BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig812

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603801.1|  PREDICTED: crt homolog 3 isoform X2                102   1e-22   Nicotiana tomentosiformis
ref|XP_009603800.1|  PREDICTED: crt homolog 3 isoform X1                102   1e-22   Nicotiana tomentosiformis
ref|XP_009789545.1|  PREDICTED: crt homolog 3                           102   1e-21   Nicotiana sylvestris
ref|XP_010938545.1|  PREDICTED: crt homolog 1-like                      100   7e-21   Elaeis guineensis
ref|XP_011080445.1|  PREDICTED: crt homolog 1                         99.0    1e-20   
gb|KDO54779.1|  hypothetical protein CISIN_1g0128211mg                97.4    1e-20   Citrus sinensis [apfelsine]
ref|XP_002526057.1|  conserved hypothetical protein                   97.1    3e-20   
ref|XP_010099798.1|  hypothetical protein L484_004373                 97.1    3e-20   
gb|EYU46190.1|  hypothetical protein MIMGU_mgv1a006625mg              97.8    4e-20   Erythranthe guttata [common monkey flower]
ref|XP_007015263.1|  CRT-like transporter 3 isoform 2                 97.1    4e-20   
ref|XP_004500069.1|  PREDICTED: crt homolog 1-like                    97.4    5e-20   Cicer arietinum [garbanzo]
ref|XP_006349792.1|  PREDICTED: crt homolog 1-like                    97.8    5e-20   Solanum tuberosum [potatoes]
gb|KJB35700.1|  hypothetical protein B456_006G124500                  96.7    6e-20   Gossypium raimondii
ref|XP_004252884.1|  PREDICTED: crt homolog 1                         97.4    7e-20   Solanum lycopersicum
ref|XP_004140194.1|  PREDICTED: crt homolog 1                         97.4    8e-20   Cucumis sativus [cucumbers]
ref|XP_008449652.1|  PREDICTED: crt homolog 3                         97.1    9e-20   Cucumis melo [Oriental melon]
emb|CAN62639.1|  hypothetical protein VITISV_040590                   94.0    1e-19   Vitis vinifera
ref|XP_007015262.1|  CRT-like transporter 3 isoform 1                 96.7    1e-19   
ref|XP_006446307.1|  hypothetical protein CICLE_v10017793mg           97.1    1e-19   Citrus clementina [clementine]
emb|CDP19492.1|  unnamed protein product                              96.7    1e-19   Coffea canephora [robusta coffee]
gb|KJB35701.1|  hypothetical protein B456_006G124500                  96.3    1e-19   Gossypium raimondii
ref|XP_006470531.1|  PREDICTED: crt homolog 1-like                    96.7    1e-19   Citrus sinensis [apfelsine]
gb|KHN23935.1|  Crt like 1                                            95.5    1e-19   Glycine soja [wild soybean]
gb|KJB35699.1|  hypothetical protein B456_006G124500                  96.3    2e-19   Gossypium raimondii
gb|KJB83546.1|  hypothetical protein B456_013G253300                  95.5    2e-19   Gossypium raimondii
gb|EPS69263.1|  hypothetical protein M569_05507                       92.4    2e-19   Genlisea aurea
gb|KHG29231.1|  Crt                                                   96.7    2e-19   Gossypium arboreum [tree cotton]
gb|KJB83545.1|  hypothetical protein B456_013G253300                  95.1    3e-19   Gossypium raimondii
gb|KHG16222.1|  Crt                                                   95.5    3e-19   Gossypium arboreum [tree cotton]
ref|XP_003556785.1|  PREDICTED: crt homolog 1-like                    95.1    3e-19   Glycine max [soybeans]
gb|KHN28163.1|  Crt like 1                                            94.4    3e-19   Glycine soja [wild soybean]
gb|KEH28375.1|  CRT (chloroquine-resistance transporter)-like tra...  94.4    3e-19   Medicago truncatula
ref|XP_003567491.1|  PREDICTED: crt homolog 1-like                    95.1    4e-19   Brachypodium distachyon [annual false brome]
gb|KJB83544.1|  hypothetical protein B456_013G253300                  95.1    5e-19   Gossypium raimondii
ref|XP_010031716.1|  PREDICTED: crt homolog 1                         95.1    6e-19   Eucalyptus grandis [rose gum]
ref|XP_003528593.1|  PREDICTED: crt homolog 1-like                    94.4    6e-19   Glycine max [soybeans]
ref|XP_008227269.1|  PREDICTED: crt homolog 1                         94.7    6e-19   Prunus mume [ume]
ref|XP_012065873.1|  PREDICTED: crt homolog 1-like                    94.7    7e-19   Jatropha curcas
ref|XP_009368715.1|  PREDICTED: crt homolog 1-like isoform X1         94.4    1e-18   Pyrus x bretschneideri [bai li]
gb|AET00194.2|  CRT (chloroquine-resistance transporter)-like tra...  94.0    1e-18   Medicago truncatula
ref|XP_004491229.1|  PREDICTED: crt homolog 3-like isoform X1         94.0    1e-18   Cicer arietinum [garbanzo]
ref|XP_002456955.1|  hypothetical protein SORBIDRAFT_03g046260        93.6    1e-18   Sorghum bicolor [broomcorn]
dbj|BAJ91104.1|  predicted protein                                    93.6    2e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010651520.1|  PREDICTED: uncharacterized protein LOC100265...  93.6    2e-18   
ref|XP_002276436.2|  PREDICTED: uncharacterized protein LOC100265...  93.6    2e-18   Vitis vinifera
emb|CBI24254.3|  unnamed protein product                              92.0    2e-18   Vitis vinifera
ref|XP_007141505.1|  hypothetical protein PHAVU_008G201700g           92.4    4e-18   Phaseolus vulgaris [French bean]
ref|XP_003545164.1|  PREDICTED: crt homolog 1-like                    92.4    4e-18   Glycine max [soybeans]
ref|XP_007146130.1|  hypothetical protein PHAVU_006G014700g           92.0    5e-18   Phaseolus vulgaris [French bean]
gb|AFW83925.1|  hypothetical protein ZEAMMB73_730584                  92.0    5e-18   
ref|XP_008656857.1|  PREDICTED: uncharacterized protein LOC103636...  92.0    5e-18   
gb|KEH17262.1|  CRT (chloroquine-resistance transporter)-like tra...  90.9    6e-18   Medicago truncatula
gb|ABF94479.1|  expressed protein                                     90.1    7e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006399733.1|  hypothetical protein EUTSA_v10015653mg           91.7    8e-18   Eutrema salsugineum [saltwater cress]
emb|CDX91169.1|  BnaC02g04280D                                        91.7    8e-18   
ref|NP_001140411.1|  hypothetical protein                             91.3    9e-18   Zea mays [maize]
emb|CDX85698.1|  BnaA02g01150D                                        91.7    9e-18   
ref|XP_009125851.1|  PREDICTED: LOW QUALITY PROTEIN: crt homolog 1    91.3    1e-17   Brassica rapa
dbj|BAK05407.1|  predicted protein                                    90.1    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007018275.1|  CRT-like transporter 2                           90.9    1e-17   Theobroma cacao [chocolate]
ref|XP_008656855.1|  PREDICTED: crt homolog 1-like isoform X1         92.0    1e-17   Zea mays [maize]
gb|EAY77278.1|  hypothetical protein OsI_05253                        91.7    1e-17   Oryza sativa Indica Group [Indian rice]
gb|ABK23422.1|  unknown                                               91.3    1e-17   Picea sitchensis
ref|XP_010673766.1|  PREDICTED: crt homolog 1                         90.9    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010420740.1|  PREDICTED: crt homolog 1-like                    90.5    2e-17   Camelina sativa [gold-of-pleasure]
gb|KJB58833.1|  hypothetical protein B456_009G228500                  89.4    2e-17   Gossypium raimondii
ref|XP_010454210.1|  PREDICTED: crt homolog 1-like                    90.5    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010492995.1|  PREDICTED: crt homolog 1-like                    90.5    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_003622835.1|  hypothetical protein MTR_7g054190                90.5    2e-17   
gb|EEC74695.1|  hypothetical protein OsI_10400                        90.1    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_006646693.1|  PREDICTED: crt homolog 1-like                    89.4    2e-17   Oryza brachyantha
ref|XP_009403363.1|  PREDICTED: crt homolog 1-like                    90.1    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM62809.1|  unknown                                               90.1    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHG30118.1|  Crt                                                   89.4    3e-17   Gossypium arboreum [tree cotton]
ref|XP_002873945.1|  predicted protein                                89.7    3e-17   Arabidopsis lyrata subsp. lyrata
ref|NP_568373.1|  CRT (chloroquine-resistance transporter)-like t...  89.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006651138.1|  PREDICTED: crt homolog 1-like                    89.4    4e-17   Oryza brachyantha
ref|XP_011009129.1|  PREDICTED: uncharacterized protein LOC105114312  89.0    4e-17   Populus euphratica
ref|XP_003561943.1|  PREDICTED: crt homolog 3-like                    89.4    4e-17   Brachypodium distachyon [annual false brome]
gb|KFK26200.1|  hypothetical protein AALP_AA8G215600                  89.7    4e-17   Arabis alpina [alpine rockcress]
dbj|BAJ86384.1|  predicted protein                                    85.5    5e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004971309.1|  PREDICTED: crt homolog 1-like                    89.4    5e-17   Setaria italica
emb|CDY44914.1|  BnaA02g04190D                                        89.4    5e-17   Brassica napus [oilseed rape]
ref|XP_009126357.1|  PREDICTED: crt homolog 1                         89.4    6e-17   Brassica rapa
ref|XP_006856983.1|  PREDICTED: crt homolog 1                         89.0    6e-17   Amborella trichopoda
ref|XP_011014422.1|  PREDICTED: crt homolog 1                         89.4    6e-17   Populus euphratica
ref|XP_006287751.1|  hypothetical protein CARUB_v10000962mg           89.0    6e-17   Capsella rubella
ref|XP_010276678.1|  PREDICTED: crt homolog 1-like                    89.4    6e-17   Nelumbo nucifera [Indian lotus]
gb|KJB58831.1|  hypothetical protein B456_009G228500                  89.0    8e-17   Gossypium raimondii
ref|XP_002313263.2|  hypothetical protein POPTR_0009s07350g           89.0    8e-17   
ref|XP_010453280.1|  PREDICTED: crt homolog 1-like                    89.0    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010491972.1|  PREDICTED: crt homolog 1-like                    89.0    9e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010419799.1|  PREDICTED: crt homolog 1-like                    88.6    9e-17   Camelina sativa [gold-of-pleasure]
gb|EMT20926.1|  hypothetical protein F775_01320                       87.0    1e-16   
gb|KFK25491.1|  hypothetical protein AALP_AA8G121700                  88.2    1e-16   Arabis alpina [alpine rockcress]
ref|NP_001078575.1|  CRT (chloroquine-resistance transporter)-lik...  88.2    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAM60923.1|  unknown                                               88.2    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871515.1|  hypothetical protein ARALYDRAFT_488059           88.2    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010254583.1|  PREDICTED: crt homolog 2                         87.8    2e-16   Nelumbo nucifera [Indian lotus]
emb|CDY62039.1|  BnaCnng39070D                                        87.8    2e-16   Brassica napus [oilseed rape]
ref|XP_006400494.1|  hypothetical protein EUTSA_v10015536mg           87.8    2e-16   Eutrema salsugineum [saltwater cress]
ref|XP_002468330.1|  hypothetical protein SORBIDRAFT_01g043890        87.4    2e-16   
gb|EEC69365.1|  hypothetical protein OsI_38489                        86.3    2e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001066868.1|  Os12g0511300                                     86.3    2e-16   
gb|EYU36446.1|  hypothetical protein MIMGU_mgv1a023373mg              87.0    3e-16   Erythranthe guttata [common monkey flower]
ref|XP_004985325.1|  PREDICTED: crt homolog 1-like isoform X2         86.7    3e-16   
ref|XP_006287749.1|  hypothetical protein CARUB_v10000960mg           87.0    3e-16   Capsella rubella
ref|XP_004985324.1|  PREDICTED: crt homolog 1-like isoform X1         86.7    3e-16   Setaria italica
ref|NP_001144440.1|  uncharacterized protein LOC100277401             86.7    4e-16   Zea mays [maize]
gb|AFW89349.1|  hypothetical protein ZEAMMB73_630257                  86.7    4e-16   
ref|XP_002527366.1|  conserved hypothetical protein                   86.3    5e-16   Ricinus communis
ref|XP_008444903.1|  PREDICTED: crt homolog 1 isoform X2              85.1    6e-16   Cucumis melo [Oriental melon]
gb|KCW68528.1|  hypothetical protein EUGRSUZ_F02159                   85.1    7e-16   Eucalyptus grandis [rose gum]
ref|XP_006664586.1|  PREDICTED: crt homolog 1-like                    84.7    8e-16   Oryza brachyantha
ref|XP_010519808.1|  PREDICTED: crt homolog 1                         85.9    8e-16   Tarenaya hassleriana [spider flower]
ref|XP_011458905.1|  PREDICTED: LOW QUALITY PROTEIN: crt homolog ...  85.5    1e-15   Fragaria vesca subsp. vesca
ref|XP_006472426.1|  PREDICTED: crt homolog 1-like isoform X3         84.7    1e-15   
gb|KCW68526.1|  hypothetical protein EUGRSUZ_F02159                   84.7    1e-15   Eucalyptus grandis [rose gum]
ref|XP_010943152.1|  PREDICTED: crt homolog 3                         84.7    1e-15   Elaeis guineensis
gb|EMS60940.1|  Crt-like protein 1                                    84.0    2e-15   Triticum urartu
ref|XP_006472425.1|  PREDICTED: crt homolog 1-like isoform X2         84.7    2e-15   Citrus sinensis [apfelsine]
ref|XP_006472424.1|  PREDICTED: crt homolog 1-like isoform X1         84.7    2e-15   Citrus sinensis [apfelsine]
gb|KDO81242.1|  hypothetical protein CISIN_1g014092mg                 84.7    2e-15   Citrus sinensis [apfelsine]
ref|XP_010061564.1|  PREDICTED: crt homolog 1                         84.7    2e-15   Eucalyptus grandis [rose gum]
ref|XP_006852886.1|  PREDICTED: crt homolog 2                         84.3    2e-15   Amborella trichopoda
gb|EMT28281.1|  hypothetical protein F775_30487                       83.6    2e-15   
ref|XP_008444902.1|  PREDICTED: crt homolog 1 isoform X1              84.7    2e-15   Cucumis melo [Oriental melon]
ref|XP_008775799.1|  PREDICTED: crt homolog 3-like                    84.3    2e-15   Phoenix dactylifera
ref|XP_006433790.1|  hypothetical protein CICLE_v10000856mg           84.7    2e-15   
ref|XP_009795853.1|  PREDICTED: uncharacterized protein LOC104242...  83.6    3e-15   Nicotiana sylvestris
ref|XP_010542173.1|  PREDICTED: crt homolog 1                         84.0    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_011074278.1|  PREDICTED: crt homolog 1-like                    84.0    4e-15   Sesamum indicum [beniseed]
ref|XP_002283727.1|  PREDICTED: crt homolog 1                         83.6    4e-15   Vitis vinifera
ref|XP_012068051.1|  PREDICTED: crt homolog 1 isoform X2              83.6    5e-15   Jatropha curcas
emb|CAN72155.1|  hypothetical protein VITISV_019018                   83.6    5e-15   Vitis vinifera
ref|XP_012068050.1|  PREDICTED: crt homolog 1 isoform X1              83.2    6e-15   Jatropha curcas
ref|XP_009414763.1|  PREDICTED: crt homolog 3                         83.2    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW74654.1|  hypothetical protein ZEAMMB73_664224                  80.9    6e-15   
gb|AFW74653.1|  hypothetical protein ZEAMMB73_664224                  80.9    6e-15   
ref|XP_004152605.1|  PREDICTED: crt homolog 1 isoform X1              83.2    7e-15   Cucumis sativus [cucumbers]
gb|AES73115.2|  CRT (chloroquine-resistance transporter)-like tra...  82.8    8e-15   Medicago truncatula
ref|XP_009795852.1|  PREDICTED: crt homolog 1 isoform X1              82.8    8e-15   Nicotiana sylvestris
gb|AAO64175.1|  unknown protein                                       80.9    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004962898.1|  PREDICTED: crt homolog 1-like                    81.6    1e-14   Setaria italica
ref|XP_004288863.2|  PREDICTED: crt homolog 1-like                    82.0    1e-14   Fragaria vesca subsp. vesca
ref|XP_004501668.1|  PREDICTED: crt homolog 2-like isoform X2         82.0    2e-14   Cicer arietinum [garbanzo]
ref|XP_004501667.1|  PREDICTED: crt homolog 2-like isoform X1         82.0    2e-14   Cicer arietinum [garbanzo]
ref|XP_002986821.1|  hypothetical protein SELMODRAFT_182638           82.0    2e-14   Selaginella moellendorffii
ref|XP_002969295.1|  hypothetical protein SELMODRAFT_170659           80.9    2e-14   
ref|XP_010671420.1|  PREDICTED: crt homolog 2                         81.6    2e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001242115.1|  uncharacterized protein LOC100787260             81.3    2e-14   Glycine max [soybeans]
gb|KHN08975.1|  Crt like 1                                            81.3    2e-14   Glycine soja [wild soybean]
ref|XP_003522773.1|  PREDICTED: crt homolog 1-like isoform X1         81.3    2e-14   Glycine max [soybeans]
ref|XP_009605243.1|  PREDICTED: crt homolog 1-like                    81.3    3e-14   Nicotiana tomentosiformis
ref|XP_008647668.1|  PREDICTED: uncharacterized protein LOC100277...  80.1    3e-14   Zea mays [maize]
ref|XP_008647667.1|  PREDICTED: uncharacterized protein LOC100277...  80.1    3e-14   Zea mays [maize]
emb|CAB45081.1|  hypothetical protein                                 80.5    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001144179.1|  uncharacterized protein LOC100277036             80.1    3e-14   Zea mays [maize]
ref|XP_010320228.1|  PREDICTED: crt homolog 3 isoform X3              80.9    3e-14   Solanum lycopersicum
ref|XP_003576016.1|  PREDICTED: crt homolog 1-like                    80.1    3e-14   Brachypodium distachyon [annual false brome]
emb|CDY56575.1|  BnaC01g41530D                                        80.9    4e-14   Brassica napus [oilseed rape]
ref|XP_006413428.1|  hypothetical protein EUTSA_v10025263mg           80.9    4e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009138072.1|  PREDICTED: crt homolog 1                         80.5    4e-14   Brassica rapa
emb|CDY61009.1|  BnaA01g35140D                                        80.5    5e-14   Brassica napus [oilseed rape]
ref|XP_008219232.1|  PREDICTED: crt homolog 1                         80.5    5e-14   Prunus mume [ume]
ref|XP_010448563.1|  PREDICTED: crt homolog 2                         80.5    5e-14   Camelina sativa [gold-of-pleasure]
ref|NP_194177.2|  CRT (chloroquine-resistance transporter)-like t...  80.5    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238016.1|  PREDICTED: crt homolog 1 isoform X1              80.1    7e-14   Solanum lycopersicum
emb|CDP00923.1|  unnamed protein product                              80.1    8e-14   Coffea canephora [robusta coffee]
ref|XP_006338030.1|  PREDICTED: crt homolog 3-like isoform X2         79.3    8e-14   Solanum tuberosum [potatoes]
ref|XP_002869717.1|  hypothetical protein ARALYDRAFT_492400           79.7    9e-14   
ref|XP_003617235.1|  Crt-like protein                                 79.7    1e-13   
ref|XP_010439030.1|  PREDICTED: LOW QUALITY PROTEIN: crt homolog ...  79.7    1e-13   
ref|XP_010099562.1|  hypothetical protein L484_011568                 79.3    1e-13   
ref|XP_006283786.1|  hypothetical protein CARUB_v10004876mg           79.0    1e-13   Capsella rubella
ref|XP_007136303.1|  hypothetical protein PHAVU_009G035000g           79.0    2e-13   Phaseolus vulgaris [French bean]
ref|XP_006338029.1|  PREDICTED: crt homolog 3-like isoform X1         78.6    2e-13   Solanum tuberosum [potatoes]
gb|KFK29005.1|  hypothetical protein AALP_AA7G076900                  77.8    4e-13   Arabis alpina [alpine rockcress]
gb|EYU36441.1|  hypothetical protein MIMGU_mgv1a008405mg              75.5    2e-12   Erythranthe guttata [common monkey flower]
gb|EYU36445.1|  hypothetical protein MIMGU_mgv1a020365mg              75.1    3e-12   Erythranthe guttata [common monkey flower]
ref|XP_011074279.1|  PREDICTED: uncharacterized protein LOC105159044  73.9    8e-12   Sesamum indicum [beniseed]
gb|EYU36442.1|  hypothetical protein MIMGU_mgv1a010446mg              66.6    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_005650231.1|  hypothetical protein COCSUDRAFT_64779            64.7    1e-08   Coccomyxa subellipsoidea C-169
ref|XP_007222981.1|  hypothetical protein PRUPE_ppa008968mg           63.5    2e-08   
ref|XP_010320227.1|  PREDICTED: crt homolog 1 isoform X2              62.8    4e-08   Solanum lycopersicum
ref|NP_001045437.2|  Os01g0955700                                     59.3    8e-08   
gb|KHN08288.1|  Crt like 3                                            60.5    2e-07   Glycine soja [wild soybean]
ref|XP_008782109.1|  PREDICTED: uncharacterized protein LOC103701724  60.1    3e-07   
ref|XP_001754536.1|  predicted protein                                59.3    5e-07   
ref|XP_001763845.1|  predicted protein                                57.8    2e-06   
ref|NP_001154721.1|  CRT (chloroquine-resistance transporter)-lik...  58.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10034.1|  unnamed protein product                              54.7    4e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD88271.1|  hypothetical protein                                 55.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009617410.1|  PREDICTED: uncharacterized protein LOC104109...  52.0    3e-05   
emb|CDY02751.1|  BnaC02g11380D                                        53.9    5e-05   
ref|XP_009617409.1|  PREDICTED: uncharacterized protein LOC104109...  50.8    9e-05   
gb|EYU36453.1|  hypothetical protein MIMGU_mgv1a019563mg              52.0    9e-05   Erythranthe guttata [common monkey flower]
gb|KJB58832.1|  hypothetical protein B456_009G228500                  51.2    3e-04   Gossypium raimondii



