BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig808

Length=659
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008446819.1|  PREDICTED: uncharacterized protein LOC103489435    277   7e-86   Cucumis melo [Oriental melon]
ref|XP_009627853.1|  PREDICTED: uncharacterized protein LOC104118334    273   3e-84   Nicotiana tomentosiformis
ref|XP_004142499.2|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    270   5e-83   Cucumis sativus [cucumbers]
ref|XP_009792652.1|  PREDICTED: uncharacterized protein LOC104239662    268   4e-82   Nicotiana sylvestris
ref|XP_010103517.1|  putative transporter MCH1                          266   8e-82   Morus notabilis
ref|XP_009598854.1|  PREDICTED: uncharacterized protein LOC104094596    266   2e-81   Nicotiana tomentosiformis
ref|XP_006436518.1|  hypothetical protein CICLE_v10030988mg             266   2e-81   Citrus clementina [clementine]
gb|KDO47545.1|  hypothetical protein CISIN_1g040453mg                   264   3e-81   Citrus sinensis [apfelsine]
ref|XP_011094505.1|  PREDICTED: uncharacterized protein LOC105174183    266   3e-81   Sesamum indicum [beniseed]
ref|XP_009780392.1|  PREDICTED: uncharacterized protein LOC104229438    263   2e-80   Nicotiana sylvestris
ref|XP_010534423.1|  PREDICTED: uncharacterized protein LOC104809977    263   2e-80   Tarenaya hassleriana [spider flower]
emb|CDY44632.1|  BnaC04g06300D                                          261   4e-80   Brassica napus [oilseed rape]
emb|CBI31406.3|  unnamed protein product                                261   5e-80   Vitis vinifera
ref|XP_003555226.2|  PREDICTED: uncharacterized protein LOC100819661    261   5e-80   
ref|XP_002272074.2|  PREDICTED: uncharacterized protein LOC100266758    262   6e-80   Vitis vinifera
ref|XP_009143336.1|  PREDICTED: uncharacterized protein LOC103867059    261   7e-80   Brassica rapa
ref|XP_008354067.1|  PREDICTED: uncharacterized protein LOC103417686    256   7e-80   
emb|CDX74863.1|  BnaA05g06090D                                          261   7e-80   
emb|CBI31405.3|  unnamed protein product                                260   1e-79   Vitis vinifera
emb|CDY07663.1|  BnaA03g18480D                                          261   1e-79   Brassica napus [oilseed rape]
gb|KHN11442.1|  Putative transporter MCH1                               261   1e-79   Glycine soja [wild soybean]
ref|XP_009133348.1|  PREDICTED: uncharacterized protein LOC103857852    261   1e-79   Brassica rapa
ref|XP_002534014.1|  conserved hypothetical protein                     259   1e-79   
emb|CDY24976.1|  BnaC03g21960D                                          260   1e-79   Brassica napus [oilseed rape]
ref|XP_010658344.1|  PREDICTED: uncharacterized membrane protein ...    261   2e-79   Vitis vinifera
ref|XP_006379525.1|  nodulin family protein                             261   2e-79   
ref|XP_006411146.1|  hypothetical protein EUTSA_v10016410mg             260   2e-79   Eutrema salsugineum [saltwater cress]
ref|XP_009141793.1|  PREDICTED: uncharacterized protein LOC103865707    259   4e-79   Brassica rapa
emb|CDX93282.1|  BnaC04g46140D                                          259   5e-79   
emb|CDO99801.1|  unnamed protein product                                259   6e-79   Coffea canephora [robusta coffee]
ref|XP_010509060.1|  PREDICTED: uncharacterized protein LOC104785526    259   6e-79   Camelina sativa [gold-of-pleasure]
emb|CAN66928.1|  hypothetical protein VITISV_011832                     259   7e-79   Vitis vinifera
ref|XP_003536696.1|  PREDICTED: uncharacterized protein LOC100776865    258   1e-78   Glycine max [soybeans]
ref|NP_181454.1|  major facilitator protein                             258   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011655862.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    258   1e-78   Cucumis sativus [cucumbers]
ref|XP_006293868.1|  hypothetical protein CARUB_v10022856mg             258   2e-78   Capsella rubella
ref|XP_006345994.1|  PREDICTED: uncharacterized protein LOC102592436    257   2e-78   Solanum tuberosum [potatoes]
ref|XP_004250040.1|  PREDICTED: uncharacterized protein LOC101265191    258   2e-78   Solanum lycopersicum
ref|XP_010509061.1|  PREDICTED: uncharacterized protein LOC104785527    257   3e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010067354.1|  PREDICTED: uncharacterized protein LOC104454...    257   4e-78   
ref|XP_010325963.1|  PREDICTED: uncharacterized protein LOC101257997    257   4e-78   Solanum lycopersicum
ref|XP_010067352.1|  PREDICTED: uncharacterized protein LOC104454...    257   5e-78   Eucalyptus grandis [rose gum]
ref|XP_006361693.1|  PREDICTED: uncharacterized protein LOC102605820    256   7e-78   Solanum tuberosum [potatoes]
ref|XP_002862889.1|  nodulin family protein                             255   8e-78   
ref|XP_008362281.1|  PREDICTED: uncharacterized protein LOC103425934    256   9e-78   
gb|KFK36814.1|  hypothetical protein AALP_AA4G174900                    256   1e-77   Arabis alpina [alpine rockcress]
ref|XP_010517258.1|  PREDICTED: uncharacterized protein LOC104792736    256   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010557206.1|  PREDICTED: uncharacterized protein LOC104826258    256   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_002881636.1|  predicted protein                                  255   1e-77   
ref|XP_010068847.1|  PREDICTED: uncharacterized protein LOC104455819    256   2e-77   Eucalyptus grandis [rose gum]
ref|XP_012082447.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    256   2e-77   Jatropha curcas
ref|XP_007142881.1|  hypothetical protein PHAVU_007G024800g             256   2e-77   Phaseolus vulgaris [French bean]
ref|XP_012080984.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    255   3e-77   Jatropha curcas
ref|XP_006354409.1|  PREDICTED: uncharacterized membrane protein ...    254   4e-77   
ref|XP_010505589.1|  PREDICTED: uncharacterized protein LOC104782373    254   5e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009765800.1|  PREDICTED: uncharacterized membrane protein ...    254   5e-77   Nicotiana sylvestris
gb|KCW65468.1|  hypothetical protein EUGRSUZ_G02878                     254   9e-77   Eucalyptus grandis [rose gum]
ref|XP_010068870.1|  PREDICTED: uncharacterized protein LOC104455846    254   1e-76   Eucalyptus grandis [rose gum]
ref|XP_007220549.1|  hypothetical protein PRUPE_ppa003180mg             253   1e-76   Prunus persica
ref|XP_002519465.1|  conserved hypothetical protein                     254   1e-76   Ricinus communis
ref|XP_009630642.1|  PREDICTED: uncharacterized membrane protein ...    253   1e-76   
ref|XP_008233256.1|  PREDICTED: uncharacterized protein LOC103332309    253   1e-76   Prunus mume [ume]
gb|KJB73494.1|  hypothetical protein B456_011G235000                    253   2e-76   Gossypium raimondii
ref|XP_004307342.1|  PREDICTED: uncharacterized protein LOC101306672    253   2e-76   Fragaria vesca subsp. vesca
gb|KEH44271.1|  MFS transporter                                         253   2e-76   Medicago truncatula
gb|KEH44270.1|  MFS transporter                                         252   2e-76   Medicago truncatula
ref|XP_007142882.1|  hypothetical protein PHAVU_007G024900g             252   3e-76   Phaseolus vulgaris [French bean]
ref|XP_010435975.1|  PREDICTED: uncharacterized protein LOC104719709    252   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_004497124.1|  PREDICTED: uncharacterized protein LOC101508657    252   3e-76   Cicer arietinum [garbanzo]
gb|KDO37221.1|  hypothetical protein CISIN_1g039263mg                   249   4e-76   Citrus sinensis [apfelsine]
ref|XP_004240185.2|  PREDICTED: uncharacterized protein LOC101262315    251   6e-76   
ref|XP_010450661.1|  PREDICTED: uncharacterized protein LOC104732777    250   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_003637404.1|  Nitrate and chloride transporter                   250   1e-75   
gb|EPS72672.1|  hypothetical protein M569_02085                         249   1e-75   Genlisea aurea
gb|KEH44269.1|  MFS transporter                                         250   2e-75   Medicago truncatula
emb|CAN63260.1|  hypothetical protein VITISV_029213                     250   2e-75   Vitis vinifera
ref|XP_007162787.1|  hypothetical protein PHAVU_001G180500g             249   2e-75   Phaseolus vulgaris [French bean]
ref|XP_002268663.2|  PREDICTED: uncharacterized protein LOC100248651    251   2e-75   Vitis vinifera
ref|XP_010067353.1|  PREDICTED: uncharacterized protein LOC104454...    250   2e-75   Eucalyptus grandis [rose gum]
ref|XP_003535733.2|  PREDICTED: uncharacterized protein LOC100787176    250   4e-75   Glycine max [soybeans]
ref|XP_010267223.1|  PREDICTED: uncharacterized protein LOC104604543    250   5e-75   Nelumbo nucifera [Indian lotus]
ref|XP_004142500.2|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    248   5e-75   Cucumis sativus [cucumbers]
gb|KCW65302.1|  hypothetical protein EUGRSUZ_G02759                     249   6e-75   Eucalyptus grandis [rose gum]
ref|XP_003555885.1|  PREDICTED: uncharacterized protein LOC100808975    248   6e-75   Glycine max [soybeans]
ref|XP_003555225.2|  PREDICTED: uncharacterized protein LOC100819121    249   7e-75   
gb|KHN11443.1|  Putative transporter MCH1                               248   7e-75   Glycine soja [wild soybean]
ref|XP_011031645.1|  PREDICTED: uncharacterized protein LOC105130706    248   9e-75   Populus euphratica
gb|KHN05591.1|  hypothetical protein glysoja_035791                     248   1e-74   Glycine soja [wild soybean]
ref|NP_001236811.1|  nitrate and chloride transporter                   248   2e-74   
ref|XP_007142880.1|  hypothetical protein PHAVU_007G024700g             247   2e-74   Phaseolus vulgaris [French bean]
gb|KHN05589.1|  Putative transporter MCH1                               248   2e-74   Glycine soja [wild soybean]
