09836 [Jatropha curcas]
Length=585

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 154/184 (84%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            SSDL+SDG   + G  S  + L  L+ + E+CEQ+YGFLPCTTTA GNLFLI+VYGYLM+
Sbjct  28   SSDLISDGVHDNNGVTSPYIFLNPLSFKAESCEQTYGFLPCTTTAFGNLFLIIVYGYLMY  87

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
            L+ATYLS+GSELLL ILGPG++GGLFLP+LGALPDAMLILVSG+SGS   AQSQVSVGMG
Sbjct  88   LSATYLSAGSELLLAILGPGIVGGLFLPMLGALPDAMLILVSGISGSKETAQSQVSVGMG  147

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDIQNA----VAVDLKDTKAFSLTGSGVTTDVWTSYAA  658
            LLAGSTVML+TVIWG+CV+VGKCDI+ +    V +  ++TK FSL GSGV+TD+WT YAA
Sbjct  148  LLAGSTVMLITVIWGSCVIVGKCDIRESEIGPVTISGQNTKGFSLIGSGVSTDIWTCYAA  207

Query  659  IIMA  670
             IMA
Sbjct  208  RIMA  211



>ref|XP_010675392.1| PREDICTED: uncharacterized protein LOC104891403 [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 149/186 (80%), Gaps = 3/186 (2%)
 Frame = +2

Query  122  VDRSSDLVSDGGVHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLFLILV  292
            +  + DL+SD        G   LRL  +       E CEQSYGFLPCTTT LGN+FLILV
Sbjct  21   ISAARDLISDENNEVGVVGHSYLRLPTMKSVFSSSEICEQSYGFLPCTTTVLGNMFLILV  80

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLM+ AATYLS GSELLLEILGPG+IGGLFLPILGALPDAMLI+VSGLSGS A AQ Q
Sbjct  81   YGYLMYTAATYLSYGSELLLEILGPGIIGGLFLPILGALPDAMLIMVSGLSGSPAVAQQQ  140

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            V VGMGLLAGSTVML+TVIWGTCV+VGKCDI+ ++AVD +DTK F+L  SGV+TD+WTSY
Sbjct  141  VFVGMGLLAGSTVMLITVIWGTCVLVGKCDIEGSLAVDERDTKGFNLRDSGVSTDIWTSY  200

Query  653  AAIIMA  670
            AA IMA
Sbjct  201  AARIMA  206



>gb|KFK35737.1| hypothetical protein AALP_AA4G030000 [Arabis alpina]
Length=533

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  200  VLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpglig  379
            V+  +EE CEQ+YGF+PCT TALGN+FLILVYG+LMF AATYLS+GSELLLEILGPG++G
Sbjct  5    VVPEKEEACEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVG  64

Query  380  glflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKC  559
            GLFLP+LGALPDAMLI+VSGLSG  +EAQSQVSVGMGLLAGSTVMLLTVIWGTC VVGKC
Sbjct  65   GLFLPMLGALPDAMLIMVSGLSGDASEAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKC  124

Query  560  DIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            D+++++AV+ +DTK F L  SGVT DVWTSYAA IMA
Sbjct  125  DLRDSIAVNNQDTKGFHLKDSGVTVDVWTSYAARIMA  161



>gb|KJB13247.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=506

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I  R S   LVSDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTGLVSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            SQVSVGMGLLAGSTVMLLTVIWG+C++VG+CD+ ++VA+D  +TK F+L  SGV+TD+WT
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAARIMA  209



>emb|CDY24108.1| BnaA06g01060D [Brassica napus]
Length=648

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 155/188 (82%), Gaps = 3/188 (2%)
 Frame = +2

Query  113  RLIVDR--SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            RL+  R  S+DL+   G++ A  GS +  L     +EE CEQ+YGF+PCT TALGN+FLI
Sbjct  90   RLVAVRPSSTDLIISDGINGAS-GSVIKTLVSAEEKEEACEQTYGFMPCTKTALGNVFLI  148

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            LVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ
Sbjct  149  LVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQ  208

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            +QVSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV+ +DTK F L  SGVT DVWT
Sbjct  209  TQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIAVNNQDTKGFHLKDSGVTVDVWT  268

Query  647  SYAAIIMA  670
            SYAA IMA
Sbjct  269  SYAARIMA  276



>gb|KJB13245.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=505

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I  R S   LVSDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTGLVSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            SQVSVGMGLLAGSTVMLLTVIWG+C++VG+CD+ ++VA+D  +TK F+L  SGV+TD+WT
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAARIMA  209



>gb|KHG25681.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 153/188 (81%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I  R S  DL+SDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTDLLSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            SQVSVGMGLLAGSTVMLLTVIWG+C++VG+CD+ ++VA+D  +TK F+L  SGV+TD+WT
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAARIMA  209



>ref|XP_009106991.1| PREDICTED: uncharacterized protein LOC103832685 [Brassica rapa]
 emb|CDY02520.1| BnaA08g01270D [Brassica napus]
Length=583

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 8/185 (4%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGE----GSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLFLILVY  295
            S+DL+SDG     GE       +++  V A E EE CEQ+YGF+PCT TALGN+FLILVY
Sbjct  30   STDLISDG---VNGEPLINSRSIIKTVVSAEEKEEACEQTYGFMPCTKTALGNVFLILVY  86

Query  296  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  475
            G+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ+QV
Sbjct  87   GFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQTQV  146

Query  476  SVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYA  655
            SVGMGLLAGSTVMLLTVIWGTC VVGKCD+++++AV+ +DTK F L  SGVT DVWTSYA
Sbjct  147  SVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVDVWTSYA  206

Query  656  AIIMA  670
            A IMA
Sbjct  207  ARIMA  211



>ref|XP_002279120.1| PREDICTED: uncharacterized protein LOC100253888 [Vitis vinifera]
 emb|CBI21944.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            ++C+Q+YGFLPCTTT LGN+FLILVYGYLMF+AA +LS GSE+LL ILGPG+IGGLFLP+
Sbjct  58   DSCDQTYGFLPCTTTVLGNIFLILVYGYLMFIAAKFLSDGSEILLGILGPGIIGGLFLPV  117

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAV  577
            L A PDA++IL SGLSGS   AQSQVS+GMGLLAGSTVMLLT++WG+C++VGKCDI+N+V
Sbjct  118  LSAFPDAVIILASGLSGSKETAQSQVSIGMGLLAGSTVMLLTILWGSCIIVGKCDIENSV  177

Query  578  AVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            A DLKDT+ FSLTGSGV+TD+W SYAA IM
Sbjct  178  ATDLKDTRGFSLTGSGVSTDIWASYAARIM  207



>gb|KJB13246.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=578

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = +2

Query  113  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I  R S   LVSDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTGLVSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            SQVSVGMGLLAGSTVMLLTVIWG+C++VG+CD+ ++VA+D  +TK F+L  SGV+TD+WT
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTDIWT  201

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  202  CYAARIMA  209



>emb|CDY26003.1| BnaC06g06210D [Brassica napus]
Length=571

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 150/182 (82%), Gaps = 14/182 (8%)
 Frame = +2

Query  131  SSDLVSDG--GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYL  304
            S++L+SDG   V SA E            +EE CEQ+YGF+PCT TALGN+FLILVYG+L
Sbjct  30   STNLISDGINTVVSAEE------------KEEACEQTYGFMPCTKTALGNVFLILVYGFL  77

Query  305  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  484
            MF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ+QVSVG
Sbjct  78   MFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQTQVSVG  137

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV+ +DTK F L  SGVT DVWTSYAA I
Sbjct  138  MGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIAVNNRDTKGFHLKDSGVTVDVWTSYAARI  197

Query  665  MA  670
            MA
Sbjct  198  MA  199



>ref|XP_009147618.1| PREDICTED: uncharacterized protein LOC103871140 [Brassica rapa]
Length=576

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 153/188 (81%), Gaps = 7/188 (4%)
 Frame = +2

Query  113  RLIVDR--SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            RL+  R  S+DL+   G++      G L L     +EE CEQ+YGF+PCT TALGN+FLI
Sbjct  22   RLVSVRPSSTDLIISDGING-----GNLALVSAEEKEEACEQTYGFMPCTKTALGNVFLI  76

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            LVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ
Sbjct  77   LVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQ  136

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            +QVSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV+ +DTK F L  SGVT DVWT
Sbjct  137  TQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIAVNNQDTKGFHLKDSGVTVDVWT  196

Query  647  SYAAIIMA  670
            SYAA IMA
Sbjct  197  SYAARIMA  204



>ref|XP_004294083.1| PREDICTED: uncharacterized protein LOC101314065 [Fragaria vesca 
subsp. vesca]
Length=578

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 152/181 (84%), Gaps = 1/181 (1%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSG-VLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            S++LVSDG      E S  +L L  L   E TCE++YGF+PCTTT LGNLFL+LVYGYLM
Sbjct  33   STELVSDGISKPNYETSSYLLSLKPLTSAELTCEETYGFMPCTTTVLGNLFLMLVYGYLM  92

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
            + AA +LSSGSE+LLEILGPG++GGLFLP+L +LPDAMLILVSGLSGS   AQSQVSVG+
Sbjct  93   YSAAKWLSSGSEILLEILGPGIVGGLFLPVLTSLPDAMLILVSGLSGSTETAQSQVSVGI  152

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GLLAGSTV++L++IWG+CVVVGKCDI+++ A D KDTK F+ TGSGV+TD+WTSY+A IM
Sbjct  153  GLLAGSTVLVLSLIWGSCVVVGKCDIEDSTAKDNKDTKGFNFTGSGVSTDIWTSYSARIM  212

Query  668  A  670
            A
Sbjct  213  A  213



>gb|KDO45772.1| hypothetical protein CISIN_1g0423002mg, partial [Citrus sinensis]
Length=372

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I + S+ ++SDG        S  L    L    + CEQ+YGFLPCTT+ LGN+FLI V
Sbjct  26   RPITNLSTVVISDGTHDVREPASTQLNNKYLISPSDMCEQTYGFLPCTTSLLGNVFLIAV  85

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLM LAA  LS+GSE+LL+I+GPG+IGGLFLP+L ++PDA +IL SGLSGS   AQ+Q
Sbjct  86   YGYLMLLAAKLLSNGSEILLQIIGPGIIGGLFLPVLSSVPDAAIILASGLSGSKETAQNQ  145

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VSVGMGLLAGSTVMLLTV+WG+C++VGKCDI+   AVDLKDTK FSLTGSGV+TDVWT Y
Sbjct  146  VSVGMGLLAGSTVMLLTVLWGSCLLVGKCDIEGTTAVDLKDTKRFSLTGSGVSTDVWTCY  205

Query  653  AAIIM  667
            AA IM
Sbjct  206  AARIM  210



>ref|XP_009348415.1| PREDICTED: uncharacterized protein LOC103940069 [Pyrus x bretschneideri]
 ref|XP_009348416.1| PREDICTED: uncharacterized protein LOC103940070 [Pyrus x bretschneideri]
Length=580

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 153/182 (84%), Gaps = 7/182 (4%)
 Frame = +2

Query  143  VSDGGVHSAGEGSGVLRLGVLAPEE------ETCEQSYGFLPCTTTALGNLFLILVYGYL  304
            VSDG VH     S V  L +  P +        CE++YGFLPCT + LGNLFLILVYGYL
Sbjct  38   VSDG-VHRRSNNSTVPYLTLNRPGDIAAEAEGECEETYGFLPCTDSVLGNLFLILVYGYL  96

Query  305  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  484
            M+LAATYLS+GSELLLEILGPG++GGLFLP+LG+LPDA+LILVSGLSGS   AQSQVSVG
Sbjct  97   MYLAATYLSNGSELLLEILGPGIVGGLFLPVLGSLPDAILILVSGLSGSKETAQSQVSVG  156

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGSTV++LT+IWG+CVVVGKCDIQN+VA+D KDTK FSLTGSGV+TD+WTSYAA I
Sbjct  157  MGLLAGSTVLILTLIWGSCVVVGKCDIQNSVAIDNKDTKGFSLTGSGVSTDIWTSYAARI  216

Query  665  MA  670
            MA
Sbjct  217  MA  218



>gb|ACY66868.1| P20Sh148J07 [Saccharum hybrid cultivar R570]
Length=563

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  319
            L+SDG    +     V+RL    P EE CEQSYGFLPCTTT LGNLFL+L YG+ M+ AA
Sbjct  29   LISDGA--PSAPLVSVIRLSGSPPAEEKCEQSYGFLPCTTTVLGNLFLVLTYGFFMYKAA  86

Query  320  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  499
            TYLS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS  EAQSQV +GMGLLA
Sbjct  87   TYLSTGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKEEAQSQVLIGMGLLA  146

Query  500  GSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GSTV LLT++WGTCVVVGKCD+     AVDL DTK FSLTG+G+TTDV TSYAA IM
Sbjct  147  GSTVFLLTLLWGTCVVVGKCDLGPTREAVDLTDTKGFSLTGTGITTDVQTSYAARIM  203



>ref|XP_007021639.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
 gb|EOY13164.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
Length=707

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 151/188 (80%), Gaps = 3/188 (2%)
 Frame = +2

Query  113  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R I  R S  DLVSDG + +      +L L  LA  E +CEQ+YGFLPC+TTALGNLFLI
Sbjct  24   RFITGRPSPTDLVSDG-ISTVKSPPYLLLLKPLASAEVSCEQTYGFLPCSTTALGNLFLI  82

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            LVYGYLM+LAATYLS+GSE+L  I GPG++GGL LP LGALP+AMLILVSGLSG+   AQ
Sbjct  83   LVYGYLMYLAATYLSNGSEVLHVIRGPGIVGGLSLPPLGALPNAMLILVSGLSGAPETAQ  142

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            SQVSVGMG+LAGST+M LTV+WG+CV VG+CD++++VAVD   TK FSLT +GV+TD+WT
Sbjct  143  SQVSVGMGMLAGSTIMFLTVVWGSCVAVGRCDLRDSVAVDGTITKGFSLTETGVSTDIWT  202

Query  647  SYAAIIMA  670
             YAA IMA
Sbjct  203  CYAARIMA  210



>ref|XP_007213018.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
 gb|EMJ14217.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
Length=575

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  319
            +VSDG +    + + +   G L    ++C+Q+YGFLPCTTT LGN FLI+VYGYLMFL+A
Sbjct  34   MVSDGVLEKTPKPNSIWLPGRLF-SSDSCDQTYGFLPCTTTVLGNTFLIIVYGYLMFLSA  92

Query  320  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  499
              LS+GSE+LL+ILGPG++GG FLP+L ++PDA +IL SGLSG    AQSQVSVGMGLLA
Sbjct  93   KLLSNGSEILLQILGPGIVGGFFLPLLSSIPDATIILASGLSGDTETAQSQVSVGMGLLA  152

Query  500  GSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GS VMLLT++WGTC++VGKCD++N+VAVD KD K FSLTGSGV+TD+WTSYAA IM
Sbjct  153  GSNVMLLTILWGTCLLVGKCDLENSVAVDQKDEKRFSLTGSGVSTDIWTSYAARIM  208



>ref|XP_008229131.1| PREDICTED: uncharacterized protein LOC103328510 [Prunus mume]
Length=575

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  319
            +VSDG +    + + +   G L    ++C+Q+YGFLPCTTT LGN FLI+VYGYLMFL+A
Sbjct  34   MVSDGVLEKTPKPNSIWLPGRLF-SSDSCDQTYGFLPCTTTVLGNTFLIIVYGYLMFLSA  92

Query  320  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  499
              LS+GSE+LL+ILGPG++GG FLP+L ++PDA +IL SGLSG    AQSQVSVGMGLLA
Sbjct  93   KLLSNGSEILLQILGPGIVGGFFLPLLSSIPDATIILASGLSGDTETAQSQVSVGMGLLA  152

Query  500  GSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GS VMLLT++WGTC++VGKCD++N+VAVD KD K FSLTGSGV+TD+WTSYAA IM
Sbjct  153  GSNVMLLTILWGTCLLVGKCDLENSVAVDQKDEKRFSLTGSGVSTDIWTSYAARIM  208



>ref|XP_006451747.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 ref|XP_006494847.1| PREDICTED: uncharacterized protein LOC102612450 [Citrus sinensis]
 gb|ESR64987.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 gb|KDO58493.1| hypothetical protein CISIN_1g048038mg [Citrus sinensis]
Length=591

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 152/190 (80%), Gaps = 10/190 (5%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAP--------EEETCEQSYGFLPCTTTALGNLFLI  286
             SDL+SDG   +        +  +L P           TCEQ+YGFLPCTTT LGNLFLI
Sbjct  33   PSDLISDGINSNNNHNQRGPQYLLLNPFIKAEEESSSSTCEQTYGFLPCTTTVLGNLFLI  92

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VYGYLM++AATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  93   IVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETAQ  152

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ--NAVAVDLKDTKAFSLTGSGVTTDV  640
            SQVSVGMGLLAGSTVML TVIWGTCVVVGKCD++  ++VA+D ++TK F LTG+GV+TDV
Sbjct  153  SQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRLTGTGVSTDV  212

Query  641  WTSYAAIIMA  670
            WT YAA IMA
Sbjct  213  WTCYAARIMA  222



>dbj|BAI94501.1| sodium/calcium exchanger protein [Dianthus caryophyllus]
Length=581

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E CEQ+YGFLPCTTT  GN+FLI VYGYLM+LAAT+LS GSELLLEILGPG++GGLFLP+
Sbjct  64   EECEQTYGFLPCTTTWAGNMFLIGVYGYLMYLAATFLSDGSELLLEILGPGIVGGLFLPV  123

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAV  577
            LGALPDAMLILVSG+SGS +EAQSQVSVGMGLLAGSTVMLLTVIWGTC+++GKCD+    
Sbjct  124  LGALPDAMLILVSGISGSTSEAQSQVSVGMGLLAGSTVMLLTVIWGTCILIGKCDMDGTE  183

Query  578  AVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            A+DL DTK FSL GSGV+TD WTSYAA IM
Sbjct  184  AIDLTDTKGFSLLGSGVSTDTWTSYAARIM  213



>ref|XP_006469050.1| PREDICTED: uncharacterized protein LOC102616350 [Citrus sinensis]
Length=577

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGV-LRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  289
            R I + S+ ++SDG  H   E + + L    L    + CEQ+YGFLPCTT+ LGN+FLI 
Sbjct  26   RPITNLSTAVISDG-THDVRETALIQLNNKYLISPSDMCEQTYGFLPCTTSLLGNVFLIA  84

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
            VYGYLM LAA  LS+GSE+LL+I+GPG+IGGLFLP+L ++PDA +IL SGLSGS   AQ+
Sbjct  85   VYGYLMLLAAKLLSNGSEILLQIIGPGIIGGLFLPVLSSVPDAAIILASGLSGSKETAQN  144

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTS  649
            QVSVGMGLLAGSTVMLLTV+WG+C++VGKCDI+   AVDLKDTK FSLTGSGV+TDVWT 
Sbjct  145  QVSVGMGLLAGSTVMLLTVLWGSCLLVGKCDIEGTTAVDLKDTKRFSLTGSGVSTDVWTC  204

Query  650  YAAIIM  667
            YAA IM
Sbjct  205  YAARIM  210



>ref|XP_010060650.1| PREDICTED: uncharacterized protein LOC104448506 [Eucalyptus grandis]
 gb|KCW67435.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=589

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 144/169 (85%), Gaps = 4/169 (2%)
 Frame = +2

Query  173  EGSGVLRLGVLAPEE----ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgs  340
             GS  L+L   +P +     +CE++YGFLPCT +  GNLFLI+VYG LMFLAATYLS+GS
Sbjct  53   PGSPYLQLLRSSPADAESASSCEETYGFLPCTASWPGNLFLIVVYGSLMFLAATYLSNGS  112

Query  341  ellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLL  520
            ELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS   AQSQVSVGMGLLAGSTVMLL
Sbjct  113  ELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGSTETAQSQVSVGMGLLAGSTVMLL  172

Query  521  TVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            TVIWG+C++VGKCD+ N+VA+D +DTK FSL GSGV+TD+WT YAA IM
Sbjct  173  TVIWGSCIIVGKCDLHNSVAMDKQDTKGFSLKGSGVSTDLWTKYAARIM  221



>ref|XP_004305436.1| PREDICTED: uncharacterized protein LOC101295737 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 150/181 (83%), Gaps = 6/181 (3%)
 Frame = +2

Query  125  DRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYL  304
            D   +LVSDG   S+ +    + L       ++C+++YGFLPCT+T LGN+FLI+VYGY+
Sbjct  32   DSLFNLVSDGVNQSSWDELNYIWLS------DSCDETYGFLPCTSTVLGNIFLIIVYGYV  85

Query  305  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  484
            MFL+A  LS+GSE+LL+ILGPG+IGGLFLP+L A+PDA +IL SGLSG  A AQSQVSVG
Sbjct  86   MFLSAKLLSAGSEILLQILGPGIIGGLFLPLLSAVPDATIILASGLSGDTATAQSQVSVG  145

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGS VMLLT++WGTC++VGKCD++N+VAVD KDTK+FSLTGSGV+TD+WTSYAA I
Sbjct  146  MGLLAGSNVMLLTILWGTCLIVGKCDLENSVAVDEKDTKSFSLTGSGVSTDIWTSYAAGI  205

Query  665  M  667
            M
Sbjct  206  M  206



>ref|XP_002525142.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF37269.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  319
            +VSDG   SA      +RL  L   + +C+++YGF PCTTT LGN+FLILVYGYLMFL+A
Sbjct  1    MVSDGKYSSAQGQQPFIRLYDLFSSDGSCDETYGFFPCTTTILGNIFLILVYGYLMFLSA  60

Query  320  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  499
              LS GSE+LL+ILGPG+IGGLFLP+L ALPD+ +IL SGLSGS   AQSQVSVGMGL+A
Sbjct  61   KLLSDGSEILLQILGPGIIGGLFLPVLSALPDSAIILASGLSGSTETAQSQVSVGMGLMA  120

Query  500  GSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GSTV+LLT++WG+C++VGKCDI+ +VAVD KDTK FSL GSGVTTD+WTS+AA +M
Sbjct  121  GSTVLLLTLLWGSCLIVGKCDIEGSVAVDSKDTKTFSLIGSGVTTDIWTSFAARLM  176



>ref|NP_001151543.1| LOC100285177 precursor [Zea mays]
 gb|ACG43258.1| calcium ion binding protein [Zea mays]
Length=568

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  319
            L+SDGG         V+RL    P E  CEQ+YGFLPCTTT LGNLFL+L YG+LMF AA
Sbjct  30   LISDGG--PPAPLLPVIRLAA-PPAEAECEQTYGFLPCTTTVLGNLFLVLAYGFLMFKAA  86

Query  320  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  499
            T+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS  EAQSQV +GMGLLA
Sbjct  87   TFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKEEAQSQVLIGMGLLA  146

Query  500  GSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GSTV LLT++WGTCVVVGKCD+     AVD+ DTK FSLTG+GVTTDV TSYAA IM
Sbjct  147  GSTVFLLTLLWGTCVVVGKCDLGPGREAVDVTDTKGFSLTGTGVTTDVQTSYAARIM  203



>ref|XP_008655084.1| PREDICTED: LOC100285177 isoform X1 [Zea mays]
Length=596

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  319
            L+SDGG         V+RL    P E  CEQ+YGFLPCTTT LGNLFL+L YG+LMF AA
Sbjct  30   LISDGG--PPAPLLPVIRLAA-PPAEAECEQTYGFLPCTTTVLGNLFLVLAYGFLMFKAA  86

Query  320  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  499
            T+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS  EAQSQV +GMGLLA
Sbjct  87   TFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKEEAQSQVLIGMGLLA  146

Query  500  GSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GSTV LLT++WGTCVVVGKCD+     AVD+ DTK FSLTG+GVTTDV TSYAA IM
Sbjct  147  GSTVFLLTLLWGTCVVVGKCDLGPGREAVDVTDTKGFSLTGTGVTTDVQTSYAARIM  203