>ref|XP_009603801.1| PREDICTED: crt homolog 3 isoform X2 [Nicotiana tomentosiformis]
Length=411

 Score =   102 bits (253),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY +IL+L YHAGKVT+EMLSLPKTP
Sbjct  115  NRVLYKLALVPLKNYPFFLAQLATFGYVLVYFTILYLRYHAGKVTDEMLSLPKTP  169


 Score = 32.0 bits (71),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 12/99 (12%)
 Frame = +1

Query  169  MTVWSRPITGGSIGTQAGPEGSRHLHLRRRGAEFQHVISPWLLQGRRRRPEIVLRATATR  348
            M++  R ITG     +     SRH+   +  A      SP        RP I+ R+T T+
Sbjct  1    MSICRRIITG-----ELSSPVSRHVPATKLPAR-----SPVHYVNFNHRPAIISRSTTTK  50

Query  349  QWAVEAAATPAGANGKFGEVRRSRKRRSWCAVGDLQGVE  465
             + +EA  + A    +      + K R WCAVGD Q VE
Sbjct  51   CYVIEAVES-AVVLRRGVGGGGNGKWRRWCAVGD-QVVE  87



>ref|XP_009603800.1| PREDICTED: crt homolog 3 isoform X1 [Nicotiana tomentosiformis]
Length=441

 Score =   102 bits (253),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY +IL+L YHAGKVT+EMLSLPKTP
Sbjct  115  NRVLYKLALVPLKNYPFFLAQLATFGYVLVYFTILYLRYHAGKVTDEMLSLPKTP  169


 Score = 32.0 bits (71),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 12/99 (12%)
 Frame = +1

Query  169  MTVWSRPITGGSIGTQAGPEGSRHLHLRRRGAEFQHVISPWLLQGRRRRPEIVLRATATR  348
            M++  R ITG     +     SRH+   +  A      SP        RP I+ R+T T+
Sbjct  1    MSICRRIITG-----ELSSPVSRHVPATKLPAR-----SPVHYVNFNHRPAIISRSTTTK  50

Query  349  QWAVEAAATPAGANGKFGEVRRSRKRRSWCAVGDLQGVE  465
             + +EA  + A    +      + K R WCAVGD Q VE
Sbjct  51   CYVIEAVES-AVVLRRGVGGGGNGKWRRWCAVGD-QVVE  87