ref|XP_010243234.1|  PREDICTED: uncharacterized protein LOC104587357    248   2e-74   Nelumbo nucifera [Indian lotus]
gb|KHN11444.1|  hypothetical protein glysoja_015339                     246   3e-74   Glycine soja [wild soybean]
emb|CDP15282.1|  unnamed protein product                                246   4e-74   Coffea canephora [robusta coffee]
ref|XP_006491715.1|  PREDICTED: uncharacterized membrane protein ...    246   5e-74   Citrus sinensis [apfelsine]
ref|XP_010050677.1|  PREDICTED: uncharacterized protein LOC104439293    246   8e-74   Eucalyptus grandis [rose gum]
ref|XP_010050685.1|  PREDICTED: uncharacterized protein LOC104439301    246   8e-74   Eucalyptus grandis [rose gum]
ref|XP_010098801.1|  hypothetical protein L484_022566                   234   8e-74   
ref|XP_009377045.1|  PREDICTED: uncharacterized protein LOC103965696    246   8e-74   Pyrus x bretschneideri [bai li]
ref|XP_004497125.1|  PREDICTED: uncharacterized protein LOC101508976    244   2e-73   Cicer arietinum [garbanzo]
gb|KJB60522.1|  hypothetical protein B456_009G310000                    244   3e-73   Gossypium raimondii
ref|XP_008387534.1|  PREDICTED: uncharacterized protein LOC103449994    244   4e-73   
ref|XP_007027453.1|  Major facilitator superfamily protein              244   5e-73   
ref|XP_011084395.1|  PREDICTED: uncharacterized protein LOC105166653    243   6e-73   Sesamum indicum [beniseed]
ref|XP_010933270.1|  PREDICTED: uncharacterized membrane protein ...    244   7e-73   Elaeis guineensis
ref|XP_010050695.1|  PREDICTED: uncharacterized protein LOC104439313    244   8e-73   Eucalyptus grandis [rose gum]
ref|XP_003521414.2|  PREDICTED: uncharacterized protein LOC100797779    243   2e-72   Glycine max [soybeans]
gb|KEH44272.1|  MFS transporter                                         242   3e-72   Medicago truncatula
gb|KEH24041.1|  MFS transporter                                         242   3e-72   Medicago truncatula
ref|XP_007010014.1|  Major facilitator superfamily protein              242   3e-72   
ref|XP_003554397.1|  PREDICTED: uncharacterized protein LOC100818752    241   4e-72   Glycine max [soybeans]
ref|XP_007204603.1|  hypothetical protein PRUPE_ppa002810mg             241   8e-72   Prunus persica
ref|XP_008443577.1|  PREDICTED: uncharacterized protein LOC103487133    235   1e-71   
ref|XP_011018791.1|  PREDICTED: uncharacterized protein LOC105121728    240   1e-71   Populus euphratica
gb|KJB36485.1|  hypothetical protein B456_006G161500                    240   1e-71   Gossypium raimondii
ref|XP_004494077.1|  PREDICTED: uncharacterized protein LOC101506073    239   1e-71   Cicer arietinum [garbanzo]
ref|XP_011089957.1|  PREDICTED: uncharacterized protein LOC105170752    239   1e-71   Sesamum indicum [beniseed]
gb|KHN18681.1|  Putative transporter MCH1                               239   2e-71   Glycine soja [wild soybean]
ref|XP_006369229.1|  hypothetical protein POPTR_0001s19730g             232   2e-71   
gb|EYU36146.1|  hypothetical protein MIMGU_mgv1a018039mg                239   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_004249478.1|  PREDICTED: uncharacterized protein LOC101244136    239   3e-71   Solanum lycopersicum
ref|XP_010557355.1|  PREDICTED: uncharacterized protein LOC104826384    238   3e-71   Tarenaya hassleriana [spider flower]
ref|XP_009368999.1|  PREDICTED: uncharacterized protein LOC103958461    239   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_008241388.1|  PREDICTED: uncharacterized protein LOC103339814    239   4e-71   Prunus mume [ume]
ref|XP_006838710.1|  PREDICTED: uncharacterized protein LOC18429361     238   4e-71   
ref|XP_011094591.1|  PREDICTED: uncharacterized protein LOC105174255    238   5e-71   Sesamum indicum [beniseed]
ref|XP_012080987.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    238   6e-71   Jatropha curcas
ref|XP_012080986.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    238   6e-71   Jatropha curcas
emb|CBI30156.3|  unnamed protein product                                238   6e-71   Vitis vinifera
ref|XP_008379735.1|  PREDICTED: uncharacterized protein LOC103442697    238   9e-71   
ref|XP_006295838.1|  hypothetical protein CARUB_v10024965mg             237   1e-70   
ref|XP_011089961.1|  PREDICTED: uncharacterized protein LOC105170755    237   1e-70   Sesamum indicum [beniseed]
ref|XP_012080985.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    238   1e-70   Jatropha curcas
ref|XP_010414589.1|  PREDICTED: uncharacterized protein LOC104700...    237   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010510684.1|  PREDICTED: uncharacterized protein LOC104786...    237   1e-70   Camelina sativa [gold-of-pleasure]
emb|CDY30506.1|  BnaA04g16270D                                          236   2e-70   Brassica napus [oilseed rape]
ref|XP_010470138.1|  PREDICTED: uncharacterized protein LOC104750092    236   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002880951.1|  nodulin family protein                             236   2e-70   Arabidopsis lyrata subsp. lyrata
dbj|BAO45884.1|  nitrate and chloride transporter                       238   2e-70   Acacia mangium
ref|XP_009140846.1|  PREDICTED: uncharacterized protein LOC103864824    236   2e-70   Brassica rapa
ref|XP_006339088.1|  PREDICTED: uncharacterized protein LOC102588077    236   2e-70   
ref|XP_006409833.1|  hypothetical protein EUTSA_v10016458mg             236   2e-70   
ref|XP_008348275.1|  PREDICTED: uncharacterized protein LOC103411418    231   2e-70   
ref|XP_007208506.1|  hypothetical protein PRUPE_ppa026488mg             236   3e-70   Prunus persica
ref|XP_012064708.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    235   3e-70   Jatropha curcas
gb|KFK32342.1|  hypothetical protein AALP_AA6G229300                    236   3e-70   Arabis alpina [alpine rockcress]
emb|CDX77158.1|  BnaC04g39530D                                          235   4e-70   
ref|XP_007208449.1|  hypothetical protein PRUPE_ppa003535mg             235   4e-70   
ref|XP_006381386.1|  hypothetical protein POPTR_0006s12430g             236   5e-70   
ref|XP_010111839.1|  hypothetical protein L484_020631                   235   5e-70   Morus notabilis
ref|XP_008443578.1|  PREDICTED: uncharacterized protein LOC103487134    229   6e-70   
ref|XP_010691116.1|  PREDICTED: uncharacterized protein LOC104904...    235   7e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006384953.1|  nodulin family protein                             234   8e-70   Populus trichocarpa [western balsam poplar]
ref|XP_008227863.1|  PREDICTED: uncharacterized membrane protein ...    234   1e-69   Prunus mume [ume]
ref|NP_180379.1|  major facilitator protein                             234   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008226501.1|  PREDICTED: uncharacterized protein LOC103326070    234   1e-69   Prunus mume [ume]
emb|CDP07039.1|  unnamed protein product                                234   1e-69   Coffea canephora [robusta coffee]
ref|XP_009103645.1|  PREDICTED: uncharacterized membrane protein ...    234   1e-69   Brassica rapa
emb|CDY04538.1|  BnaA07g13640D                                          234   2e-69   
emb|CDX71381.1|  BnaC04g16160D                                          234   2e-69   
ref|XP_011028256.1|  PREDICTED: uncharacterized protein LOC105128342    233   3e-69   Populus euphratica
ref|XP_010098800.1|  hypothetical protein L484_022565                   234   4e-69   
ref|XP_011094731.1|  PREDICTED: uncharacterized protein LOC105174351    233   4e-69   Sesamum indicum [beniseed]
ref|XP_006339087.1|  PREDICTED: uncharacterized protein LOC102587756    233   5e-69   Solanum tuberosum [potatoes]
ref|XP_010267225.1|  PREDICTED: uncharacterized protein LOC104604545    233   6e-69   Nelumbo nucifera [Indian lotus]
ref|XP_007144375.1|  hypothetical protein PHAVU_007G151000g             233   6e-69   Phaseolus vulgaris [French bean]
gb|EYU29889.1|  hypothetical protein MIMGU_mgv1a003835mg                231   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_009413295.1|  PREDICTED: uncharacterized protein LOC103994629    233   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008462497.1|  PREDICTED: uncharacterized protein LOC103500834    232   1e-68   Cucumis melo [Oriental melon]
ref|XP_011469614.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    232   1e-68   Fragaria vesca subsp. vesca
ref|XP_002519464.1|  conserved hypothetical protein                     231   2e-68   Ricinus communis
gb|KHN39024.1|  Putative transporter MCH1                               231   2e-68   Glycine soja [wild soybean]
ref|XP_011469615.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    231   2e-68   Fragaria vesca subsp. vesca
ref|XP_010691115.1|  PREDICTED: uncharacterized protein LOC104904...    231   2e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB73493.1|  hypothetical protein B456_011G234900                    229   3e-68   Gossypium raimondii
ref|XP_009356932.1|  PREDICTED: uncharacterized protein LOC103947713    231   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_003537006.1|  PREDICTED: uncharacterized protein LOC100782396    231   3e-68   Glycine max [soybeans]
ref|XP_004304474.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    231   3e-68   Fragaria vesca subsp. vesca
ref|XP_002313536.1|  nodulin family protein                             230   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_009627404.1|  PREDICTED: uncharacterized protein LOC104117959    231   3e-68   Nicotiana tomentosiformis
ref|XP_004143363.2|  PREDICTED: uncharacterized protein LOC101203981    231   3e-68   Cucumis sativus [cucumbers]
ref|XP_003553561.1|  PREDICTED: uncharacterized protein LOC100798313    230   3e-68   Glycine max [soybeans]