>ref|XP_003565462.1| PREDICTED: uncharacterized protein LOC100838274 [Brachypodium 
distachyon]
Length=582

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 148/191 (77%), Gaps = 14/191 (7%)
 Frame = +2

Query  140  LVSDGG----------VHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLF  280
            L+SDG           + S    S V+RL   +P   E E CEQSYGFLPCTTT  GNLF
Sbjct  28   LISDGSPASTASSSILIASPVSSSDVIRLNTSSPAAAEAEQCEQSYGFLPCTTTVFGNLF  87

Query  281  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  460
            L+L YG+LMF AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSG+   
Sbjct  88   LVLTYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGTKET  147

Query  461  AQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTD  637
            AQSQV +GMGLLAGSTV LLT++WGTCVVVGKCD+  N VA+D  DTK FSLTG+G++TD
Sbjct  148  AQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDVGPNNVAIDSTDTKGFSLTGAGISTD  207

Query  638  VWTSYAAIIMA  670
            V TSYAA IMA
Sbjct  208  VQTSYAARIMA  218



>ref|XP_008362437.1| PREDICTED: uncharacterized protein LOC103426126 [Malus domestica]
Length=549

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 147/182 (81%), Gaps = 6/182 (3%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLR------LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  301
            +V+DGG     +   V +      +  L   + +CEQ+YGFLPCT+T LGN+FL+LVYGY
Sbjct  1    MVTDGGNQLLLQNQNVWKPFFSGLMDSLFSSDSSCEQTYGFLPCTSTVLGNIFLVLVYGY  60

Query  302  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  481
            +MFL+A  LS+GSE+LL+ILGPG++GGLFLP+LG+LPDA +IL SGLSG    AQSQVSV
Sbjct  61   MMFLSAKLLSNGSEILLQILGPGIVGGLFLPLLGSLPDATIILASGLSGDTETAQSQVSV  120

Query  482  GMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAI  661
            GMGL+AGS VMLLT++WGTC++VGKCDI+N++AVD KD K FSLTGSGV+TD+WTSY+A 
Sbjct  121  GMGLMAGSNVMLLTILWGTCLIVGKCDIENSIAVDQKDEKRFSLTGSGVSTDIWTSYSAR  180

Query  662  IM  667
            IM
Sbjct  181  IM  182



>ref|XP_009354324.1| PREDICTED: uncharacterized protein LOC103945475 [Pyrus x bretschneideri]
Length=585

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 147/182 (81%), Gaps = 6/182 (3%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLR------LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  301
            +V+DGG     +   V +      +  L   + +CEQ+YGFLPCT+T LGN+FL+LVYGY
Sbjct  37   MVTDGGNQLLLQNQNVWKPFFSGLMDSLFSSDSSCEQTYGFLPCTSTVLGNIFLVLVYGY  96

Query  302  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  481
            LMFL+A  LS+GSE+LL+ILGPG++GGLFLP+LG+LPDA +IL SGLSG    AQSQVSV
Sbjct  97   LMFLSAKLLSNGSEILLQILGPGIVGGLFLPLLGSLPDATIILASGLSGDTETAQSQVSV  156

Query  482  GMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAI  661
            GMGL+AGS VMLLT++WGTC++VGKCDI+N++AVD KD K FSLTGSGV+TD+WTSY+A 
Sbjct  157  GMGLMAGSNVMLLTILWGTCLIVGKCDIENSIAVDQKDEKLFSLTGSGVSTDIWTSYSAR  216

Query  662  IM  667
            IM
Sbjct  217  IM  218



>emb|CDM82192.1| unnamed protein product [Triticum aestivum]
Length=579

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 149/188 (79%), Gaps = 11/188 (6%)
 Frame = +2

Query  140  LVSDG-------GVHSAGEGSGVLRLGVLAPE---EETCEQSYGFLPCTTTALGNLFLIL  289
            L+SDG        V ++   S VLRL   +P     E CEQ+YGFLPCTTT  GN+FL+L
Sbjct  28   LISDGMPATPSSSVLASPLSSAVLRLNSSSPATAAAEECEQTYGFLPCTTTVFGNMFLVL  87

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
             YG+LMF AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSG+   AQS
Sbjct  88   TYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGTKETAQS  147

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            QV +GMGLLAGSTV LLT++WGTCVVVGKCD+ +N VA+D  DTK FSLTGSG+TTDV T
Sbjct  148  QVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDVGENGVAIDSTDTKGFSLTGSGITTDVQT  207

Query  647  SYAAIIMA  670
            SYAA IMA
Sbjct  208  SYAARIMA  215



>ref|XP_008368645.1| PREDICTED: uncharacterized protein LOC103432241 [Malus domestica]
Length=585

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 147/182 (81%), Gaps = 6/182 (3%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLR------LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  301
            +V+DGG     +   V +      +  L   + +CEQ+YGFLPCT+T LGN+FL+LVYGY
Sbjct  37   MVTDGGNQLLLQNQNVWKPFFSGLMDSLFSSDSSCEQTYGFLPCTSTVLGNIFLVLVYGY  96

Query  302  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  481
            +MFL+A  LS+GSE+LL+ILGPG++GGLFLP+LG+LPDA +IL SGLSG    AQSQVSV
Sbjct  97   MMFLSAKLLSNGSEILLQILGPGIVGGLFLPLLGSLPDATIILASGLSGDTETAQSQVSV  156

Query  482  GMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAI  661
            GMGL+AGS VMLLT++WGTC++VGKCDI+N++AVD KD K FSLTGSGV+TD+WTSY+A 
Sbjct  157  GMGLMAGSNVMLLTILWGTCLIVGKCDIENSIAVDQKDEKRFSLTGSGVSTDIWTSYSAR  216

Query  662  IM  667
            IM
Sbjct  217  IM  218



>ref|XP_007050030.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
 gb|EOX94187.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
Length=462

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E+CEQ+YGFLPCTTT LGN+FLILVYGYLMF AA  L  G E+LLEILGPG+IGGLFLP+
Sbjct  58   ESCEQTYGFLPCTTTVLGNVFLILVYGYLMFRAAKLLCDGCEILLEILGPGIIGGLFLPV  117

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAV  577
            L +LPDA++IL SGLSGS   AQSQVSVG+GLLAGSTVMLLTV+WG+C+++GKCD+++A+
Sbjct  118  LSSLPDAIIILASGLSGSQETAQSQVSVGIGLLAGSTVMLLTVLWGSCLILGKCDLESAL  177

Query  578  AVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            + DL DTK FSLTGSGV+TDVWTSYAA IMA
Sbjct  178  SKDLVDTKGFSLTGSGVSTDVWTSYAARIMA  208



>ref|XP_006307086.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
 gb|EOA39984.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
Length=585

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 151/176 (86%), Gaps = 3/176 (2%)
 Frame = +2

Query  149  DGGVHSAGEGSGVLR--LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAAT  322
            DGG + AG GS V++  +     +EE CEQ+YGF+PCT TALGN+FLILVYG+LMF AAT
Sbjct  39   DGGRNLAGSGS-VIKTVVSAEEEKEEACEQTYGFMPCTKTALGNVFLILVYGFLMFTAAT  97

Query  323  YlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAG  502
            YLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQVSVGMGLLAG
Sbjct  98   YLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQVSVGMGLLAG  157

Query  503  STVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            STVMLLTVIWGTC VVGKCD+++ +AV+ +DTK FSL  SGVT DVWTSYAA IMA
Sbjct  158  STVMLLTVIWGTCTVVGKCDLRDTIAVNNQDTKRFSLKDSGVTVDVWTSYAARIMA  213



>ref|XP_008673552.1| PREDICTED: uncharacterized protein LOC103649588 [Zea mays]
Length=575

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 147/184 (80%), Gaps = 10/184 (5%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRLGVLAPEEET-------CEQSYGFLPCTTTALGNLFLILVYG  298
            L+SDGG   + +   V+RL   +P           CEQSYGFLPCTTT LGNLFL+L YG
Sbjct  29   LISDGG--PSAQLLSVIRLSGSSPAAGAAAKAEEKCEQSYGFLPCTTTVLGNLFLVLTYG  86

Query  299  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  478
            YLM+ AATYLS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS  EAQSQV 
Sbjct  87   YLMYKAATYLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKEEAQSQVL  146

Query  479  VGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYA  655
            +GMGLLAGSTV LLT++WGTCVVVGKCD+  N  AVD+ DTK FSLTG+G+TTDV TSYA
Sbjct  147  IGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPNREAVDVTDTKGFSLTGTGITTDVQTSYA  206

Query  656  AIIM  667
            A IM
Sbjct  207  ARIM  210



>ref|XP_010500958.1| PREDICTED: uncharacterized protein LOC104778258 [Camelina sativa]
Length=585

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  409
            Q+YGF+PCT TALGN+FLILVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGAL
Sbjct  67   QTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGAL  126

Query  410  pDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDL  589
            PDAMLI+VSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV+ 
Sbjct  127  PDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNN  186

Query  590  KDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            +DTK FSLT SGVT D+WTSYAA IMA
Sbjct  187  QDTKRFSLTDSGVTVDIWTSYAARIMA  213



>ref|XP_004968611.1| PREDICTED: uncharacterized protein LOC101771765 [Setaria italica]
Length=575

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 147/181 (81%), Gaps = 5/181 (3%)
 Frame = +2

Query  140  LVSDGGV-HSAGEGSGVLRLG---VLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            L+SDGG   SA   + V+RL    V A  E  CEQSYGFLPCTTT LGNLFLILVYG+LM
Sbjct  30   LISDGGAAPSAPLLASVIRLASPAVAAAVEGKCEQSYGFLPCTTTVLGNLFLILVYGFLM  89

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
            F AATYLSSGSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS   AQSQV +GM
Sbjct  90   FKAATYLSSGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKETAQSQVLIGM  149

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            GLLAGSTV LLT++WGTCVVVGKCD   N  AVDL +TK FSLTG+ +TTDV TSYAA I
Sbjct  150  GLLAGSTVFLLTLLWGTCVVVGKCDAGPNGEAVDLTNTKGFSLTGTCITTDVQTSYAARI  209

Query  665  M  667
            M
Sbjct  210  M  210



>gb|ACY66874.1| P20Sh095F0 [Saccharum hybrid cultivar R570]
Length=573

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +2

Query  215  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  394
            EE CEQSYGFLPCTTT LGNLFL+L YG+LM+ AATYLS+GSELLLEI+GPGL+GGL LP
Sbjct  60   EEKCEQSYGFLPCTTTVLGNLFLVLTYGFLMYKAATYLSTGSELLLEIMGPGLVGGLLLP  119

Query  395  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QN  571
            ILGALPDA+L+LVSGLSGS  EAQSQV +GMGLLAGSTV LLT++WGTCVVVGKCD+   
Sbjct  120  ILGALPDALLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPT  179

Query  572  AVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
              AVDL DTK FSLTG+G+TTDV TSYAA IM
Sbjct  180  REAVDLTDTKGFSLTGTGITTDVQTSYAARIM  211



>ref|XP_006446746.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
 gb|ESR59986.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
Length=575

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 145/186 (78%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEG-SGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  289
            R I + S+ ++SDG  H   E  S  L    L    + CEQ+YGFLPCTT+ LGN+FLI 
Sbjct  26   RPITNLSTVVISDG-THDVREPVSTQLNNKYLISPSDMCEQTYGFLPCTTSLLGNVFLIA  84

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
            VYGYLM LAA  LS+GSE+LL+I+GPG+IGGLFLP+L ++PDA +IL SGLSGS   AQ+
Sbjct  85   VYGYLMLLAAKLLSNGSEILLQIIGPGIIGGLFLPVLSSVPDAAIILASGLSGSKETAQN  144

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTS  649
            QVSVGMGLLAGS VMLLTV+WG+C++VGKCDI+   AVDLKDTK FS TGSGV+TDVWT 
Sbjct  145  QVSVGMGLLAGSIVMLLTVLWGSCLLVGKCDIEGTTAVDLKDTKRFSFTGSGVSTDVWTC  204

Query  650  YAAIIM  667
            YAA IM
Sbjct  205  YAARIM  210



>ref|XP_010052481.1| PREDICTED: uncharacterized protein LOC104441166 isoform X1 [Eucalyptus 
grandis]
Length=576

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            + C+Q+YGFLPCTTT  GN+FLIL YGYLMFLAA  LS GSE+LL+ILGPG+IGGLFLP+
Sbjct  57   DDCDQTYGFLPCTTTVWGNVFLILAYGYLMFLAAKLLSDGSEILLQILGPGIIGGLFLPV  116

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAV  577
            L +LPDA +IL SG+SGS  +AQSQVSVGMGLLAGSTVMLLTV+WGTC++VGKCDI+N+ 
Sbjct  117  LSSLPDATIILASGVSGSAEDAQSQVSVGMGLLAGSTVMLLTVLWGTCIIVGKCDIENST  176

Query  578  AVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
             +D KDTK FSL GSGV+TD+WTSYAA IM
Sbjct  177  TMDQKDTKKFSLAGSGVSTDIWTSYAARIM  206



>ref|XP_006643900.1| PREDICTED: uncharacterized protein LOC102712578 [Oryza brachyantha]
Length=577

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 148/187 (79%), Gaps = 11/187 (6%)
 Frame = +2

Query  140  LVSDGG-------VHSAGEGSGVLRLGVLAPEE---ETCEQSYGFLPCTTTALGNLFLIL  289
            L+SDG        + S+   S VLRL   A      E CEQSYGFLPCTTT LGN+FL+L
Sbjct  26   LISDGSPAAPSTSLLSSNPVSAVLRLSTSASPAAAGEKCEQSYGFLPCTTTVLGNVFLVL  85

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
             YG+LM+ AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS   AQS
Sbjct  86   AYGFLMYKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSRETAQS  145

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            QV +GMGLLAGSTV LLTV+WGTCVVVGKCDI  N VAVDL++ K FSLTG+G++TDV T
Sbjct  146  QVLIGMGLLAGSTVFLLTVLWGTCVVVGKCDIGPNGVAVDLQNNKGFSLTGTGISTDVQT  205

Query  647  SYAAIIM  667
            SYAA IM
Sbjct  206  SYAARIM  212



>dbj|BAJ93500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 148/188 (79%), Gaps = 11/188 (6%)
 Frame = +2

Query  140  LVSDG-------GVHSAGEGSGVLRLGVLAPE---EETCEQSYGFLPCTTTALGNLFLIL  289
            L+SDG        + ++   S  +RL   +P     E CEQSYGFLPCTTT  GN+FL+L
Sbjct  28   LISDGMPATPSSSILASPLSSAAIRLNSSSPATAAAEECEQSYGFLPCTTTVFGNMFLVL  87

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
             YG+LMF AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSG+   AQS
Sbjct  88   TYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGTKETAQS  147

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            QV +GMGLLAGST+ LLT++WGTCVVVGKCD+ +N VA+D  DTK FSLTGSG+TTDV T
Sbjct  148  QVLIGMGLLAGSTIFLLTLLWGTCVVVGKCDVGENGVAIDSTDTKGFSLTGSGITTDVQT  207

Query  647  SYAAIIMA  670
            SYAA IMA
Sbjct  208  SYAARIMA  215



>ref|XP_010462200.1| PREDICTED: uncharacterized protein LOC104742841 [Camelina sativa]
Length=581

 Score =   179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  409
            Q+YGF+PCT TALGN+FLILVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGAL
Sbjct  63   QTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGAL  122

Query  410  pDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDL  589
            PDAMLI+VSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV+ 
Sbjct  123  PDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNN  182

Query  590  KDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            +DTK FSL  SGVT DVWTSYAA IMA
Sbjct  183  QDTKRFSLKDSGVTVDVWTSYAARIMA  209



>ref|XP_010479874.1| PREDICTED: uncharacterized protein LOC104758667 [Camelina sativa]
Length=585

 Score =   179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  230  QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  409
            Q+YGF+PCT TALGN+FLILVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGAL
Sbjct  67   QTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGAL  126

Query  410  pDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDL  589
            PDAMLI+VSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV+ 
Sbjct  127  PDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNN  186

Query  590  KDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            +DTK FSL  SGVT DVWTSYAA IMA
Sbjct  187  QDTKRFSLKDSGVTVDVWTSYAARIMA  213



>ref|XP_007050029.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOX94186.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=586

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E+CEQ+YGFLPCTTT LGN+FLILVYGYLMF AA  L  G E+LLEILGPG+IGGLFLP+
Sbjct  75   ESCEQTYGFLPCTTTVLGNVFLILVYGYLMFRAAKLLCDGCEILLEILGPGIIGGLFLPV  134

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAV  577
            L +LPDA++IL SGLSGS   AQSQVSVG+GLLAGSTVMLLTV+WG+C+++GKCD+++A+
Sbjct  135  LSSLPDAIIILASGLSGSQETAQSQVSVGIGLLAGSTVMLLTVLWGSCLILGKCDLESAL  194

Query  578  AVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            + DL DTK FSLTGSGV+TDVWTSYAA IMA
Sbjct  195  SKDLVDTKGFSLTGSGVSTDVWTSYAARIMA  225



>ref|NP_001042378.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAD73036.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04292.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAG89983.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70160.1| hypothetical protein OsI_00872 [Oryza sativa Indica Group]
 gb|EEE54102.1| hypothetical protein OsJ_00857 [Oryza sativa Japonica Group]
Length=584

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = +2

Query  215  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  394
            EE CEQSYGFLPCTTT LGNLFL+L YG+LM+ AAT+LS+GSELLLEI+GPGL+GGL LP
Sbjct  68   EEKCEQSYGFLPCTTTVLGNLFLVLAYGFLMYKAATFLSAGSELLLEIMGPGLVGGLLLP  127

Query  395  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QN  571
            ILGALPDA+L+LVSGLSGS   AQSQV +GMGLLAGSTV LLT++WGTCVVVGKCDI  N
Sbjct  128  ILGALPDALLVLVSGLSGSRETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDIGPN  187

Query  572  AVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
             VAVDL++ K FSLTG+G++TDV TSYAA IM
Sbjct  188  GVAVDLQNNKGFSLTGTGISTDVQTSYAARIM  219



>gb|EAZ04370.1| hypothetical protein OsI_26513 [Oryza sativa Indica Group]
Length=502

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
             +SDGG  +A   + VLRL      A E+  CE SYGFLPCTTTA GNLFL+L YG+LMF
Sbjct  32   FISDGGNANANANASVLRLPSAAAAAGEDIGCEMSYGFLPCTTTAWGNLFLVLAYGFLMF  91

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
             +ATYLSSGSE+LL+ILGPG++GGLFLPILGALPDA+LILVSGLSG+   AQSQV +GMG
Sbjct  92   KSATYLSSGSEMLLQILGPGIVGGLFLPILGALPDALLILVSGLSGTKEVAQSQVLIGMG  151

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            LLAGSTVMLLT++WG+CVVVGKCD+ +N+ A+D +DTK FSL GSGV+TD  TSYAA IM
Sbjct  152  LLAGSTVMLLTLLWGSCVVVGKCDLSENSTAIDSRDTKGFSLLGSGVSTDKQTSYAARIM  211

Query  668  A  670
            A
Sbjct  212  A  212



>gb|EEE56655.1| hypothetical protein OsJ_06069 [Oryza sativa Japonica Group]
Length=575

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
             +SDGG  +A   + VLRL      A E+  CE SYGFLPCTTTA GNLFL+L YG+LMF
Sbjct  32   FISDGGNANANANASVLRLPSAAAAAGEDMGCEMSYGFLPCTTTAWGNLFLVLAYGFLMF  91

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
             +ATYLSSGSE+LL+ILGPG++GGLFLPILGALPDA+LILVSGLSG+   AQSQV +GMG
Sbjct  92   KSATYLSSGSEMLLQILGPGIVGGLFLPILGALPDALLILVSGLSGTKEVAQSQVLIGMG  151

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            LLAGSTVMLLT++WG+CVVVGKCD+ +N+ A+D +DTK FSL GSGV+TD  TSYAA IM
Sbjct  152  LLAGSTVMLLTLLWGSCVVVGKCDLSENSTAIDSRDTKGFSLLGSGVSTDKQTSYAARIM  211

Query  668  A  670
            A
Sbjct  212  A  212



>dbj|BAD19956.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
 dbj|BAD19782.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
Length=571

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
             +SDGG  +A   + VLRL      A E+  CE SYGFLPCTTTA GNLFL+L YG+LMF
Sbjct  32   FISDGGNANANANASVLRLPSAAAAAGEDMGCEMSYGFLPCTTTAWGNLFLVLAYGFLMF  91

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
             +ATYLSSGSE+LL+ILGPG++GGLFLPILGALPDA+LILVSGLSG+   AQSQV +GMG
Sbjct  92   KSATYLSSGSEMLLQILGPGIVGGLFLPILGALPDALLILVSGLSGTKEVAQSQVLIGMG  151

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            LLAGSTVMLLT++WG+CVVVGKCD+ +N+ A+D +DTK FSL GSGV+TD  TSYAA IM
Sbjct  152  LLAGSTVMLLTLLWGSCVVVGKCDLSENSTAIDSRDTKGFSLLGSGVSTDKQTSYAARIM  211

Query  668  A  670
            A
Sbjct  212  A  212



>gb|KCW69971.1| hypothetical protein EUGRSUZ_F03285 [Eucalyptus grandis]
Length=498

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R SD VSDG       GS +L L   A   +TC+++YGFLPCTT  +GNLFLILVYGYLM
Sbjct  28   RLSDQVSDGLGKPLRRGSPLL-LPSWAASSDTCDETYGFLPCTTNWIGNLFLILVYGYLM  86

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
            + AAT LS GSE+LLEILGPGLIGGL LPILGALPDA+LILVSGLSGS   AQSQVSVG 
Sbjct  87   YTAATCLSGGSEMLLEILGPGLIGGLVLPILGALPDALLILVSGLSGSTETAQSQVSVGK  146

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GLLAGSTVMLLTVIWG+CV+VGKCD+Q++ AVD  DTK FSLTGSG+T D  T  AA IM
Sbjct  147  GLLAGSTVMLLTVIWGSCVLVGKCDLQDSTAVDKLDTKGFSLTGSGITIDDLTRRAAWIM  206



>ref|XP_004951320.1| PREDICTED: uncharacterized protein LOC101782315 [Setaria italica]
Length=572

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 143/169 (85%), Gaps = 8/169 (5%)
 Frame = +2

Query  176  GSGVLRLGVLAPEE---ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsel  346
            G+ VLRL    P E   E CE +YGFLPCT TALGNLFL+L YG+LMF AATYLS+GSEL
Sbjct  44   GATVLRL----PSEAAAEGCEMTYGFLPCTDTALGNLFLVLAYGFLMFKAATYLSAGSEL  99

Query  347  lleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTV  526
            LLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQSQV +GMGLLAGSTVMLLT+
Sbjct  100  LLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKEVAQSQVLIGMGLLAGSTVMLLTL  159

Query  527  IWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            +WG+CVVVGKCD+ +N+ A D +DTK FSL GSGV+TDV TSYAA IMA
Sbjct  160  LWGSCVVVGKCDLWENSTATDSQDTKRFSLFGSGVSTDVQTSYAARIMA  208



>ref|XP_010062838.1| PREDICTED: uncharacterized protein LOC104450104 [Eucalyptus grandis]
 gb|KCW69970.1| hypothetical protein EUGRSUZ_F03285 [Eucalyptus grandis]
Length=577

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R SD VSDG       GS +L L   A   +TC+++YGFLPCTT  +GNLFLILVYGYLM
Sbjct  28   RLSDQVSDGLGKPLRRGSPLL-LPSWAASSDTCDETYGFLPCTTNWIGNLFLILVYGYLM  86

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
            + AAT LS GSE+LLEILGPGLIGGL LPILGALPDA+LILVSGLSGS   AQSQVSVG 
Sbjct  87   YTAATCLSGGSEMLLEILGPGLIGGLVLPILGALPDALLILVSGLSGSTETAQSQVSVGK  146