>ref|XP_009789545.1| PREDICTED: crt homolog 3 [Nicotiana sylvestris]
Length=442

 Score =   102 bits (253),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY +IL+L YHAGKVT+EMLSLPKTP
Sbjct  116  NRVLYKLALVPLKNYPFFLAQLATFGYVLVYFTILYLRYHAGKVTDEMLSLPKTP  170


 Score = 28.5 bits (62),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 28/53 (53%), Gaps = 2/53 (4%)
 Frame = +1

Query  307  RRRPEIVLRATATRQWAVEAAATPAGANGKFGEVRRSRKRRSWCAVGDLQGVE  465
              RP I+ R+  TR + +EAA   AG   + G    + K R  CAVGD Q VE
Sbjct  38   NHRPAIISRSITTRFYVIEAAEF-AGVFRRGGGGSGNEKWRRLCAVGD-QVVE  88



>ref|XP_010938545.1| PREDICTED: crt homolog 1-like [Elaeis guineensis]
Length=449

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLKQYPFFLAQLATFGYV+VY SIL+  YH+G VTNEMLSLPKTP
Sbjct  118  NRVLYKLALVPLKQYPFFLAQLATFGYVVVYFSILYARYHSGIVTNEMLSLPKTP  172



>ref|XP_011080445.1| PREDICTED: crt homolog 1 [Sesamum indicum]
Length=398

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY SIL+L Y AGKVT+EMLSLPK+P
Sbjct  75   NRVLYKLALVPLKHYPFFLAQLATFGYVIVYFSILYLRYQAGKVTDEMLSLPKSP  129



>gb|KDO54779.1| hypothetical protein CISIN_1g0128211mg, partial [Citrus sinensis]
 gb|KDO54780.1| hypothetical protein CISIN_1g0128211mg, partial [Citrus sinensis]
 gb|KDO54781.1| hypothetical protein CISIN_1g0128211mg, partial [Citrus sinensis]
 gb|KDO54782.1| hypothetical protein CISIN_1g0128211mg, partial [Citrus sinensis]
 gb|KDO54783.1| hypothetical protein CISIN_1g0128211mg, partial [Citrus sinensis]
Length=255

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV VY SIL+L YHAG VT+EMLS+PK P
Sbjct  131  NRVLYKLALVPLKHYPFFLAQLATFGYVAVYFSILYLRYHAGIVTDEMLSMPKAP  185



>ref|XP_002526057.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36334.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY +IL++ YHAG VT+EMLS+PK P
Sbjct  115  NRVLYKLALVPLKHYPFFLAQLATFGYVIVYFTILYIRYHAGIVTDEMLSMPKAP  169



>ref|XP_010099798.1| hypothetical protein L484_004373 [Morus notabilis]
 gb|EXB80466.1| hypothetical protein L484_004373 [Morus notabilis]
Length=302

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQ ATFGYV+VY SIL+L YHAG VT+EMLS+PK P
Sbjct  128  NRVLYKLALVPLKHYPFFLAQFATFGYVVVYFSILYLRYHAGIVTDEMLSMPKAP  182



>gb|EYU46190.1| hypothetical protein MIMGU_mgv1a006625mg [Erythranthe guttata]
Length=437

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY SIL+L Y +GKVT+EMLSLPK+P
Sbjct  113  NRVLYKLALVPLKHYPFFLAQLATFGYVIVYFSILYLRYQSGKVTDEMLSLPKSP  167



>ref|XP_007015263.1| CRT-like transporter 3 isoform 2 [Theobroma cacao]
 gb|EOY32882.1| CRT-like transporter 3 isoform 2 [Theobroma cacao]
Length=347

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY SIL+L YHAG VT+EMLS+PK P
Sbjct  125  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSILYLRYHAGIVTDEMLSMPKAP  179



>ref|XP_004500069.1| PREDICTED: crt homolog 1-like [Cicer arietinum]
Length=432

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLKQYPFFLAQLATFGYVIVY SIL++ Y AG VT+EMLS+PKTP
Sbjct  110  NRVMYKLALVPLKQYPFFLAQLATFGYVIVYFSILYMRYRAGIVTDEMLSMPKTP  164



>ref|XP_006349792.1| PREDICTED: crt homolog 1-like [Solanum tuberosum]
Length=455

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY SIL++ YH GKVT+EMLSLPK P
Sbjct  130  NRVLYKLALVPLKNYPFFLAQLATFGYVLVYFSILYVRYHTGKVTDEMLSLPKIP  184



>gb|KJB35700.1| hypothetical protein B456_006G124500 [Gossypium raimondii]
Length=351

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY S+L+L YHAG VT+EMLS+PK P
Sbjct  119  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSVLYLRYHAGIVTDEMLSMPKAP  173



>ref|XP_004252884.1| PREDICTED: crt homolog 1 [Solanum lycopersicum]
Length=455

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV++Y SIL++ YH GKVT+EMLSLPK P
Sbjct  130  NRVLYKLALVPLKNYPFFLAQLATFGYVLIYFSILYVRYHTGKVTDEMLSLPKIP  184



>ref|XP_004140194.1| PREDICTED: crt homolog 1 [Cucumis sativus]
 gb|KGN48096.1| hypothetical protein Csa_6G430720 [Cucumis sativus]
Length=459

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY SIL+L YHAG VT+EMLS PK P
Sbjct  131  NRVLYKLALVPLKHYPFFLAQLATFGYVIVYFSILYLRYHAGIVTDEMLSTPKAP  185



>ref|XP_008449652.1| PREDICTED: crt homolog 3 [Cucumis melo]
Length=459

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY SIL+L YHAG VT+EMLS PK P
Sbjct  131  NRVLYKLALVPLKHYPFFLAQLATFGYVIVYFSILYLRYHAGIVTDEMLSTPKAP  185



>emb|CAN62639.1| hypothetical protein VITISV_040590 [Vitis vinifera]
Length=196

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLAT GYV+VY SIL L Y+AG VT+EMLSLPKTP
Sbjct  83   NRVLYKLALVPLKHYPFFLAQLATVGYVLVYFSILSLRYNAGIVTDEMLSLPKTP  137



>ref|XP_007015262.1| CRT-like transporter 3 isoform 1 [Theobroma cacao]
 gb|EOY32881.1| CRT-like transporter 3 isoform 1 [Theobroma cacao]
Length=447

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY SIL+L YHAG VT+EMLS+PK P
Sbjct  125  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSILYLRYHAGIVTDEMLSMPKAP  179



>ref|XP_006446307.1| hypothetical protein CICLE_v10017793mg [Citrus clementina]
 gb|ESR59547.1| hypothetical protein CICLE_v10017793mg [Citrus clementina]
Length=456

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV VY SIL+L YHAG VT+EMLS+PK P
Sbjct  131  NRVLYKLALVPLKHYPFFLAQLATFGYVAVYFSILYLRYHAGIVTDEMLSMPKAP  185



>emb|CDP19492.1| unnamed protein product [Coffea canephora]
Length=444

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLKQYPFFLAQLATFGYVIVY SILFL + AGKVT +ML+LPK P
Sbjct  126  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYFSILFLRFRAGKVTVQMLALPKAP  180



>gb|KJB35701.1| hypothetical protein B456_006G124500 [Gossypium raimondii]
Length=424

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY S+L+L YHAG VT+EMLS+PK P
Sbjct  119  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSVLYLRYHAGIVTDEMLSMPKAP  173



>ref|XP_006470531.1| PREDICTED: crt homolog 1-like [Citrus sinensis]
Length=455

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV VY SIL+L YHAG VT+EMLS+PK P
Sbjct  130  NRVLYKLALVPLKHYPFFLAQLATFGYVAVYFSILYLRYHAGIVTDEMLSMPKAP  184



>gb|KHN23935.1| Crt like 1 [Glycine soja]
Length=337

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY SIL++ Y AG VT+EMLS+PKTP
Sbjct  14   NRVLYKLALVPLKNYPFFLAQLATFGYVIVYFSILYMRYRAGIVTDEMLSVPKTP  68



>gb|KJB35699.1| hypothetical protein B456_006G124500 [Gossypium raimondii]
Length=445

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY S+L+L YHAG VT+EMLS+PK P
Sbjct  119  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSVLYLRYHAGIVTDEMLSMPKAP  173



>gb|KJB83546.1| hypothetical protein B456_013G253300 [Gossypium raimondii]
Length=379

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY S+++L YHAG VT+EMLS+PK P
Sbjct  121  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSVMYLRYHAGIVTHEMLSMPKAP  175



>gb|EPS69263.1| hypothetical protein M569_05507, partial [Genlisea aurea]
Length=173

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLAT GY+IVY SIL L + AGKVT+EMLSLPK P
Sbjct  25   NRVLYKLALVPLKHYPFFLAQLATVGYIIVYFSILNLRHQAGKVTDEMLSLPKAP  79



>gb|KHG29231.1| Crt [Gossypium arboreum]
Length=521

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY S+L+L YHAG VT+EMLS+PK P
Sbjct  119  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSVLYLRYHAGIVTDEMLSMPKAP  173



>gb|KJB83545.1| hypothetical protein B456_013G253300 [Gossypium raimondii]
Length=426

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY S+++L YHAG VT+EMLS+PK P
Sbjct  121  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSVMYLRYHAGIVTHEMLSMPKAP  175



>gb|KHG16222.1| Crt [Gossypium arboreum]
Length=445

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY S+++L YHAG VT+EMLS+PK P
Sbjct  119  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSVMYLRYHAGIVTDEMLSMPKAP  173



>ref|XP_003556785.1| PREDICTED: crt homolog 1-like [Glycine max]
Length=428

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY SIL++ Y AG VT+EMLS+PKTP
Sbjct  105  NRVLYKLALVPLKNYPFFLAQLATFGYVIVYFSILYIRYRAGIVTDEMLSVPKTP  159



>gb|KHN28163.1| Crt like 1 [Glycine soja]
Length=337

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL+ YPFFLAQLATFGYVIVY SIL++ Y AG VT+EMLS+PKTP
Sbjct  14   NRVLYKLALVPLRNYPFFLAQLATFGYVIVYFSILYIRYRAGIVTDEMLSVPKTP  68



>gb|KEH28375.1| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=336

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLKQYPFFLAQL+TFGYVIVY  I+++ + AG VT+EMLSLPKTP
Sbjct  110  NRVLYKLALVPLKQYPFFLAQLSTFGYVIVYFGIMYIRHRAGIVTDEMLSLPKTP  164



>ref|XP_003567491.1| PREDICTED: crt homolog 1-like [Brachypodium distachyon]
Length=440

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL+QYPFFLAQ ATFGYV+VY S+LFL Y AG +T+EMLSLP+ P
Sbjct  118  NRVLYKLALVPLRQYPFFLAQFATFGYVVVYFSVLFLRYQAGAITDEMLSLPQKP  172



>gb|KJB83544.1| hypothetical protein B456_013G253300 [Gossypium raimondii]
Length=447

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY S+++L YHAG VT+EMLS+PK P
Sbjct  121  NRVLYKLALVPLKHYPFFLAQLATFGYVLVYFSVMYLRYHAGIVTHEMLSMPKAP  175



>ref|XP_010031716.1| PREDICTED: crt homolog 1 [Eucalyptus grandis]
 gb|KCW51082.1| hypothetical protein EUGRSUZ_J00689 [Eucalyptus grandis]
Length=466

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLAT GYV+VY SIL+L YHAG VT+EMLS+PK P
Sbjct  146  NRVLYKLALVPLKHYPFFLAQLATVGYVVVYFSILYLRYHAGIVTDEMLSMPKAP  200



>ref|XP_003528593.1| PREDICTED: crt homolog 1-like [Glycine max]
Length=426

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL+ YPFFLAQLATFGYVIVY SIL++ Y AG VT+EMLS+PKTP
Sbjct  103  NRVLYKLALVPLRNYPFFLAQLATFGYVIVYFSILYIRYRAGIVTDEMLSVPKTP  157



>ref|XP_008227269.1| PREDICTED: crt homolog 1 [Prunus mume]
Length=453

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY S+L+L Y AG VT+EMLS+PK P
Sbjct  126  NRVLYKLALVPLKHYPFFLAQLATFGYVIVYFSVLYLRYRAGIVTDEMLSMPKAP  180