ref|XP_009356931.1|  PREDICTED: uncharacterized protein LOC103947712    230   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_004249479.1|  PREDICTED: uncharacterized protein LOC101244433    230   3e-68   Solanum lycopersicum
ref|XP_003541428.1|  PREDICTED: uncharacterized protein LOC100814000    231   4e-68   Glycine max [soybeans]
ref|XP_008794008.1|  PREDICTED: uncharacterized membrane protein ...    231   4e-68   Phoenix dactylifera
ref|XP_008385511.1|  PREDICTED: uncharacterized protein LOC103448054    230   5e-68   
ref|XP_007010021.1|  Major facilitator superfamily protein              230   5e-68   
ref|XP_011032303.1|  PREDICTED: uncharacterized protein LOC105131167    229   6e-68   Populus euphratica
ref|XP_008385512.1|  PREDICTED: uncharacterized protein LOC103448055    229   6e-68   Malus domestica [apple tree]
ref|XP_006436519.1|  hypothetical protein CICLE_v10031022mg             230   7e-68   Citrus clementina [clementine]
ref|XP_009606524.1|  PREDICTED: uncharacterized protein LOC104100872    229   9e-68   Nicotiana tomentosiformis
ref|XP_002523712.1|  conserved hypothetical protein                     229   9e-68   
ref|XP_008465591.1|  PREDICTED: uncharacterized protein LOC103503227    229   1e-67   Cucumis melo [Oriental melon]
ref|XP_010651774.1|  PREDICTED: uncharacterized protein LOC100244770    231   1e-67   
ref|XP_009783152.1|  PREDICTED: uncharacterized protein LOC104231797    229   1e-67   Nicotiana sylvestris
ref|XP_010321905.1|  PREDICTED: uncharacterized protein LOC101251293    229   2e-67   Solanum lycopersicum
ref|XP_004147280.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    229   2e-67   Cucumis sativus [cucumbers]
ref|XP_010658347.1|  PREDICTED: uncharacterized protein LOC100256...    228   3e-67   Vitis vinifera
ref|XP_002267992.3|  PREDICTED: uncharacterized protein LOC100256...    228   3e-67   Vitis vinifera
ref|XP_007016870.1|  Major facilitator superfamily protein              229   3e-67   
ref|XP_006366091.1|  PREDICTED: uncharacterized protein LOC102598479    228   3e-67   Solanum tuberosum [potatoes]
ref|XP_009356979.1|  PREDICTED: uncharacterized protein LOC103947752    227   4e-67   
ref|XP_009335989.1|  PREDICTED: uncharacterized protein LOC103928636    227   4e-67   Pyrus x bretschneideri [bai li]
ref|XP_009345750.1|  PREDICTED: uncharacterized protein LOC103937531    227   5e-67   Pyrus x bretschneideri [bai li]
ref|XP_010691114.1|  PREDICTED: uncharacterized protein LOC104904539    228   6e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW65298.1|  hypothetical protein EUGRSUZ_G027541                    221   6e-67   Eucalyptus grandis [rose gum]
gb|KDP29178.1|  hypothetical protein JCGZ_16567                         227   9e-67   Jatropha curcas
ref|XP_008233255.1|  PREDICTED: uncharacterized protein LOC103332307    227   9e-67   Prunus mume [ume]
ref|XP_004288935.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    226   9e-67   Fragaria vesca subsp. vesca
ref|XP_008379570.1|  PREDICTED: uncharacterized protein LOC103442545    227   1e-66   
gb|EPS63290.1|  hypothetical protein M569_11492                         226   1e-66   Genlisea aurea
ref|XP_012082602.1|  PREDICTED: uncharacterized protein LOC105642394    226   1e-66   
ref|XP_008385510.1|  PREDICTED: uncharacterized protein LOC103448053    226   1e-66   Malus domestica [apple tree]
ref|XP_004150375.2|  PREDICTED: uncharacterized protein LOC101208506    226   2e-66   Cucumis sativus [cucumbers]
ref|XP_010068872.1|  PREDICTED: uncharacterized protein LOC104455848    226   2e-66   Eucalyptus grandis [rose gum]
ref|XP_007219108.1|  hypothetical protein PRUPE_ppa015620mg             226   2e-66   
ref|XP_009612261.1|  PREDICTED: uncharacterized protein LOC104105...    226   2e-66   
gb|KCW65471.1|  hypothetical protein EUGRSUZ_G02881                     226   2e-66   Eucalyptus grandis [rose gum]
ref|XP_008456537.1|  PREDICTED: uncharacterized protein LOC103496460    226   3e-66   Cucumis melo [Oriental melon]
ref|XP_009621656.1|  PREDICTED: uncharacterized protein LOC104113249    220   3e-66   
ref|XP_009612260.1|  PREDICTED: uncharacterized protein LOC104105...    226   3e-66   Nicotiana tomentosiformis
ref|XP_008355198.1|  PREDICTED: uncharacterized protein LOC103418866    224   5e-66   
ref|XP_006349027.1|  PREDICTED: uncharacterized membrane protein ...    224   6e-66   Solanum tuberosum [potatoes]
ref|XP_009368937.1|  PREDICTED: uncharacterized protein LOC103958409    225   7e-66   Pyrus x bretschneideri [bai li]
ref|XP_008226513.1|  PREDICTED: uncharacterized protein LOC103326077    224   8e-66   
ref|XP_011651970.1|  PREDICTED: uncharacterized protein LOC101216551    224   1e-65   Cucumis sativus [cucumbers]
ref|XP_002464077.1|  hypothetical protein SORBIDRAFT_01g011890          225   1e-65   Sorghum bicolor [broomcorn]
ref|XP_008665606.1|  PREDICTED: uncharacterized protein LOC103644190    225   2e-65   
ref|XP_004250977.1|  PREDICTED: uncharacterized membrane protein ...    223   2e-65   Solanum lycopersicum
dbj|BAJ86921.1|  predicted protein                                      224   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93275.1|  predicted protein                                      224   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS59101.1|  hypothetical protein M569_15705                         223   2e-65   Genlisea aurea
ref|XP_010045310.1|  PREDICTED: uncharacterized protein LOC104434056    223   2e-65   Eucalyptus grandis [rose gum]
emb|CAN71485.1|  hypothetical protein VITISV_025339                     222   2e-65   Vitis vinifera
ref|XP_006424462.1|  hypothetical protein CICLE_v10028100mg             223   3e-65   Citrus clementina [clementine]
ref|XP_009782107.1|  PREDICTED: uncharacterized membrane protein ...    222   4e-65   Nicotiana sylvestris
ref|XP_007206680.1|  hypothetical protein PRUPE_ppa022835mg             222   4e-65   
ref|XP_007027450.1|  Major facilitator superfamily protein, putative    222   5e-65   
ref|XP_003559292.1|  PREDICTED: uncharacterized protein LOC100830563    223   5e-65   Brachypodium distachyon [annual false brome]
ref|XP_006488014.1|  PREDICTED: uncharacterized protein LOC102630186    222   5e-65   Citrus sinensis [apfelsine]
ref|XP_009614669.1|  PREDICTED: uncharacterized protein LOC104107543    222   5e-65   
ref|XP_003590250.1|  Nodule-specific protein Nlj70                      223   5e-65   Medicago truncatula
ref|XP_002301218.2|  hypothetical protein POPTR_0002s13500g             220   7e-65   
ref|XP_010689140.1|  PREDICTED: uncharacterized protein LOC104902902    222   7e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011084394.1|  PREDICTED: uncharacterized protein LOC105166652    222   1e-64   Sesamum indicum [beniseed]
ref|XP_004142503.1|  PREDICTED: uncharacterized protein LOC101205503    222   1e-64   Cucumis sativus [cucumbers]
ref|XP_004981407.1|  PREDICTED: uncharacterized protein LOC101759573    222   1e-64   Setaria italica
ref|XP_006361717.1|  PREDICTED: uncharacterized protein LOC102585444    221   1e-64   Solanum tuberosum [potatoes]
emb|CDP14418.1|  unnamed protein product                                221   1e-64   Coffea canephora [robusta coffee]
gb|KHN02305.1|  Putative transporter MCH1                               221   1e-64   Glycine soja [wild soybean]
gb|AAO37543.1|  putative nodule-specific protein                        222   2e-64   Oryza sativa Japonica Group [Japonica rice]
gb|EMT24580.1|  hypothetical protein F775_21272                         221   2e-64   
ref|XP_009397027.1|  PREDICTED: uncharacterized protein LOC103981971    221   2e-64   
ref|XP_002466277.1|  hypothetical protein SORBIDRAFT_01g004940          221   2e-64   Sorghum bicolor [broomcorn]
ref|XP_012064707.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    220   2e-64   Jatropha curcas
ref|XP_006650740.1|  PREDICTED: uncharacterized protein LOC102714717    219   2e-64   Oryza brachyantha
ref|XP_009786215.1|  PREDICTED: uncharacterized protein LOC104234332    221   3e-64   Nicotiana sylvestris
ref|XP_004986309.1|  PREDICTED: uncharacterized membrane protein ...    221   3e-64   Setaria italica
ref|XP_010933292.1|  PREDICTED: uncharacterized protein LOC105053726    220   3e-64   Elaeis guineensis
ref|XP_006428454.1|  hypothetical protein CICLE_v10013568mg             220   3e-64   Citrus clementina [clementine]
ref|XP_007145510.1|  hypothetical protein PHAVU_007G244600g             220   3e-64   Phaseolus vulgaris [French bean]
ref|XP_010673913.1|  PREDICTED: uncharacterized protein LOC104890215    220   4e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003559578.1|  PREDICTED: uncharacterized protein LOC100828435    220   5e-64   Brachypodium distachyon [annual false brome]
ref|XP_009417128.1|  PREDICTED: uncharacterized membrane protein ...    221   6e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB26230.1|  hypothetical protein B456_004G231700                    219   6e-64   Gossypium raimondii
ref|XP_010673912.1|  PREDICTED: uncharacterized protein LOC104890214    210   7e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009762916.1|  PREDICTED: uncharacterized protein LOC104214891    219   9e-64   Nicotiana sylvestris
tpg|DAA50695.1|  TPA: hypothetical protein ZEAMMB73_557403              221   1e-63   
ref|XP_002519466.1|  conserved hypothetical protein                     218   1e-63   
gb|EPS69782.1|  hypothetical protein M569_04980                         216   4e-63   Genlisea aurea
gb|KJB36486.1|  hypothetical protein B456_006G161600                    217   6e-63   Gossypium raimondii
ref|XP_008446818.1|  PREDICTED: uncharacterized protein LOC103489434    217   6e-63   Cucumis melo [Oriental melon]
gb|EAY91415.1|  hypothetical protein OsI_13040                          216   1e-62   Oryza sativa Indica Group [Indian rice]
gb|KCW65475.1|  hypothetical protein EUGRSUZ_G028862                    207   1e-62   Eucalyptus grandis [rose gum]