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GLLAGSTVMLLTVIWG+CV+VGKCD+Q++ AVD  DTK FSLTGSG+T D  T  AA IM
Sbjct  147  GLLAGSTVMLLTVIWGSCVLVGKCDLQDSTAVDKLDTKGFSLTGSGITIDDLTRRAAWIM  206



>ref|XP_010915578.1| PREDICTED: uncharacterized protein LOC105040648 [Elaeis guineensis]
Length=590

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 149/189 (79%), Gaps = 7/189 (4%)
 Frame = +2

Query  125  DRSSDLVSDG-GVHSAGEGSGVLRLGVLAP-----EEETCEQSYGFLPCTTTALGNLFLI  286
            D    L+SDG  + SA      L L   A        E CEQ+YGFLPCTTT +GNLFL 
Sbjct  38   DEEDQLISDGVALGSAARSDPFLLLRRSAGYSRLFSAEECEQTYGFLPCTTTVVGNLFLA  97

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            L YG+LMF AATYLS+GSE+LLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQ
Sbjct  98   LAYGFLMFKAATYLSTGSEMLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKETAQ  157

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVW  643
            +QV +GMGLLAGSTVMLLT++WG+CVVVGKCD+ +N+ ++D +DTK+FSL GSGV+TD+ 
Sbjct  158  NQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTSIDSQDTKSFSLFGSGVSTDLQ  217

Query  644  TSYAAIIMA  670
            TSYAA IMA
Sbjct  218  TSYAARIMA  226



>ref|XP_006852513.1| PREDICTED: uncharacterized protein LOC18442228 [Amborella trichopoda]
 gb|ERN13980.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda]
Length=574

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 2/186 (1%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            RL    +SDL+SDG   S+   S +L L   +   ETCEQ+YGFLPCT+T LGNLFL++V
Sbjct  25   RLFSTENSDLISDGAS-SSSSWSSLLVLKGKSATSETCEQTYGFLPCTSTVLGNLFLVIV  83

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLMFL ATYLS+GSELLLE+LGPG++GGLFLPILGALPDA+LILVSGLSGS   AQ Q
Sbjct  84   YGYLMFLGATYLSTGSELLLEVLGPGIVGGLFLPILGALPDAILILVSGLSGSTETAQKQ  143

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTS  649
            V +GMGLL+GSTVMLLT++WG+C+V+GKCD+ + + A+D +DTK FSL GSG+TTD  TS
Sbjct  144  VLIGMGLLSGSTVMLLTLLWGSCIVLGKCDLSERSTAIDQQDTKRFSLIGSGITTDRSTS  203

Query  650  YAAIIM  667
             AA IM
Sbjct  204  MAARIM  209



>gb|KCW89606.1| hypothetical protein EUGRSUZ_A01890 [Eucalyptus grandis]
Length=557

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  227  EQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilga  406
            + +YGFLPCTTT  GN+FLIL YGYLMFLAA  LS GSE+LL+ILGPG+IGGLFLP+L +
Sbjct  41   QYTYGFLPCTTTVWGNVFLILAYGYLMFLAAKLLSDGSEILLQILGPGIIGGLFLPVLSS  100

Query  407  lpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVD  586
            LPDA +IL SG+SGS  +AQSQVSVGMGLLAGSTVMLLTV+WGTC++VGKCDI+N+  +D
Sbjct  101  LPDATIILASGVSGSAEDAQSQVSVGMGLLAGSTVMLLTVLWGTCIIVGKCDIENSTTMD  160

Query  587  LKDTKAFSLTGSGVTTDVWTSYAAIIM  667
             KDTK FSL GSGV+TD+WTSYAA IM
Sbjct  161  QKDTKKFSLAGSGVSTDIWTSYAARIM  187



>ref|XP_002522155.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40234.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 142/171 (83%), Gaps = 3/171 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R ++   SDL+   G+H+    S +   G  A  EETCEQSYGFLPCTTTALGN+FLI+V
Sbjct  22   RPLLSDPSDLLVSDGLHTNRTSSHINLWGS-AAAEETCEQSYGFLPCTTTALGNMFLIIV  80

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            YGYLMF+AATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQSQ
Sbjct  81   YGYLMFIAATYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKETAQSQ  140

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNA--VAVDLKDTKAFSLTG  619
            VSVGMGLLAGSTVMLLT+IWG+CVVVGKCDI+ A  +A+  +DT+  SLTG
Sbjct  141  VSVGMGLLAGSTVMLLTIIWGSCVVVGKCDIREADSIAISGRDTRGISLTG  191



>gb|KDP31770.1| hypothetical protein JCGZ_12231 [Jatropha curcas]
Length=577

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 152/188 (81%), Gaps = 5/188 (3%)
 Frame = +2

Query  113  RLIVD-RSSDLVSDGGVHSA--GEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFL  283
            R ++D  SS +VSDG V+S+   +    +RL      + +C+++YGFLPCTTT LGN+FL
Sbjct  24   RHLIDYPSSSMVSDG-VNSSFNHQQQAFIRLYNFL-SDSSCDETYGFLPCTTTILGNIFL  81

Query  284  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  463
            ILVYG LMFL+A  LS GSE+LL+ILGPG+IGGL LP+L  LPDA +IL SGLSGS   A
Sbjct  82   ILVYGCLMFLSAKLLSDGSEILLQILGPGIIGGLLLPVLSCLPDAAIILASGLSGSKETA  141

Query  464  QSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVW  643
            QSQVSVGMGL+AGSTV+LLT++WG+C++VGKCDI+++VAVD KDTK FSLTGSGVTTD+ 
Sbjct  142  QSQVSVGMGLMAGSTVLLLTLLWGSCLIVGKCDIESSVAVDSKDTKIFSLTGSGVTTDIG  201

Query  644  TSYAAIIM  667
            TSYAA IM
Sbjct  202  TSYAARIM  209



>ref|XP_010276580.1| PREDICTED: uncharacterized protein LOC104611295 [Nelumbo nucifera]
Length=577

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 149/182 (82%), Gaps = 5/182 (3%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            +S+ VSDG +H+    S ++ L        TCEQ+YGFLPCTTT +GN+FLI+ YGYLMF
Sbjct  32   TSNTVSDG-IHNVQTESPLILLKRQV-ASGTCEQTYGFLPCTTTVVGNIFLIIAYGYLMF  89

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
            LAAT LS+GSELLLEILGPG+IGGLFLPILG+ PDAMLILVSGLSGS   AQSQ+ VGMG
Sbjct  90   LAATNLSNGSELLLEILGPGIIGGLFLPILGSFPDAMLILVSGLSGSSQTAQSQILVGMG  149

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS---LTGSGVTTDVWTSYAAI  661
            LL+GSTV+LLT++WG+CVVVGKCD+  + AVDL+DT+  +   LTGSGV+TD+WTSYAA 
Sbjct  150  LLSGSTVLLLTLLWGSCVVVGKCDLDGSTAVDLQDTEGLTIAALTGSGVSTDIWTSYAAR  209

Query  662  IM  667
            IM
Sbjct  210  IM  211



>ref|XP_008645573.1| PREDICTED: uncharacterized protein LOC103626994 [Zea mays]
Length=579

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 146/186 (78%), Gaps = 6/186 (3%)
 Frame = +2

Query  125  DRSSDLVSDGGVHSAGEGSGVLRLGVLA---PEEETCEQSYGFLPCTTTALGNLFLILVY  295
            DRS  L+  G        + VLRL   A   P  E CE +YGFLPCT TA GNLFL+L Y
Sbjct  32   DRS--LLLAGSSDEVAAATSVLRLPSAAGEDPAPEACEMTYGFLPCTDTAPGNLFLVLAY  89

Query  296  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  475
            G LMF AATYLS+GSELLLE+LGPG++GGLFLPILGALPDAMLILVSGL+G+   AQSQV
Sbjct  90   GLLMFKAATYLSAGSELLLEVLGPGVVGGLFLPILGALPDAMLILVSGLAGTKEVAQSQV  149

Query  476  SVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
             +GMGLLAGSTVMLLT++WG+CVVVGKCD+ +N+ A D +DTK FSL GSGV+TDV TSY
Sbjct  150  LIGMGLLAGSTVMLLTLLWGSCVVVGKCDMSENSTATDSQDTKGFSLFGSGVSTDVQTSY  209

Query  653  AAIIMA  670
            AA IMA
Sbjct  210  AARIMA  215



>ref|XP_009380498.1| PREDICTED: uncharacterized protein LOC103968880 [Musa acuminata 
subsp. malaccensis]
Length=589

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E+CE +YGFLPCTTT +GNLFL+LVYG+LMF AATYLSSGSELLL+ILGPG++GGLFLPI
Sbjct  75   ESCEPTYGFLPCTTTVVGNLFLVLVYGFLMFKAATYLSSGSELLLQILGPGIVGGLFLPI  134

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQN-A  574
            LGALPDAMLILVSGLSGS   AQSQV +GMGLLAGSTVMLLT++WG+CVVVGKCD+ + +
Sbjct  135  LGALPDAMLILVSGLSGSKETAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSDSS  194

Query  575  VAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
             +VDL+DT+ FSL  SG++TDV TSYAA IMA
Sbjct  195  TSVDLQDTRGFSLFASGISTDVQTSYAARIMA  226



>ref|XP_008783929.1| PREDICTED: uncharacterized protein LOC103703017 [Phoenix dactylifera]
Length=641

 Score =   171 bits (434),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 136/152 (89%), Gaps = 1/152 (1%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E CEQ+YGFLPCTTT +GNLFL + YG+LMF  ATYLS+GSELLLEILGPG++GGLFLPI
Sbjct  125  EECEQTYGFLPCTTTVVGNLFLAVAYGFLMFKGATYLSTGSELLLEILGPGIVGGLFLPI  184

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNA  574
            LGALPDAMLILVSGLSGS   AQ+QV +GMGLLAGSTVMLLT++WG+CVVVGKCD+ +N+
Sbjct  185  LGALPDAMLILVSGLSGSKETAQNQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENS  244

Query  575  VAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
             ++DL+DTK FSL GSG++TD+ TSYAA IMA
Sbjct  245  TSIDLQDTKGFSLFGSGISTDLQTSYAARIMA  276



>ref|XP_009405607.1| PREDICTED: uncharacterized protein LOC103988717 [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 150/189 (79%), Gaps = 9/189 (5%)
 Frame = +2

Query  131  SSDLVSDGGVHS--AGEGSGVLRLGVLAPEEET------CEQSYGFLPCTTTALGNLFLI  286
            S+DL+   GV S  A E   +L   +  P          CEQ+YGFLPCTTT +GN+FL+
Sbjct  42   SADLLLSDGVSSRPASESQTLLLPRLPWPRSSRVFAAGQCEQTYGFLPCTTTVVGNMFLV  101

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            + YG+LM+ AATYLSSGSELLLEI+GPG++GGLFLPILGALPDAMLILVSGLSGS   AQ
Sbjct  102  IAYGFLMYKAATYLSSGSELLLEIMGPGIVGGLFLPILGALPDAMLILVSGLSGSRETAQ  161

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVW  643
            +QV +GMGLLAGSTVMLLTV+WG+C++VGKCD+  N+ ++D +DTKAFSL GSGV+TD+ 
Sbjct  162  NQVLIGMGLLAGSTVMLLTVLWGSCIIVGKCDLSDNSTSIDSQDTKAFSLFGSGVSTDLQ  221

Query  644  TSYAAIIMA  670
            TSYAA IMA
Sbjct  222  TSYAARIMA  230



>ref|XP_012079036.1| PREDICTED: uncharacterized protein LOC105639564 [Jatropha curcas]
Length=544

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +2

Query  215  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  394
            + +C+++YGFLPCTTT LGN+FLILVYG LMFL+A  LS GSE+LL+ILGPG+IGGL LP
Sbjct  26   DSSCDETYGFLPCTTTILGNIFLILVYGCLMFLSAKLLSDGSEILLQILGPGIIGGLLLP  85

Query  395  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNA  574
            +L  LPDA +IL SGLSGS   AQSQVSVGMGL+AGSTV+LLT++WG+C++VGKCDI+++
Sbjct  86   VLSCLPDAAIILASGLSGSKETAQSQVSVGMGLMAGSTVLLLTLLWGSCLIVGKCDIESS  145

Query  575  VAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            VAVD KDTK FSLTGSGVTTD+ TSYAA IM
Sbjct  146  VAVDSKDTKIFSLTGSGVTTDIGTSYAARIM  176



>ref|XP_002451861.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
 gb|EES04837.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
Length=562

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 1/150 (1%)
 Frame = +2

Query  224  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  403
            CE +YGFLPCT TA GNLFL+L YG+LMF AATYLS+GSELLL+ILGPG++GGLFLPILG
Sbjct  83   CEMTYGFLPCTDTAPGNLFLVLAYGFLMFKAATYLSAGSELLLQILGPGIVGGLFLPILG  142

Query  404  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVA  580
            ALPDAMLILVSGLSG+   AQSQV +GMGLLAGSTVMLLT++WG+CVVVGKCD+ +N+ A
Sbjct  143  ALPDAMLILVSGLSGTKEVAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTA  202

Query  581  VDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            +D +DTK FSL GSGV+TDV TSYAA IMA
Sbjct  203  IDSRDTKGFSLFGSGVSTDVQTSYAARIMA  232



>ref|XP_010277717.1| PREDICTED: uncharacterized protein LOC104612097 isoform X1 [Nelumbo 
nucifera]
Length=200

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 140/180 (78%), Gaps = 9/180 (5%)
 Frame = +2

Query  113  RLIVDR-SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  289
            R I +  SS+LVSDG  +   +  G+    + A   ETCEQ+YGFLPCTT  +GNLFLI+
Sbjct  26   RFITESFSSNLVSDGVENGRVQSPGIFLKRLRA--SETCEQTYGFLPCTTNVVGNLFLII  83

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
            VYG+LMF  A YLS GSELLL +LGPG+IGGLFLPILGALPDAMLILVSGLSGS   AQS
Sbjct  84   VYGFLMFHGARYLSDGSELLLSVLGPGIIGGLFLPILGALPDAMLILVSGLSGSRETAQS  143

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTS  649
            QV VGMGLLAGSTVMLLT +WG+C++VGKCDI+++ AVDL+DTK  SL      +D+W+S
Sbjct  144  QVLVGMGLLAGSTVMLLTSLWGSCIIVGKCDIEDSTAVDLQDTKGLSL------SDLWSS  197



>ref|XP_003571165.2| PREDICTED: uncharacterized protein LOC100833492 isoform X1 [Brachypodium 
distachyon]
Length=639

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +2

Query  146  SDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATY  325
            SD  +    E        + A  EE CE +YGFLPCTTTA GNLFL L YG+LMF AATY
Sbjct  100  SDAALRLPSEQQQQQPAPLRAAGEEGCEMTYGFLPCTTTAGGNLFLALAYGFLMFKAATY  159

Query  326  lssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGS  505
            LS+GSELLLEILGPG++GGLFLPILGALPDA+LILVSG+SG+   AQSQV +GMGLLAGS
Sbjct  160  LSAGSELLLEILGPGIVGGLFLPILGALPDALLILVSGISGTKEVAQSQVLIGMGLLAGS  219

Query  506  TVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            TVMLLTV+WG+CVVVGKCD+ +++  +D +DTK FSL GSGV+TD+ TSYAA IMA
Sbjct  220  TVMLLTVLWGSCVVVGKCDLTEDSTPIDSRDTKRFSLFGSGVSTDLQTSYAARIMA  275



>ref|XP_010234099.1| PREDICTED: uncharacterized protein LOC100833492 isoform X2 [Brachypodium 
distachyon]
Length=666

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +2

Query  146  SDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATY  325
            SD  +    E        + A  EE CE +YGFLPCTTTA GNLFL L YG+LMF AATY
Sbjct  100  SDAALRLPSEQQQQQPAPLRAAGEEGCEMTYGFLPCTTTAGGNLFLALAYGFLMFKAATY  159

Query  326  lssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGS  505
            LS+GSELLLEILGPG++GGLFLPILGALPDA+LILVSG+SG+   AQSQV +GMGLLAGS
Sbjct  160  LSAGSELLLEILGPGIVGGLFLPILGALPDALLILVSGISGTKEVAQSQVLIGMGLLAGS  219

Query  506  TVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            TVMLLTV+WG+CVVVGKCD+ +++  +D +DTK FSL GSGV+TD+ TSYAA IMA
Sbjct  220  TVMLLTVLWGSCVVVGKCDLTEDSTPIDSRDTKRFSLFGSGVSTDLQTSYAARIMA  275



>ref|XP_010277718.1| PREDICTED: uncharacterized protein LOC104612097 isoform X2 [Nelumbo 
nucifera]
Length=199

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 136/171 (80%), Gaps = 3/171 (2%)
 Frame = +2

Query  113  RLIVDR-SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  289
            R I +  SS+LVSDG  +   +  G+    + A   ETCEQ+YGFLPCTT  +GNLFLI+
Sbjct  26   RFITESFSSNLVSDGVENGRVQSPGIFLKRLRA--SETCEQTYGFLPCTTNVVGNLFLII  83

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
            VYG+LMF  A YLS GSELLL +LGPG+IGGLFLPILGALPDAMLILVSGLSGS   AQS
Sbjct  84   VYGFLMFHGARYLSDGSELLLSVLGPGIIGGLFLPILGALPDAMLILVSGLSGSRETAQS  143

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGS  622
            QV VGMGLLAGSTVMLLT +WG+C++VGKCDI+++ AVDL+DTK  SL+ +
Sbjct  144  QVLVGMGLLAGSTVMLLTSLWGSCIIVGKCDIEDSTAVDLQDTKGLSLSAN  194



>ref|XP_010041151.1| PREDICTED: uncharacterized protein LOC104430086 [Eucalyptus grandis]
Length=579

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R SD VSDG   + G  S  L L   A    +C+++YGF+PCTTT +GNLFLILVY YLM
Sbjct  31   RLSDPVSDGLGKALGRRSP-LYLPSSAASSYSCDETYGFMPCTTTWIGNLFLILVYIYLM  89

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
            + AA  LS GSE+LLEILGPGLI GL LP+LGA+P+A+LILVSGLSGS   AQSQVS+G 
Sbjct  90   YTAAMCLSRGSEMLLEILGPGLISGLVLPMLGAIPNALLILVSGLSGSTETAQSQVSIGK  149

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GLLAGSTVMLLTVIWG+CV+VGKCD+Q++ AVD  DTK FSLTGSG+T D  T  AA IM
Sbjct  150  GLLAGSTVMLLTVIWGSCVLVGKCDLQDSTAVDKLDTKGFSLTGSGITIDNLTRSAAWIM  209



>emb|CAN78652.1| hypothetical protein VITISV_033128 [Vitis vinifera]
Length=598

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 132/171 (77%), Gaps = 21/171 (12%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            ++C+Q+YGFLPCTTT LGN+FLILVYGYLMF+AA +LS GSE+LL ILGPG+IGGLFLP+
Sbjct  58   DSCDQTYGFLPCTTTVLGNIFLILVYGYLMFIAAKFLSDGSEILLGILGPGIIGGLFLPV  117

Query  398  lgalpDAMLILVS---------------------GLSGSVAEAQSQVSVGMGLLAGSTVM  514
            L A PDA++IL S                     G   +  + + QVS+GMGLLAGSTVM
Sbjct  118  LSAFPDAVIILESSTLLTPLSDPRFPMGAIIIHLGYLEAKKQLKVQVSIGMGLLAGSTVM  177

Query  515  LLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            LLT++WG+C++VGKCDI+N+VA DLKDT+ FSLTGSGV+TD+W SYAA IM
Sbjct  178  LLTILWGSCIIVGKCDIENSVATDLKDTRGFSLTGSGVSTDIWASYAARIM  228



>ref|XP_012074224.1| PREDICTED: uncharacterized protein LOC105635748 [Jatropha curcas]
Length=566

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 126/153 (82%), Gaps = 2/153 (1%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E+C+Q+YGF+PC++   GNL LI+ YGYL F+A+T+LS+GSE+L EILGPG+ GGL LP 
Sbjct  44   ESCDQTYGFMPCSSNKFGNLILIIGYGYLFFVASTFLSNGSEILREILGPGIAGGLLLPQ  103

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI--QN  571
            LG L DA L+LVSGL+GS   AQ QVSVGMGLLAGSTV LLTV+WG+CVV GKCDI  ++
Sbjct  104  LGELADATLVLVSGLTGSTTTAQRQVSVGMGLLAGSTVTLLTVVWGSCVVAGKCDIGGED  163

Query  572  AVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            ++A+D KDTK FS TGSGVTT +WT Y+A IMA
Sbjct  164  SLAIDGKDTKGFSFTGSGVTTSIWTCYSARIMA  196



>ref|XP_012074223.1| PREDICTED: uncharacterized protein LOC105635747 [Jatropha curcas]
Length=526

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 128/153 (84%), Gaps = 2/153 (1%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E+C+Q+YGF+PC+    GNL LI+ YGYL F+A+T+LS+GSE+LLEILGPG++GGL LP 
Sbjct  4    ESCDQTYGFMPCSGNKFGNLILIIGYGYLFFVASTFLSNGSEILLEILGPGIVGGLLLPQ  63

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI--QN  571
            LG L DA L+LVSGL+G+   AQ QVSVGMGLLAGSTV LLTV+WG+CVV GKCDI  ++
Sbjct  64   LGELADATLVLVSGLTGNTTTAQRQVSVGMGLLAGSTVTLLTVVWGSCVVAGKCDIGEED  123

Query  572  AVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
            ++A+D KDTK F+ TGSGVTTD+WT Y+A IMA
Sbjct  124  SLAIDGKDTKGFNFTGSGVTTDIWTCYSARIMA  156



>ref|XP_009409407.1| PREDICTED: uncharacterized protein LOC103991626 [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 140/177 (79%), Gaps = 3/177 (2%)
 Frame = +2

Query  146  SDG--GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  319
            SDG  G  +AG     L +       E CE SYGFLPCTTT  GNLFL+LVYG+LM+ AA
Sbjct  50   SDGISGYAAAGYKHSPLLVLPRGSAAEACEPSYGFLPCTTTVAGNLFLVLVYGFLMYKAA  109

Query  320  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  499
            T LS+GSE+LLEILGPG++GGLFLPILGALPDA+LILVSGLSGS   AQ+QV +GMGLLA
Sbjct  110  TCLSAGSEMLLEILGPGIVGGLFLPILGALPDALLILVSGLSGSKEVAQNQVLIGMGLLA  169

Query  500  GSTVMLLTVIWGTCVVVGKCD-IQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            GSTVML+T++WG+CVVVGKCD ++N+ +VD +DT  FSL  SG+TTD  TS+AA IM
Sbjct  170  GSTVMLITLLWGSCVVVGKCDLLENSTSVDSQDTNGFSLFASGITTDSQTSHAAKIM  226



>emb|CDP05978.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLK  592
            DAMLILVSGLSGS   AQSQVSVG+GLLAGSTVMLLTVIWG CV VGKCDI+N VA DL+
Sbjct  37   DAMLILVSGLSGSAETAQSQVSVGIGLLAGSTVMLLTVIWGACVTVGKCDIENHVAKDLQ  96

Query  593  DTKAFSLTGSGVTTDVWTSYAAIIMA  670
            DTK FSLTGSGV+TD+WT YAAIIMA
Sbjct  97   DTKGFSLTGSGVSTDIWTCYAAIIMA  122



>ref|XP_010064464.1| PREDICTED: uncharacterized protein LOC104451526 [Eucalyptus grandis]
Length=197

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  239  GFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDA  418
            G  P    A   ++LI+VY Y ++ A TYLS+GS LLL ILGPG+I  LF P+LGALP+A
Sbjct  2    GSCPAPPLASAGMYLIVVYEYKIYTAVTYLSNGSALLLRILGPGIISNLFSPMLGALPNA  61