>ref|XP_012065873.1| PREDICTED: crt homolog 1-like [Jatropha curcas]
 gb|KDP43205.1| hypothetical protein JCGZ_22757 [Jatropha curcas]
Length=470

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY +IL + YHAG VT+EMLS+PK P
Sbjct  143  NRVLYKLALVPLKHYPFFLAQLATFGYVIVYFTILRMRYHAGLVTDEMLSMPKAP  197



>ref|XP_009368715.1| PREDICTED: crt homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=454

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY S+L+L Y AG VT+EMLS+PK P
Sbjct  127  NRVLYKLALVPLKHYPFFLAQLATFGYVIVYFSVLYLRYRAGIVTDEMLSMPKAP  181



>gb|AET00194.2| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=437

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLKQYPFFLAQL+TFGYVIVY  I+++ + AG VT+EMLSLPKTP
Sbjct  110  NRVLYKLALVPLKQYPFFLAQLSTFGYVIVYFGIMYIRHRAGIVTDEMLSLPKTP  164



>ref|XP_004491229.1| PREDICTED: crt homolog 3-like isoform X1 [Cicer arietinum]
Length=433

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQL+TFGYVIVY  I+++ +HAG VT+EMLS+PKTP
Sbjct  110  NRVLYKLALVPLKHYPFFLAQLSTFGYVIVYFGIMYIRHHAGIVTDEMLSVPKTP  164



>ref|XP_002456955.1| hypothetical protein SORBIDRAFT_03g046260 [Sorghum bicolor]
 gb|EES02075.1| hypothetical protein SORBIDRAFT_03g046260 [Sorghum bicolor]
Length=444

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL++YPFFLAQ ATFGYV+VY SIL+L Y AG VTNEMLSLP+ P
Sbjct  119  NRVLYKLALVPLREYPFFLAQFATFGYVVVYFSILYLRYQAGIVTNEMLSLPQKP  173



>dbj|BAJ91104.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL+QYPFFLAQ ATFGYV+VY SILF  Y AG VT+EMLS+P+ P
Sbjct  118  NRVLYKLALVPLRQYPFFLAQFATFGYVVVYFSILFFRYQAGTVTDEMLSVPQKP  172



>ref|XP_010651520.1| PREDICTED: uncharacterized protein LOC100265335 isoform X1 [Vitis 
vinifera]
Length=455

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLAT GYV+VY SIL L Y+AG VT+EMLSLPKTP
Sbjct  126  NRVLYKLALVPLKHYPFFLAQLATVGYVLVYFSILSLRYNAGIVTDEMLSLPKTP  180



>ref|XP_002276436.2| PREDICTED: uncharacterized protein LOC100265335 isoform X2 [Vitis 
vinifera]
Length=453

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLAT GYV+VY SIL L Y+AG VT+EMLSLPKTP
Sbjct  126  NRVLYKLALVPLKHYPFFLAQLATVGYVLVYFSILSLRYNAGIVTDEMLSLPKTP  180



>emb|CBI24254.3| unnamed protein product [Vitis vinifera]
Length=344

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLAT GYV+VY SIL L Y+AG VT+EMLSLPKTP
Sbjct  17   NRVLYKLALVPLKHYPFFLAQLATVGYVLVYFSILSLRYNAGIVTDEMLSLPKTP  71



>ref|XP_007141505.1| hypothetical protein PHAVU_008G201700g [Phaseolus vulgaris]
 gb|ESW13499.1| hypothetical protein PHAVU_008G201700g [Phaseolus vulgaris]
Length=438

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLKQYPFFLAQLATFGYVIVY  IL + +HAG VT+EML  PK P
Sbjct  112  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYFGILCIRHHAGIVTDEMLDAPKAP  166



>ref|XP_003545164.1| PREDICTED: crt homolog 1-like [Glycine max]
Length=438

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY +IL++ +HAG VT+EML  PK P
Sbjct  110  NRVLYKLALVPLKHYPFFLAQLATFGYVIVYFAILYIRHHAGIVTDEMLDAPKAP  164



>ref|XP_007146130.1| hypothetical protein PHAVU_006G014700g [Phaseolus vulgaris]
 gb|ESW18124.1| hypothetical protein PHAVU_006G014700g [Phaseolus vulgaris]
Length=436

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYVIVY SIL + Y  G VT+EMLS+PKTP
Sbjct  110  NRVLYKLALVPLKNYPFFLAQLATFGYVIVYFSILSIRYRMGIVTDEMLSMPKTP  164



>gb|AFW83925.1| hypothetical protein ZEAMMB73_730584 [Zea mays]
Length=441

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL++YPFFLAQ ATFGYV+VY SIL+L Y AG VT+EMLSLP+ P
Sbjct  117  NRVLYKLALVPLREYPFFLAQFATFGYVVVYFSILYLRYQAGIVTDEMLSLPQKP  171



>ref|XP_008656857.1| PREDICTED: uncharacterized protein LOC103636274 isoform X2 [Zea 
mays]
Length=450

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL++YPFFLAQ ATFGYV+VY SIL+L Y AG VT+EMLSLP+ P
Sbjct  233  NRVLYKLALVPLREYPFFLAQFATFGYVVVYFSILYLRYQAGIVTDEMLSLPQKP  287



>gb|KEH17262.1| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=345

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLKQYPFFLAQ +TF YVIVY SIL++ Y AG VT+EML++PKTP
Sbjct  106  NRVLYKLALVPLKQYPFFLAQFSTFVYVIVYFSILYIRYRAGIVTDEMLAVPKTP  160



>gb|ABF94479.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG93206.1| unnamed protein product [Oryza sativa Japonica Group]
Length=309

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP++ YPFFLAQ  TFGYVIVY SILF+ YHAG VT EML+LPK+
Sbjct  101  NRVLYKLALVPMRNYPFFLAQATTFGYVIVYFSILFIRYHAGIVTKEMLALPKS  154



>ref|XP_006399733.1| hypothetical protein EUTSA_v10015653mg [Eutrema salsugineum]
 gb|ESQ41186.1| hypothetical protein EUTSA_v10015653mg [Eutrema salsugineum]
Length=453

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLKQYPFFLAQL+TFGYV VY SIL+  Y AG VT+ MLS+PKTP
Sbjct  122  NRVMYKLALVPLKQYPFFLAQLSTFGYVAVYYSILYFRYRAGTVTDAMLSVPKTP  176



>emb|CDX91169.1| BnaC02g04280D [Brassica napus]
Length=457

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLKQYPFFLAQL+TFGYV VY SIL+  Y AG VT+EMLS+PK P
Sbjct  126  NRVMYKLALVPLKQYPFFLAQLSTFGYVAVYYSILYFRYRAGTVTDEMLSVPKMP  180



>ref|NP_001140411.1| hypothetical protein [Zea mays]
 gb|ACF83778.1| unknown [Zea mays]
 tpg|DAA55771.1| TPA: hypothetical protein ZEAMMB73_240854 [Zea mays]
Length=436

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL++YPFFLAQ ATFGYV+VY SIL+L Y AG VT+EMLSLP+ P
Sbjct  110  NRVLYKLALVPLRKYPFFLAQFATFGYVVVYFSILYLRYRAGIVTDEMLSLPQKP  164



>emb|CDX85698.1| BnaA02g01150D [Brassica napus]
Length=456

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLKQYPFFLAQL+TFGYV VY SIL+  Y AG VT+EMLS+PK P
Sbjct  125  NRVMYKLALVPLKQYPFFLAQLSTFGYVAVYYSILYFRYRAGTVTDEMLSVPKMP  179



>ref|XP_009125851.1| PREDICTED: LOW QUALITY PROTEIN: crt homolog 1 [Brassica rapa]
Length=457

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLKQYPFFLAQL+TFGYV VY SIL+  Y AG VT+EMLS+PK P
Sbjct  126  NRVMYKLALVPLKQYPFFLAQLSTFGYVAVYYSILYFRYRAGTVTDEMLSVPKMP  180



>dbj|BAK05407.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=350

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL+QYPFFLAQ AT GYV+VY SILF  Y AG VT+EMLS+P+ P
Sbjct  27   NRVLYKLALVPLRQYPFFLAQFATLGYVVVYFSILFFRYQAGTVTDEMLSVPQKP  81



>ref|XP_007018275.1| CRT-like transporter 2 [Theobroma cacao]
 gb|EOY15500.1| CRT-like transporter 2 [Theobroma cacao]
Length=425

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQL TFGYV++Y SILF+ Y AG VTNEML LPK+
Sbjct  103  NRVLYKLALVPMKEYPFFLAQLTTFGYVVIYFSILFVRYRAGIVTNEMLGLPKS  156



>ref|XP_008656855.1| PREDICTED: crt homolog 1-like isoform X1 [Zea mays]
Length=557

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL++YPFFLAQ ATFGYV+VY SIL+L Y AG VT+EMLSLP+ P
Sbjct  233  NRVLYKLALVPLREYPFFLAQFATFGYVVVYFSILYLRYQAGIVTDEMLSLPQKP  287



>gb|EAY77278.1| hypothetical protein OsI_05253 [Oryza sativa Indica Group]
Length=531

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL+ YPFFLAQLATFGYV+VY SIL+L + AG VT+EMLSLP+ P
Sbjct  111  NRVLYKLALVPLRDYPFFLAQLATFGYVVVYFSILYLRHQAGIVTDEMLSLPQKP  165



>gb|ABK23422.1| unknown [Picea sitchensis]
Length=466

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLK+YPFFLAQL TFGYV+VY SIL+  YHAG VT+EML+ PK
Sbjct  122  NRVLYKLALVPLKEYPFFLAQLTTFGYVVVYFSILYFRYHAGIVTDEMLAFPK  174



>ref|XP_010673766.1| PREDICTED: crt homolog 1 [Beta vulgaris subsp. vulgaris]
Length=437

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLK YPFFLAQLATFGYV+VY SIL++ + AG VT EMLSLP+ P
Sbjct  114  NRVLYKLALVPLKHYPFFLAQLATFGYVVVYFSILYMRHRAGIVTKEMLSLPQVP  168



>ref|XP_010420740.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=442

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLKQYPFFLAQL+TFGYV VY ++L+  Y AG VT EMLS+PKTP
Sbjct  114  NRVLYKLALIPLKQYPFFLAQLSTFGYVAVYFTVLYFRYRAGIVTKEMLSVPKTP  168



>gb|KJB58833.1| hypothetical protein B456_009G228500 [Gossypium raimondii]
Length=350

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ  TFGYV +Y SILFL Y AG V NEMLSLPK+
Sbjct  149  NRVLYKLALVPMKEYPFFLAQFTTFGYVAIYFSILFLRYRAGIVANEMLSLPKS  202



>ref|XP_010454210.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=445

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLKQYPFFLAQL+TFGYV VY ++L+  Y AG VT EMLS+PKTP
Sbjct  117  NRVLYKLALIPLKQYPFFLAQLSTFGYVAVYFTVLYFRYRAGIVTKEMLSVPKTP  171



>ref|XP_010492995.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=445

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLKQYPFFLAQL+TFGYV VY ++L+  Y AG VT EMLS+PKTP
Sbjct  117  NRVLYKLALIPLKQYPFFLAQLSTFGYVAVYFTVLYFRYRAGIVTKEMLSVPKTP  171



>ref|XP_003622835.1| hypothetical protein MTR_7g054190 [Medicago truncatula]
 gb|KEH17261.1| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=432

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLKQYPFFLAQ +TF YVIVY SIL++ Y AG VT+EML++PKTP
Sbjct  106  NRVLYKLALVPLKQYPFFLAQFSTFVYVIVYFSILYIRYRAGIVTDEMLAVPKTP  160



>gb|EEC74695.1| hypothetical protein OsI_10400 [Oryza sativa Indica Group]
Length=423

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP++ YPFFLAQ  TFGYVIVY SILF+ YHAG VT EML+LPK+
Sbjct  101  NRVLYKLALVPMRNYPFFLAQATTFGYVIVYFSILFIRYHAGIVTKEMLALPKS  154



>ref|XP_006646693.1| PREDICTED: crt homolog 1-like [Oryza brachyantha]
Length=374

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL+ YPFFLAQ ATFGYV+VY SIL+L + AG VT+EMLSLP+ P
Sbjct  46   NRVLYKLALVPLRDYPFFLAQFATFGYVVVYFSILYLRHQAGIVTDEMLSLPQKP  100



>ref|XP_009403363.1| PREDICTED: crt homolog 1-like [Musa acuminata subsp. malaccensis]
Length=436