ref|XP_008811024.1|  PREDICTED: uncharacterized protein LOC103722300    216   1e-62   Phoenix dactylifera
gb|AAP68384.1|  hypothetical protein                                    216   2e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008665607.1|  PREDICTED: uncharacterized protein LOC103644191    216   2e-62   Zea mays [maize]
ref|XP_010543563.1|  PREDICTED: uncharacterized protein LOC104816431    215   3e-62   Tarenaya hassleriana [spider flower]
ref|XP_003590365.1|  Nodule-specific protein Nlj70                      215   3e-62   
ref|XP_009621414.1|  PREDICTED: uncharacterized protein LOC104113038    214   4e-62   
gb|ABF98224.1|  nodulin family protein, putative                        216   4e-62   
gb|KHN48244.1|  Putative transporter MCH1                               214   4e-62   
ref|XP_009766499.1|  PREDICTED: uncharacterized protein LOC104217867    214   4e-62   
gb|KCW65466.1|  hypothetical protein EUGRSUZ_G02876                     214   4e-62   
ref|XP_006651692.1|  PREDICTED: uncharacterized protein LOC102719372    215   5e-62   
ref|XP_010670396.1|  PREDICTED: uncharacterized protein LOC104887465    213   6e-62   
gb|KDO39314.1|  hypothetical protein CISIN_1g047229mg                   214   6e-62   
ref|XP_006658348.1|  PREDICTED: uncharacterized protein LOC102709579    207   9e-62   
ref|XP_002273103.2|  PREDICTED: uncharacterized protein LOC100249900    213   1e-61   
emb|CAN82898.1|  hypothetical protein VITISV_026994                     213   2e-61   
gb|KHN32812.1|  hypothetical protein glysoja_024171                     212   4e-61   
ref|XP_006599452.1|  PREDICTED: uncharacterized protein LOC102661181    212   4e-61   
gb|AAC39500.1|  nodule-specific protein Nlj70                           212   4e-61   
ref|XP_004230920.1|  PREDICTED: uncharacterized protein LOC101255930    211   7e-61   
ref|XP_006354407.1|  PREDICTED: uncharacterized protein LOC102589907    211   8e-61   
dbj|BAJ86744.1|  predicted protein                                      210   1e-60   
ref|XP_009399380.1|  PREDICTED: uncharacterized protein LOC103983816    210   2e-60   
ref|XP_002461592.1|  hypothetical protein SORBIDRAFT_02g005120          211   2e-60   
ref|XP_003518996.1|  PREDICTED: uncharacterized protein LOC100789645    210   2e-60   
ref|XP_008442718.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    209   3e-60   
ref|XP_004977870.1|  PREDICTED: uncharacterized protein LOC101756569    209   4e-60   
gb|KDP43975.1|  hypothetical protein JCGZ_05442                         208   4e-60   
emb|CDO99802.1|  unnamed protein product                                209   6e-60   
ref|XP_007221112.1|  hypothetical protein PRUPE_ppa017904mg             208   7e-60   
emb|CBI17146.3|  unnamed protein product                                213   8e-60   
ref|XP_010677449.1|  PREDICTED: uncharacterized protein LOC104893078    208   1e-59   
gb|EAZ28933.1|  hypothetical protein OsJ_12977                          208   1e-59   
ref|XP_003557448.1|  PREDICTED: uncharacterized protein LOC100822987    207   5e-59   
gb|EAZ03041.1|  hypothetical protein OsI_25182                          207   5e-59   
dbj|BAC83908.1|  putative nodule-specific protein                       207   7e-59   
emb|CDP15281.1|  unnamed protein product                                205   9e-59   
emb|CDP14419.1|  unnamed protein product                                205   9e-59   
gb|KJB56226.1|  hypothetical protein B456_009G111200                    205   1e-58   
emb|CDM84956.1|  unnamed protein product                                205   3e-58   
gb|EYU39872.1|  hypothetical protein MIMGU_mgv1a024761mg                203   7e-58   
emb|CBI31408.3|  unnamed protein product                                206   7e-58   
ref|XP_008811023.1|  PREDICTED: uncharacterized protein LOC103722299    203   8e-58   
tpg|DAA42500.1|  TPA: nitrate and chloride transporter                  202   2e-57   
ref|NP_001152028.1|  nitrate and chloride transporter                   202   2e-57   
gb|KHN23223.1|  hypothetical protein glysoja_047351                     201   3e-57   
dbj|BAJ90449.1|  predicted protein                                      201   9e-57   
ref|XP_006428271.1|  hypothetical protein CICLE_v10013309mg             199   2e-56   
ref|XP_009338584.1|  PREDICTED: uncharacterized protein LOC103930905    201   3e-56   
gb|KDO60260.1|  hypothetical protein CISIN_1g037996mg                   197   6e-56   
ref|XP_009333629.1|  PREDICTED: uncharacterized protein LOC103926552    198   1e-55   
gb|KGN54809.1|  hypothetical protein Csa_4G507390                       196   1e-55   
gb|EAY83124.1|  hypothetical protein OsI_38340                          197   2e-55   
ref|NP_001066777.2|  Os12g0484600                                       197   2e-55   
ref|XP_008369817.1|  PREDICTED: uncharacterized protein LOC103433347    196   3e-55   
gb|EMT08425.1|  hypothetical protein F775_07944                         196   5e-55   
emb|CDP03435.1|  unnamed protein product                                189   6e-55   
ref|XP_004962674.1|  PREDICTED: uncharacterized protein LOC101763766    196   6e-55   
ref|XP_008652149.1|  PREDICTED: uncharacterized protein LOC103632070    196   7e-55   
ref|XP_003576191.1|  PREDICTED: uncharacterized protein LOC100839547    195   1e-54   
ref|XP_002442137.1|  hypothetical protein SORBIDRAFT_08g014860          194   1e-54   
ref|XP_007132716.1|  hypothetical protein PHAVU_011G118800g             194   3e-54   
dbj|BAJ89452.1|  predicted protein                                      193   7e-54   
ref|XP_002272443.3|  PREDICTED: uncharacterized protein LOC100242799    192   9e-54   
ref|XP_010933280.1|  PREDICTED: uncharacterized membrane protein ...    192   9e-54   
ref|XP_002442614.1|  hypothetical protein SORBIDRAFT_08g023010          191   5e-53   
ref|XP_004963329.1|  PREDICTED: uncharacterized protein LOC101753233    190   7e-53   
gb|KHN21070.1|  hypothetical protein glysoja_006549                     189   9e-53   
gb|KHN21069.1|  hypothetical protein glysoja_006548                     182   1e-52   
ref|XP_004963328.1|  PREDICTED: uncharacterized protein LOC101752820    189   2e-52   
ref|XP_003540770.1|  PREDICTED: uncharacterized protein LOC100799928    188   2e-52   
emb|CAN72050.1|  hypothetical protein VITISV_016339                     187   3e-52   
emb|CAN66929.1|  hypothetical protein VITISV_011833                     182   8e-52   
ref|NP_001067374.2|  Os12g0637800                                       186   1e-51   
ref|XP_006664781.1|  PREDICTED: uncharacterized protein LOC102705033    186   1e-51   
gb|EAZ21349.1|  hypothetical protein OsJ_37006                          186   1e-51   
ref|XP_004146405.2|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    186   1e-51   
gb|EAY84040.1|  hypothetical protein OsI_39270                          186   2e-51   
ref|NP_001067373.1|  Os12g0637700                                       186   2e-51   
gb|EMS49129.1|  hypothetical protein TRIUR3_19318                       182   3e-51   
ref|XP_008464767.1|  PREDICTED: uncharacterized protein LOC103502570    185   5e-51   
ref|XP_008464809.1|  PREDICTED: uncharacterized protein LOC103502605    185   6e-51   
ref|XP_010236602.1|  PREDICTED: uncharacterized protein LOC100836162    182   4e-50   
ref|XP_004979965.1|  PREDICTED: uncharacterized protein LOC101755644    182   1e-49   
gb|EMT08792.1|  hypothetical protein F775_14992                         180   1e-49   
ref|XP_004147309.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    181   1e-49   
ref|XP_008670908.1|  PREDICTED: uncharacterized protein LOC103648199    179   3e-49   
ref|XP_002443658.1|  hypothetical protein SORBIDRAFT_08g023020          180   4e-49   
ref|XP_006664561.1|  PREDICTED: uncharacterized protein LOC102703921    179   7e-49   
ref|XP_004147303.2|  PREDICTED: uncharacterized protein LOC101202941    179   9e-49   
ref|XP_006577711.1|  PREDICTED: uncharacterized protein LOC100820499    171   1e-48   
ref|XP_011459986.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    177   2e-48   
gb|AAM01022.1|AC090488_22  Hypothetical protein                         178   2e-48   
gb|EAY77816.1|  hypothetical protein OsI_32858                          177   3e-48   
ref|XP_002449966.1|  hypothetical protein SORBIDRAFT_05g026300          175   3e-47   
ref|XP_004147304.1|  PREDICTED: uncharacterized protein LOC101203173    173   1e-46   
ref|XP_006662218.1|  PREDICTED: uncharacterized protein LOC102719238    172   2e-46   
ref|XP_008464731.1|  PREDICTED: uncharacterized protein LOC103502544    172   2e-46   
ref|XP_004147311.1|  PREDICTED: uncharacterized protein LOC101204873    171   5e-46   
gb|EEE53674.1|  hypothetical protein OsJ_37007                          170   9e-46   
gb|EEC69742.1|  hypothetical protein OsI_39271                          169   1e-45   
ref|XP_008670991.1|  PREDICTED: uncharacterized protein LOC103648285    169   2e-45   
ref|XP_004147312.1|  PREDICTED: uncharacterized membrane protein ...    169   3e-45   
ref|XP_008464760.1|  PREDICTED: uncharacterized protein LOC103502564    168   8e-45   
ref|XP_008464784.1|  PREDICTED: uncharacterized protein LOC103502588    164   1e-43   
ref|XP_002461320.1|  hypothetical protein SORBIDRAFT_02g000890          164   1e-43   
ref|XP_007208600.1|  hypothetical protein PRUPE_ppa022397mg             162   7e-43   
ref|XP_008464773.1|  PREDICTED: uncharacterized protein LOC103502580    156   1e-40   
ref|XP_004147308.1|  PREDICTED: uncharacterized protein LOC101204150    153   1e-39   
ref|XP_001784458.1|  predicted protein                                  152   3e-39   
ref|XP_002979925.1|  hypothetical protein SELMODRAFT_178001             151   7e-39   
ref|XP_002994617.1|  hypothetical protein SELMODRAFT_138881             142   7e-39   