Query  419  MLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDT  598
            +LILVSGLSGS   AQSQVSVGMGLLAGSTVMLLTVIWG+C++VGKCD+ N+VA+D +DT
Sbjct  62   ILILVSGLSGSTETAQSQVSVGMGLLAGSTVMLLTVIWGSCIIVGKCDLHNSVAMDKQDT  121

Query  599  KAFSLTGSGVTTDVWTSYAAIIM  667
            K FSL  SGV+TD+W  YAA IM
Sbjct  122  KGFSLKSSGVSTDLWAKYAARIM  144



>ref|XP_007212014.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
 gb|EMJ13213.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
Length=489

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLK  592
            DAMLILVSGLSG+   AQSQVSVGMGLLAGSTVMLLTVIWG+C++VGKCDI+N++A+D K
Sbjct  37   DAMLILVSGLSGTTETAQSQVSVGMGLLAGSTVMLLTVIWGSCILVGKCDIENSIAIDNK  96

Query  593  DTKAFSLTGSGVTTDVWTSYAAIIMA  670
            DTK  SLTGSGV+TD+WTSYAA IMA
Sbjct  97   DTKGLSLTGSGVSTDIWTSYAARIMA  122



>ref|XP_007213956.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
 gb|EMJ15155.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
Length=490

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLK  592
            DA+LILVSGLSGS   AQSQVSVGMGLLAGSTV++LT+IWG+CVVVGKCDIQN+VA+D K
Sbjct  37   DAILILVSGLSGSTETAQSQVSVGMGLLAGSTVLILTLIWGSCVVVGKCDIQNSVAIDNK  96

Query  593  DTKAFSLTGSGVTTDVWTSYAAIIM  667
            DTK FSLTGSGV+TD+WTSYAA IM
Sbjct  97   DTKGFSLTGSGVSTDIWTSYAARIM  121



>emb|CBI20223.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLK  592
            DA+LILVSGLSGS   AQSQVSVGMGLLAGSTV+LLT++WG+CV+VGKCD+Q++VA DL+
Sbjct  37   DAILILVSGLSGSTETAQSQVSVGMGLLAGSTVILLTIMWGSCVIVGKCDLQDSVAKDLQ  96

Query  593  DTKAFSLTGSGVTTDVWTSYAAIIM  667
            DTK FSLTGSGV+TD+WTSYAAIIM
Sbjct  97   DTKGFSLTGSGVSTDIWTSYAAIIM  121



>ref|XP_002522156.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40235.1| calcium ion binding protein, putative [Ricinus communis]
Length=588

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 139/188 (74%), Gaps = 8/188 (4%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYG  298
            + ++ VSDG VH     S  L     G    EEE CEQ+YGF+PC+TTA+GNL LI+ YG
Sbjct  35   QPANSVSDGSVHPHRSTSPYLLTSISGTEEAEEEWCEQTYGFMPCSTTAMGNLLLIIGYG  94

Query  299  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLIL--VSGLS-GSVAEAQS  469
            Y MFLAATYLS GSE+L EILGPG++GGL LP+L AL DA+++L  +  L  GS A AQ 
Sbjct  95   YAMFLAATYLSKGSEMLHEILGPGIVGGLLLPVLCALSDAVIVLGKLEYLDFGSKAVAQK  154

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ--NAVAVDLKDTKAFSLTGSGVTTDVW  643
            ++SVGMGLLAGST +LLT++WG+C+  GKCDI+  +++A+D   TK F+LTG+GV+TD+W
Sbjct  155  EISVGMGLLAGSTALLLTLVWGSCIFFGKCDIRKIDSLAIDGHGTKGFNLTGTGVSTDIW  214

Query  644  TSYAAIIM  667
            T Y A IM
Sbjct  215  TCYGARIM  222



>ref|XP_010279180.1| PREDICTED: uncharacterized protein LOC104613163 [Nelumbo nucifera]
Length=565

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDG-GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  289
            RL+ + S++L+SDG     A +GS  L L  L+    TCE  YGFLPCTT   G LF+I+
Sbjct  22   RLVTENSTNLISDGIDDDHASDGSPFLALKRLS-SPVTCEPEYGFLPCTTNIWGQLFIIV  80

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
            VY YL+FL   Y+S+G+EL+ ++LGPG+ G     ILG+LP+A+L+LV+G+SGS+  AQ 
Sbjct  81   VYEYLLFLGENYISAGTELIFKLLGPGIFGASAFHILGSLPEAVLVLVAGVSGSIEIAQE  140

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQN-AVAVDLKDTKAFSLTGSGVTTDVWT  646
            Q  +GM LLAGSTVMLLT++WG+ V VGK D+ N +   D+  T+   LTG GV TD+ T
Sbjct  141  QAVIGMALLAGSTVMLLTILWGSIVAVGKYDLSNDSKPTDISVTRRSHLTGFGVVTDLET  200

Query  647  SYAAIIM  667
            +Y A IM
Sbjct  201  NYTAKIM  207



>ref|XP_010052488.1| PREDICTED: uncharacterized protein LOC104441166 isoform X2 [Eucalyptus 
grandis]
Length=491

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLK  592
            DA +IL SG+SGS  +AQSQVSVGMGLLAGSTVMLLTV+WGTC++VGKCDI+N+  +D K
Sbjct  37   DATIILASGVSGSAEDAQSQVSVGMGLLAGSTVMLLTVLWGTCIIVGKCDIENSTTMDQK  96

Query  593  DTKAFSLTGSGVTTDVWTSYAAIIM  667
            DTK FSL GSGV+TD+WTSYAA IM
Sbjct  97   DTKKFSLAGSGVSTDIWTSYAARIM  121



>gb|EMS61578.1| hypothetical protein TRIUR3_22187 [Triticum urartu]
Length=497

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = +2

Query  275  LFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSV  454
            +FL+L YG+LMF AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSG+ 
Sbjct  1    MFLVLTYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGTK  60

Query  455  AEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVT  631
              AQSQV +GMGLLAGSTV LLT++WGTCVVVGKCD+ ++ VA+D  DTK FSL+GSG+T
Sbjct  61   ETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDVGEDGVAIDSTDTKGFSLSGSGIT  120

Query  632  TDVWTSYAAIIMA  670
            TDV TSYAA IMA
Sbjct  121  TDVQTSYAARIMA  133



>gb|AAK32813.1|AF361800_1 At1g53210/F12M16_12 [Arabidopsis thaliana]
 gb|AAM91449.1| At1g53210/F12M16_12 [Arabidopsis thaliana]
Length=493

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLK  592
            DAMLI+VSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++++AV+ +
Sbjct  37   DAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQ  96

Query  593  DTKAFSLTGSGVTTDVWTSYAAIIMA  670
            DTK F L  SGVT D+WTSYAA IMA
Sbjct  97   DTKGFHLKDSGVTVDIWTSYAARIMA  122



>ref|XP_002987555.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
 gb|EFJ11391.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
Length=531

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 121/156 (78%), Gaps = 4/156 (3%)
 Frame = +2

Query  212  EEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  391
            +EE+CE +YGFLPC+T   GN+FL++VYG+L+  AA +LS GSELLL +L PG+IGGL L
Sbjct  1    KEESCEPNYGFLPCSTGVAGNIFLLIVYGFLLLKAAQFLSEGSELLLLVLNPGIIGGLLL  60

Query  392  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ-  568
            PILGALPDA+LILVSGL  S AE  SQV VGMGLLAGST+MLLT++WG+ ++VG+CD+Q 
Sbjct  61   PILGALPDAILILVSGLFASEAEVLSQVLVGMGLLAGSTIMLLTLLWGSSLIVGRCDLQE  120

Query  569  ---NAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
               N VA D   T+ F ++ +GVTTD  T  +A IM
Sbjct  121  VNGNLVAKDKTLTRKFDVSKTGVTTDAQTKVSAWIM  156



>gb|EPS57671.1| hypothetical protein M569_17145, partial [Genlisea aurea]
Length=448

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  431  VSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS  610
            VSGLSGS   AQ QVSVG+GLLAGSTVMLLTVIWG+CVVVGKCD+QN V++D +DTK FS
Sbjct  1    VSGLSGSKETAQKQVSVGIGLLAGSTVMLLTVIWGSCVVVGKCDLQNNVSIDSQDTKCFS  60

Query  611  LTGSGVTTDVWTSYAAIIMA  670
             TGSGV+TDVWTSYAA IMA
Sbjct  61   PTGSGVSTDVWTSYAARIMA  80



>ref|XP_002992821.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
 gb|EFJ06111.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
Length=531

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 120/156 (77%), Gaps = 4/156 (3%)
 Frame = +2

Query  212  EEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  391
            +EE+CE +YGFLPC+T   GN+FL++VYG+L+  AA +LS GSELLL +L PG+IGGL L
Sbjct  1    KEESCEPNYGFLPCSTGVAGNIFLLIVYGFLLLKAAQFLSEGSELLLLVLNPGIIGGLLL  60

Query  392  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ-  568
            PILGALPDA+LILVSGL  S  E  SQV VGMGLLAGST+MLLT++WG+ ++VG+CD+Q 
Sbjct  61   PILGALPDAILILVSGLFASEEEVLSQVLVGMGLLAGSTIMLLTLLWGSSLIVGRCDLQE  120

Query  569  ---NAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
               N VA D   T+ F ++ +GVTTD  T  +A IM
Sbjct  121  VNGNLVAKDKTLTRKFDVSKTGVTTDAQTKASAWIM  156



>gb|KCW67440.1| hypothetical protein EUGRSUZ_F011933, partial [Eucalyptus grandis]
Length=128

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  434  SGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSL  613
            SGLSGS   AQSQVSVGMGLLAGSTVMLLTVIWG+C++VGKCD+ N+VA+D +DTK FSL
Sbjct  1    SGLSGSTETAQSQVSVGMGLLAGSTVMLLTVIWGSCIIVGKCDLHNSVAMDKQDTKGFSL  60

Query  614  TGSGVTTDVWTSYAAIIM  667
              SGV+TD+W  YAA IM
Sbjct  61   KSSGVSTDLWAKYAARIM  78



>ref|XP_006307087.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
 gb|EOA39985.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
Length=461

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  422  LILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTK  601
            + LVSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGTC VVGKCD+++ +AV+ +DTK
Sbjct  7    IYLVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNNQDTK  66

Query  602  AFSLTGSGVTTDVWTSYAAIIMA  670
             FSL  SGVT DVWTSYAA IMA
Sbjct  67   RFSLKDSGVTVDVWTSYAARIMA  89



>gb|KDP36272.1| hypothetical protein JCGZ_09837 [Jatropha curcas]
Length=522

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 109/151 (72%), Gaps = 20/151 (13%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E+C+Q+YGF+PC++   GNL LI+ YGYL F+A+T+LS+GSE+L EILGPG+ GGL LP 
Sbjct  44   ESCDQTYGFMPCSSNKFGNLILIIGYGYLFFVASTFLSNGSEILREILGPGIAGGLLLPQ  103

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAV  577
            LG L DA L+LVSGL+GS   AQ QVSVGMGLLAGSTV LLTV+WG+CVV GKC      
Sbjct  104  LGELADATLVLVSGLTGSTTTAQRQVSVGMGLLAGSTVTLLTVVWGSCVVAGKC------  157

Query  578  AVDLKDTKAFSLTGSGVTTDVWTSYAAIIMA  670
                          SGVTT +WT Y+A IMA
Sbjct  158  --------------SGVTTSIWTCYSARIMA  174



>ref|XP_002974272.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
 gb|EFJ24494.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
Length=525

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = +2

Query  224  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  403
            C +SYG LPC+T  +GNL+L+  YG++M  AA  LS GSELLL +L PG+IGGL LPILG
Sbjct  1    CSESYGMLPCSTRVVGNLYLLATYGFVMLKAAQLLSDGSELLLTVLNPGIIGGLLLPILG  60

Query  404  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ----N  571
            +LPDA+LILVSGL G+   AQSQVSVGMGLLAGST+MLLT++WG+C+ VG+CD+     +
Sbjct  61   SLPDALLILVSGLGGNQETAQSQVSVGMGLLAGSTIMLLTLLWGSCLFVGRCDLYPVHAD  120

Query  572  AVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
             VA D   T+ FSLTG+G+TTD  T+ +A IM
Sbjct  121  LVAKDRTLTRGFSLTGTGITTDSQTTVSAWIM  152



>gb|EMT26919.1| hypothetical protein F775_25869 [Aegilops tauschii]
Length=469

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDL  589
            DA+L+LVSGLSG+   AQSQV +GMGLLAGSTV LLT++WGTCVVVGKCD+ +N VA+D 
Sbjct  19   DALLVLVSGLSGTKETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDVTENGVAIDS  78

Query  590  KDTKAFSLTGSGVTTDVWTSYAAIIMA  670
             DTK FSLTGSG+TTDV TSYAA IMA
Sbjct  79   TDTKGFSLTGSGITTDVQTSYAARIMA  105



>ref|XP_002985644.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
 gb|EFJ13222.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
Length=528

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = +2

Query  224  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  403
            C +SYG LPC+T  +GN++L+  YG++M  AA  LS GSELLL +L PG+IGGL LPILG
Sbjct  3    CSESYGMLPCSTRVVGNVYLLATYGFVMLKAAQLLSDGSELLLTVLNPGIIGGLLLPILG  62

Query  404  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ--NA-  574
            +LPDA+LILVSGL G+   AQSQVSVGMGLLAGST+MLLT++WG+C+ VG+CD+   NA 
Sbjct  63   SLPDALLILVSGLGGNQETAQSQVSVGMGLLAGSTIMLLTLLWGSCLFVGRCDLYPVNAD  122

Query  575  -VAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
             VA D   T+ FSLTG+G+TTD  T+ +A IM
Sbjct  123  LVAKDGTLTRGFSLTGTGITTDSQTTVSAWIM  154



>ref|XP_002275961.1| PREDICTED: uncharacterized protein LOC100260847 [Vitis vinifera]
Length=539

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  209  PEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglf  388
            P   +C+Q++G +PCTTT  GN+FLILVYGYLMF AA  L  GSE+L+E+L PG+ GG+F
Sbjct  55   PSPYSCKQTHGVMPCTTTVFGNVFLILVYGYLMFFAARLLYDGSEILVELLSPGITGGVF  114

Query  389  lpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ  568
            LP+L +LPDA++IL S L G+   A SQVS G  LL GST MLLT++ G C++VGKCD++
Sbjct  115  LPLLSSLPDAIIILASRLCGNKDTASSQVSAGSALLGGSTAMLLTLLGGCCIIVGKCDLE  174

Query  569  NAVAVDL-KDTKAFSLTGSGVTTDVWTSYAAIIM  667
            N  A  + K+ + FSL GS  +TD+  SY A IM
Sbjct  175  NLRAKPVEKNARGFSLVGSAASTDIRASYTARIM  208



>gb|ACN27225.1| unknown [Zea mays]
Length=487

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDL  589
            DA+L+LVSGLSGS  EAQSQV +GMGLLAGSTV LLT++WGTCVVVGKCD+     AVD+
Sbjct  37   DALLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPGREAVDV  96

Query  590  KDTKAFSLTGSGVTTDVWTSYAAIIM  667
             DTK FSLTG+GVTTDV TSYAA IM
Sbjct  97   TDTKGFSLTGTGVTTDVQTSYAARIM  122



>emb|CBI21945.3| unnamed protein product [Vitis vinifera]
Length=892

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = +2

Query  209  PEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglf  388
            P   +C+Q++G +PCTTT  GN+FLILVYGYLMF AA  L  GSE+L+E+L PG+ GG+F
Sbjct  112  PSPYSCKQTHGVMPCTTTVFGNVFLILVYGYLMFFAARLLYDGSEILVELLSPGITGGVF  171

Query  389  lpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ  568
            LP+L +LPDA++IL S L G+   A SQVS G  LL GST MLLT++ G C++VGKCD++
Sbjct  172  LPLLSSLPDAIIILASRLCGNKDTASSQVSAGSALLGGSTAMLLTLLGGCCIIVGKCDLE  231

Query  569  NAVAVDL-KDTKAFSLTGSGVTTDVWTSYAAIIM  667
            N  A  + K+ + FSL GS  +TD+  SY A IM
Sbjct  232  NLRAKPVEKNARGFSLVGSAASTDIRASYTARIM  265


 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 119/184 (65%), Gaps = 12/184 (7%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEE----ETCEQSYGFLPCTTTALGNLFLILVYG  298
            SS LVSDG     GE   V +   +  EE     +C Q+YGF+PCT T  GN+ LILVY 
Sbjct  611  SSGLVSDGD----GE---VQQPAFIVFEEWASSYSCNQTYGFMPCTATVPGNILLILVYV  663

Query  299  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  478
             LM  AA  L  GSE+L+E+L PG+ G +FLP+L +L DA++ + S L G+   AQ+QVS
Sbjct  664  SLMLFAAKLLYDGSEILVELLSPGIAGAVFLPLLSSLLDAIINIASRLCGNGETAQNQVS  723

Query  479  VGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDT-KAFSLTGSGVTTDVWTSYA  655
             G+GLL GST +LLT++ G C++V KCD +N+     ++T + FSL GS ++TD+  SY 
Sbjct  724  AGLGLLTGSTAILLTLLGGCCIIVDKCDPENSREKASEETARGFSLAGSAISTDIRASYT  783

Query  656  AIIM  667
            A IM
Sbjct  784  ARIM  787



>ref|XP_010644148.1| PREDICTED: uncharacterized protein LOC100241883 [Vitis vinifera]
Length=718

 Score =   121 bits (304),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 87/187 (47%), Positives = 113/187 (60%), Gaps = 9/187 (5%)
 Frame = +2

Query  137  DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            +LVSDG     G+ S VL L  +    E CEQ YGFLPC+    G+LFLI+VY YLMF  
Sbjct  36   ELVSDGVDEGEGQKSSVLVLRGMEYSSEECEQLYGFLPCSNNIFGHLFLIVVYEYLMFHG  95

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  496
             +Y++SG E + +ILGPG+ G     +LGALP+++++L SGL  S   AQ  V   +GLL
Sbjct  96   ESYVASGGEQIFKILGPGVFGASVFQVLGALPESLILLASGLLNSKDTAQEYVLTAVGLL  155

Query  497  AGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS---------LTGSGVTTDVWTS  649
            AGST++LLTV+WGTCV+VG C+   A +    D              LTGSG+ TD  T 
Sbjct  156  AGSTILLLTVLWGTCVIVGSCEFPGAGSGATVDANLLQKPYRKILLMLTGSGIATDEETG  215

Query  650  YAAIIMA  670
            Y A IM 
Sbjct  216  YMARIMG  222



>ref|XP_010277716.1| PREDICTED: uncharacterized protein LOC104612096 [Nelumbo nucifera]
Length=688

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 123/192 (64%), Gaps = 17/192 (9%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEE-ETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            SS LVSDG      + S +L L    P   E CE  YGFLPCT    G+LFL++VY Y++
Sbjct  29   SSQLVSDG----MDDESPMLLLKSQEPSSSEACEHMYGFLPCTENLAGHLFLVVVYEYML  84

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
            F+   YLSSGS+LL EILG G+ G  F  ILG LP++M++LVSGLS S   AQ  V  G+
Sbjct  85   FIGEKYLSSGSKLLFEILGEGVYGASFFHILGTLPESMILLVSGLSNSKEIAQKNVLTGV  144

Query  488  GLLAGSTVMLLTVIWGTCVVVGKC-----------DIQNAVAVDLKDTKAFS-LTGSGVT  631
            GLL GSTV+ LT++WGTCV+VGK            D+Q++ + DL+  +    LTGSG+T
Sbjct  145  GLLVGSTVLHLTIVWGTCVIVGKHKLSEPECSATEDLQSSASKDLQCKRQLRCLTGSGIT  204

Query  632  TDVWTSYAAIIM  667
            TD+ TSY A IM
Sbjct  205  TDLKTSYTARIM  216



>ref|XP_001762095.1| predicted protein [Physcomitrella patens]
 gb|EDQ73199.1| predicted protein [Physcomitrella patens]
Length=573

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 111/155 (72%), Gaps = 6/155 (4%)
 Frame = +2

Query  221  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  400
            TCE+ YG +PC+ +  GN  L+++YGY+M  AA  LS GSELLL ++ PG+IGGL LPI 
Sbjct  50   TCEEKYGVMPCSVSLGGNAALLVIYGYMMLQAAQLLSDGSELLLTVMSPGIIGGLLLPIF  109

Query  401  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-----  565
            GA PDA+LI VSG   ++AEAQ +V VGMGLLAGS+VMLLT +WG+C++VG+CD+     
Sbjct  110  GAFPDALLITVSGFGANLAEAQEKVFVGMGLLAGSSVMLLTALWGSCLIVGRCDLVPHFA  169

Query  566  -QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
                VA D   TK F LT +GVTTD  T +A+ IM
Sbjct  170  NSKLVAKDRTLTKGFHLTETGVTTDQQTKWASWIM  204



>ref|XP_011083284.1| PREDICTED: uncharacterized protein LOC105165819 [Sesamum indicum]
Length=714

 Score =   118 bits (296),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 89/201 (44%), Positives = 123/201 (61%), Gaps = 17/201 (8%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVL-------APEEETCEQSYGFLPCTTTALG  271
            R + + S  LVSDG V      S    +G         +  EETCEQ YGFLPC+ T  G
Sbjct  20   RPLTNSSPGLVSDG-VEEENRFSSYNTIGFKGIIGNSGSSREETCEQMYGFLPCSKTIPG  78

Query  272  NLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGS  451
            +LFLILVY YL+F A +Y++SG E + +ILGPG+ G     ++G+LP+A+++L SGLS S
Sbjct  79   HLFLILVYEYLLFHAESYVASGGERIFKILGPGVFGASAFQVIGSLPEALILLASGLSSS  138

Query  452  VAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKA--------F  607
               AQ  V  G+GLLAGS+++LLT+IWGTC+++G     + +  +L D K         F
Sbjct  139  DEIAQECVLTGVGLLAGSSILLLTIIWGTCIILGSQSFSSHLHSNLSDNKRYNPLERLLF  198

Query  608  SL-TGSGVTTDVWTSYAAIIM  667
            SL  G GV TD+  SY ++IM
Sbjct  199  SLWPGHGVVTDLGASYTSMIM  219



>ref|XP_011460765.1| PREDICTED: uncharacterized protein LOC105350438 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=240

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 109/180 (61%), Gaps = 6/180 (3%)
 Frame = +2

Query  113  RLIVDRSSDLVSDG--GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            R +   SS+LVSDG   + +  + S ++  G  + E+  C   YG  PC+ T LG LFLI
Sbjct  21   RSLQHSSSNLVSDGTDNIEAVTQTSLLVFGGTYSFED--CSLLYGLFPCSYTVLGKLFLI  78

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            + Y  L  +  +Y+++G EL+ E+ G        +       DA+++LVSGL+ S   AQ
Sbjct  79   VGYVLLYIIGESYVAAGGELIFEVNGSVGANLFHILGAIP--DAIILLVSGLTASTETAQ  136

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            S+VS+G+GLL GSTV  LT +WG CV  GKCD++   + D  DTK FSL GSGV+T++WT
Sbjct  137  SKVSIGVGLLVGSTVFYLTAVWGLCVYAGKCDLEGKESQDTTDTKMFSLLGSGVSTEIWT  196



>ref|XP_007021646.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
 gb|EOY13171.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
Length=714

 Score =   118 bits (296),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 89/205 (43%), Positives = 117/205 (57%), Gaps = 25/205 (12%)
 Frame = +2

Query  113  RLIVDRSSDLVSDG---------GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTA  265
            R +   SS LVSDG           HS+G     L L  +   EE CEQ YGFLPC+ + 
Sbjct  24   RSLPQSSSQLVSDGIDGDDDPVQASHSSG-----LFLKEMESSEEYCEQMYGFLPCSNSI  78

Query  266  LGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLS  445
             G+LFLILVY YL+F   +YL+SG E + +I GPG  G     IL ALP+A+++L SGL 
Sbjct  79   YGHLFLILVYEYLLFHGESYLASGGEQMFKIPGPGFFGASAFQILSALPEALILLASGLM  138