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVL KLALVPLK+YPFFLAQ  TFGY++VY SIL + YH G VT+EMLSLPKTP
Sbjct  113  NRVLQKLALVPLKEYPFFLAQFTTFGYLVVYFSILCIRYHTGIVTDEMLSLPKTP  167



>gb|AAM62809.1| unknown [Arabidopsis thaliana]
Length=447

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLKQYPFFLAQL+TFGYV VY SIL+  Y AG VT EMLS+PK P
Sbjct  119  NRVLYKLALIPLKQYPFFLAQLSTFGYVAVYFSILYFRYRAGIVTKEMLSVPKLP  173



>gb|KHG30118.1| Crt [Gossypium arboreum]
Length=391

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ  TFGYV +Y SILFL Y AG V NEMLSLPK+
Sbjct  75   NRVLYKLALVPMKEYPFFLAQFTTFGYVAIYFSILFLRYRAGIVANEMLSLPKS  128



>ref|XP_002873945.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50204.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLKQYPFFLAQL+TFGYV VY SIL+  Y AG VT EMLS+PK P
Sbjct  109  NRVLYKLALIPLKQYPFFLAQLSTFGYVAVYFSILYFRYRAGIVTKEMLSVPKLP  163



>ref|NP_568373.1| CRT (chloroquine-resistance transporter)-like transporter 1 [Arabidopsis 
thaliana]
 gb|ABJ17107.1| At5g19380 [Arabidopsis thaliana]
 gb|AED92693.1| CRT (chloroquine-resistance transporter)-like transporter 1 [Arabidopsis 
thaliana]
Length=447

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLKQYPFFLAQL+TFGYV VY SIL+  Y AG VT EMLS+PK P
Sbjct  119  NRVLYKLALIPLKQYPFFLAQLSTFGYVAVYFSILYFRYRAGIVTKEMLSVPKLP  173



>ref|XP_006651138.1| PREDICTED: crt homolog 1-like [Oryza brachyantha]
Length=425

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP++ YPFFLAQ+ TFGYVIVY SILF+ YHAG V+ EML+LPK+
Sbjct  103  NRVLYKLALVPMRNYPFFLAQVTTFGYVIVYFSILFIRYHAGIVSKEMLALPKS  156



>ref|XP_011009129.1| PREDICTED: uncharacterized protein LOC105114312 [Populus euphratica]
Length=384

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLK YPFFLAQLATFGYVIVY +IL + + AG VT+EMLS+PK P
Sbjct  137  NRVLYKLALLPLKHYPFFLAQLATFGYVIVYFTILHIRHRAGIVTDEMLSMPKAP  191



>ref|XP_003561943.1| PREDICTED: crt homolog 3-like [Brachypodium distachyon]
Length=424

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K YPFFLAQ+ TFGYVIVY SILF+ YHAG V+ EML+LPK+
Sbjct  102  NRVLYKLALVPMKNYPFFLAQVLTFGYVIVYFSILFIRYHAGIVSKEMLALPKS  155



>gb|KFK26200.1| hypothetical protein AALP_AA8G215600 [Arabis alpina]
Length=445

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLK YPFFLAQL+TFGYV+VY SIL+  Y AG VT EMLS+PK P
Sbjct  118  NRVMYKLALVPLKHYPFFLAQLSTFGYVVVYYSILYFRYRAGIVTKEMLSVPKIP  172



>dbj|BAJ86384.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=143

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K YPFFLAQ+ TFGYV VY S+LF+ Y AG VT EML+LPK+
Sbjct  20   NRVLYKLALVPMKNYPFFLAQVLTFGYVAVYFSVLFVRYQAGIVTREMLALPKS  73



>ref|XP_004971309.1| PREDICTED: crt homolog 1-like [Setaria italica]
Length=444

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPL++YPFFLAQ ATFGYV++Y SIL+L Y AG V +EMLSLP+ P
Sbjct  119  NRVLYKLALVPLREYPFFLAQFATFGYVVIYFSILYLRYQAGIVNDEMLSLPQKP  173



>emb|CDY44914.1| BnaA02g04190D [Brassica napus]
Length=448

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLAL+PLKQYPFFLAQL+TFGYV VY SIL+  Y AG VT EMLS+PK P
Sbjct  120  NRVMYKLALIPLKQYPFFLAQLSTFGYVAVYFSILYFRYRAGIVTKEMLSVPKIP  174



>ref|XP_009126357.1| PREDICTED: crt homolog 1 [Brassica rapa]
Length=449

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLAL+PLKQYPFFLAQL+TFGYV VY SIL+  Y AG VT EMLS+PK P
Sbjct  121  NRVMYKLALIPLKQYPFFLAQLSTFGYVAVYFSILYFRYRAGIVTKEMLSVPKIP  175



>ref|XP_006856983.1| PREDICTED: crt homolog 1 [Amborella trichopoda]
 gb|ERN18450.1| hypothetical protein AMTR_s00190p00035510 [Amborella trichopoda]
Length=437

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYK+AL+PLKQYPFFLAQ+ATFGYV +Y +IL   YHAG VT+EML+LPK+
Sbjct  115  NRVLYKMALIPLKQYPFFLAQIATFGYVAIYFTILHFRYHAGIVTDEMLALPKS  168



>ref|XP_011014422.1| PREDICTED: crt homolog 1 [Populus euphratica]
Length=451

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLK YPFFLAQLATFGYVIVY +IL + + AG VT+EMLS+PK P
Sbjct  137  NRVLYKLALLPLKHYPFFLAQLATFGYVIVYFTILHIRHRAGIVTDEMLSMPKAP  191



>ref|XP_006287751.1| hypothetical protein CARUB_v10000962mg [Capsella rubella]
 gb|EOA20649.1| hypothetical protein CARUB_v10000962mg [Capsella rubella]
Length=444

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLKQYPFFLAQL+TFGYV VY ++LF  Y AG VT EMLS+PK P
Sbjct  116  NRVLYKLALMPLKQYPFFLAQLSTFGYVAVYFTVLFFRYRAGIVTKEMLSVPKLP  170



>ref|XP_010276678.1| PREDICTED: crt homolog 1-like [Nelumbo nucifera]
Length=470

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLAL+PL+ YPFFLAQLATFGYV+VY SIL   Y+AG VT+EMLSLPKT
Sbjct  140  NRVLYKLALIPLRHYPFFLAQLATFGYVLVYFSILRFRYNAGIVTDEMLSLPKT  193



>gb|KJB58831.1| hypothetical protein B456_009G228500 [Gossypium raimondii]
Length=469

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ  TFGYV +Y SILFL Y AG V NEMLSLPK+
Sbjct  149  NRVLYKLALVPMKEYPFFLAQFTTFGYVAIYFSILFLRYRAGIVANEMLSLPKS  202



>ref|XP_002313263.2| hypothetical protein POPTR_0009s07350g [Populus trichocarpa]
 gb|EEE87218.2| hypothetical protein POPTR_0009s07350g [Populus trichocarpa]
Length=477

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLAL+PLK YPFFLAQLATFGYVIVY +IL + + AG VT+EMLS+PK P
Sbjct  137  NRVLYKLALLPLKHYPFFLAQLATFGYVIVYFTILHIRHRAGIVTDEMLSMPKAP  191



>ref|XP_010453280.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=462

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLKQYPFFLAQL+TFGYV VY +IL++ Y AG VT+ MLS+PK P
Sbjct  131  NRVMYKLALVPLKQYPFFLAQLSTFGYVAVYYTILYIRYRAGTVTDAMLSVPKPP  185



>ref|XP_010491972.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=460

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLKQYPFFLAQL+TFGYV VY +IL++ Y AG VT+ MLS+PK P
Sbjct  129  NRVMYKLALVPLKQYPFFLAQLSTFGYVAVYYTILYIRYRAGTVTDAMLSVPKPP  183



>ref|XP_010419799.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=458

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLKQYPFFLAQL+TFGYV VY +IL++ Y AG VT+ MLS+PK P
Sbjct  127  NRVMYKLALVPLKQYPFFLAQLSTFGYVAVYYTILYIRYRAGTVTDAMLSVPKPP  181



>gb|EMT20926.1| hypothetical protein F775_01320 [Aegilops tauschii]
Length=341

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K YPFFLAQ+ TFGYV+VY SILF+ Y AG VT EML+LPK+
Sbjct  2    NRVLYKLALVPMKNYPFFLAQVLTFGYVVVYFSILFVRYQAGIVTKEMLALPKS  55



>gb|KFK25491.1| hypothetical protein AALP_AA8G121700 [Arabis alpina]
Length=449

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLK YPFFLAQL+TFGYV VY SIL+  Y AG VT+ MLS+PK P
Sbjct  118  NRVMYKLALVPLKHYPFFLAQLSTFGYVAVYYSILYFRYRAGTVTDAMLSVPKMP  172



>ref|NP_001078575.1| CRT (chloroquine-resistance transporter)-like transporter 3 [Arabidopsis 
thaliana]
 gb|AAM13018.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91339.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44200.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED91770.1| CRT (chloroquine-resistance transporter)-like transporter 3 [Arabidopsis 
thaliana]
Length=452

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLK+YPFFLAQL+TFGYV VY +IL+  Y AG VT+ MLS+PK+P
Sbjct  121  NRVMYKLALVPLKEYPFFLAQLSTFGYVAVYYTILYFRYRAGTVTDAMLSVPKSP  175



>gb|AAM60923.1| unknown [Arabidopsis thaliana]
Length=452

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLK+YPFFLAQL+TFGYV VY +IL+  Y AG VT+ MLS+PK+P
Sbjct  121  NRVMYKLALVPLKEYPFFLAQLSTFGYVAVYYTILYFRYRAGTVTDAMLSVPKSP  175



>ref|XP_002871515.1| hypothetical protein ARALYDRAFT_488059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47774.1| hypothetical protein ARALYDRAFT_488059 [Arabidopsis lyrata subsp. 
lyrata]
Length=454

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLK+YPFFLAQL+TFGYV VY +IL+  Y AG VT+ MLS+PK+P
Sbjct  123  NRVMYKLALVPLKEYPFFLAQLSTFGYVAVYYTILYFRYRAGTVTDAMLSVPKSP  177



>ref|XP_010254583.1| PREDICTED: crt homolog 2 [Nelumbo nucifera]
Length=434

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+KQYPFFLAQ+ TFGYV +Y SILF  Y AG VT+EML+LPK+
Sbjct  112  NRVLYKLALVPMKQYPFFLAQVTTFGYVAIYFSILFARYRAGIVTDEMLALPKS  165



>emb|CDY62039.1| BnaCnng39070D [Brassica napus]
Length=449

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLAL+PLK+YPFFLAQL+TFGYV VY SIL+  Y AG VT EMLS+PK P
Sbjct  121  NRVMYKLALIPLKKYPFFLAQLSTFGYVAVYFSILYFRYRAGIVTKEMLSVPKIP  175



>ref|XP_006400494.1| hypothetical protein EUTSA_v10015536mg [Eutrema salsugineum]
 gb|ESQ41947.1| hypothetical protein EUTSA_v10015536mg [Eutrema salsugineum]
Length=442

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLAL+PLK YPFFLAQL+TFGYV VY SIL+  Y AG VT EMLS+PK P
Sbjct  115  NRVMYKLALIPLKHYPFFLAQLSTFGYVAVYYSILYFRYRAGIVTKEMLSVPKIP  169



>ref|XP_002468330.1| hypothetical protein SORBIDRAFT_01g043890 [Sorghum bicolor]
 gb|EER95328.1| hypothetical protein SORBIDRAFT_01g043890 [Sorghum bicolor]
Length=422

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K YPFFLAQ ATFGYV+VY SILF+ + AG VT EML+LPK+
Sbjct  106  NRVLYKLALVPMKDYPFFLAQFATFGYVLVYFSILFIRFRAGIVTREMLALPKS  159



>gb|EEC69365.1| hypothetical protein OsI_38489 [Oryza sativa Indica Group]
Length=343

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLKQYPFFLAQL TFGYV VY SIL+  Y AG VT +ML+LPK
Sbjct  21   NRVLYKLALVPLKQYPFFLAQLTTFGYVAVYFSILYARYRAGVVTGDMLALPK  73



>ref|NP_001066868.1| Os12g0511300 [Oryza sativa Japonica Group]
 gb|ABA99044.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29887.1| Os12g0511300 [Oryza sativa Japonica Group]
 dbj|BAG98949.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53296.1| hypothetical protein OsJ_36259 [Oryza sativa Japonica Group]
Length=343