ref|XP_002987406.1|  hypothetical protein SELMODRAFT_235284             150   1e-38   
ref|XP_002979899.1|  hypothetical protein SELMODRAFT_271410             147   1e-37   
gb|EMT03392.1|  hypothetical protein F775_21889                         143   1e-37   
ref|XP_006838662.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4      145   7e-37   
ref|XP_002987402.1|  hypothetical protein SELMODRAFT_126136             141   1e-35   
ref|XP_002979921.1|  hypothetical protein SELMODRAFT_111826             140   2e-35   
ref|XP_008777475.1|  PREDICTED: probable transporter mch1               137   5e-34   
ref|XP_002436956.1|  hypothetical protein SORBIDRAFT_10g012242          132   1e-33   
ref|XP_010917688.1|  PREDICTED: uncharacterized membrane protein ...    134   4e-33   
ref|XP_010933956.1|  PREDICTED: probable transporter mch1 isoform X3    134   5e-33   
ref|XP_010933948.1|  PREDICTED: probable transporter mch1 isoform X2    134   6e-33   
ref|XP_010933941.1|  PREDICTED: probable transporter mch1 isoform X1    134   7e-33   
ref|XP_001777486.1|  predicted protein                                  133   2e-32   
ref|XP_009400855.1|  PREDICTED: uncharacterized protein LOC103984984    132   3e-32   
ref|XP_001772604.1|  predicted protein                                  132   3e-32   
gb|EPS63509.1|  hypothetical protein M569_11277                         124   9e-32   
gb|AFW61584.1|  nodulin-like protein                                    131   9e-32   
ref|NP_001146179.1|  uncharacterized protein LOC100279749               131   1e-31   
ref|XP_011087194.1|  PREDICTED: uncharacterized protein LOC105168749    130   1e-31   
ref|NP_001152103.1|  nodulin-like protein                               130   2e-31   
ref|XP_008664391.1|  PREDICTED: uncharacterized protein LOC103643013    130   2e-31   
ref|XP_006367060.1|  PREDICTED: uncharacterized protein LOC102578528    130   2e-31   
emb|CAH10054.1|  Unknown similar to A.thaliana Hypothetical prote...    129   5e-31   
ref|XP_004236184.1|  PREDICTED: uncharacterized protein LOC101244171    128   7e-31   
ref|XP_002445809.1|  hypothetical protein SORBIDRAFT_07g026140          129   7e-31   
emb|CAH10046.1|  Unknown similar to A.thaliana Hypothetical prote...    128   8e-31   
gb|ACJ22502.1|  unknown                                                 128   8e-31   
gb|EMT21355.1|  hypothetical protein F775_05525                         127   8e-31   
emb|CAH10068.1|  Unknown similar to A.thaliana Hypothetical prote...    128   8e-31   
gb|ACJ22518.1|  unknown                                                 127   1e-30   
ref|XP_001757080.1|  predicted protein                                  128   1e-30   
ref|NP_173328.1|  nodulin-like and major facilitator domain-conta...    127   1e-30   
emb|CAH10204.1|  Unknown similar to A.thaliana Hypothetical prote...    127   1e-30   
ref|XP_002442621.1|  hypothetical protein SORBIDRAFT_08g023130          127   1e-30   
ref|XP_003574828.1|  PREDICTED: probable transporter mch1               128   1e-30   
ref|XP_009623438.1|  PREDICTED: probable transporter mch1               127   2e-30   
gb|KEH22006.1|  nodulin-like/MFS transporter                            127   2e-30   
emb|CDX85856.1|  BnaC06g22780D                                          127   2e-30   
dbj|BAJ95281.1|  predicted protein                                      127   3e-30   
gb|AAV49984.1|  hypothetical protein                                    126   4e-30   
gb|EAZ07770.1|  hypothetical protein OsI_30023                          126   4e-30   
gb|EMT08736.1|  hypothetical protein F775_20527                         126   4e-30   
ref|XP_004974007.1|  PREDICTED: uncharacterized protein LOC101764387    126   5e-30   
ref|NP_001062339.1|  Os08g0532400                                       126   5e-30   
ref|XP_002960946.1|  hypothetical protein SELMODRAFT_266544             126   5e-30   
ref|XP_002967061.1|  hypothetical protein SELMODRAFT_87151              126   5e-30   
ref|XP_010272188.1|  PREDICTED: uncharacterized protein LOC104608039    125   5e-30   
ref|XP_009783567.1|  PREDICTED: probable transporter mch1               125   8e-30   
ref|XP_010539949.1|  PREDICTED: uncharacterized protein LOC104813863    125   9e-30   
ref|XP_004299628.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    125   1e-29   
ref|XP_001776979.1|  predicted protein                                  125   1e-29   
gb|ERN09846.1|  hypothetical protein AMTR_s00013p00061220               124   1e-29   
ref|XP_009788802.1|  PREDICTED: uncharacterized protein LOC104236559    125   1e-29   
gb|EPS64558.1|  hypothetical protein M569_10221                         125   2e-29   
ref|XP_006351510.1|  PREDICTED: uncharacterized protein LOC102597647    125   2e-29   
ref|XP_002890306.1|  nodulin family protein                             124   2e-29   
ref|XP_004234304.1|  PREDICTED: probable transporter mch1 isoform X1    125   2e-29   
ref|XP_012080181.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    124   2e-29   
ref|XP_009385482.1|  PREDICTED: probable transporter mch1               124   4e-29   
ref|XP_008801876.1|  PREDICTED: uncharacterized protein LOC103715...    123   4e-29   
ref|XP_010926825.1|  PREDICTED: probable transporter mch1               124   5e-29   
emb|CDY72365.1|  BnaAnng40840D                                          122   5e-29   
ref|XP_011087196.1|  PREDICTED: uncharacterized protein LOC105168751    123   5e-29   
ref|XP_009403771.1|  PREDICTED: probable transporter mch1               124   5e-29   
emb|CDP14900.1|  unnamed protein product                                123   5e-29   
emb|CDY66763.1|  BnaAnng22870D                                          122   5e-29   
ref|XP_008801875.1|  PREDICTED: uncharacterized protein LOC103715...    123   6e-29   
ref|XP_009402249.1|  PREDICTED: uncharacterized protein LOC103986091    123   7e-29   
ref|XP_009141377.1|  PREDICTED: uncharacterized protein LOC103865331    122   7e-29   
gb|EYU24433.1|  hypothetical protein MIMGU_mgv1a004516mg                122   7e-29   
ref|XP_009404757.1|  PREDICTED: uncharacterized protein LOC103987995    123   9e-29   
ref|XP_002887558.1|  nodulin family protein                             122   1e-28   
ref|XP_009609133.1|  PREDICTED: uncharacterized protein LOC104102979    122   1e-28   
ref|XP_009104745.1|  PREDICTED: uncharacterized protein LOC103830685    122   1e-28   
gb|EPS63811.1|  hypothetical protein M569_10970                         122   1e-28   
ref|XP_006404864.1|  hypothetical protein EUTSA_v10000696mg             122   1e-28   
ref|XP_010495184.1|  PREDICTED: uncharacterized protein LOC104772249    122   1e-28   
ref|XP_004513316.1|  PREDICTED: uncharacterized protein LOC101511301    122   1e-28   
ref|XP_006659624.1|  PREDICTED: uncharacterized protein LOC102701471    122   2e-28   
ref|XP_004975414.1|  PREDICTED: uncharacterized protein LOC101772491    122   2e-28   
ref|XP_008392789.1|  PREDICTED: probable transporter mch1               122   2e-28   
ref|XP_010927760.1|  PREDICTED: uncharacterized protein LOC105049721    122   2e-28   
ref|XP_010550224.1|  PREDICTED: probable transporter mch1 isoform X1    122   2e-28   
emb|CDP16703.1|  unnamed protein product                                122   2e-28   
ref|NP_001167921.1|  hypothetical protein                               122   2e-28   
ref|XP_008801667.1|  PREDICTED: uncharacterized protein LOC103715713    122   2e-28   
tpg|DAA38148.1|  TPA: hypothetical protein ZEAMMB73_491057              122   2e-28   
ref|XP_009413001.1|  PREDICTED: probable transporter mch1               122   2e-28   
ref|XP_010250690.1|  PREDICTED: uncharacterized protein LOC104592...    121   2e-28   
gb|KJB26227.1|  hypothetical protein B456_004G231600                    120   3e-28   
ref|XP_006302127.1|  hypothetical protein CARUB_v10020132mg             121   3e-28   
emb|CBI15294.3|  unnamed protein product                                122   3e-28   
ref|XP_010420035.1|  PREDICTED: uncharacterized protein LOC104705...    121   3e-28   
ref|XP_001768905.1|  predicted protein                                  121   3e-28   
ref|XP_010453528.1|  PREDICTED: uncharacterized protein LOC104735432    121   3e-28   
gb|EYU34813.1|  hypothetical protein MIMGU_mgv1a003413mg                121   3e-28   
gb|AAP04143.1|  unknown protein                                         120   3e-28   
ref|NP_177616.1|  nodulin-like and major facilitator domain-conta...    120   3e-28   
ref|XP_002300113.2|  hypothetical protein POPTR_0001s33670g             121   4e-28   
gb|KHG28603.1|  putative transporter MCH1                               120   4e-28   
ref|XP_010498299.1|  PREDICTED: uncharacterized protein LOC104776010    120   4e-28   
ref|XP_011087197.1|  PREDICTED: uncharacterized protein LOC105168753    120   4e-28   
ref|XP_008379106.1|  PREDICTED: uncharacterized protein LOC103442130    121   4e-28   
gb|KDO63910.1|  hypothetical protein CISIN_1g007654mg                   118   4e-28   
ref|XP_004236183.1|  PREDICTED: uncharacterized protein LOC101243876    120   4e-28   
gb|EYU24441.1|  hypothetical protein MIMGU_mgv1a020189mg                120   5e-28   
emb|CDY19262.1|  BnaC05g14630D                                          120   5e-28   
ref|XP_010913012.1|  PREDICTED: uncharacterized protein LOC105038807    121   5e-28   
ref|XP_006307112.1|  hypothetical protein CARUB_v10008700mg             120   5e-28   
ref|XP_006416551.1|  hypothetical protein EUTSA_v10007356mg             120   5e-28   
ref|XP_008790755.1|  PREDICTED: uncharacterized protein LOC103707...    120   6e-28   
ref|XP_009606507.1|  PREDICTED: uncharacterized protein LOC104100862    120   6e-28   
ref|XP_009597102.1|  PREDICTED: probable transporter mch1 isoform X1    120   6e-28   