Query  446  GSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKA-------  604
             +   AQ     G+GLLAGS+++LLT+IWGTC++VG  D+ N     +  T +       
Sbjct  139  NTKEVAQEYAYTGVGLLAGSSILLLTIIWGTCLIVGSHDLSNGAEYSILSTNSNSRILSC  198

Query  605  ----FSLTGSGVTTDVWTSYAAIIM  667
                 SL+G G+ TD  TSY A IM
Sbjct  199  NRLLHSLSGFGIITDQETSYTARIM  223



>ref|XP_011096402.1| PREDICTED: uncharacterized protein LOC105175605 isoform X2 [Sesamum 
indicum]
Length=562

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 106/160 (66%), Gaps = 0/160 (0%)
 Frame = +2

Query  188  LRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgp  367
            L    L+   ETCE +YGFLPC+T   G LFLI+ Y +L+ L   Y+++GS+L  +I GP
Sbjct  46   LEWSYLSATTETCEPTYGFLPCSTNVWGLLFLIVAYEFLLSLGGRYVATGSDLFFKITGP  105

Query  368  gligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVV  547
            G+ G      LG +P  +LILVS LSGS+  AQ + S+GMGL+AG+TVMLLT+IWGT VV
Sbjct  106  GIFGASLFQFLGTIPQIVLILVSTLSGSLEAAQQRASLGMGLVAGTTVMLLTLIWGTSVV  165

Query  548  VGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            +G  D+  A+ +D   +   +L G G+ TDV TSY A IM
Sbjct  166  LGSYDLSAAITIDKSGSPKSNLKGFGIVTDVETSYTARIM  205



>ref|XP_001752917.1| predicted protein [Physcomitrella patens]
 gb|EDQ82421.1| predicted protein [Physcomitrella patens]
Length=601

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 117/157 (75%), Gaps = 6/157 (4%)
 Frame = +2

Query  215  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  394
            E+ CE+ YG LPC+TT  GN  L+++YG+++  AA  LS GSELLL ++ PG+IGGL LP
Sbjct  78   EKECEEKYGILPCSTTLGGNASLLVIYGFMLLKAAQLLSDGSELLLAVMSPGIIGGLVLP  137

Query  395  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI---  565
            ILGALPDAML++VSGL  S AEAQ +V VGMGL+AGS++M+LT++WG+C+++G+CD+   
Sbjct  138  ILGALPDAMLVIVSGLGASQAEAQHEVLVGMGLVAGSSIMVLTLLWGSCLILGRCDLVPH  197

Query  566  ---QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
                  +A D   T+ F+LT +GVT D  T +A+ IM
Sbjct  198  PTTGQLIAKDRTLTQGFNLTKTGVTNDRQTKWASWIM  234



>ref|XP_006594741.1| PREDICTED: uncharacterized protein LOC100798009 isoform X1 [Glycine 
max]
Length=712

 Score =   116 bits (290),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 89/195 (46%), Positives = 124/195 (64%), Gaps = 15/195 (8%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSA---GEGSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLF  280
            R + +R+++LVSDG VH+     E S ++  G+     EE C+Q YGFLPCT    G+LF
Sbjct  25   RYLPERATELVSDG-VHNNLQHNETSYLVLKGIDDESFEEPCKQMYGFLPCTNNIFGHLF  83

Query  281  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  460
            LILVY YL+F   +YL+ G E + +ILGPG+ G     ILGALP+++++LVSGL  +   
Sbjct  84   LILVYEYLLFHGESYLAKGGEQIFKILGPGIFGASAFQILGALPESLILLVSGLVSNREI  143

Query  461  AQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ------NAVAVDLKDTKAFSLTGS  622
            AQ     G+GLLAGS+++LLTV+WG+CV+ G  + +      N+    LK      LTG 
Sbjct  144  AQEYAFSGVGLLAGSSILLLTVVWGSCVIAGSQEFEHDSPTSNSAHTSLKAL----LTGC  199

Query  623  GVTTDVWTSYAAIIM  667
            G+TTD+ TSY A IM
Sbjct  200  GITTDLETSYTARIM  214



>ref|XP_006594742.1| PREDICTED: uncharacterized protein LOC100798009 isoform X2 [Glycine 
max]
Length=705

 Score =   115 bits (289),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 89/195 (46%), Positives = 124/195 (64%), Gaps = 15/195 (8%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSA---GEGSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLF  280
            R + +R+++LVSDG VH+     E S ++  G+     EE C+Q YGFLPCT    G+LF
Sbjct  25   RYLPERATELVSDG-VHNNLQHNETSYLVLKGIDDESFEEPCKQMYGFLPCTNNIFGHLF  83

Query  281  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  460
            LILVY YL+F   +YL+ G E + +ILGPG+ G     ILGALP+++++LVSGL  +   
Sbjct  84   LILVYEYLLFHGESYLAKGGEQIFKILGPGIFGASAFQILGALPESLILLVSGLVSNREI  143

Query  461  AQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ------NAVAVDLKDTKAFSLTGS  622
            AQ     G+GLLAGS+++LLTV+WG+CV+ G  + +      N+    LK      LTG 
Sbjct  144  AQEYAFSGVGLLAGSSILLLTVVWGSCVIAGSQEFEHDSPTSNSAHTSLKAL----LTGC  199

Query  623  GVTTDVWTSYAAIIM  667
            G+TTD+ TSY A IM
Sbjct  200  GITTDLETSYTARIM  214



>ref|XP_001755925.1| predicted protein [Physcomitrella patens]
 gb|EDQ79210.1| predicted protein [Physcomitrella patens]
Length=568

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +2

Query  224  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  403
            CE++YG LPC+T+  GN+FL+L YGYL+F AA  +S GSELLLE++ PGL+GGL LPILG
Sbjct  59   CEETYGVLPCSTSIGGNVFLMLAYGYLLFTAAKLISDGSELLLEVMNPGLLGGLLLPILG  118

Query  404  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI--QNAV  577
            A PD++LILVSG+ GSV +AQ +V VG+G+LAGS+VMLLT+ W   ++ G+CD+   N  
Sbjct  119  AFPDSILILVSGVGGSVQQAQEEVMVGVGVLAGSSVMLLTIAWAGSLLAGRCDLDGPNGT  178

Query  578  AVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            A DL  T+     G+GVTTD  T   A IM
Sbjct  179  ATDLTLTRPLDPFGTGVTTDEQTRVGAWIM  208



>gb|EMT05376.1| hypothetical protein F775_06447 [Aegilops tauschii]
Length=503

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +2

Query  431  VSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAF  607
            VSGLSG+   AQSQV +GMGLLAGST+MLLT++WG+CV+VGKCD+ +N+  +D +DTKAF
Sbjct  32   VSGLSGTKEVAQSQVLIGMGLLAGSTIMLLTILWGSCVIVGKCDLSENSTTIDSQDTKAF  91

Query  608  SLTGSGVTTDVWTSYAAIIMA  670
            SL GSGV+TD+ TSYAA IMA
Sbjct  92   SLFGSGVSTDLQTSYAARIMA  112



>ref|XP_006594743.1| PREDICTED: uncharacterized protein LOC100798009 isoform X3 [Glycine 
max]
Length=694

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 124/195 (64%), Gaps = 15/195 (8%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHS---AGEGSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLF  280
            R + +R+++LVSDG VH+     E S ++  G+     EE C+Q YGFLPCT    G+LF
Sbjct  25   RYLPERATELVSDG-VHNNLQHNETSYLVLKGIDDESFEEPCKQMYGFLPCTNNIFGHLF  83

Query  281  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  460
            LILVY YL+F   +YL+ G E + +ILGPG+ G     ILGALP+++++LVSGL  +   
Sbjct  84   LILVYEYLLFHGESYLAKGGEQIFKILGPGIFGASAFQILGALPESLILLVSGLVSNREI  143

Query  461  AQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ------NAVAVDLKDTKAFSLTGS  622
            AQ     G+GLLAGS+++LLTV+WG+CV+ G  + +      N+    LK      LTG 
Sbjct  144  AQEYAFSGVGLLAGSSILLLTVVWGSCVIAGSQEFEHDSPTSNSAHTSLKAL----LTGC  199

Query  623  GVTTDVWTSYAAIIM  667
            G+TTD+ TSY A IM
Sbjct  200  GITTDLETSYTARIM  214



>ref|XP_005650712.1| hypothetical protein COCSUDRAFT_61158 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26168.1| hypothetical protein COCSUDRAFT_61158 [Coccomyxa subellipsoidea 
C-169]
Length=555

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 113/151 (75%), Gaps = 1/151 (1%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E CE++YG  PC+TT  G + L+L YG+++   A  LS GSELLLE+L PG+IGGL LPI
Sbjct  3    EACEETYGVFPCSTTLPGTIVLMLAYGFMLLQGANLLSDGSELLLEVLNPGIIGGLLLPI  62

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNA  574
            LGALPDA++I+VSGL G+  EA  QVSVG+G LAGST+MLLT+ WG  ++VG+CD+ +  
Sbjct  63   LGALPDALIIVVSGLGGTREEAAEQVSVGVGTLAGSTIMLLTIAWGGSLLVGRCDLNERG  122

Query  575  VAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
             A++ K T+ F   G+GVTTD +TS  A+IM
Sbjct  123  KAINKKLTRKFDAMGTGVTTDKFTSSGAVIM  153



>ref|XP_007021642.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
 gb|EOY13167.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
Length=478

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 116/205 (57%), Gaps = 25/205 (12%)
 Frame = +2

Query  113  RLIVDRSSDLVSDG---------GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTA  265
            R +   SS LVSDG           HS+G     L L  +   E+ CEQ YGFLPC+ + 
Sbjct  24   RSLPQSSSQLVSDGIDGDDDPVQASHSSG-----LFLKEMESSEKYCEQMYGFLPCSNSI  78

Query  266  LGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLS  445
             G+LFLILVY YL+F   +YL+SG E + +I GPG  G     IL ALP+A+++L SGL 
Sbjct  79   YGHLFLILVYEYLLFHGESYLASGGEQMFKIPGPGFFGASAFQILSALPEALILLASGLM  138

Query  446  GSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKA-------  604
             +   A      G+GLLAGS+++LLT+ WGTC++VG  D+ N     +  T++       
Sbjct  139  NTKEVAHEYAYTGVGLLAGSSILLLTITWGTCLIVGSRDLSNGAEYSILSTESNPRILSC  198

Query  605  ----FSLTGSGVTTDVWTSYAAIIM  667
                 SLTG G+ TD  TSY A IM
Sbjct  199  NRLLHSLTGFGIITDQETSYTARIM  223



>ref|XP_007025465.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
 gb|EOY28087.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
Length=574

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 121/199 (61%), Gaps = 17/199 (9%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I ++SS  VSDG   ++   S VL L +      TCE  YGFLPCTTT  G LFL++V
Sbjct  24   RSIKEKSSP-VSDGMDQTSK--SSVLELDLPITTTVTCEPIYGFLPCTTTLWGQLFLLVV  80

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            Y YL+ L+  ++SSGS L  ++ G G+ G     ILG +P  ML+LVSG S S    +++
Sbjct  81   YEYLLSLSEEFISSGSNLFFQMFGTGIFGASLFHILGIIPQVMLVLVSGASASGETIEAR  140

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQN--------------AVAVDLKDTKAFS  610
             ++GMGLLAGS V++LT++WG+ +  G  D+ +              +++ + K+ K FS
Sbjct  141  ATIGMGLLAGSAVLMLTLVWGSVIAFGSYDLSDTSSPNSSNPDNADTSISSNSKNKKPFS  200

Query  611  LTGSGVTTDVWTSYAAIIM  667
            LTG GV TD+ T Y+AIIM
Sbjct  201  LTGYGVRTDIETRYSAIIM  219



>ref|XP_001751608.1| predicted protein [Physcomitrella patens]
 gb|EDQ83925.1| predicted protein [Physcomitrella patens]
Length=576

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 6/154 (4%)
 Frame = +2

Query  224  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  403
            CE+ YG LPC+ +  GN  L+++YGY++  AA  LS GSELLL ++ PG+IGGL LPILG
Sbjct  43   CEEHYGILPCSVSLGGNAALLVIYGYMLLQAAQLLSDGSELLLTVMSPGIIGGLVLPILG  102

Query  404  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI------  565
            A PDA+LI VSGL  S AEAQ +V VGMGL+AGS+VMLLT +WG C++ G+CD+      
Sbjct  103  AFPDALLITVSGLGASQAEAQQEVLVGMGLVAGSSVMLLTALWGACLIFGRCDLIPHPAN  162

Query  566  QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
               VA D   TK FSLT +GVT+D  T +A+ IM
Sbjct  163  GKLVAKDRTLTKGFSLTETGVTSDEQTKWASWIM  196



>ref|XP_011096401.1| PREDICTED: uncharacterized protein LOC105175605 isoform X1 [Sesamum 
indicum]
Length=563

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 106/161 (66%), Gaps = 1/161 (1%)
 Frame = +2

Query  188  LRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgp  367
            L    L+   ETCE +YGFLPC+T   G LFLI+ Y +L+ L   Y+++GS+L  +I GP
Sbjct  46   LEWSYLSATTETCEPTYGFLPCSTNVWGLLFLIVAYEFLLSLGGRYVATGSDLFFKITGP  105

Query  368  gligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVV  547
            G+ G      LG +P  +LILVS LSGS+  AQ + S+GMGL+AG+TVMLLT+IWGT VV
Sbjct  106  GIFGASLFQFLGTIPQIVLILVSTLSGSLEAAQQRASLGMGLVAGTTVMLLTLIWGTSVV  165

Query  548  VGKCDIQNAVAVDLKDTKAFSLT-GSGVTTDVWTSYAAIIM  667
            +G  D+  A+ +D   +   +L  G G+ TDV TSY A IM
Sbjct  166  LGSYDLSAAITIDKSGSPKSNLKAGFGIVTDVETSYTARIM  206



>emb|CAN66793.1| hypothetical protein VITISV_034151 [Vitis vinifera]
Length=354

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGSTV+LLT++WG+CV+VGKCD+Q++VA DL+DTK FSLTGSGV+TD+WTSYAAII
Sbjct  1    MGLLAGSTVILLTIMWGSCVIVGKCDLQDSVAKDLQDTKGFSLTGSGVSTDIWTSYAAII  60

Query  665  M  667
            M
Sbjct  61   M  61



>ref|XP_007149414.1| hypothetical protein PHAVU_005G068300g [Phaseolus vulgaris]
 gb|ESW21408.1| hypothetical protein PHAVU_005G068300g [Phaseolus vulgaris]
Length=702

 Score =   111 bits (277),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 78/154 (51%), Positives = 106/154 (69%), Gaps = 8/154 (5%)
 Frame = +2

Query  224  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  403
            C+Q YGFLPC++  LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G     ILG
Sbjct  60   CKQMYGFLPCSSNILGHLFLILVYEYLLFHGESYLATGGEQIFKILGPGVFGASAFDILG  119

Query  404  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAV  583
            ALP+++++LV+G+S     AQ   S G+GLLAGS++ LLTV+WGTCV++GK +I N    
Sbjct  120  ALPESLILLVTGISSDKESAQEYASTGVGLLAGSSIFLLTVVWGTCVIIGKQEIINDSNS  179

Query  584  DLKDTKAF------SLTGSGVTTDVWTSYAAIIM  667
            D  D  ++      SLTG G+T DV T   AIIM
Sbjct  180  D--DLHSWSTGIKKSLTGYGITMDVDTREMAIIM  211



>gb|ABR26205.1| sodium/calcium exchanger protein [Oryza sativa Indica Group]
Length=313

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +2

Query  461  AQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTD  637
            AQSQV +GMGLLAGSTVMLLT++WG+CVVVGKCD+ +N+ A+DL+DTK FSL GSGV+TD
Sbjct  2    AQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTAIDLRDTKGFSLLGSGVSTD  61

Query  638  VWTSYAAIIMA  670
              TSYAA IMA
Sbjct  62   KQTSYAARIMA  72



>ref|XP_011000236.1| PREDICTED: uncharacterized protein LOC105107867 isoform X2 [Populus 
euphratica]
Length=711

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  496
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLL  156

Query  497  AGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS-LTGSGVTTDVWTSYAAIIM  667
            AG++++LLTV+WGTCV+VG          +   ++ FS LT  GVTTD+ TSY A IM
Sbjct  157  AGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTEFGVTTDLETSYTARIM  214



>ref|XP_008226451.1| PREDICTED: uncharacterized protein LOC103326025 [Prunus mume]
Length=725

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 120/202 (59%), Gaps = 22/202 (11%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGS---------GVLRLGVLAPEEETCEQSYGFLPCTTTALGNLF  280
            R   LVSDGG                  +L  G+ + EEETCEQ YGFLPC+ +  GN+F
Sbjct  25   RYFRLVSDGGTDHHHHPHNQNQSSSSSPLLFKGIDSAEEETCEQLYGFLPCSNSVYGNVF  84

Query  281  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  460
            L++VY YL+F   +YL++G E + +ILGPG+ G     +LGALP+++L+L SG+  S   
Sbjct  85   LMVVYEYLLFHGESYLAAGGEQIFQILGPGVFGASAFHVLGALPESLLLLASGIFNSKDI  144

Query  461  AQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTK-------------  601
            A   V  G+GLLAG++++LLT++WGTC++V   D  N ++ D + ++             
Sbjct  145  AAEYVYTGVGLLAGTSILLLTILWGTCIIVSSQDFPNKLSSDSEASRDSISSPPLSWKRL  204

Query  602  AFSLTGSGVTTDVWTSYAAIIM  667
              SLTG G+TTDV TS  A IM
Sbjct  205  PASLTGCGITTDVETSRLARIM  226



>ref|XP_004489085.1| PREDICTED: uncharacterized protein LOC101490110 [Cicer arietinum]
Length=500

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E C+Q YGFLPC+    G+LFLILVY YL+F   +YL++G E + +ILGPG+ G     I
Sbjct  59   EYCKQMYGFLPCSNNIFGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGASVFDI  118

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAV  577
            LGALP++++++V+GLS     AQ   S G+GLLAGS+++LLT++WGTCV+VGK +++N  
Sbjct  119  LGALPESLILVVTGLSSDKESAQEYASTGVGLLAGSSILLLTLVWGTCVIVGKQNLKNDS  178

Query  578  AVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
                +  K  SL G G+T DV T   A IM
Sbjct  179  YSSTRTIKQ-SLIGYGITMDVDTRKMARIM  207



>ref|XP_002272134.1| PREDICTED: uncharacterized protein LOC100243523 [Vitis vinifera]
 emb|CBI30651.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = +2

Query  221  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  400
            TCE +YGFLPCTT   G LFLI+VY +L+ L   Y+S+GS+L  +I G G+ G     IL
Sbjct  53   TCEPTYGFLPCTTVVWGELFLIVVYEFLLSLGEQYVSAGSDLFFQIFGTGIFGASLFHIL  112

Query  401  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVA  580
            G++P+  +ILV+GLSGS   A+S  ++ M +LAGS VM LTVIWG+CV  G  DI ++  
Sbjct  113  GSIPEVAMILVTGLSGSTDTAESMATMSMAMLAGSAVMQLTVIWGSCVFFGNYDISDSST  172

Query  581  VDL--KDTKAFSLTGSGVTTDVWTSYAAIIM  667
                  + K FSLTG GV TD  T Y A IM
Sbjct  173  SSALENNKKPFSLTGYGVRTDDATRYTARIM  203



>ref|XP_010060649.1| PREDICTED: uncharacterized protein LOC104448505 [Eucalyptus grandis]
Length=727

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 121/194 (62%), Gaps = 15/194 (8%)
 Frame = +2

Query  131  SSDLVSDG-----GVHSAGEGSGVLRLGV---LAPEEETCEQSYGFLPCTTTALGNLFLI  286
            SS L+SDG       H+      +L  G    L  E+E CEQ YGFLPC+ +  G+LFLI
Sbjct  33   SSPLISDGVDCGHDQHNGPPPDLILLKGAAGDLDDEDEVCEQMYGFLPCSYSIAGHLFLI  92

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            LVY YL+F   + ++SGSE + ++LGPG+ G     +LGALP+A+++L SGL  S   AQ
Sbjct  93   LVYEYLLFQGESCVASGSEQIFKMLGPGIFGASAFHVLGALPEALILLASGLLNSEEVAQ  152

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAF-------SLTGSG  625
              V  G+GLLAGS+++LLT++WGTCV++G   + + +  +  ++  F       SL GSG
Sbjct  153  EYVVTGVGLLAGSSILLLTLLWGTCVLLGSRKLSDGMEPNTLNSSRFSWKKFLSSLKGSG  212

Query  626  VTTDVWTSYAAIIM  667
            + TD+ TSY A IM
Sbjct  213  IITDLETSYTARIM  226



>ref|XP_002275985.2| PREDICTED: uncharacterized protein LOC100255777 [Vitis vinifera]
Length=541

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 119/184 (65%), Gaps = 12/184 (7%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEE----ETCEQSYGFLPCTTTALGNLFLILVYG  298
            SS LVSDG     GE   V +   +  EE     +C Q+YGF+PCT T  GN+ LILVY 
Sbjct  33   SSGLVSDGD----GE---VQQPAFIVFEEWASSYSCNQTYGFMPCTATVPGNILLILVYV  85

Query  299  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  478
             LM  AA  L  GSE+L+E+L PG+ G +FLP+L +L DA++ + S L G+   AQ+QVS
Sbjct  86   SLMLFAAKLLYDGSEILVELLSPGIAGAVFLPLLSSLLDAIINIASRLCGNGETAQNQVS  145

Query  479  VGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDT-KAFSLTGSGVTTDVWTSYA  655
             G+GLL GST +LLT++ G C++V KCD +N+     ++T + FSL GS ++TD+  SY 
Sbjct  146  AGLGLLTGSTAILLTLLGGCCIIVDKCDPENSREKASEETARGFSLAGSAISTDIRASYT  205

Query  656  AIIM  667
            A IM
Sbjct  206  ARIM  209



>ref|XP_003540477.1| PREDICTED: uncharacterized protein LOC100800452 [Glycine max]
Length=711

 Score =   108 bits (270),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 75/158 (47%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = +2

Query  206  APEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgliggl  385
            + +E  C+Q YGFLPC+   LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G  
Sbjct  63   SSDEHFCKQMYGFLPCSNNILGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGAS  122

Query  386  flpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI  565
               ILGALP++++++V+GLS     AQ   S G+GLLAGS++MLLTV+WGTCV +G+  +
Sbjct  123  AFDILGALPESLILVVTGLSSDKESAQEYASTGVGLLAGSSIMLLTVVWGTCVFIGRQKL  182

Query  566  QNAVAVDLKDTKAF----SLTGSGVTTDVWTSYAAIIM  667
            +N       ++ +     SLTG G+T DV T   A IM
Sbjct  183  KNDSNYGGTNSSSGGIKESLTGYGITMDVDTRKMARIM  220



>ref|XP_012092420.1| PREDICTED: uncharacterized protein LOC105650151 [Jatropha curcas]
 gb|KDP21052.1| hypothetical protein JCGZ_21523 [Jatropha curcas]
Length=571

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 103/187 (55%), Gaps = 3/187 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I +  S L+SDG +     GS  L++  L     TCE +YGFLPCTT   G LFL++V
Sbjct  21   RTIREDESILISDG-LMDHKNGSKFLKIDGLRTTTVTCEPTYGFLPCTTEIWGQLFLLVV  79

Query  293  YGYLMFLAATYlss-gsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
            Y YL+ L+A Y+S      L       +       +LG  P  +L+LV+G SG+    QS
Sbjct  80   YEYLLSLSAHYISEGSELFLETSGTDNIFSASVFQMLGMFPQVILVLVAGFSGTSDTVQS  139

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWT  646
               +GMGLLAGS +M LT+IWG+ V  G   + Q + + + ++   FSLTG GV TD  T
Sbjct  140  MAEMGMGLLAGSVIMNLTLIWGSVVAFGSYSLSQASTSSNTENQDKFSLTGYGVRTDNQT  199