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLKQYPFFLAQL TFGYV VY SIL+  Y AG VT +ML+LPK
Sbjct  21   NRVLYKLALVPLKQYPFFLAQLTTFGYVAVYFSILYARYRAGVVTGDMLALPK  73



>gb|EYU36446.1| hypothetical protein MIMGU_mgv1a023373mg [Erythranthe guttata]
Length=447

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVP+K++PFFLAQL TFGYV +Y SILF+ Y AG  T+EMLS PK P
Sbjct  125  NRVLYKLALVPMKEFPFFLAQLTTFGYVAIYFSILFMRYRAGIATDEMLSFPKIP  179



>ref|XP_004985325.1| PREDICTED: crt homolog 1-like isoform X2 [Setaria italica]
Length=420

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K YPFFLAQ ATFGYV+VY SILF+ + AG VT EML+LPK 
Sbjct  99   NRVLYKLALVPMKNYPFFLAQFATFGYVLVYFSILFIRFRAGIVTREMLALPKA  152



>ref|XP_006287749.1| hypothetical protein CARUB_v10000960mg [Capsella rubella]
 gb|EOA20647.1| hypothetical protein CARUB_v10000960mg [Capsella rubella]
Length=445

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLKQYPFFLAQL+TFGYV VY +IL+  Y +G VT+ MLS+PK P
Sbjct  114  NRVMYKLALVPLKQYPFFLAQLSTFGYVAVYYTILYFRYRSGTVTDAMLSVPKPP  168



>ref|XP_004985324.1| PREDICTED: crt homolog 1-like isoform X1 [Setaria italica]
Length=421

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K YPFFLAQ ATFGYV+VY SILF+ + AG VT EML+LPK 
Sbjct  99   NRVLYKLALVPMKNYPFFLAQFATFGYVLVYFSILFIRFRAGIVTREMLALPKA  152



>ref|NP_001144440.1| uncharacterized protein LOC100277401 [Zea mays]
 gb|ACG40571.1| hypothetical protein [Zea mays]
Length=426

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+K YPFFLAQ ATFGYV+VY SILF+ + AG VT EML+LPK
Sbjct  104  NRVLYKLALVPMKNYPFFLAQFATFGYVLVYFSILFIRFRAGIVTREMLALPK  156



>gb|AFW89349.1| hypothetical protein ZEAMMB73_630257 [Zea mays]
Length=468

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+K YPFFLAQ ATFGYV+VY SILF+ + AG VT EML+LPK
Sbjct  146  NRVLYKLALVPMKNYPFFLAQFATFGYVLVYFSILFIRFRAGIVTREMLALPK  198



>ref|XP_002527366.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35038.1| conserved hypothetical protein [Ricinus communis]
Length=429

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+K+YPFFLAQ  TFGYV++Y SIL++ Y AG VTNEM+S+PK
Sbjct  109  NRVLYKLALVPMKRYPFFLAQFITFGYVVIYFSILYVRYRAGIVTNEMISIPK  161



>ref|XP_008444903.1| PREDICTED: crt homolog 1 isoform X2 [Cucumis melo]
Length=364

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVPLK+YPFFLAQL TFGYV+VY SIL+L   A  VT EMLSLPK+
Sbjct  127  NRVLYKLALVPLKEYPFFLAQLTTFGYVMVYFSILYLRRRANIVTEEMLSLPKS  180



>gb|KCW68528.1| hypothetical protein EUGRSUZ_F02159 [Eucalyptus grandis]
Length=365

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+KQYPFFLAQ+ TFGYV +Y SIL++ + AG VT EML+LPK+
Sbjct  112  NRVLYKLALVPMKQYPFFLAQVTTFGYVAIYFSILYIRHRAGIVTGEMLALPKS  165



>ref|XP_006664586.1| PREDICTED: crt homolog 1-like [Oryza brachyantha]
Length=347

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLKQYPFFLAQL TFGYV VY S+L+  Y AG VT +M++LPK
Sbjct  25   NRVLYKLALVPLKQYPFFLAQLTTFGYVAVYFSVLYARYRAGVVTRDMMALPK  77



>ref|XP_010519808.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
Length=454

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRV+YKLALVPLK YPFFLAQ +TFGYV VY +IL+L + +G VT+EMLS+PK P
Sbjct  127  NRVMYKLALVPLKHYPFFLAQFSTFGYVAVYFAILYLRHRSGTVTDEMLSVPKMP  181



>ref|XP_011458905.1| PREDICTED: LOW QUALITY PROTEIN: crt homolog 1-like [Fragaria 
vesca subsp. vesca]
Length=436

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            N+VLYKLALVP+K +PFF AQL TFGYVI+Y SIL+L Y +G VT+EM++LPK P
Sbjct  114  NKVLYKLALVPMKHHPFFFAQLTTFGYVIIYFSILYLRYRSGMVTDEMIALPKAP  168



>ref|XP_006472426.1| PREDICTED: crt homolog 1-like isoform X3 [Citrus sinensis]
Length=381

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQ+ TFGYV++Y SIL+  Y  G VT+EM+SLPK
Sbjct  109  NRVLYKLALVPMKQYPFFLAQITTFGYVVIYFSILYTRYLMGIVTDEMISLPK  161



>gb|KCW68526.1| hypothetical protein EUGRSUZ_F02159 [Eucalyptus grandis]
Length=390

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+KQYPFFLAQ+ TFGYV +Y SIL++ + AG VT EML+LPK+
Sbjct  112  NRVLYKLALVPMKQYPFFLAQVTTFGYVAIYFSILYIRHRAGIVTGEMLALPKS  165



>ref|XP_010943152.1| PREDICTED: crt homolog 3 [Elaeis guineensis]
Length=416

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K YPFFLAQ+ TFGYV+VY SIL+  Y AG VT EML++PK+
Sbjct  94   NRVLYKLALVPMKNYPFFLAQVTTFGYVVVYFSILYFRYRAGTVTKEMLAIPKS  147



>gb|EMS60940.1| Crt-like protein 1 [Triticum urartu]
Length=344

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLK YPFFLAQL TFGYV VY SIL+  Y AG VT +ML+LPK
Sbjct  23   NRVLYKLALVPLKSYPFFLAQLTTFGYVTVYFSILYARYRAGVVTRDMLTLPK  75



>ref|XP_006472425.1| PREDICTED: crt homolog 1-like isoform X2 [Citrus sinensis]
Length=424

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQ+ TFGYV++Y SIL+  Y  G VT+EM+SLPK
Sbjct  109  NRVLYKLALVPMKQYPFFLAQITTFGYVVIYFSILYTRYLMGIVTDEMISLPK  161



>ref|XP_006472424.1| PREDICTED: crt homolog 1-like isoform X1 [Citrus sinensis]
Length=431

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQ+ TFGYV++Y SIL+  Y  G VT+EM+SLPK
Sbjct  109  NRVLYKLALVPMKQYPFFLAQITTFGYVVIYFSILYTRYLMGIVTDEMISLPK  161



>gb|KDO81242.1| hypothetical protein CISIN_1g014092mg [Citrus sinensis]
Length=431

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQ+ TFGYV++Y SIL+  Y  G VT+EM+SLPK
Sbjct  109  NRVLYKLALVPMKQYPFFLAQITTFGYVVIYFSILYTRYLMGIVTDEMISLPK  161



>ref|XP_010061564.1| PREDICTED: crt homolog 1 [Eucalyptus grandis]
 gb|KCW68527.1| hypothetical protein EUGRSUZ_F02159 [Eucalyptus grandis]
Length=432

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+KQYPFFLAQ+ TFGYV +Y SIL++ + AG VT EML+LPK+
Sbjct  112  NRVLYKLALVPMKQYPFFLAQVTTFGYVAIYFSILYIRHRAGIVTGEMLALPKS  165



>ref|XP_006852886.1| PREDICTED: crt homolog 2 [Amborella trichopoda]
 gb|ERN14353.1| hypothetical protein AMTR_s00033p00216940 [Amborella trichopoda]
Length=408

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ+ +FGYV++Y SIL + YHAG VT +ML LPK+
Sbjct  86   NRVLYKLALVPMKKYPFFLAQVTSFGYVVIYFSILCIRYHAGVVTKDMLLLPKS  139



>gb|EMT28281.1| hypothetical protein F775_30487 [Aegilops tauschii]
Length=344

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLK YPFFLAQL TFGYV VY SIL++ Y AG VT +ML+LPK
Sbjct  23   NRVLYKLALVPLKSYPFFLAQLTTFGYVGVYFSILYVRYRAGVVTRDMLALPK  75



>ref|XP_008444902.1| PREDICTED: crt homolog 1 isoform X1 [Cucumis melo]
Length=449

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVPLK+YPFFLAQL TFGYV+VY SIL+L   A  VT EMLSLPK+
Sbjct  127  NRVLYKLALVPLKEYPFFLAQLTTFGYVMVYFSILYLRRRANIVTEEMLSLPKS  180



>ref|XP_008775799.1| PREDICTED: crt homolog 3-like [Phoenix dactylifera]
Length=426

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K YPFFLAQ+ TFGYV VY SIL++ Y AG VT EML++PK+
Sbjct  104  NRVLYKLALVPMKNYPFFLAQVTTFGYVAVYFSILYIRYRAGTVTKEMLAIPKS  157



>ref|XP_006433790.1| hypothetical protein CICLE_v10000856mg [Citrus clementina]
 gb|ESR47030.1| hypothetical protein CICLE_v10000856mg [Citrus clementina]
Length=523

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQ+ TFGYV++Y SIL+  Y  G VT+EM+SLPK
Sbjct  201  NRVLYKLALVPMKQYPFFLAQITTFGYVVIYFSILYTRYLMGIVTDEMISLPK  253



>ref|XP_009795853.1| PREDICTED: uncharacterized protein LOC104242494 isoform X2 [Nicotiana 
sylvestris]
Length=386

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ+ TFGY+ +Y SIL+  YHAG VT+EM++ PK+
Sbjct  103  NRVLYKLALVPMKEYPFFLAQVTTFGYLAIYLSILYARYHAGIVTDEMVAYPKS  156



>ref|XP_010542173.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
 ref|XP_010542174.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
 ref|XP_010542175.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
 ref|XP_010542176.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
Length=399

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQL TFGYV++Y ++L++ YH G VT EM+++PK
Sbjct  75   NRVLYKLALVPMKQYPFFLAQLNTFGYVLIYFTVLYVRYHLGIVTREMIAVPK  127



>ref|XP_011074278.1| PREDICTED: crt homolog 1-like [Sesamum indicum]
Length=431

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVP+K++PFFLAQL TFGYV++Y S+L++ Y AG  T+EML+ PK P
Sbjct  109  NRVLYKLALVPMKEFPFFLAQLTTFGYVVIYFSVLYMRYRAGIATDEMLASPKFP  163



>ref|XP_002283727.1| PREDICTED: crt homolog 1 [Vitis vinifera]
 emb|CBI19288.3| unnamed protein product [Vitis vinifera]
Length=422

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRV YKLALVPLKQYPFFLAQ  TFGY  +Y SIL++ Y AG VT+EM++LPK+
Sbjct  103  NRVFYKLALVPLKQYPFFLAQFTTFGYAAIYFSILYIRYRAGIVTDEMIALPKS  156



>ref|XP_012068051.1| PREDICTED: crt homolog 1 isoform X2 [Jatropha curcas]
 gb|KDP41501.1| hypothetical protein JCGZ_15908 [Jatropha curcas]
Length=430

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+KQYPFFLAQ  TFGYV++Y SILF  Y  G V++EM++LPK+
Sbjct  110  NRVLYKLALVPMKQYPFFLAQFTTFGYVMIYFSILFARYRLGIVSDEMIALPKS  163



>emb|CAN72155.1| hypothetical protein VITISV_019018 [Vitis vinifera]
Length=478

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRV YKLALVPLKQYPFFLAQ  TFGY  +Y SIL++ Y AG VT+EM++LPK+
Sbjct  103  NRVFYKLALVPLKQYPFFLAQFTTFGYXAIYFSILYIRYRAGIVTDEMIALPKS  156



>ref|XP_012068050.1| PREDICTED: crt homolog 1 isoform X1 [Jatropha curcas]
Length=440

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+KQYPFFLAQ  TFGYV++Y SILF  Y  G V++EM++LPK+
Sbjct  110  NRVLYKLALVPMKQYPFFLAQFTTFGYVMIYFSILFARYRLGIVSDEMIALPKS  163