>ref|XP_008446819.1| PREDICTED: uncharacterized protein LOC103489435 [Cucumis melo]
Length=582

 Score =   277 bits (708),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 162/179 (91%), Gaps = 2/179 (1%)
 Frame = +3

Query  129  AGGGSR--ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            AGGG    + +GS+AVH+I GRWF+VFA+ LIM+AAGATYMFGLYS D+K  LGYDQTTL
Sbjct  3    AGGGISGCSDIGSIAVHVITGRWFVVFASLLIMAAAGATYMFGLYSSDIKSVLGYDQTTL  62

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            NLLSFFKDLG+NVGVLSGLINEVTPPWVVL IGA LNFFGYFM+WLAVT++ISTPKVWQM
Sbjct  63   NLLSFFKDLGANVGVLSGLINEVTPPWVVLSIGAVLNFFGYFMIWLAVTRRISTPKVWQM  122

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            CLYIC+  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQLFHA YG D
Sbjct  123  CLYICIGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLFHAFYGND  181



>ref|XP_009627853.1| PREDICTED: uncharacterized protein LOC104118334 [Nicotiana tomentosiformis]
Length=600

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A+M +L V ++  RWFMVFAT LI+SAAGATYMFG+YSGD+K ALGYDQTTLNLLSFFKD
Sbjct  16   ANMTNLPVRVLMSRWFMVFATILILSAAGATYMFGIYSGDIKSALGYDQTTLNLLSFFKD  75

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LGSNVGVLSGLINE++PPWVVL IGA LNFFGYFM+W+AVTKK+STPKVW MCLYIC+ G
Sbjct  76   LGSNVGVLSGLINEISPPWVVLSIGAVLNFFGYFMIWMAVTKKMSTPKVWLMCLYICIGG  135

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQSFANTGALVT VKNFPESRG VLGLLKGFVGLSGAILTQ++HA+YG D
Sbjct  136  NSQSFANTGALVTCVKNFPESRGAVLGLLKGFVGLSGAILTQIYHAIYGND  186



>ref|XP_004142499.2| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Cucumis sativus]
Length=581

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + + S+ VH+I GRWF+VFA+ LIM+AAGATYMFGLYS D+K  LGYDQTTLNLLSFFKD
Sbjct  11   SDISSIGVHVITGRWFVVFASLLIMAAAGATYMFGLYSSDIKSVLGYDQTTLNLLSFFKD  70

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVGVLSGLINEVTPPWVVL IGA LNFFGYFM+WLAVT++IS PKVWQMCLYIC+  
Sbjct  71   LGANVGVLSGLINEVTPPWVVLSIGAVLNFFGYFMIWLAVTRRISAPKVWQMCLYICIGA  130

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQLFHA YG D
Sbjct  131  NSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLFHAFYGDD  181



>ref|XP_009792652.1| PREDICTED: uncharacterized protein LOC104239662 [Nicotiana sylvestris]
Length=598

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A+M +L V ++  RWFMVFAT LI+SAAGATYMFGLYSGD+K +LGYDQTTLNLLSFFKD
Sbjct  16   ANMTNLPVRVLMSRWFMVFATMLILSAAGATYMFGLYSGDIKSSLGYDQTTLNLLSFFKD  75

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LGSNVGVLSGLINE++PPWVVL IGA LNFFGYFM+W+AVTKK+STPKVW MCLYIC+  
Sbjct  76   LGSNVGVLSGLINEISPPWVVLSIGAVLNFFGYFMIWMAVTKKMSTPKVWLMCLYICIGA  135

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQSFANTGALVT VKNFPESRG VLGLLKGFVGLSGAILTQ++ A+YG D
Sbjct  136  NSQSFANTGALVTCVKNFPESRGAVLGLLKGFVGLSGAILTQIYQAIYGND  186



>ref|XP_010103517.1| putative transporter MCH1 [Morus notabilis]
 gb|EXB96177.1| putative transporter MCH1 [Morus notabilis]
Length=593

 Score =   266 bits (681),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  162  LAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNV  341
            LAV ++ GRWFMVFA+ LIMSAAGATYMFGLYS ++K+ LGYDQTTLNLLSFFKDLGSNV
Sbjct  20   LAVQVLTGRWFMVFASLLIMSAAGATYMFGLYSSEIKEVLGYDQTTLNLLSFFKDLGSNV  79

Query  342  GVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSF  521
            GVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAV+K+I+TPKVW MCLYIC+  NSQSF
Sbjct  80   GVLSGLINEVTPPWVVLSVGAVLNFFGYFMIWLAVSKRIATPKVWHMCLYICIGANSQSF  139

Query  522  ANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            ANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA+YG D
Sbjct  140  ANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHALYGDD  185



>ref|XP_009598854.1| PREDICTED: uncharacterized protein LOC104094596 [Nicotiana tomentosiformis]
Length=603

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = +3

Query  123  VFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            V   G   A+M SL + +  GRWFMVFAT LI+SA+GATY+FG+YS D+K +LGYDQTTL
Sbjct  5    VEGSGSGLANMRSLTLQVFTGRWFMVFATVLILSASGATYIFGIYSSDIKTSLGYDQTTL  64

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            NLLSFFKDLGSNVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAVTKKI TPKVW M
Sbjct  65   NLLSFFKDLGSNVGVLSGLINEVTPPWVVLSVGAILNFFGYFMIWLAVTKKIPTPKVWHM  124

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            C+YIC+  NSQSFANTGALVT VKNFPESRG VLGLLKG+VGLSGA+LTQ++HA+YG +
Sbjct  125  CVYICIGANSQSFANTGALVTCVKNFPESRGAVLGLLKGYVGLSGAMLTQIYHAIYGNE  183



>ref|XP_006436518.1| hypothetical protein CICLE_v10030988mg [Citrus clementina]
 ref|XP_006485321.1| PREDICTED: uncharacterized protein LOC102627686 [Citrus sinensis]
 gb|ESR49758.1| hypothetical protein CICLE_v10030988mg [Citrus clementina]
Length=611

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A+M SLA+ +I GRWFMVFA+ LIM+AAGATYMF LYSGD+K ALGYDQTTLNLLSFFKD
Sbjct  23   ANMKSLAIQVITGRWFMVFASFLIMAAAGATYMFSLYSGDIKYALGYDQTTLNLLSFFKD  82

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVG+LSGLINE+TPPWVVL +GA LNFFGYFM+WLAVTKKI+ P+VW MCLYICV  
Sbjct  83   LGANVGILSGLINEITPPWVVLVLGAVLNFFGYFMIWLAVTKKIARPQVWHMCLYICVGA  142

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A+YG D
Sbjct  143  NSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRALYGDD  193