Query  647  SYAAIIM  667
               A IM
Sbjct  200  KTTARIM  206



>emb|CAN78650.1| hypothetical protein VITISV_033126 [Vitis vinifera]
Length=541

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 118/184 (64%), Gaps = 12/184 (7%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEE----ETCEQSYGFLPCTTTALGNLFLILVYG  298
            SS LVSDG     GE   V +   +  EE     +C Q+YGF+PCT T  GN+ LILVY 
Sbjct  33   SSGLVSDGD----GE---VQQPAFIVFEEWASSYSCNQTYGFMPCTATVPGNILLILVYV  85

Query  299  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  478
             LM  AA  L  GSE+L+E+L PG+ G +FLP+L +L DA++ + S L G+   AQ+QVS
Sbjct  86   SLMLFAAKLLYDGSEILVELLSPGIAGAVFLPLLSSLLDAIINIASRLCGNGETAQNQVS  145

Query  479  VGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDT-KAFSLTGSGVTTDVWTSYA  655
             G+GLL GST +LLT++ G C++V KCD +N+     ++T + FSL GS  +TD+  SY 
Sbjct  146  AGLGLLTGSTAILLTLLGGCCIIVDKCDPENSREKASEETARGFSLAGSAXSTDIRASYT  205

Query  656  AIIM  667
            A IM
Sbjct  206  ARIM  209



>ref|XP_011000239.1| PREDICTED: uncharacterized protein LOC105107867 isoform X4 [Populus 
euphratica]
Length=652

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 115/186 (62%), Gaps = 10/186 (5%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  496
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLL  156

Query  497  AGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS-LTGS--------GVTTDVWTS  649
            AG++++LLTV+WGTCV+VG          +   ++ FS LTG+        GVTTD+ TS
Sbjct  157  AGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTDLETS  216

Query  650  YAAIIM  667
            Y A IM
Sbjct  217  YTARIM  222



>ref|XP_011000240.1| PREDICTED: uncharacterized protein LOC105107867 isoform X5 [Populus 
euphratica]
Length=652

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 115/186 (62%), Gaps = 10/186 (5%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  496
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLL  156

Query  497  AGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS-LTGS--------GVTTDVWTS  649
            AG++++LLTV+WGTCV+VG          +   ++ FS LTG+        GVTTD+ TS
Sbjct  157  AGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTDLETS  216

Query  650  YAAIIM  667
            Y A IM
Sbjct  217  YTARIM  222



>ref|XP_011000235.1| PREDICTED: uncharacterized protein LOC105107867 isoform X1 [Populus 
euphratica]
Length=719

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 115/186 (62%), Gaps = 10/186 (5%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  496
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLL  156

Query  497  AGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS-LTGS--------GVTTDVWTS  649
            AG++++LLTV+WGTCV+VG          +   ++ FS LTG+        GVTTD+ TS
Sbjct  157  AGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTDLETS  216

Query  650  YAAIIM  667
            Y A IM
Sbjct  217  YTARIM  222



>ref|XP_007213499.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
 gb|EMJ14698.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
Length=645

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 13/164 (8%)
 Frame = +2

Query  215  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  394
            EETCEQ YGFLPC+ +  G +FL++VY +L+F   +YL++G E + +ILGPG+ G     
Sbjct  1    EETCEQLYGFLPCSNSVYGQVFLMVVYEFLLFHGESYLAAGGEQIFQILGPGVFGASAFH  60

Query  395  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNA  574
            +LGALP+++L+L SGL  S   A   V  G+GLLAG++++LLT++WGTCV+VG  D  N 
Sbjct  61   VLGALPESLLLLASGLFNSKDIAAEYVYTGVGLLAGTSILLLTILWGTCVIVGSQDFPNE  120

Query  575  VAVDLKDTK-------------AFSLTGSGVTTDVWTSYAAIIM  667
            ++ D + +K               SLTG G+TTDV TS  A IM
Sbjct  121  LSSDSEASKDSISSPPLSWKRLPASLTGCGITTDVETSRLARIM  164



>emb|CBI20222.3| unnamed protein product [Vitis vinifera]
Length=661

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 103/159 (65%), Gaps = 9/159 (6%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E CEQ YGFLPC+    G+LFLI+VY YLMF   +Y++SG E + +ILGPG+ G     +
Sbjct  6    EECEQLYGFLPCSNNIFGHLFLIVVYEYLMFHGESYVASGGEQIFKILGPGVFGASVFQV  65

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNA-  574
            LGALP+++++L SGL  S   AQ  V   +GLLAGST++LLTV+WGTCV+VG C+   A 
Sbjct  66   LGALPESLILLASGLLNSKDTAQEYVLTAVGLLAGSTILLLTVLWGTCVIVGSCEFPGAG  125

Query  575  ----VAVDL--KDTKA--FSLTGSGVTTDVWTSYAAIIM  667
                V  +L  K  +     LTGSG+ TD  T Y A IM
Sbjct  126  SGATVDANLLQKPYRKILLMLTGSGIATDEETGYMARIM  164



>gb|EYU28049.1| hypothetical protein MIMGU_mgv1a003825mg [Erythranthe guttata]
Length=561

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 102/171 (60%), Gaps = 0/171 (0%)
 Frame = +2

Query  155  GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlss  334
            GV    +G+       L+   ETCE  YGFLPC+T   G LFLI+VY  L+     ++  
Sbjct  34   GVDWKSKGASSFLEWKLSATTETCEPIYGFLPCSTNVWGLLFLIVVYEILLSTGGKFVGI  93

Query  335  gsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVM  514
            GS L  +I GPG+ G     +LG  P  +L+LVS LSG+   AQ + ++GMGL+AG+TVM
Sbjct  94   GSNLFFQITGPGIFGASLFQLLGVFPQIVLVLVSSLSGTTEAAQQRATLGMGLVAGTTVM  153

Query  515  LLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            LLT+IWG  V++G  D+  A+ VD    +  +  G GV TDV TSY A IM
Sbjct  154  LLTLIWGISVILGSYDLSEAITVDDSGNQKDTPKGHGVVTDVETSYTARIM  204



>gb|KCW67437.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=429

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGSTVMLLTVIWG+C++VGKCD+ N+VA+D +DTK FSL GSGV+TD+WT YAA I
Sbjct  1    MGLLAGSTVMLLTVIWGSCIIVGKCDLHNSVAMDKQDTKGFSLKGSGVSTDLWTKYAARI  60

Query  665  M  667
            M
Sbjct  61   M  61



>ref|XP_011460767.1| PREDICTED: uncharacterized protein LOC105350439 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   104 bits (260),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 81/193 (42%), Positives = 117/193 (61%), Gaps = 17/193 (9%)
 Frame = +2

Query  134  SDLVSDGGVHSAG--EGSGVLRL------GVLAPEEETCEQSYGFLPCTTTALGNLFLIL  289
            SD V D   H+ G    +G +R       G+ A   ETCEQ YGFLPC+ +  G++FL++
Sbjct  42   SDGVDDHHHHNVGFNHSNGTIRSSFQLLKGIEAESNETCEQLYGFLPCSDSVYGHVFLMV  101

Query  290  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
            VY YL+F   +YL++G E + +ILGPG+ G     +LGALP+++L+L SG   +   A+ 
Sbjct  102  VYEYLLFHGESYLAAGGEQIFKILGPGVFGASAFHVLGALPESLLLLASGFFNTKEIAED  161

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS-------LTGSGV  628
             V  G+GLLAG++++LLTV+WGTCV+VG+    +    D   + AFS       LT  G+
Sbjct  162  YVYTGVGLLAGTSILLLTVLWGTCVIVGRQHFTS--CNDANSSTAFSWERILALLTNCGI  219

Query  629  TTDVWTSYAAIIM  667
            T D+ TS  A IM
Sbjct  220  TIDMETSVLARIM  232



>ref|XP_011082730.1| PREDICTED: uncharacterized protein LOC105165425 [Sesamum indicum]
Length=724

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 104/165 (63%), Gaps = 13/165 (8%)
 Frame = +2

Query  212  EEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  391
            E E+C Q YGFLPC+ +  G++FLI+VY YL+F   +Y++SG E + +ILGPG+ G    
Sbjct  72   ESESCSQMYGFLPCSESVWGHVFLIVVYEYLLFHGESYVASGGERIFKILGPGVFGACAF  131

Query  392  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQN  571
             ++G+LP+++++L SGL  S  EAQ  V  G+GLLAGS+++LLT++WGTCV++G  D  +
Sbjct  132  QLIGSLPESLILLASGLLNSKEEAQDCVLTGVGLLAGSSILLLTLLWGTCVILGTRDFSD  191

Query  572  AVAVDLKDTKA------------FSL-TGSGVTTDVWTSYAAIIM  667
             +  D   +               SL  G G+ TD WT Y A IM
Sbjct  192  YLQSDAASSSDCPNQKNPLERLFLSLWPGYGLVTDSWTGYTARIM  236



>ref|XP_002962226.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
 gb|EFJ37486.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
Length=546

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 110/162 (68%), Gaps = 4/162 (2%)
 Frame = +2

Query  194  LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgl  373
            L +L  E + C++SYG  PC+    G++FL++VY Y    AA  L +GSELLLEI  PG+
Sbjct  9    LSLLRREGKACQESYGIFPCSEKLGGSVFLLIVYSYAFVKAAQLLLNGSELLLEIAHPGI  68

Query  374  igglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVG  553
            +GGL LPI+  +PDA +ILVSG+ G    AQSQV +GMG+LAGSTV+LLT++WGT ++VG
Sbjct  69   VGGLCLPIICTIPDAAVILVSGIFGDKETAQSQVMIGMGVLAGSTVLLLTMLWGTALIVG  128

Query  554  KCDIQ----NAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            +CD+     +  A +   TK F LT +GVT    T+Y A I+
Sbjct  129  RCDLYEINGHKYAREKTLTKGFHLTETGVTLTKQTTYVAWIL  170



>ref|XP_002965139.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
 gb|EFJ33977.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
Length=546

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 110/162 (68%), Gaps = 4/162 (2%)
 Frame = +2

Query  194  LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgl  373
            L +L  E + C++SYG  PC+    G++FL++VY Y    AA  L +GSELLLEI  PG+
Sbjct  9    LSLLRREGKACQESYGIFPCSEKLGGSVFLLIVYSYAFVKAAQLLLNGSELLLEIAHPGI  68

Query  374  igglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVG  553
            +GGL LPI+  +PDA +ILVSG+ G    AQSQV +GMG+LAGSTV+LLT++WGT ++VG
Sbjct  69   VGGLCLPIICTIPDAAVILVSGIFGDKETAQSQVMIGMGVLAGSTVLLLTMLWGTALIVG  128

Query  554  KCDIQ----NAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            +CD+     +  A +   TK F LT +GVT    T+Y A I+
Sbjct  129  RCDLYEINGHKYAREKTLTKGFHLTETGVTLTKQTTYVAWIL  170



>gb|KHN36865.1| hypothetical protein glysoja_001596 [Glycine soja]
Length=640

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 101/155 (65%), Gaps = 18/155 (12%)
 Frame = +2

Query  236  YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpD  415
            YGFLPC+   LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G     ILGALP+
Sbjct  2    YGFLPCSNNILGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGASAFDILGALPE  61

Query  416  AMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKD  595
            +++++V+GLS     AQ   S G+GLLAGS++MLLTV+WGTCV++GK  ++N       D
Sbjct  62   SLILVVTGLSSDKESAQEYASTGVGLLAGSSIMLLTVVWGTCVIIGKQKLKN-------D  114

Query  596  TKAF-----------SLTGSGVTTDVWTSYAAIIM  667
              +F           SLTG G+T DV T   A IM
Sbjct  115  PDSFGTNSSNGGIKESLTGYGITMDVETRKMARIM  149



>ref|XP_009340418.1| PREDICTED: uncharacterized protein LOC103932516 [Pyrus x bretschneideri]
Length=725

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 120/194 (62%), Gaps = 15/194 (8%)
 Frame = +2

Query  131  SSDLVSDGGVH---SAGEGSGVLRLGV--LAPEEETCEQSYGFLPCTTTALGNLFLILVY  295
            SS LVSDG  H   +   GS +L  GV  +   E +CEQ YGFLPC+ +  G++FL++VY
Sbjct  36   SSQLVSDGTDHEYQNQSSGSLLLLKGVENIDSTESSCEQLYGFLPCSDSVFGHVFLMVVY  95

Query  296  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  475
             YL+F   +YL++G E + +ILGPG+ G     ++GALP+++L+L SG   S   AQ  V
Sbjct  96   EYLLFHGESYLAAGGEQIFKILGPGVFGASAFHVIGALPESLLLLASGFFNSKEVAQEYV  155

Query  476  SVGMGLLAGSTVMLLTVIWGTCVVVGK---CDIQNAVAVDLKDTKAF-------SLTGSG  625
              G+GLLAGS+++ LTV+WGTCV+V      D Q++ A +  D+          SLT  G
Sbjct  156  YTGVGLLAGSSILSLTVLWGTCVIVSSQEFSDHQSSKASNESDSSLLSWKRLPASLTDCG  215

Query  626  VTTDVWTSYAAIIM  667
            +TTD+ TS  A IM
Sbjct  216  ITTDLETSSLAKIM  229



>ref|XP_002305761.1| hypothetical protein POPTR_0004s05210g [Populus trichocarpa]
 gb|EEE86272.1| hypothetical protein POPTR_0004s05210g [Populus trichocarpa]
Length=560

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 111/185 (60%), Gaps = 3/185 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I +  SDL+SDG +   G+ +  L+L  L     TCE  YGF+PCTT   GNLFL++V
Sbjct  21   RSIRNEFSDLISDG-LDQKGQNN-FLQLNNLG-TTVTCEPIYGFMPCTTKVWGNLFLLVV  77

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            Y YL+ LA  Y+SSGS L  ++ G G+ GG    ++G  P  +L+LV+ LS S     S 
Sbjct  78   YEYLLSLADKYISSGSNLFFQMFGTGVFGGSVFYVVGKFPQIVLVLVTLLSASENVVGSA  137

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VS+ MG LAGST+M LT+IWG+ +  G  D+Q   + +L++       G GV TD+ T Y
Sbjct  138  VSMSMGFLAGSTMMSLTIIWGSVIAFGSYDLQQTNSSNLENKTPCLSNGYGVKTDIVTKY  197

Query  653  AAIIM  667
             A I+
Sbjct  198  TARII  202



>ref|XP_009352820.1| PREDICTED: uncharacterized protein LOC103944133 [Pyrus x bretschneideri]
Length=567

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 110/181 (61%), Gaps = 2/181 (1%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R S L+SDG ++     S  +++  L  +  TCE SYGFLPC T+  G LFLI+VY  L+
Sbjct  29   RDSSLISDG-INDETSQSSFVKVLNLKADSVTCEPSYGFLPCATSVWGLLFLIIVYEVLL  87

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
             LA  Y+S GSE+  E+ G G+ G     +LG +P   ++LV+ ++ +   A+    + M
Sbjct  88   SLADHYVSRGSEIFFELFGTGIFGASAFHLLGLIPQVGVVLVTVITATTETAEEMAKMNM  147

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQNA-VAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
             +LAGST+M+LT+IWG+ V  G  D+ ++  +   ++ K FSLTGSGV TDV T   A I
Sbjct  148  SMLAGSTIMILTLIWGSVVAFGSSDLSDSQTSSKSENKKPFSLTGSGVRTDVETQDTARI  207

Query  665  M  667
            M
Sbjct  208  M  208



>gb|ACU19365.1| unknown [Glycine max]
Length=197

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +2

Query  212  EEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  391
            +E  C+Q YGFLPC+   LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G    
Sbjct  65   DEHFCKQMYGFLPCSNNILGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGASAF  124

Query  392  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ  568
             ILGALP++++++V+GLS     AQ   S G+GLLAGS++MLLTV+WGTCV +G+  ++
Sbjct  125  DILGALPESLILVVTGLSSDKESAQEYASTGVGLLAGSSIMLLTVVWGTCVFIGRQKLK  183



>ref|XP_009353170.1| PREDICTED: uncharacterized protein LOC103944425 [Pyrus x bretschneideri]
Length=628

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 109/181 (60%), Gaps = 2/181 (1%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R S L+SDG     G+ S +L    L  +  TCE +YGFLPC T+  G L LI+VY  L+
Sbjct  89   RDSGLISDGINDIRGQSS-ILEAPNLKADSVTCEPTYGFLPCATSVWGLLSLIIVYEVLL  147

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
             LA  Y+S GSE   E+ G G+ G     +LG +P   ++LV+G++ +    +    + M
Sbjct  148  SLADQYVSKGSEFFFELFGTGIFGASAFHMLGLIPQVGMVLVTGVTATSTTVEEMAEMSM  207

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQNA-VAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            G+LAGST+M+LT+IWG+ V  G  D+ ++  + + ++ K FSLTGSGV TDV T   A I
Sbjct  208  GMLAGSTIMILTLIWGSVVAFGSYDLSDSQTSSNPENKKPFSLTGSGVRTDVETQDTARI  267

Query  665  M  667
            M
Sbjct  268  M  268



>ref|XP_008383659.1| PREDICTED: uncharacterized protein LOC103446347 [Malus domestica]
Length=563

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 109/181 (60%), Gaps = 2/181 (1%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R S L+SDG      + S V  L + A +  TCE  YGFLPC T+  G LFLI+VY  L+
Sbjct  25   RDSSLISDGINDETSQSSIVEALNLKA-DSVTCESIYGFLPCATSVWGFLFLIIVYEVLL  83

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
             LA  Y+S GSE+  E+ G G+ G     +LG +P   ++LV+G++ +   A+    + M
Sbjct  84   SLADHYVSRGSEIFFELFGTGIFGASAFHLLGLIPQVGVVLVTGITATTETAEEMAKMNM  143

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQNA-VAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
             +LAGST+M+LT+IWG+ V  G  D+ ++  + + ++   FSLTGSGV TDV T   A I
Sbjct  144  SMLAGSTIMILTLIWGSVVAFGSSDLSDSQTSSNSENKNPFSLTGSGVRTDVETQDTARI  203

Query  665  M  667
            M
Sbjct  204  M  204



>gb|AFW71107.1| hypothetical protein ZEAMMB73_054247, partial [Zea mays]
Length=179

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = +2

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAI  661
            MGLLAGSTVMLLT++WG+CVVVGKCD+ +N+ A D +DTK FSL GSGV+TDV TSYAA 
Sbjct  1    MGLLAGSTVMLLTLLWGSCVVVGKCDMSENSTATDSQDTKGFSLFGSGVSTDVQTSYAAR  60

Query  662  IMA  670
            IMA
Sbjct  61   IMA  63



>ref|XP_011027727.1| PREDICTED: uncharacterized protein LOC105127946 isoform X3 [Populus 
euphratica]
Length=429

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 110/185 (59%), Gaps = 3/185 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I +  S L+SDG +   G+ +  L+L  L     TCE  YGF+PCTT   GNLFL++V
Sbjct  21   RSIRNEFSYLISDG-LDKKGQNN-FLQLNNLGTSV-TCEPIYGFMPCTTKVWGNLFLLVV  77

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            Y YL+ LA  Y+SSGS L  ++ G G+ GG    +LG  P  +L+LV+ LS S     S 
Sbjct  78   YEYLLSLADKYISSGSNLFFQMFGTGIFGGSVFYVLGKFPQIVLVLVTLLSASEDVVGSA  137

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VS+ MG LAGST+M LT+IWG+ +  G  D+Q   + +L++       G GV TD+ T Y
Sbjct  138  VSMSMGFLAGSTMMSLTIIWGSVIAFGSYDLQQTPSSNLENKMLCLSNGYGVKTDIVTKY  197

Query  653  AAIIM  667
             A I+
Sbjct  198  TARII  202



>ref|XP_007214217.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
 gb|EMJ15416.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
Length=535

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 105/162 (65%), Gaps = 1/162 (1%)
 Frame = +2

Query  185  VLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilg  364
            V+++  L  +  TCE  YGFLPC T+  G LFLI+VY  L+ LA  Y+S+GS+L  E+ G
Sbjct  16   VIQIMDLQADTVTCEPIYGFLPCATSVWGLLFLIIVYEVLLSLADQYVSAGSDLFFELFG  75

Query  365  pgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCV  544
             G+ G     +LG +P   L+LV+G++GS   A++   + MGLLAGS +MLLT++WG+ V
Sbjct  76   TGIFGASAFHMLGMIPQVGLVLVTGVTGSTETAEAMAEMSMGLLAGSAIMLLTLVWGSVV  135

Query  545  VVGKCDIQ-NAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
              G  D+  +  + + ++ K+FSLTG GVTTDV T   A IM
Sbjct  136  AFGSHDLSVSQTSSNTENKKSFSLTGYGVTTDVETKATARIM  177



>gb|EYU26347.1| hypothetical protein MIMGU_mgv1a002045mg [Erythranthe guttata]
Length=723

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 105/166 (63%), Gaps = 9/166 (5%)
 Frame = +2

Query  197  GVLAPEEE--TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpg  370
            G+   EEE   CEQ YGFLPC+ +  G+LFLI+VY +L+F   +Y++SG E + +ILGPG
Sbjct  58   GIDGEEEELMICEQMYGFLPCSKSMTGHLFLIVVYEFLLFRGESYVASGGERIFKILGPG  117

Query  371  ligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVV  550
            + G     ++G+LP+A+++L SGL      A+  V  G+GLLAGST+++LT++WGTCV++
Sbjct  118  VFGASAFQVIGSLPEALILLASGLLSKEESAEEFVVTGVGLLAGSTILILTLLWGTCVIL  177

Query  551  GKCDIQNAVAVDLKDTK------AFSL-TGSGVTTDVWTSYAAIIM  667
            G     +  + D    +       FSL  G GV TD  T+Y A IM
Sbjct  178  GGQRFPHHTSSDHPKNQNPLEKILFSLWPGYGVLTDTETNYTARIM  223



>ref|XP_002979758.1| hypothetical protein SELMODRAFT_177778, partial [Selaginella 
moellendorffii]
 gb|EFJ19160.1| hypothetical protein SELMODRAFT_177778, partial [Selaginella 
moellendorffii]
Length=306

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 108/167 (65%), Gaps = 16/167 (10%)
 Frame = +2

Query  215  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  394
            E  CE+SYGFLPC++   GNLFL+  +G L+ +AA ++S GSE+LLE++ PGLIGGL LP
Sbjct  18   ENLCEESYGFLPCSSNIGGNLFLMATFGCLLLVAARFISKGSEVLLEVMNPGLIGGLLLP  77

Query  395  ilgalpDAMLILVSGLSGSVAE--------------AQSQVSVGMGLLAGSTVMLLTVIW  532
            ILGALPD +LIL SG  GS+ E              AQ +V VG+G+LAGST +LLT+ W
Sbjct  78   ILGALPDTLLILASGTGGSIQEINSELHSFFESFFQAQEEVMVGVGVLAGSTTLLLTLAW  137

Query  533  GTCVVVGKCDI--QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
               ++ G+CD+   +  A D   TK + L  +GVT D  T + A IM
Sbjct  138  AGSLLAGRCDLSSSDGTAKDEVLTKKYDLFHTGVTVDTQTRWGAWIM  184



>gb|KHN28092.1| hypothetical protein glysoja_007824 [Glycine soja]
Length=640

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 100/148 (68%), Gaps = 4/148 (3%)
 Frame = +2

Query  236  YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpD  415
            YGFLPC+   LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G     ILGALP+
Sbjct  2    YGFLPCSNNILGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGASAFDILGALPE  61

Query  416  AMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKD  595
            +++++V+GLS     AQ   S G+GLLAGS++MLLTV+WGTCV +G+  ++N       +
Sbjct  62   SLILVVTGLSSDKESAQEYASTGVGLLAGSSIMLLTVVWGTCVFIGRQKLKNDSNYGGTN  121