>ref|XP_009414763.1| PREDICTED: crt homolog 3 [Musa acuminata subsp. malaccensis]
Length=431

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ+ TFGYV VY  IL+L Y AG VT EML+LPK+
Sbjct  109  NRVLYKLALVPMKEYPFFLAQVTTFGYVAVYFFILYLRYSAGIVTKEMLALPKS  162



>gb|AFW74654.1| hypothetical protein ZEAMMB73_664224 [Zea mays]
Length=211

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLK YPFFLAQL TFGYV VY S+L+  Y  G VT +ML+LPK
Sbjct  22   NRVLYKLALVPLKAYPFFLAQLTTFGYVAVYFSMLYTRYRTGLVTRDMLALPK  74



>gb|AFW74653.1| hypothetical protein ZEAMMB73_664224 [Zea mays]
Length=221

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLK YPFFLAQL TFGYV VY S+L+  Y  G VT +ML+LPK
Sbjct  22   NRVLYKLALVPLKAYPFFLAQLTTFGYVAVYFSMLYTRYRTGLVTRDMLALPK  74



>ref|XP_004152605.1| PREDICTED: crt homolog 1 isoform X1 [Cucumis sativus]
 ref|XP_011649683.1| PREDICTED: crt homolog 1 isoform X2 [Cucumis sativus]
 gb|KGN62740.1| hypothetical protein Csa_2G370400 [Cucumis sativus]
Length=449

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVPLK+YPFFLAQL TFGYV+ Y SIL+L   A  VT EMLSLPK+
Sbjct  127  NRVLYKLALVPLKEYPFFLAQLTTFGYVMAYFSILYLRRRANIVTEEMLSLPKS  180



>gb|AES73115.2| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=422

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+  YPFFLAQL TFGYV++Y SIL++ Y  G VTNEML++PK
Sbjct  99   NRVLYKLALVPMSNYPFFLAQLNTFGYVVIYFSILYIRYRLGIVTNEMLAIPK  151



>ref|XP_009795852.1| PREDICTED: crt homolog 1 isoform X1 [Nicotiana sylvestris]
Length=424

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ+ TFGY+ +Y SIL+  YHAG VT+EM++ PK+
Sbjct  103  NRVLYKLALVPMKEYPFFLAQVTTFGYLAIYLSILYARYHAGIVTDEMVAYPKS  156



>gb|AAO64175.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00542.1| hypothetical protein [Arabidopsis thaliana]
Length=266

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFF+AQL TFGYV++Y +IL+     G VTNEM+ +PK
Sbjct  108  NRVLYKLALVPMKQYPFFMAQLTTFGYVLIYFTILYTRRRLGIVTNEMMDVPK  160



>ref|XP_004962898.1| PREDICTED: crt homolog 1-like [Setaria italica]
Length=344

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLK YPFFLAQL TFGYV VY SIL+  + AG VT +ML+LPK
Sbjct  22   NRVLYKLALVPLKAYPFFLAQLTTFGYVAVYFSILYARHRAGVVTRDMLALPK  74



>ref|XP_004288863.2| PREDICTED: crt homolog 1-like [Fragaria vesca subsp. vesca]
Length=426

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K +PFFLAQ  TFGYV++Y SIL++ Y +G VT+EML LPK+
Sbjct  104  NRVLYKLALVPMKNHPFFLAQFTTFGYVVIYFSILYVRYRSGIVTDEMLRLPKS  157



>ref|XP_004501668.1| PREDICTED: crt homolog 2-like isoform X2 [Cicer arietinum]
Length=423

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLAL+P+  YPFFLAQ  TFGYV++Y SIL++ Y  G VTNEML++PK
Sbjct  101  NRVLYKLALIPMSNYPFFLAQFTTFGYVVIYFSILYIRYQLGIVTNEMLAIPK  153



>ref|XP_004501667.1| PREDICTED: crt homolog 2-like isoform X1 [Cicer arietinum]
Length=424

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLAL+P+  YPFFLAQ  TFGYV++Y SIL++ Y  G VTNEML++PK
Sbjct  101  NRVLYKLALIPMSNYPFFLAQFTTFGYVVIYFSILYIRYQLGIVTNEMLAIPK  153



>ref|XP_002986821.1| hypothetical protein SELMODRAFT_182638 [Selaginella moellendorffii]
 gb|EFJ12151.1| hypothetical protein SELMODRAFT_182638 [Selaginella moellendorffii]
Length=442

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            N+VLYK+AL+PL++YPFFLAQ+ TFGYV+VYSSIL   Y +G VT +ML+LPK+
Sbjct  123  NKVLYKMALIPLREYPFFLAQVNTFGYVLVYSSILLARYRSGAVTAKMLALPKS  176



>ref|XP_002969295.1| hypothetical protein SELMODRAFT_170659 [Selaginella moellendorffii]
 gb|EFJ29383.1| hypothetical protein SELMODRAFT_170659 [Selaginella moellendorffii]
Length=346

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            N+VLYK+AL+PL++YPFFLAQ+ TFGYV+VYSSIL   Y +G VT +ML+LPK+
Sbjct  27   NKVLYKMALIPLREYPFFLAQVNTFGYVLVYSSILLARYRSGAVTAKMLALPKS  80



>ref|XP_010671420.1| PREDICTED: crt homolog 2 [Beta vulgaris subsp. vulgaris]
Length=444

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRV YKLALVPL++YPFFLAQ  TFGYV +Y SILF+ + AG VT+EML++PK+
Sbjct  120  NRVFYKLALVPLQEYPFFLAQFITFGYVAIYFSILFIRHRAGIVTDEMLAIPKS  173



>ref|NP_001242115.1| uncharacterized protein LOC100787260 [Glycine max]
 gb|ACU17997.1| unknown [Glycine max]
Length=408

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+K+YPFFLAQ  TFGYV++Y SIL+  Y A  VT+EML++PK
Sbjct  86   NRVLYKLALVPMKEYPFFLAQFITFGYVVIYFSILYFRYRARIVTDEMLAIPK  138



>gb|KHN08975.1| Crt like 1 [Glycine soja]
Length=408

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+K+YPFFLAQ  TFGYV++Y SIL+  Y A  VT+EML++PK
Sbjct  86   NRVLYKLALVPMKEYPFFLAQFITFGYVVIYFSILYFRYRARIVTDEMLAIPK  138



>ref|XP_003522773.1| PREDICTED: crt homolog 1-like isoform X1 [Glycine max]
Length=406

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+K+YPFFLAQ  TFGYV++Y SIL+  Y A  VT+EML++PK
Sbjct  84   NRVLYKLALVPMKEYPFFLAQFITFGYVVIYFSILYFRYRARIVTDEMLAIPK  136



>ref|XP_009605243.1| PREDICTED: crt homolog 1-like [Nicotiana tomentosiformis]
Length=428

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ+ TFGY+ +Y SIL+  Y AG VTNEM++ PK+
Sbjct  107  NRVLYKLALVPMKEYPFFLAQVTTFGYLTIYLSILYARYRAGIVTNEMVAYPKS  160



>ref|XP_008647668.1| PREDICTED: uncharacterized protein LOC100277036 isoform X2 [Zea 
mays]
 ref|XP_008647669.1| PREDICTED: uncharacterized protein LOC100277036 isoform X2 [Zea 
mays]
Length=338

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLK YPFFLAQL TFGYV VY S+L+  Y  G VT +ML+LPK
Sbjct  22   NRVLYKLALVPLKAYPFFLAQLTTFGYVAVYFSMLYTRYRTGLVTRDMLALPK  74



>ref|XP_008647667.1| PREDICTED: uncharacterized protein LOC100277036 isoform X1 [Zea 
mays]
 gb|ACN27362.1| unknown [Zea mays]
 gb|AFW74652.1| hypothetical protein ZEAMMB73_664224 [Zea mays]
Length=344

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLK YPFFLAQL TFGYV VY S+L+  Y  G VT +ML+LPK
Sbjct  22   NRVLYKLALVPLKAYPFFLAQLTTFGYVAVYFSMLYTRYRTGLVTRDMLALPK  74



>emb|CAB45081.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79356.1| hypothetical protein [Arabidopsis thaliana]
Length=380

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFF+AQL TFGYV++Y +IL+     G VTNEM+ +PK
Sbjct  108  NRVLYKLALVPMKQYPFFMAQLTTFGYVLIYFTILYTRRRLGIVTNEMMDVPK  160



>ref|NP_001144179.1| uncharacterized protein LOC100277036 [Zea mays]
 gb|ACG38497.1| hypothetical protein [Zea mays]
Length=344

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVPLK YPFFLAQL TFGYV VY S+L+  Y  G VT +ML+LPK
Sbjct  22   NRVLYKLALVPLKAYPFFLAQLTTFGYVAVYFSMLYTRYRTGLVTRDMLALPK  74



>ref|XP_010320228.1| PREDICTED: crt homolog 3 isoform X3 [Solanum lycopersicum]
Length=393

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQL TFGY+ +Y SIL+  Y AG VT EM++ PK+
Sbjct  109  NRVLYKLALVPMKEYPFFLAQLTTFGYLAIYLSILYARYRAGIVTKEMVAYPKS  162



>ref|XP_003576016.1| PREDICTED: crt homolog 1-like [Brachypodium distachyon]
Length=342

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVPLK YPFFLAQL TFGYV VY +IL++ Y  G VT +ML+LPK+
Sbjct  21   NRVLYKLALVPLKAYPFFLAQLTTFGYVAVYFTILYVRYRRGLVTWDMLALPKS  74



>emb|CDY56575.1| BnaC01g41530D [Brassica napus]
Length=429

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQL TFGYV++Y +IL+     G VT+EMLS+PK
Sbjct  106  NRVLYKLALVPMKQYPFFLAQLMTFGYVLIYFTILYSRRRLGIVTDEMLSVPK  158



>ref|XP_006413428.1| hypothetical protein EUTSA_v10025263mg [Eutrema salsugineum]
 gb|ESQ54881.1| hypothetical protein EUTSA_v10025263mg [Eutrema salsugineum]
Length=430

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQL TFGYV++Y SIL+     G VT EM+S+PK
Sbjct  108  NRVLYKLALVPMKQYPFFLAQLNTFGYVLIYFSILYTRCRLGIVTGEMMSIPK  160



>ref|XP_009138072.1| PREDICTED: crt homolog 1 [Brassica rapa]
Length=430

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQL TFGYV++Y +IL+     G VT+EMLS+PK
Sbjct  107  NRVLYKLALVPMKQYPFFLAQLMTFGYVLIYFTILYSRRRLGIVTDEMLSVPK  159



>emb|CDY61009.1| BnaA01g35140D [Brassica napus]
Length=430

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQL TFGYV++Y +IL+     G VT+EMLS+PK
Sbjct  107  NRVLYKLALVPMKQYPFFLAQLMTFGYVLIYFTILYSRRRLGIVTDEMLSVPK  159



>ref|XP_008219232.1| PREDICTED: crt homolog 1 [Prunus mume]
Length=442

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K +PFFLAQ  TFGYVI+Y  ILF  Y +G VT+EM+ LPK+
Sbjct  120  NRVLYKLALVPMKNHPFFLAQFTTFGYVIIYFLILFARYRSGIVTDEMIGLPKS  173



>ref|XP_010448563.1| PREDICTED: crt homolog 2 [Camelina sativa]
Length=437

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQL TFGYV++Y +IL+     G VTNEM+ +PK
Sbjct  113  NRVLYKLALVPMKQYPFFLAQLTTFGYVLIYFTILYTRRRLGIVTNEMMGVPK  165



>ref|NP_194177.2| CRT (chloroquine-resistance transporter)-like transporter 2 [Arabidopsis 
thaliana]
 ref|NP_001190820.1| CRT (chloroquine-resistance transporter)-like transporter 2 [Arabidopsis 
thaliana]
 gb|ABM06027.1| At4g24460 [Arabidopsis thaliana]
 gb|AEE84907.1| CRT (chloroquine-resistance transporter)-like transporter 2 [Arabidopsis 
thaliana]
 gb|AEE84908.1| CRT (chloroquine-resistance transporter)-like transporter 2 [Arabidopsis 
thaliana]
Length=431

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFF+AQL TFGYV++Y +IL+     G VTNEM+ +PK
Sbjct  108  NRVLYKLALVPMKQYPFFMAQLTTFGYVLIYFTILYTRRRLGIVTNEMMDVPK  160