>gb|KDO47545.1| hypothetical protein CISIN_1g040453mg [Citrus sinensis]
Length=547

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A+M SLA+ +I GRWFMVFA+ LIM+AAGATYMF LYSGD+K ALGYDQTTLNLLSFFKD
Sbjct  23   ANMKSLAIQVITGRWFMVFASFLIMAAAGATYMFSLYSGDIKYALGYDQTTLNLLSFFKD  82

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVG+LSGLINE+TPPWVVL +GA LNFFGYFM+WLAVTKKI+ P+VW MCLYICV  
Sbjct  83   LGANVGILSGLINEITPPWVVLVLGAVLNFFGYFMIWLAVTKKIARPQVWHMCLYICVGA  142

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A YG D
Sbjct  143  NSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGDD  193



>ref|XP_011094505.1| PREDICTED: uncharacterized protein LOC105174183 [Sesamum indicum]
Length=610

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 156/180 (87%), Gaps = 4/180 (2%)
 Frame = +3

Query  132  GGGSRA----SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTT  299
            GGG  A    +  + A  ++ GRWFMVFATTLIMSAAGATYMFGLYS ++K ALGYDQTT
Sbjct  8    GGGGAAVEWPTTRAFATQVLTGRWFMVFATTLIMSAAGATYMFGLYSSEIKSALGYDQTT  67

Query  300  LNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQ  479
            LNLLSFFKDLGSNVGVLSGLINEVTPPWVVL IGA LNFFGY M+WLAV+KKIS P+VW 
Sbjct  68   LNLLSFFKDLGSNVGVLSGLINEVTPPWVVLSIGAVLNFFGYLMIWLAVSKKISRPQVWH  127

Query  480  MCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            MCLYIC+  NSQSFANTGALVTAVKNFPESRG VLGLLKGFVGLSGAI+TQ++HAVY  D
Sbjct  128  MCLYICIGANSQSFANTGALVTAVKNFPESRGAVLGLLKGFVGLSGAIITQIYHAVYEDD  187



>ref|XP_009780392.1| PREDICTED: uncharacterized protein LOC104229438 [Nicotiana sylvestris]
Length=598

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +3

Query  123  VFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            V   G   A+M SL + +  GRWFMVFAT LI+SA+GATY+FG+YS D+K +LGYDQTTL
Sbjct  5    VEGSGSGLANMRSLTLQVFTGRWFMVFATVLILSASGATYIFGIYSSDIKTSLGYDQTTL  64

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            NLLSFFKDLGSNVGVLSGL+NEVTPPWVVL +GA LNFFGYFM+WLAVTKKI  PKVW M
Sbjct  65   NLLSFFKDLGSNVGVLSGLLNEVTPPWVVLSVGAVLNFFGYFMIWLAVTKKIPKPKVWHM  124

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            C+YIC+  NSQSFANTGALVT VKNFPESRG VLGLLKG+VGLSGA+LTQ++HA+YG +
Sbjct  125  CVYICIGANSQSFANTGALVTCVKNFPESRGAVLGLLKGYVGLSGAMLTQIYHAIYGNE  183



>ref|XP_010534423.1| PREDICTED: uncharacterized protein LOC104809977 [Tarenaya hassleriana]
Length=593

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GG  A   SLA  I+ GRWFM FA+ LIMS AGATYMFGLYS ++K  LGYDQT
Sbjct  1    MVAASPGGGGAPATSLAAQIMTGRWFMFFASLLIMSTAGATYMFGLYSNEIKHTLGYDQT  60

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVLSGLINEVTPPWVVL IGA LNFFGYFM+WLAVTK+I  P VW
Sbjct  61   TLNLLSFFKDLGANVGVLSGLINEVTPPWVVLSIGAILNFFGYFMIWLAVTKRIPKPHVW  120

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYICV  NSQSFANTGALVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  121  HMCLYICVGANSQSFANTGALVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGD  180

Query  657  D  659
            D
Sbjct  181  D  181



>emb|CDY44632.1| BnaC04g06300D [Brassica napus]
Length=577

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M SLA+ I+ GRWFM FA+ LIMSAAGATYMFGLYSGD+K ALGYDQTTLNLLSFFKDLG
Sbjct  1    MKSLAIQILTGRWFMFFASLLIMSAAGATYMFGLYSGDIKTALGYDQTTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVG+++GL+NEV+PPW  L IGA LNFFGYFM+WLAVTK+IS PKVW MCLYICV  NS
Sbjct  61   ANVGIIAGLLNEVSPPWFTLIIGAILNFFGYFMIWLAVTKRISKPKVWHMCLYICVGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            QSFANTG++VT VKNFPESRG VLG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  121  QSFANTGSIVTCVKNFPESRGFVLGILKGYVGLSGAIITQLYHAFYGDD  169



>emb|CBI31406.3| unnamed protein product [Vitis vinifera]
Length=581

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            SL+VH+I GRWFMVFA+ LIMSAAGATYMFGLYS  LK  LGYDQTTLNLLSFFKDLG+N
Sbjct  18   SLSVHVITGRWFMVFASFLIMSAAGATYMFGLYSSTLKSVLGYDQTTLNLLSFFKDLGAN  77

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLINEVTPPWVVL IGA +NFFGYFM+WLAV+ KI+ P+VW MCLYIC+  NSQ+
Sbjct  78   VGVLSGLINEVTPPWVVLSIGAAMNFFGYFMIWLAVSHKIAKPQVWHMCLYICIGANSQA  137

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  138  FANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGND  184



>ref|XP_003555226.2| PREDICTED: uncharacterized protein LOC100819661 [Glycine max]
Length=571

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M SL V++I GRWF+VFA+ LIM+AAGATYMFGLYS D+K  LGYDQ+TLNLLSFFKDLG
Sbjct  1    MKSLTVNVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQSTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            SNVG+LSGLINE+TPPWVVL IGA LNFFGYFM+WL+VTKKI+ PKVWQMCLYIC+  NS
Sbjct  61   SNVGILSGLINELTPPWVVLAIGAILNFFGYFMIWLSVTKKIAKPKVWQMCLYICIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            QSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQL+HA+Y  D
Sbjct  121  QSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYHAIYYDD  169



>ref|XP_002272074.2| PREDICTED: uncharacterized protein LOC100266758 [Vitis vinifera]
Length=599

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL+V +I GRWF+VFA+ LIMSAAGATYMFGLYSG +K ALGYDQTTLNLLSFFKDL
Sbjct  15   DMKSLSVQVITGRWFVVFASFLIMSAAGATYMFGLYSGTIKSALGYDQTTLNLLSFFKDL  74

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAV++KI+ P+VW MCLYIC+  N
Sbjct  75   GANVGVLSGLINEVTPPWVVLSMGAALNFFGYFMIWLAVSQKIAKPQVWHMCLYICIGAN  134

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+FANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  135  SQAFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGND  184



>ref|XP_009143336.1| PREDICTED: uncharacterized protein LOC103867059 [Brassica rapa]
Length=588

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M SLA+ I+ GRWFM FA+ LIMSAAGATYMFGLYSGD+K ALGYDQTTLNLLSFFKDLG
Sbjct  1    MKSLAIQILTGRWFMFFASLLIMSAAGATYMFGLYSGDIKTALGYDQTTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVG+++GL+NEV+PPW  L IGA LNFFGYFM+WLAVTK+IS PKVW MCLYICV  NS
Sbjct  61   ANVGIIAGLLNEVSPPWFTLIIGAILNFFGYFMIWLAVTKRISKPKVWHMCLYICVGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            QSFANTG++VT VKNFPESRG VLG+LKG+VGLSGAI TQL+HA YG D
Sbjct  121  QSFANTGSIVTCVKNFPESRGFVLGILKGYVGLSGAIFTQLYHAFYGDD  169



>ref|XP_008354067.1| PREDICTED: uncharacterized protein LOC103417686, partial [Malus 
domestica]
Length=391

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            +LA+ ++ GRWFM+FA+ LIMSAAGATYMFGLYSGD+KD LGYDQ+TLNLLSFFKDLGSN
Sbjct  17   TLALQVLYGRWFMMFASLLIMSAAGATYMFGLYSGDIKDVLGYDQSTLNLLSFFKDLGSN  76

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLINEVTPPWVVL +G  LNFFGYFM+W+AVTK+I+ P VWQMCLYIC+  NSQS
Sbjct  77   VGVLSGLINEVTPPWVVLSVGGVLNFFGYFMIWMAVTKRIARPXVWQMCLYICIGANSQS  136

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI TQL+ A Y  D
Sbjct  137  FANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIFTQLYSAFYYND  183



>emb|CDX74863.1| BnaA05g06090D [Brassica napus]
Length=577

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M SLA+ I+ GRWFM FA+ LIMSAAGATYMFGLYSGD+K ALGYDQTTLNLLSFFKDLG
Sbjct  1    MKSLAIQILTGRWFMFFASLLIMSAAGATYMFGLYSGDIKTALGYDQTTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVG+++GL+NEV+PPW  L IGA LNFFGYFM+WLAVTK+IS PKVW MCLYICV  NS
Sbjct  61   ANVGIIAGLLNEVSPPWFTLIIGAILNFFGYFMIWLAVTKRISKPKVWHMCLYICVGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            QSFANTG++VT VKNFPESRG VLG+LKG+VGLSGAI TQL+HA YG D
Sbjct  121  QSFANTGSIVTCVKNFPESRGFVLGILKGYVGLSGAIFTQLYHAFYGDD  169



>emb|CBI31405.3| unnamed protein product [Vitis vinifera]
Length=567

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL+V +I GRWF+VFA+ LIMSAAGATYMFGLYSG +K ALGYDQTTLNLLSFFKDL
Sbjct  15   DMKSLSVQVITGRWFVVFASFLIMSAAGATYMFGLYSGTIKSALGYDQTTLNLLSFFKDL  74