Query  596  TKA----FSLTGSGVTTDVWTSYAAIIM  667
            + +     SLTG G+T DV T   A IM
Sbjct  122  SSSGGIKESLTGYGITMDVDTRKMARIM  149



>ref|XP_002298902.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
 gb|EEE83707.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
Length=690

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 106/177 (60%), Gaps = 22/177 (12%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            LVSDG        S +L L G+ +  EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDSSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  496
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLNTREVAQEYVSTGVGLL  156

Query  497  AGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            AG++++LLT++WGTCV+VG                        VTTD+ TSY A IM
Sbjct  157  AGTSILLLTMLWGTCVIVGSF---------------------RVTTDLQTSYTARIM  192



>ref|XP_011027724.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
 ref|XP_011027725.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
Length=554

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 110/185 (59%), Gaps = 3/185 (2%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I +  S L+SDG +   G+ +  L+L  L     TCE  YGF+PCTT   GNLFL++V
Sbjct  21   RSIRNEFSYLISDG-LDKKGQNN-FLQLNNLG-TSVTCEPIYGFMPCTTKVWGNLFLLVV  77

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            Y YL+ LA  Y+SSGS L  ++ G G+ GG    +LG  P  +L+LV+ LS S     S 
Sbjct  78   YEYLLSLADKYISSGSNLFFQMFGTGIFGGSVFYVLGKFPQIVLVLVTLLSASEDVVGSA  137

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSY  652
            VS+ MG LAGST+M LT+IWG+ +  G  D+Q   + +L++       G GV TD+ T Y
Sbjct  138  VSMSMGFLAGSTMMSLTIIWGSVIAFGSYDLQQTPSSNLENKMLCLSNGYGVKTDIVTKY  197

Query  653  AAIIM  667
             A I+
Sbjct  198  TARII  202



>emb|CDP05977.1| unnamed protein product [Coffea canephora]
Length=710

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 74/161 (46%), Positives = 103/161 (64%), Gaps = 11/161 (7%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            E C+Q YGFLPC+ T LG+LFLI+VY YL+F   + ++SG E + +ILGPG+ G     +
Sbjct  61   EGCKQLYGFLPCSNTLLGHLFLIVVYEYLLFRGESLVASGGERIFKILGPGIFGASAFHV  120

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQN--  571
            LG+LP+A+++L SGL  S   AQ  V  G GLLAGST++LLT++WGTCV+V   +  N  
Sbjct  121  LGSLPEALILLASGLLNSRETAQEYVLTGAGLLAGSTILLLTIVWGTCVIVASQEFPNGK  180

Query  572  ---AVAVDLKDTKA-----FSLT-GSGVTTDVWTSYAAIIM  667
               + A    D ++     FS + G G+T D  TS+ A IM
Sbjct  181  KRTSFASSSTDNRSQFKRLFSRSKGYGLTMDTRTSHTARIM  221



>gb|EYU43357.1| hypothetical protein MIMGU_mgv1a003865mg [Erythranthe guttata]
Length=454

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 108/177 (61%), Gaps = 4/177 (2%)
 Frame = +2

Query  137  DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            D V D G  S+   +       L+  E TC+  YGFLPC+T   G LFLI+VY  L+ + 
Sbjct  38   DGVDDCGRRSSSTSAPSFLEWGLSAAETTCDPIYGFLPCSTNLWGLLFLIVVYEILLSIG  97

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  496
              Y+ +GS L  +I GPG+ GG    +LG +P  +++LVS LSG++A AQ + ++GMGL+
Sbjct  98   GQYVVNGSTLFFQITGPGVFGGSLFQLLGTIPQVVMVLVSALSGTIAAAQQRATLGMGLV  157

Query  497  AGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            AG+TVMLLT+IWGT V++G  D+  +       T   +   SGV TDV TSY A IM
Sbjct  158  AGTTVMLLTLIWGTSVILGSSDLSQSSTT----TATTTTDSSGVVTDVETSYIARIM  210



>gb|KCW67430.1| hypothetical protein EUGRSUZ_F01186 [Eucalyptus grandis]
Length=649

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 99/151 (66%), Gaps = 7/151 (5%)
 Frame = +2

Query  236  YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpD  415
            YGFLPC+ +  G+LFLILVY YL+F   +Y++S +E +  +LGPG+ G     +LGALP+
Sbjct  2    YGFLPCSYSTAGHLFLILVYEYLLFHGESYVASATEQIFNMLGPGIFGASAFHVLGALPE  61

Query  416  AMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKD  595
            A+++L SGL  S   AQ  V  G+GLLAGS+++LLT++WGTC+++G  +  +    +  +
Sbjct  62   ALILLASGLLNSEEVAQEYVVTGVGLLAGSSILLLTLLWGTCILLGSREFSDGRESNPSN  121

Query  596  TKAFSL-------TGSGVTTDVWTSYAAIIM  667
            +   SL        GSG+ TD+ TSY A IM
Sbjct  122  SSKLSLKKFVSTFKGSGIITDLETSYTARIM  152



>ref|XP_008225191.1| PREDICTED: uncharacterized protein LOC103324855 [Prunus mume]
Length=563

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 107/181 (59%), Gaps = 1/181 (1%)
 Frame = +2

Query  128  RSSDLVSDGGV-HSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYL  304
            R S L+S+GG+  +      +L +  L  +  TCE  YGFLPC T+  G LFLI+VY  L
Sbjct  25   RDSGLISNGGIIDNRISQPSILEVVDLQADTVTCEPVYGFLPCATSVWGLLFLIIVYEVL  84

Query  305  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  484
            + LA  Y+S+GSEL  E+ G G+ G     +LG +P   L+LV+G++GS   A+    + 
Sbjct  85   LSLADQYVSAGSELFFELFGTGIFGASAFHVLGMIPQVGLVLVTGVTGSTETAEVMAEMS  144

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            MGLLAGS +MLLT++WG+ V  G  D+  +      +    +L+G GVTTDV T   A I
Sbjct  145  MGLLAGSAIMLLTLVWGSVVAFGSHDLSVSQTSSNTENNMHALSGYGVTTDVETKATARI  204

Query  665  M  667
            M
Sbjct  205  M  205



>ref|XP_008386229.1| PREDICTED: uncharacterized protein LOC103448738 [Malus domestica]
 ref|XP_008359329.1| PREDICTED: uncharacterized protein LOC103423037 [Malus domestica]
Length=725

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 118/194 (61%), Gaps = 15/194 (8%)
 Frame = +2

Query  131  SSDLVSDG---GVHSAGEGSGVLRLGV--LAPEEETCEQSYGFLPCTTTALGNLFLILVY  295
            SS LVSDG      +    S +L  GV  +   E +CEQ YGFLPC+ +  G++FL++VY
Sbjct  36   SSQLVSDGTDXAYQNQSSCSLLLLKGVENIDSTESSCEQLYGFLPCSDSVFGHVFLMVVY  95

Query  296  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  475
             YL+F   +YL++G E + +ILGPG+ G     ++GALP+++L+L SG   S   AQ  V
Sbjct  96   EYLLFHGESYLAAGGEQIFKILGPGVFGASAFHVIGALPESLLLLASGFFNSKEVAQEYV  155

Query  476  SVGMGLLAGSTVMLLTVIWGTCVVVGK---CDIQNAVAVDLKDTKAF-------SLTGSG  625
              G+GLLAGS+++ LT++WGTCV+V      D Q++ A +  D+          SLT  G
Sbjct  156  YTGVGLLAGSSILSLTILWGTCVIVSSQZFSDNQSSKASNESDSSLLSWKRLPASLTXCG  215

Query  626  VTTDVWTSYAAIIM  667
            +TTD+ TS  A IM
Sbjct  216  ITTDLETSSLAKIM  229



>gb|EYU43358.1| hypothetical protein MIMGU_mgv1a003865mg [Erythranthe guttata]
Length=559

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 108/177 (61%), Gaps = 4/177 (2%)
 Frame = +2

Query  137  DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            D V D G  S+   +       L+  E TC+  YGFLPC+T   G LFLI+VY  L+ + 
Sbjct  38   DGVDDCGRRSSSTSAPSFLEWGLSAAETTCDPIYGFLPCSTNLWGLLFLIVVYEILLSIG  97

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  496
              Y+ +GS L  +I GPG+ GG    +LG +P  +++LVS LSG++A AQ + ++GMGL+
Sbjct  98   GQYVVNGSTLFFQITGPGVFGGSLFQLLGTIPQVVMVLVSALSGTIAAAQQRATLGMGLV  157

Query  497  AGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            AG+TVMLLT+IWGT V++G  D+  +       T   +   SGV TDV TSY A IM
Sbjct  158  AGTTVMLLTLIWGTSVILGSSDLSQSSTT----TATTTTDSSGVVTDVETSYIARIM  210



>ref|XP_006370033.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
 gb|ERP66602.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
Length=632

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 21/151 (14%)
 Frame = +2

Query  215  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  394
            EE CEQ YGFLPC++   G+LFLI VY Y++F    YL+SG E +  ILGPG+ G     
Sbjct  6    EEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHGEGYLASGGEKIFRILGPGVFGASAFQ  65

Query  395  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNA  574
            +LGALP+++++L SGL  +   AQ  VS G+GLLAG++++LLT++WGTCV+ G       
Sbjct  66   VLGALPESLILLASGLLNTREVAQEYVSTGVGLLAGTSILLLTMLWGTCVIAGSF-----  120

Query  575  VAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
                            GVTTD+ TSY A IM
Sbjct  121  ----------------GVTTDLETSYTARIM  135



>gb|EMS45634.1| hypothetical protein TRIUR3_11261 [Triticum urartu]
Length=427

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +2

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAI  661
            MGLLAGST+MLLT++WG+CV+VGKCD+ +++  +D +DTKAFSL GSGV+TD+ TSYAA 
Sbjct  1    MGLLAGSTIMLLTILWGSCVIVGKCDLSEDSTTIDSQDTKAFSLFGSGVSTDLQTSYAAR  60

Query  662  IMA  670
            IMA
Sbjct  61   IMA  63



>ref|XP_005839482.1| hypothetical protein GUITHDRAFT_159252 [Guillardia theta CCMP2712]
 gb|EKX52502.1| hypothetical protein GUITHDRAFT_159252 [Guillardia theta CCMP2712]
Length=503

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLK  592
            D+ +I++SGL G+  +A+ QVSVG+G LAGST+MLL++ WG  + VG+CDIQ+ +A+D +
Sbjct  42   DSAMIVMSGLGGTREQAKEQVSVGIGTLAGSTIMLLSIAWGGSLWVGRCDIQDGMAIDRR  101

Query  593  DTKAFSLTGSGVTTDVWTSYAAIIM  667
             T++F LT +GVTTD  T   A IM
Sbjct  102  LTRSFDLTNTGVTTDESTKLNAYIM  126



>ref|XP_009352959.1| PREDICTED: uncharacterized protein LOC103944258 [Pyrus x bretschneideri]
Length=564

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 106/181 (59%), Gaps = 2/181 (1%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R S LVS  G+++    S +L    L  +  TCE +YGFLPC T+  G LFL++VY  L+
Sbjct  25   RDSGLVS-YGINNVISQSSILEALNLKADYVTCEPTYGFLPCATSVWGLLFLVIVYEVLL  83

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
             LA  Y+S GS +  E+ G G+ G     +L  +P   ++LV G++ +   A+    + M
Sbjct  84   SLADHYVSRGSGIFFELFGTGVFGASAFHMLSLIPQVGMVLVIGVTATTETAEEMAEMSM  143

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQNA-VAVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
             +LAGS++M+LT+IWG+ V  G  D+ ++  + + ++ K FSLT SGV TD+     A I
Sbjct  144  SMLAGSSIMILTIIWGSVVAFGSSDLSDSQTSSNPENKKPFSLTDSGVRTDIEARDTARI  203

Query  665  M  667
            M
Sbjct  204  M  204



>gb|EYU44996.1| hypothetical protein MIMGU_mgv1a025835mg [Erythranthe guttata]
Length=651

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 99/151 (66%), Gaps = 7/151 (5%)
 Frame = +2

Query  236  YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpD  415
            YGFLPC+ +  G++FLI+VY YL+F   +Y+++G E + +ILGPG+ G     I+GA P+
Sbjct  2    YGFLPCSKSIWGHVFLIVVYEYLLFHGESYVAAGGERIFKILGPGVFGACAFQIIGAFPE  61

Query  416  AMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAV----AV  583
            A+++LVSGL  +   AQ  V  G+GLLAGS+++LLT++WGTCV++G     N+     + 
Sbjct  62   ALILLVSGLLNNKEVAQECVLTGVGLLAGSSILLLTLVWGTCVILGSQHFPNSSQSSDST  121

Query  584  DLKDTKAFSLT---GSGVTTDVWTSYAAIIM  667
            +    + F L+   G GV TD WT Y A IM
Sbjct  122  NQNPIQNFFLSLWPGYGVVTDSWTGYTAWIM  152



>gb|ACN36915.1| unknown [Zea mays]
Length=455

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +2

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAI  661
            MGLLAGSTV LLT++WGTCVVVGKCD+     AVD+ DTK FSLTG+GVTTDV TSYAA 
Sbjct  1    MGLLAGSTVFLLTLLWGTCVVVGKCDLGPGREAVDVTDTKGFSLTGTGVTTDVQTSYAAR  60

Query  662  IM  667
            IM
Sbjct  61   IM  62



>ref|XP_011000237.1| PREDICTED: uncharacterized protein LOC105107867 isoform X3 [Populus 
euphratica]
Length=702

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 99/192 (52%), Gaps = 39/192 (20%)
 Frame = +2

Query  140  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  317  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE------AQSQVS  478
              YL+SG E +                         IL  G+ G+ A        +S + 
Sbjct  97   EGYLASGGEKI-----------------------FRILGPGVFGASAFQVLGALPESLIL  133

Query  479  VGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS-LTGS--------GVT  631
            +G+GLLAG++++LLTV+WGTCV+VG          +   ++ FS LTG+        GVT
Sbjct  134  LGVGLLAGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVT  193

Query  632  TDVWTSYAAIIM  667
            TD+ TSY A IM
Sbjct  194  TDLETSYTARIM  205



>ref|XP_002522528.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39828.1| conserved hypothetical protein [Ricinus communis]
Length=521

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 92/170 (54%), Gaps = 5/170 (3%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I D SS L+SDG        S +L+L  L     TCE +YGFLPCTT   G LFL++V
Sbjct  21   RSIRDESSILLSDG--MDQKNQSVILQLDDLRTSV-TCEPTYGFLPCTTEVWGQLFLMIV  77

Query  293  YGYLMFLAATYlss-gsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  469
            Y YL+ L+A Y+S      L       +       +LG  P  +L+LV+ + G     ++
Sbjct  78   YEYLLSLSAKYISEGSELFLETSGTENIFSANLFQMLGMFPQVILVLVAAVGGEADTVET  137

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFSLT  616
               +GMGLLAGS +M LT+IWG+ V  G  D+ Q + + + +    FSLT
Sbjct  138  MAEMGMGLLAGSVIMNLTLIWGSVVAFGSYDLSQTSTSSNTESQNKFSLT  187



>emb|CAN66375.1| hypothetical protein VITISV_037549 [Vitis vinifera]
Length=1347

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 82/146 (56%), Positives = 94/146 (64%), Gaps = 38/146 (26%)
 Frame = +2

Query  230   QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  409
             Q+Y F+PCTTT +GN+FL++VYGYLM LAATYLSSGSELLLEILG GL+GGLFLPILGAL
Sbjct  1056  QTYRFMPCTTTTVGNIFLVVVYGYLMSLAATYLSSGSELLLEILGLGLVGGLFLPILGAL  1115

Query  410   pDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDL  589
             PDAMLILVS LSGS   AQSQ S+                                    
Sbjct  1116  PDAMLILVSRLSGSTETAQSQDSIA-----------------------------------  1140

Query  590   KDTKAFSLTGSGVTTDVWTSYAAIIM  667
                K FS+ GSGV+TD+ TSY AII+
Sbjct  1141  ---KGFSVIGSGVSTDIRTSYTAIIL  1163



>emb|CDY27823.1| BnaC09g28500D [Brassica napus]
Length=124

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  470  QVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
             VSVGMGLLAGSTV LL++IW TC VVGKC+I++ +AV+ +DT+ F L  SGV+ DVWT
Sbjct  49   SVSVGMGLLAGSTVTLLSIIWRTCKVVGKCNIRDTIAVNNQDTRTFHLKDSGVSVDVWT  107



>ref|XP_010101519.1| hypothetical protein L484_008850 [Morus notabilis]
 gb|EXB88531.1| hypothetical protein L484_008850 [Morus notabilis]
Length=536

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 102/184 (55%), Gaps = 13/184 (7%)
 Frame = +2

Query  134  SDLVSDGGVHSAGEGSGVLRLGV--LAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            SD V D       E  G  +LG+  L     TC   YGFLPC TT  G LF+I+VY  L+
Sbjct  2    SDTVKD-------ETGGSTKLGLVNLKATTVTCVPIYGFLPCATTFWGLLFMIVVYEVLL  54

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
                 Y+S+GS+L  E  G GL G     +LG +P   +ILV+G+  S      Q  + M
Sbjct  55   SYGGQYISAGSDLFFETFGTGLFGASIFQLLGTIPQVGIILVTGIIASPDSVDEQAEISM  114

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQ---NAVAVDL-KDTKAFSLTGSGVTTDVWTSYA  655
            GLLAG T+M LT+IWG  VV+G  D+     + + DL +D K F+L+G GVT DV TS  
Sbjct  115  GLLAGKTIMSLTLIWGLVVVLGSHDLSLPATSTSSDLEQDEKPFTLSGYGVTFDVETSKT  174

Query  656  AIIM  667
            A IM
Sbjct  175  ARIM  178



>gb|EMT26603.1| hypothetical protein F775_16568 [Aegilops tauschii]
Length=252

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +2

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKA-FSLTGSGVTTDVWTSYAA  658
            MGLLAGST+ LLTV+WGTCV  GKCDI  N VA+D KDTK  F  TGSG++TD  TS+ A
Sbjct  1    MGLLAGSTIFLLTVVWGTCVFAGKCDIGPNGVAIDSKDTKGWFRFTGSGISTDNETSWTA  60

Query  659  IIMA  670
             IMA
Sbjct  61   RIMA  64



>ref|XP_004293919.1| PREDICTED: uncharacterized protein LOC101312324 [Fragaria vesca 
subsp. vesca]
Length=562

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = +2

Query  203  LAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligg  382
            L  +  TCE  YGFLPC T+  G  F+++VY  L++LA ++++SGSEL  ++ G GL G 
Sbjct  53   LKADTVTCEPIYGFLPCATSFWGLAFMVIVYEILLYLANSFITSGSELFFQMYGTGLFGA  112

Query  383  lflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCD  562
                +LG +P   ++LV+G++G+   A++  ++ +G++AGS +MLLT++WG+ V  G  D
Sbjct  113  SVFHLLGTVPQVGIVLVTGVTGTAETAEAMATMNIGMVAGSAIMLLTLVWGSVVAFGSYD  172

Query  563  IQNAVAVDLKDTK-AFSLTGSGVTTDVWTSYAAIIM  667
            I ++     +  K  FS+TG GVTTD  T   A IM
Sbjct  173  ISDSPTSSNRGHKNRFSITGYGVTTDAETRSTARIM  208



>ref|XP_008371442.1| PREDICTED: uncharacterized protein LOC103434855 [Malus domestica]
Length=564

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 107/181 (59%), Gaps = 2/181 (1%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R S L+SDG  +     S +L    L  +  TCE +YGFLPC T+  G L LI+VY  L+
Sbjct  25   RDSGLISDG-XNDVISQSSILEALNLKADSVTCEPTYGFLPCATSVWGLLSLIIVYEVLL  83

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
             LA  Y+S GSE   E+ G G+ G     +LG +P   ++LV+G++ +    +    + M
Sbjct  84   SLADQYVSKGSEFFFELFGTGIFGASAFHMLGLIPQVGMVLVTGVTATTTTVEEMAEMNM  143

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQNAV-AVDLKDTKAFSLTGSGVTTDVWTSYAAII  664
            G+LAGST+M+LT+IWG+ V  G  D+ ++  + + +  K FSLTGSGV TDV T   A I
Sbjct  144  GMLAGSTIMILTLIWGSVVAFGSYDLSDSQSSSNPEXKKPFSLTGSGVRTDVETRDTARI  203

Query  665  M  667
            M
Sbjct  204  M  204



>ref|XP_008383883.1| PREDICTED: uncharacterized protein LOC103446524 [Malus domestica]
Length=594

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 109/209 (52%), Gaps = 30/209 (14%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R S LVS+G ++     S +L    L  +  TCE  +GFLPC T+  G LFL+++Y  L+
Sbjct  25   RDSGLVSNG-INDEISQSSILEGLNLKSDSVTCEPIFGFLPCATSVWGLLFLVIIYEVLL  83

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
             LA  Y+S GSE+  E+ G G+ G     +LG +P   ++LV G++ +    +    + M
Sbjct  84   SLADQYVSRGSEIFFELFGTGVFGASAFHLLGLIPQVGMVLVIGVTATTETVEEMAEMSM  143

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQN-----------------AVAV---DLKD----  595
             +LAGS++M+LT+IWG+ V  G  D+                   AVA    DL D    
Sbjct  144  SMLAGSSIMILTLIWGSVVAFGSSDLSESQTLSNPENKKPLTGLLAVAFGSSDLSDSQTS  203

Query  596  -----TKAFSLTGSGVTTDVWTSYAAIIM  667
                 TK FSLTGSGV TDV T   A IM
Sbjct  204  SNPENTKPFSLTGSGVRTDVETRDTARIM  232



>ref|XP_009352958.1| PREDICTED: uncharacterized protein LOC103944256 [Pyrus x bretschneideri]
Length=594

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 112/211 (53%), Gaps = 32/211 (15%)
 Frame = +2

Query  128  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  307
            R S LVS+G ++     S +L    L  +  TCE  +GFLPC T+  G LFL++VY  L+
Sbjct  25   RDSGLVSNG-INDEISQSSILDALNLKADSVTCEPIFGFLPCATSVWGLLFLVIVYEVLL  83

Query  308  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  487
             LA  Y+S GSE+ LE+ G G+ G     +LG +P   ++LV G++ +    +    + M
Sbjct  84   SLADQYVSRGSEIFLELFGTGVFGASAFHLLGLIPQVGMVLVIGVTAATETVEEMAEMSM  143

Query  488  GLLAGSTVMLLTVIWGTCVVVGKCDIQN-------------------AVAV---DLKDT-  598
             +LAGS++M+LT+IWG+ V  G  D+ +                   AVA+   DL D+ 
Sbjct  144  SMLAGSSIMILTLIWGSVVAFGSSDLSDSQTLSNPENKKPFSLTGLLAVALGSSDLSDSQ  203

Query  599  --------KAFSLTGSGVTTDVWTSYAAIIM  667
                    K FSLTGSGV TDV T   A IM
Sbjct  204  TSSNPENKKPFSLTGSGVRTDVETRDTARIM  234



>gb|EYU44995.1| hypothetical protein MIMGU_mgv1a002795mg [Erythranthe guttata]
Length=637

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +2

Query  230  QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  409
            Q YGFLPC+ T  G+ FLILVY YL+F A +Y++SG + + +ILGPGL G     I+G+L
Sbjct  16   QMYGFLPCSQTNPGHFFLILVYQYLLFHAESYVASGGKRIFKILGPGLFGASVFQIIGSL  75

Query  410  pDAMLILVSGLSGSVAE-AQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGK  556
            P+A+++L SGL+    E A+  V  G+GLLAGS+++LLT+IWGTCV++G+
Sbjct  76   PEALILLASGLTNRSNETAEELVLTGVGLLAGSSILLLTLIWGTCVLLGR  125



>ref|XP_010058976.1| PREDICTED: uncharacterized protein LOC104446874 [Eucalyptus grandis]
 gb|KCW74042.1| hypothetical protein EUGRSUZ_E02666 [Eucalyptus grandis]
Length=561