>ref|XP_004238016.1| PREDICTED: crt homolog 1 isoform X1 [Solanum lycopersicum]
Length=430

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQL TFGY+ +Y SIL+  Y AG VT EM++ PK+
Sbjct  109  NRVLYKLALVPMKEYPFFLAQLTTFGYLAIYLSILYARYRAGIVTKEMVAYPKS  162



>emb|CDP00923.1| unnamed protein product [Coffea canephora]
Length=450

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRV YKLALVP+K+YPFFLAQL TFGYV +Y  IL+  Y AG VT+EM+ LPK+
Sbjct  128  NRVFYKLALVPMKEYPFFLAQLTTFGYVAIYFFILYTRYKAGIVTDEMIGLPKS  181



>ref|XP_006338030.1| PREDICTED: crt homolog 3-like isoform X2 [Solanum tuberosum]
Length=368

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ+ TFGY+ +Y SIL+  Y AG VT EM++ PK+
Sbjct  109  NRVLYKLALVPMKEYPFFLAQVTTFGYLAIYLSILYARYRAGIVTKEMVAYPKS  162



>ref|XP_002869717.1| hypothetical protein ARALYDRAFT_492400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45976.1| hypothetical protein ARALYDRAFT_492400 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFF+AQL TFGYV +Y +IL+     G VTNEM+++PK
Sbjct  103  NRVLYKLALVPMKQYPFFMAQLTTFGYVFIYFTILYTRRRLGIVTNEMMAVPK  155



>ref|XP_003617235.1| Crt-like protein [Medicago truncatula]
Length=432

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 5/55 (9%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVLYKLALVPLKQYPFFLAQ     YVIVY  I+++ + AG VT+EMLSLPKTP
Sbjct  110  NRVLYKLALVPLKQYPFFLAQ-----YVIVYFGIMYIRHRAGIVTDEMLSLPKTP  159



>ref|XP_010439030.1| PREDICTED: LOW QUALITY PROTEIN: crt homolog 2-like [Camelina 
sativa]
Length=434

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFFLAQL TFGYV++Y +IL      G VTNEM+ +PK
Sbjct  110  NRVLYKLALVPMKQYPFFLAQLTTFGYVLIYFTILCTRRRLGIVTNEMMGVPK  162



>ref|XP_010099562.1| hypothetical protein L484_011568 [Morus notabilis]
 gb|EXB79628.1| hypothetical protein L484_011568 [Morus notabilis]
Length=417

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+K+YPFFLAQ  TFGYV+VY  IL++ Y+ G VT+EM+  PK
Sbjct  112  NRVLYKLALVPMKEYPFFLAQFTTFGYVVVYFLILYMRYNEGIVTDEMIDQPK  164



>ref|XP_006283786.1| hypothetical protein CARUB_v10004876mg [Capsella rubella]
 gb|EOA16684.1| hypothetical protein CARUB_v10004876mg [Capsella rubella]
Length=425

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLY+LALVP+KQYPFFLAQL TFGYV++Y +IL+     G VTNEM+ +PK
Sbjct  107  NRVLYRLALVPMKQYPFFLAQLMTFGYVLIYFTILYTRRRLGIVTNEMMGVPK  159



>ref|XP_007136303.1| hypothetical protein PHAVU_009G035000g [Phaseolus vulgaris]
 gb|ESW08297.1| hypothetical protein PHAVU_009G035000g [Phaseolus vulgaris]
Length=408

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+K YPFFLAQ  TFGYV++Y SIL + Y A  VT+EM+++PK
Sbjct  86   NRVLYKLALVPMKDYPFFLAQFITFGYVVIYFSILCIRYRARIVTDEMMAIPK  138



>ref|XP_006338029.1| PREDICTED: crt homolog 3-like isoform X1 [Solanum tuberosum]
Length=430

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQ+ TFGY+ +Y SIL+  Y AG VT EM++ PK+
Sbjct  109  NRVLYKLALVPMKEYPFFLAQVTTFGYLAIYLSILYARYRAGIVTKEMVAYPKS  162



>gb|KFK29005.1| hypothetical protein AALP_AA7G076900 [Arabis alpina]
Length=426

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NRVLYKLALVP+KQYPFF+AQL TFGYV++Y SIL++    G VT EM+ +PK
Sbjct  102  NRVLYKLALVPMKQYPFFMAQLNTFGYVLIYFSILYMRCKLGIVTYEMMQVPK  154



>gb|EYU36441.1| hypothetical protein MIMGU_mgv1a008405mg [Erythranthe guttata]
Length=374

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVL KLAL+P+K +PFFLAQL +F YV V+ S+L + Y AGK T+EML LPK+P
Sbjct  116  NRVLQKLALIPMKNHPFFLAQLNSFVYVAVFFSVLRVRYRAGKTTDEMLDLPKSP  170



>gb|EYU36445.1| hypothetical protein MIMGU_mgv1a020365mg [Erythranthe guttata]
Length=439

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVL KLAL+P+K +PFFLAQL +F YV V+ S+L + Y AGK T+EML LPK+P
Sbjct  116  NRVLQKLALIPMKNHPFFLAQLNSFVYVAVFFSVLRVRYRAGKTTDEMLDLPKSP  170



>ref|XP_011074279.1| PREDICTED: uncharacterized protein LOC105159044 [Sesamum indicum]
Length=460

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            NRVL KLALVP+K +PFFLAQ  +F YV VY S+L L Y AG  T+EML++PK P
Sbjct  113  NRVLQKLALVPMKDHPFFLAQFNSFMYVAVYFSVLHLRYRAGLTTDEMLAVPKAP  167



>gb|EYU36442.1| hypothetical protein MIMGU_mgv1a010446mg [Erythranthe guttata]
Length=312

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  590  LKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKTP  721
            +K++PFFLAQL TFGYV +Y SILF+ Y AG  T+EMLS PK P
Sbjct  1    MKEFPFFLAQLTTFGYVAIYFSILFMRYRAGVATDEMLSFPKIP  44



>ref|XP_005650231.1| hypothetical protein COCSUDRAFT_64779 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25687.1| hypothetical protein COCSUDRAFT_64779 [Coccomyxa subellipsoidea 
C-169]
Length=487

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            NR+LYK+ALVPL  Y FFLAQ  TF YV+VY + L + Y +G VT +ML+ P 
Sbjct  157  NRILYKMALVPLGDYIFFLAQFQTFSYVLVYFTALLIRYRSGIVTKDMLNAPN  209



>ref|XP_007222981.1| hypothetical protein PRUPE_ppa008968mg [Prunus persica]
 gb|EMJ24180.1| hypothetical protein PRUPE_ppa008968mg [Prunus persica]
Length=312

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  590  LKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            +K +PFFLAQ  TFGYVI+Y SILF  Y +G VT+EM+SLPK+
Sbjct  1    MKNHPFFLAQFTTFGYVIIYFSILFARYRSGIVTDEMISLPKS  43



>ref|XP_010320227.1| PREDICTED: crt homolog 1 isoform X2 [Solanum lycopersicum]
Length=418

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 12/54 (22%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            NRVLYKLALVP+K+YPFFLAQL TFG            Y AG VT EM++ PK+
Sbjct  109  NRVLYKLALVPMKEYPFFLAQLTTFG------------YRAGIVTKEMVAYPKS  150



>ref|NP_001045437.2| Os01g0955700 [Oryza sativa Japonica Group]
 dbj|BAF07351.2| Os01g0955700 [Oryza sativa Japonica Group]
Length=154

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIV  646
            NRVLYKLALVPL+ YPFFLAQLATFGYV V
Sbjct  111  NRVLYKLALVPLRDYPFFLAQLATFGYVRV  140



>gb|KHN08288.1| Crt like 3 [Glycine soja]
Length=308

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  590  LKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            +K+YPFFLAQ  TFGYV++Y SIL+  Y A  VT+EML++PK
Sbjct  1    MKEYPFFLAQFITFGYVVIYFSILYFRYRARIVTDEMLAIPK  42



>ref|XP_008782109.1| PREDICTED: uncharacterized protein LOC103701724 [Phoenix dactylifera]
Length=372

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYV  640
            NRVLYKLALVPLKQYPFFLAQLATFGYV
Sbjct  118  NRVLYKLALVPLKQYPFFLAQLATFGYV  145



>ref|XP_001754536.1| predicted protein [Physcomitrella patens]
 gb|EDQ80506.1| predicted protein [Physcomitrella patens]
Length=319

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  575  LALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPK  715
            +ALVPL +Y  FLAQ  TF YV+ YSS+L + Y AG VT EML++PK
Sbjct  1    MALVPLSRYSLFLAQFNTFTYVVAYSSLLLMRYRAGIVTKEMLAIPK  47



>ref|XP_001763845.1| predicted protein [Physcomitrella patens]
 gb|EDQ71249.1| predicted protein [Physcomitrella patens]
Length=312

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  575  LALVPLKQYPFFLAQLATFGYVIVYSSILFLXYHAGKVTNEMLSLPKT  718
            +ALVPL +Y  FLAQ  T  YV+ YS+IL + Y +G VT EMLS+PKT
Sbjct  1    MALVPLSKYSLFLAQFNTVIYVVTYSTILLMRYQSGIVTKEMLSIPKT  48



>ref|NP_001154721.1| CRT (chloroquine-resistance transporter)-like transporter 1 [Arabidopsis 
thaliana]
 gb|AED92694.1| CRT (chloroquine-resistance transporter)-like transporter 1 [Arabidopsis 
thaliana]
Length=507

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 4/45 (9%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFG----YVIVYSSILFLXYHA  679
            NRVLYKLAL+PLKQYPFFLAQL+TFG    +V+ +  + F+ ++ 
Sbjct  119  NRVLYKLALIPLKQYPFFLAQLSTFGFRFRFVVSFDDLAFIVFNC  163



>dbj|BAB10034.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAT71935.1| At5g12160 [Arabidopsis thaliana]
 gb|AAU15152.1| At5g12160 [Arabidopsis thaliana]
Length=146

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFG  634
            NRV+YKLALVPLK+YPFFLAQL+TFG
Sbjct  121  NRVMYKLALVPLKEYPFFLAQLSTFG  146



>dbj|BAD88271.1| hypothetical protein [Oryza sativa Japonica Group]
Length=495

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 4/48 (8%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGYVIVYSSILFLXYH-AGKVTNE  697
            NRVLYKLALVPL+ YPFFLAQLATFG   +    L L  H +G++T  
Sbjct  77   NRVLYKLALVPLRDYPFFLAQLATFG---LCDGCLVLGVHLSGRITGR  121



>ref|XP_009617410.1| PREDICTED: uncharacterized protein LOC104109758 isoform X2 [Nicotiana 
tomentosiformis]
Length=133

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGY  637
            NRVLYKLALVP+K+YP FLAQ+ TFGY
Sbjct  107  NRVLYKLALVPMKEYPVFLAQVTTFGY  133



>emb|CDY02751.1| BnaC02g11380D [Brassica napus]
Length=509

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFG  634
            NRV+YKLAL+PLKQYPFFLAQL+TFG
Sbjct  120  NRVMYKLALIPLKQYPFFLAQLSTFG  145



>ref|XP_009617409.1| PREDICTED: uncharacterized protein LOC104109758 isoform X1 [Nicotiana 
tomentosiformis]
Length=139

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFGY  637
            NRVLYKLALVP+K+YP FLAQ+ TFG+
Sbjct  107  NRVLYKLALVPMKEYPVFLAQVTTFGF  133



>gb|EYU36453.1| hypothetical protein MIMGU_mgv1a019563mg, partial [Erythranthe 
guttata]
Length=223

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLA----QLATFGYVIVYSSILFLXYH--AGKVTNEMLSLPKT  718
            NRVLYKLALVPLK++PFF          F Y  ++ +++++ Y    G  T+E+LS PK+
Sbjct  18   NRVLYKLALVPLKEFPFFRKMKNNHCMIFCYDSLHCNLIYVNYRYGVGVATDEILSFPKS  77

Query  719  P  721
            P
Sbjct  78   P  78



>gb|KJB58832.1| hypothetical protein B456_009G228500 [Gossypium raimondii]
Length=445

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +2

Query  557  NRVLYKLALVPLKQYPFFLAQLATFG  634
            NRVLYKLALVP+K+YPFFLAQ  TFG
Sbjct  149  NRVLYKLALVPMKEYPFFLAQFTTFG  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1323106870870