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  221  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  400
            TCE +YGFLPCTT   G LFL+ VY  L+ LA  Y+SSGSEL   + G G+ G     +L
Sbjct  52   TCEPTYGFLPCTTELWGELFLVAVYECLLALAGKYVSSGSELFFRMFGTGIFGASLFQML  111

Query  401  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI--QNA  574
            G  P  +++L + +S S  + +S  ++ M +LAGS +  L+++WG+ V  G CD    + 
Sbjct  112  GTFPQVIIMLANAISASSDKTESVATMAMAMLAGSAIFSLSLVWGSIVAFGSCDFSSSSP  171

Query  575  VAVDLKDTK-AFSLTGSGVTTDVWTSYAAIIM  667
             + D + T+    LTGSGV TD  T Y A IM
Sbjct  172  SSSDRQPTREPCRLTGSGVETDPETKYIARIM  203



>emb|CDY43114.1| BnaC05g36630D [Brassica napus]
Length=71

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWT  646
            MGLLAGSTV LL++IW TC VVGKC+I++ +AV+ +DT++F L  SGV+ DVWT
Sbjct  1    MGLLAGSTVTLLSIIWRTCTVVGKCNIRDTIAVNNQDTRSFHLKDSGVSVDVWT  54



>gb|AFK39630.1| unknown [Lotus japonicus]
Length=123

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 8/63 (13%)
 Frame = +2

Query  137  DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  316
            D VSDGG       S ++RL     EE TCEQ+YGFLPCTTT LGNLFLIL+YG+LMF A
Sbjct  32   DPVSDGG------WSSIIRLPTA--EESTCEQTYGFLPCTTTVLGNLFLILIYGFLMFKA  83

Query  317  ATY  325
            AT+
Sbjct  84   ATF  86



>gb|KEH38644.1| calcium ion-binding protein, putative [Medicago truncatula]
Length=133

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 10/65 (15%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            + DL+SDG        S VLRL   A  + TCEQ+YGFLPCTTT LGNLFLILVYG+LM+
Sbjct  42   TRDLISDG--------SNVLRLPTEA--DSTCEQTYGFLPCTTTVLGNLFLILVYGFLMY  91

Query  311  LAATY  325
             AAT+
Sbjct  92   TAATF  96



>ref|XP_002522529.1| calmodulin, putative [Ricinus communis]
 gb|EEF39829.1| calmodulin, putative [Ricinus communis]
Length=703

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 72/197 (37%), Positives = 101/197 (51%), Gaps = 13/197 (7%)
 Frame = +2

Query  113  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  292
            R I   S + +   GV      S +L L  L   + TC   Y FLPC T   G +F I+V
Sbjct  21   RSIRSSSDEQLVPSGVEHLEINSSILSLKPLNSTQHTCVHYYSFLPCATNIPGFIFQIVV  80

Query  293  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  472
            + YL+ L   +L+ G + L  ILG G+ G     IL  LP  +LIL SGL+ +  +A+++
Sbjct  81   FEYLLILGDKFLTKGRQQLFSILGVGIYGATLFRILAVLPTNVLILASGLAQNREDARAR  140

Query  473  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFS------------LT  616
            +  G GLLAGSTV  LT+ WG CV++G+  I      + +++KA +            L 
Sbjct  141  IENGAGLLAGSTVFCLTLQWGICVLLGRRKIAQESEPN-QESKAPTKRCLMVKQRLSRLK  199

Query  617  GSGVTTDVWTSYAAIIM  667
              GV TD  T Y A IM
Sbjct  200  EYGVRTDTKTKYTAGIM  216



>emb|CAN66796.1| hypothetical protein VITISV_034154 [Vitis vinifera]
Length=247

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 5/75 (7%)
 Frame = +2

Query  113  RLIVDR--SSDLVSDGGVHSAGEGSGVLRLGVLAP--EEETCEQSYGFLPCTTTALGNLF  280
            R+I +R  S+DLVSD  VH    GS  L L   +     ++C+++YGF+PCTTT +GNLF
Sbjct  24   RVISNRTLSTDLVSDD-VHDHRNGSPYLLLRSFSAVSASDSCDETYGFMPCTTTIVGNLF  82

Query  281  LILVYGYLMFLAATY  325
            LI+VYGYLMFLAATY
Sbjct  83   LIVVYGYLMFLAATY  97



>ref|XP_002500016.1| Ca2+:Cation antiporter family [Micromonas sp. RCC299]
 gb|ACO61274.1| Ca2+:Cation antiporter family [Micromonas sp. RCC299]
Length=554

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 104/157 (66%), Gaps = 7/157 (4%)
 Frame = +2

Query  218  ETCEQS--YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  391
            +TC  S  +G  P       ++FL LVYGY +  AA ++S GSELLLEIL PGL+GGL L
Sbjct  3    DTCTTSGPFGVFPDCEGLGASVFLNLVYGYALLTAAGFISDGSELLLEILSPGLVGGLLL  62

Query  392  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-Q  568
            PILGA+PDA +I+ SGL  S  +AQ QVSVGMG LAGSTVMLLT+ WG  +++G+CD+  
Sbjct  63   PILGAVPDAAVIIASGLGASKEDAQEQVSVGMGTLAGSTVMLLTIAWGGSLILGRCDLSS  122

Query  569  NAVAVDLKDTKAFSLT----GSGVTTDVWTSYAAIIM  667
               A++   T   S+T     +GVTTD  T   A++M
Sbjct  123  RGTAINKTLTPKASITEAANETGVTTDTDTKTNAMVM  159



>ref|XP_009605371.1| PREDICTED: uncharacterized protein LOC104099939 [Nicotiana tomentosiformis]
Length=706

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 67/189 (35%), Positives = 104/189 (55%), Gaps = 11/189 (6%)
 Frame = +2

Query  116  LIVDRSSDLVSDG---GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            L ++ S+ L+SDG    +++   G  +L  G      + C+Q YG  PC  +  G +FLI
Sbjct  23   LRINSSNQLISDGIDDRLNNQEYGQHLLSSG------KICQQLYGIFPCANSIGGYIFLI  76

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VY YL+      +S GS+ L  IL  G+ G     IL   P  ++++ SG+S S  +AQ
Sbjct  77   VVYQYLLITGERLVSRGSKALFNILRTGIFGATIFQILKTFPRIVMVIASGVSASKEKAQ  136

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFS-LTGSGVTTDV  640
            +Q+S G+    G+TV  LT++WG CV+ G  D+ + + A     +K+F  L+ +GVT D 
Sbjct  137  NQISSGISTTVGATVFNLTLMWGICVIFGTKDMTEKSAAESSSPSKSFKGLSETGVTIDP  196

Query  641  WTSYAAIIM  667
             TS  A IM
Sbjct  197  KTSKTAGIM  205



>gb|KDP21053.1| hypothetical protein JCGZ_21524 [Jatropha curcas]
Length=686

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 86/172 (50%), Gaps = 8/172 (5%)
 Frame = +2

Query  176  GSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellle  355
             S +L    +   E TC   YGFLPC T   G +F I++  YL+ +    L+ G + L  
Sbjct  38   NSSILSPKAINSTEHTCVHYYGFLPCATNVPGFIFQIVILEYLLLVGDKILTKGRQQLFS  97

Query  356  ilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWG  535
             LG G+ G     IL  LP  +L+L SGL+ +   AQ+++  G G LAGSTV  LT+ WG
Sbjct  98   FLGVGIYGATVFRILAVLPTIVLVLASGLAQNKEAAQARIENGAGTLAGSTVFYLTLQWG  157

Query  536  TCVVVGKCDIQNAVAVDLKDTKAFSLTGS--------GVTTDVWTSYAAIIM  667
             CVV+G+  +          T  FSL           GV TD  TSY A IM
Sbjct  158  ICVVLGRTKVTKESPQSTSTTTGFSLVKKRLSIFKEYGVETDQKTSYTAKIM  209



>ref|XP_006340117.1| PREDICTED: uncharacterized protein LOC102587762 [Solanum tuberosum]
Length=703

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 67/184 (36%), Positives = 90/184 (49%), Gaps = 5/184 (3%)
 Frame = +2

Query  131  SSDLVSDGGVHSAGEGSGVLRLGVLA--PEEETCEQSYGFLPCTTTALGNLFLILVYGYL  304
            SS+ +SDG  H     S  L LG L   P  + C   YGF PC     G LF+I+ + YL
Sbjct  33   SSERISDGVEHKLKNQSNYLSLGNLKELPSGDQCNHIYGFFPCAENIGGYLFMIVTFQYL  92

Query  305  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  484
            + L    L+ GS  L  IL  G+ G    P L   P  ++   SGL  +  +AQ  VS  
Sbjct  93   LILGEKVLAIGSNRLFSILDTGIFGASIFPTLITWPRIVMAFASGLLVTREKAQVSVSSA  152

Query  485  MGLLAGSTVMLLTVIWGTCVVVGKCDI---QNAVAVDLKDTKAFSLTGSGVTTDVWTSYA  655
            +G   GS+V+ LTV+WG CV++G+ +     N+        K   L G GV T+  T Y 
Sbjct  153  LGSNVGSSVLNLTVLWGICVILGRQNTSTNSNSAESSTSTLKLEDLKGRGVVTNNLTGYI  212

Query  656  AIIM  667
            A IM
Sbjct  213  AGIM  216



>emb|CAN78275.1| hypothetical protein VITISV_037788 [Vitis vinifera]
Length=529

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +2

Query  221  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  400
            TCE +YGFLPCTT   G LFLI+VY +L+ L   Y+S+GS+L  +I G G+ G     IL
Sbjct  53   TCEPTYGFLPCTTVVWGELFLIVVYEFLLSLGEQYVSAGSDLFFQIFGTGIFGASLFHIL  112

Query  401  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCV  544
            G++P+  +ILV+GLSGS   A+S  ++ M +LAGS VM LTVIWG  V
Sbjct  113  GSIPEVAMILVTGLSGSTDTAESMATMSMAMLAGSAVMQLTVIWGXGV  160



>gb|KIY91568.1| hypothetical protein MNEG_16396, partial [Monoraphidium neglectum]
Length=166

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = +2

Query  413  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLK  592
            DA++I+ SGL  S + A+ ++SVGMG LAGSTVMLLT++WG  V++G+CD+ +       
Sbjct  32   DALIIINSGLHESRSAAREEISVGMGTLAGSTVMLLTIVWGGSVLLGRCDLDDVTGAQRD  91

Query  593  DTKA---FSLTGSGVTTDVWTSYAAIIM  667
             T+    F L  +GV+TD  T  +A  M
Sbjct  92   RTRTRPWFDLVNTGVSTDAATPRSAWAM  119



>ref|XP_002113975.1| hypothetical protein TRIADDRAFT_57950 [Trichoplax adhaerens]
 gb|EDV23065.1| hypothetical protein TRIADDRAFT_57950 [Trichoplax adhaerens]
Length=518

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 91/141 (65%), Gaps = 4/141 (3%)
 Frame = +2

Query  218  ETCEQ-SYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  394
            +TC Q  + + PC     GNL L++ YG ++ +AA  +S G+ELLL++  P  I G  + 
Sbjct  56   DTCYQMRHSWFPCANNIPGNLILMVFYGTILIMAAKLISDGAELLLDLGLPASIIGGLVL  115

Query  395  ilg-alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-Q  568
             L  A+PDA++ILVSGL G    AQ ++SVGMG LAGST+MLLT+ W   +++G+CD+ +
Sbjct  116  PLLGAIPDAVMILVSGL-GPKELAQRKISVGMGALAGSTIMLLTLAWAGSLIIGRCDLGE  174

Query  569  NAVAVDLKDTKAFSLTGSGVT  631
            +  A++      FSLT  GVT
Sbjct  175  DGKAIEKTGADKFSLTRQGVT  195



>ref|XP_642144.1| hypothetical protein DDB_G0278609 [Dictyostelium discoideum AX4]
 gb|EAL68477.1| hypothetical protein DDB_G0278609 [Dictyostelium discoideum AX4]
Length=574

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +2

Query  248  PCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLI  427
            PC+ T +G+L L+  YG L+   A ++S GSE L+EIL PGLIGGL LPIL ALPDA++I
Sbjct  105  PCSNTVVGDLMLMAAYGVLLAFGAKFISDGSEGLMEILDPGLIGGLVLPILSALPDAIII  164

Query  428  LVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAF  607
            +V+G  GS    Q+Q+S+G+G LAGST+ML+T+ W   +++ +CDI+   +VD   T  F
Sbjct  165  VVAGAFGS--NPQAQLSIGIGTLAGSTIMLMTIPWSLSLILSRCDIRGGQSVDGTLTNKF  222

Query  608  SLTGSGVTTDVWTSYAAIIM  667
            SLT +G T D  T   A +M
Sbjct  223  SLTKTGTTVDDDTPTNAKVM  242



>gb|EYU28050.1| hypothetical protein MIMGU_mgv1a023246mg [Erythranthe guttata]
Length=682

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +2

Query  221  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  400
            TC+  YGFLPC+  A G +F I+VY  L+      +  GS++L  I+G G  GG+   IL
Sbjct  7    TCDHQYGFLPCSENAAGYIFQIMVYQGLLIFGEKQIGKGSKVLFHIIGAGKFGGIIFRIL  66

Query  401  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNA  574
             ALP  ML++VSG+  S   AQ+QVS+G+G+ AG TV  LTV WG CV+VG+ D++  
Sbjct  67   MALPSMMLMIVSGVFSSKENAQNQVSLGVGIYAGITVFSLTVQWGICVIVGRRDLKEK  124



>ref|XP_009803286.1| PREDICTED: uncharacterized protein LOC104248681 [Nicotiana sylvestris]
Length=706

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 69/189 (37%), Positives = 103/189 (54%), Gaps = 11/189 (6%)
 Frame = +2

Query  116  LIVDRSSDLVSDGGVHSAGE---GSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  286
            L ++ S+ L+SDG  H       G  +L  G      + C+Q YG  PC  +  G +FLI
Sbjct  23   LRLNSSNQLISDGIDHRLNNQEYGQHLLSSG------KICQQLYGIFPCANSIGGYIFLI  76

Query  287  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  466
            +VY YL+      +S GS+ L  ILGPG+ G     IL  LP  ++++ SG++ S  +AQ
Sbjct  77   IVYQYLLITGERLVSRGSKTLFNILGPGIFGATIFQILKTLPRIVMVIASGVAASKEKAQ  136

Query  467  SQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVAVDLKDTKAFS-LTGSGVTTDV  640
            +Q+S G+    G+TV  LT++WG CV+ G  D+ + + A      K+   L+ +GVT D 
Sbjct  137  NQISSGISTTVGATVFNLTLMWGICVIFGTKDMTEKSAAASSSPFKSLKGLSETGVTIDP  196

Query  641  WTSYAAIIM  667
             TS  A IM
Sbjct  197  KTSKTAGIM  205



>ref|XP_003288984.1| hypothetical protein DICPUDRAFT_153287 [Dictyostelium purpureum]
 gb|EGC34495.1| hypothetical protein DICPUDRAFT_153287 [Dictyostelium purpureum]
Length=574

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 97/140 (69%), Gaps = 2/140 (1%)
 Frame = +2

Query  248  PCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLI  427
            PCT   +G LFL+ VYG ++ L A ++S GSE LLEIL PGLIGGL LPIL A PDA++I
Sbjct  114  PCTNNIVGMLFLMAVYGSILALGAKFISDGSEGLLEILDPGLIGGLVLPILSAAPDAIII  173

Query  428  LVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAF  607
            LVSG   S    Q+Q+++G+G LAGST+MLLT+ + + +++ +CD++   +VD   T  +
Sbjct  174  LVSGAFSS--NPQAQLAIGIGTLAGSTIMLLTIPFSSSLILARCDLRGGESVDGVLTHKW  231

Query  608  SLTGSGVTTDVWTSYAAIIM  667
            SLT +GVT D  T   A IM
Sbjct  232  SLTKTGVTVDDDTKVGAKIM  251



>emb|CDY09702.1| BnaC07g33590D [Brassica napus]
Length=136

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 5/79 (6%)
 Frame = +2

Query  413  DAMLILVSG--LSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVD  586
            DAMLI+ S   L+         VSVGMGLLAGSTVMLL++IW TC V+GKC+I++ +AV+
Sbjct  15   DAMLIMDSRSLLNLICLIVFVSVSVGMGLLAGSTVMLLSIIWRTCTVLGKCNIRDTIAVN  74

Query  587  LKDTKAFSLTGSGVTTDVW  643
             +DT++F L    V   VW
Sbjct  75   NQDTRSFHL---KVVEFVW  90



>gb|KCW44589.1| hypothetical protein EUGRSUZ_L01893 [Eucalyptus grandis]
Length=422

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  512  MLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAFSLTGSGVTTDVWTSYAAIIM  667
            MLLTVIWG+CV+VGKCD+Q++ AVD  DTK FSLTGSG+T D  T  AA IM
Sbjct  1    MLLTVIWGSCVLVGKCDLQDSTAVDKLDTKGFSLTGSGITIDNLTRSAAWIM  52



>tpg|DAA52870.1| TPA: hypothetical protein ZEAMMB73_004216 [Zea mays]
Length=144

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 9/70 (13%)
 Frame = +2

Query  137  DLVSDGGVHSAGEGSGVLRLGVLAPEEET-------CEQSYGFLPCTTTALGNLFLILVY  295
             L+SDGG   + +   V+RL   +P           CEQSYGFLPCTTT LGNLFL+L Y
Sbjct  28   RLISDGG--PSAQLLSVIRLSGSSPAAGAAAKAEEKCEQSYGFLPCTTTVLGNLFLVLTY  85

Query  296  GYLMFLAATY  325
            GYLM+ AATY
Sbjct  86   GYLMYKAATY  95



>ref|XP_004361492.1| hypothetical protein DFA_05775 [Dictyostelium fasciculatum]
 gb|EGG23641.1| hypothetical protein DFA_05775 [Dictyostelium fasciculatum]
Length=582

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 97/145 (67%), Gaps = 6/145 (4%)
 Frame = +2

Query  242  FLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAM  421
            F PC+ T  G + L+ +YG ++   A  +S GSELL+E++  G+IGGL LP+L A PDAM
Sbjct  107  FWPCSGTVGGMILLMAIYGAILAFGAKIISDGSELLMEVIDAGIIGGLLLPLLSAFPDAM  166

Query  422  LILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQ---NAVAVDLK  592
            +I++SG   S  + Q+Q++VG+G LAGST+MLLT+ W   +V+ +CD++   N  A+D K
Sbjct  167  IIIMSGAFSS--DPQTQLAVGIGTLAGSTIMLLTIPWSASMVLARCDLKDNGNGAAIDNK  224

Query  593  DTKAFSLTGSGVTTDVWTSYAAIIM  667
               +FSLT +GVT D  T   A IM
Sbjct  225  -CSSFSLTKTGVTVDDDTPTNAKIM  248



>ref|XP_011096404.1| PREDICTED: uncharacterized protein LOC105175608 [Sesamum indicum]
Length=707

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 62/147 (42%), Positives = 87/147 (59%), Gaps = 2/147 (1%)
 Frame = +2

Query  137  DLVSDGGVHS-AGEGSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLFLILVYGYLMF  310
            +L+SDG  H    + S  + +   AP    TC   YGFLPC   A G +F ILVY  L+ 
Sbjct  35   ELISDGVDHRFENQSSSSVSVYSSAPSIPSTCNHQYGFLPCAENAAGYIFQILVYQGLLT  94

Query  311  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  490
                 +  GS++L  I+G G IGG+   IL +LP  ML++VSG+  S   AQSQVS+G+G
Sbjct  95   FGERQIGRGSQVLFHIIGAGKIGGIIFRILMSLPSMMLMIVSGVFSSKENAQSQVSLGVG  154

Query  491  LLAGSTVMLLTVIWGTCVVVGKCDIQN  571
            + AG TV  LT+ WG CV+ G+ ++ +
Sbjct  155  IYAGMTVFSLTLQWGICVIFGRRELTD  181



>ref|XP_004233846.1| PREDICTED: uncharacterized protein LOC101251749 [Solanum lycopersicum]
Length=716

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 58/154 (38%), Positives = 86/154 (56%), Gaps = 4/154 (3%)
 Frame = +2

Query  218  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  397
            +TCEQ YG  PC     G +FLI+V  YL+    + +S GS+ L  ILG G+ G     I
Sbjct  61   KTCEQVYGVFPCANNIAGYIFLIVVCQYLLNTGESLISRGSKTLFNILGTGIFGATVFQI  120

Query  398  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAV  577
            L  LP  ++++ SG+S S  +AQ Q+S G+    G+TV  LT++WG C++ G  ++ +  
Sbjct  121  LMTLPRIVMVIASGVSASKEKAQFQISSGISTTVGATVFNLTLMWGICLICGTKNMTDKP  180

Query  578  AVDLKDTKAF----SLTGSGVTTDVWTSYAAIIM  667
                +++  F    SL  +GV  D  TSY A IM
Sbjct  181  DSQSEESSPFKRLKSLQDTGVRIDKETSYTAGIM  214



>ref|XP_001627159.1| predicted protein [Nematostella vectensis]
 gb|EDO35059.1| predicted protein [Nematostella vectensis]
Length=997

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 58/145 (40%), Positives = 88/145 (61%), Gaps = 7/145 (5%)
 Frame = +2

Query  227  EQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilga  406
            E+  G  PC++T  GN  L++ YG ++ +AA  +S G+ELLL++  P  I G  +  L  
Sbjct  55   EERNGIYPCSSTITGNFLLMVFYGAILGVAAKCISDGAELLLDLGLPASIVGGMVLPLLG  114

Query  407  lp-DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDI-QNAVA  580
               D+ +I+VSGL    A+AQ +++VGMG LAGST+MLLT  W   V++G+CD+ ++  A
Sbjct  115  AVPDSAIIIVSGLG---ADAQDKLNVGMGTLAGSTIMLLTAAWAGSVLIGRCDLNRHGEA  171

Query  581  VDLKDTKAFSLTGSGVTT--DVWTS  649
            ++       S T  GVT   DV T+
Sbjct  172  IEKTGYGKLSCTKQGVTVLPDVVTA  196



>gb|EFA85983.1| hypothetical protein PPL_01216 [Polysphondylium pallidum PN500]
Length=580

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = +2

Query  248  PCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLI  427
            PC+ T +G L L+  YG ++   A  +S GSELLLEIL PG+IGGL LP+L A PDA +I
Sbjct  104  PCSGTVVGMLILMAGYGVILAYGAKLISDGSELLLEILDPGIIGGLLLPLLSAFPDAAII  163

Query  428  LVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIQNAVAVDLKDTKAF  607
            +VSG   S A AQ+Q+SVG+G LAGSTVMLLT+ +   +++ +CD++N  AVD   T   
Sbjct  164  VVSGAFSSQAMAQAQLSVGLGTLAGSTVMLLTIPYSASLLLARCDLRNGYAVDGVCTSR-  222

Query  608  SLTGSGVTTDVWTSYAAIIM  667
            SLT +GVT D  T   A IM
Sbjct  223  SLTKTGVTVDDDTPLNAKIM  242



>gb|AFW71108.1| hypothetical protein ZEAMMB73_635590 [Zea mays]
Length=160

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 42/70 (60%), Gaps = 5/70 (7%)
 Frame = +2

Query  125  DRSSDLVSDGGVHSAGEGSGVLRLGVLA---PEEETCEQSYGFLPCTTTALGNLFLILVY  295
            DRS  L+  G        + VLRL   A   P  E CE +YGFLPCT TA GNLFL+L Y
Sbjct  32   DRS--LLLAGSSDEVAAATSVLRLPSAAGEDPAPEACEMTYGFLPCTDTAPGNLFLVLAY  89

Query  296  GYLMFLAATY  325
            G LMF AATY
Sbjct  90   GLLMFKAATY  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239542226394