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAV++KI+ P+VW MCLYIC+  N
Sbjct  75   GANVGVLSGLINEVTPPWVVLSMGAALNFFGYFMIWLAVSQKIAKPQVWHMCLYICIGAN  134

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+FANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  135  SQAFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGND  184



>emb|CDY07663.1| BnaA03g18480D [Brassica napus]
Length=579

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 155/181 (86%), Gaps = 2/181 (1%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GG   SM +L + I+ GRWFM FA+ LIMSAAGATYMF LYSGD+K  LGYDQT
Sbjct  1    MVAASPGG--GSMKTLTIQILTGRWFMFFASLLIMSAAGATYMFSLYSGDIKRTLGYDQT  58

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GLINEVTPPW +L IGA LNFFGYFM+WLAVTK+I  P+VW
Sbjct  59   TLNLLSFFKDLGANVGVLAGLINEVTPPWFILIIGAILNFFGYFMIWLAVTKRIPKPQVW  118

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYIC+  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  119  HMCLYICIGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGE  178

Query  657  D  659
            D
Sbjct  179  D  179



>gb|KHN11442.1| Putative transporter MCH1 [Glycine soja]
Length=582

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL V++I GRWF+VFA+ LIM+AAGATYMFGLYS D+K  LGYDQ+TLNLLSFFKDL
Sbjct  11   DMKSLTVNVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQSTLNLLSFFKDL  70

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            GSNVG+LSGLINE+TPPWVVL IGA LNFFGYFM+WL+VTKKI+ PKVWQMCLYIC+  N
Sbjct  71   GSNVGILSGLINELTPPWVVLAIGAILNFFGYFMIWLSVTKKIARPKVWQMCLYICIGAN  130

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQL+HA+Y  D
Sbjct  131  SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYHAIYYDD  180



>ref|XP_009133348.1| PREDICTED: uncharacterized protein LOC103857852 [Brassica rapa]
Length=600

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 155/181 (86%), Gaps = 2/181 (1%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GG   SM +L + I+ GRWFM FA+ LIMSAAGATYMF LYSGD+K  LGYDQT
Sbjct  1    MVAASPGG--GSMKTLTIQILTGRWFMFFASLLIMSAAGATYMFSLYSGDIKRTLGYDQT  58

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GLINEVTPPW +L IGA LNFFGYFM+WLAVTK+I  P+VW
Sbjct  59   TLNLLSFFKDLGANVGVLAGLINEVTPPWFILIIGAILNFFGYFMIWLAVTKRIPKPQVW  118

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYIC+  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  119  HMCLYICIGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGE  178

Query  657  D  659
            D
Sbjct  179  D  179



>ref|XP_002534014.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28367.1| conserved hypothetical protein [Ricinus communis]
Length=544

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A M +L + +I GRWFMVFA+ LIMSAAGATYMF LYSGD+K ALGYDQTTLNLLSFFKD
Sbjct  15   ADMKNLTIQVITGRWFMVFASFLIMSAAGATYMFSLYSGDIKSALGYDQTTLNLLSFFKD  74

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAVT+KI+   VW MCLYIC+  
Sbjct  75   LGANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTRKITGVHVWHMCLYICIGA  134

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  135  NSQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYHAFYGDD  185



>emb|CDY24976.1| BnaC03g21960D [Brassica napus]
Length=579

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 154/181 (85%), Gaps = 2/181 (1%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GG   SM +L V I+ GRWFM FA+ LIMSAAGATYMF LYSGD+K  LGYDQT
Sbjct  1    MVAASPGG--GSMKTLTVQILTGRWFMFFASLLIMSAAGATYMFSLYSGDIKRTLGYDQT  58

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GLINEVTPPW +L IGA LNFFGYFM+WLAVTK+I  P VW
Sbjct  59   TLNLLSFFKDLGANVGVLAGLINEVTPPWFILIIGAILNFFGYFMIWLAVTKRIPKPHVW  118

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYIC+  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  119  HMCLYICIGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGE  178

Query  657  D  659
            D
Sbjct  179  D  179



>ref|XP_010658344.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Vitis 
vinifera]
Length=599

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            SL+VH+I GRWFMVFA+ LIMSAAGATYMFGLYS  LK  LGYDQTTLNLLSFFKDLG+N
Sbjct  18   SLSVHVITGRWFMVFASFLIMSAAGATYMFGLYSSTLKSVLGYDQTTLNLLSFFKDLGAN  77

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLINEVTPPWVVL IGA +NFFGYFM+WLAV+ KI+ P+VW MCLYIC+  NSQ+
Sbjct  78   VGVLSGLINEVTPPWVVLSIGAAMNFFGYFMIWLAVSHKIAKPQVWHMCLYICIGANSQA  137

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  138  FANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGND  184



>ref|XP_006379525.1| nodulin family protein [Populus trichocarpa]
 gb|ERP57322.1| nodulin family protein [Populus trichocarpa]
Length=609

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A M SL   I+ GRWFMVFA+ LIMSAAGATYMF LYS D+KDALGYDQTTLNLLSFFKD
Sbjct  16   ADMKSLTTQIVTGRWFMVFASLLIMSAAGATYMFALYSPDIKDALGYDQTTLNLLSFFKD  75

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            +GSNVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAVTKKI+  +VW MCLYIC+  
Sbjct  76   VGSNVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKKITGVQVWHMCLYICIGA  135

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQ FHA YG D
Sbjct  136  NSQSFANTGSLVTCVKNFPESRGSVLGILKGYVGLSGAIITQFFHAFYGGD  186



>ref|XP_006411146.1| hypothetical protein EUTSA_v10016410mg [Eutrema salsugineum]
 gb|ESQ52599.1| hypothetical protein EUTSA_v10016410mg [Eutrema salsugineum]
Length=598

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 154/181 (85%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GGS   M SL + I+ GRWFM F + LIMSAAGATYMF LYSGD+K  LGYDQT
Sbjct  1    MVAASPGGS---MKSLTIQILTGRWFMFFGSLLIMSAAGATYMFSLYSGDIKRTLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLL FFKDLG+NVGVL+GLINEVTPPW VL IGA LNFFGYFM+WLAVT++IS PKVW
Sbjct  58   TLNLLGFFKDLGANVGVLAGLINEVTPPWFVLIIGAILNFFGYFMIWLAVTERISKPKVW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYICV  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  118  HMCLYICVGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGD  177

Query  657  D  659
            D
Sbjct  178  D  178



>ref|XP_009141793.1| PREDICTED: uncharacterized protein LOC103865707 [Brassica rapa]
Length=588

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV    GGS   M SL + I+ GRWFM F +  IMSAAGATYMF LYSGD+K  LGYDQT
Sbjct  1    MVAATPGGS---MKSLTIQILTGRWFMFFGSLWIMSAAGATYMFSLYSGDIKKTLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GLINEVTPPW +L IGA LNFFGYFM+WLAVTK+IS P+VW
Sbjct  58   TLNLLSFFKDLGANVGVLAGLINEVTPPWFILIIGAVLNFFGYFMIWLAVTKRISKPQVW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYICV  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  118  HMCLYICVGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGE  177

Query  657  D  659
            D
Sbjct  178  D  178



>emb|CDX93282.1| BnaC04g46140D [Brassica napus]
Length=576

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV    GGS   M SL + I+ GRWFM F +  IMSAAGATYMF LYSGD+K  LGYDQT
Sbjct  1    MVAATPGGS---MKSLTIQILTGRWFMFFGSLWIMSAAGATYMFSLYSGDIKKTLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GLINEVTPPW +L IGA LNFFGYFM+WLAVTK+IS P+VW
Sbjct  58   TLNLLSFFKDLGANVGVLAGLINEVTPPWFILIIGAVLNFFGYFMIWLAVTKRISKPQVW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYICV  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  118  HMCLYICVGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGE  177

Query  657  D  659
            D
Sbjct  178  D  178



>emb|CDO99801.1| unnamed protein product [Coffea canephora]
Length=612

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            AV +I  RWFM+FAT  IM+AAGATYMFGLYS  +K  LGYDQ+TLNLLSFFKDLGSNVG
Sbjct  20   AVQVITSRWFMIFATIFIMAAAGATYMFGLYSQQIKTTLGYDQSTLNLLSFFKDLGSNVG  79

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLINEVTPPWVVL +GA LNFFGYFM+WLAVTK+IS P+VW MCLYIC+ GNSQSFA
Sbjct  80   VLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRISKPQVWHMCLYICIGGNSQSFA  139

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVTAVKNFPESRGVVLGLLKGFVGLSGAI+TQL+HAVY  D
Sbjct  140  NTGALVTAVKNFPESRGVVLGLLKGFVGLSGAIITQLYHAVYVDD  184



>ref|XP_010509060.1| PREDICTED: uncharacterized protein LOC104785526 [Camelina sativa]
Length=596

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 154/181 (85%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GGS   M  LAV I+ GRWFM F + LIMS AGATYMFG+YS D+K  LGYDQT
Sbjct  1    MVAASPGGS---MKGLAVQILTGRWFMFFGSLLIMSTAGATYMFGIYSSDIKKTLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GL+NEVTPPW +L IGA LNFFGYFM+WLAVTK+IS P+VW
Sbjct  58   TLNLLSFFKDLGANVGVLAGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQVW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYICV  NSQSFANTG+LVT VKNFPESRGV+LG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  118  HMCLYICVGANSQSFANTGSLVTCVKNFPESRGVILGILKGYVGLSGAIITQLYHAFYGE  177

Query  657  D  659
            D
Sbjct  178  D  178



>emb|CAN66928.1| hypothetical protein VITISV_011832 [Vitis vinifera]
Length=599

 Score =   259 bits (662),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL+V +I GRWF+VFA+ LIMSAAGATYMFGLYS  +K ALGYDQTTLNLLSFFKDL
Sbjct  15   DMKSLSVQVITGRWFVVFASFLIMSAAGATYMFGLYSXTIKSALGYDQTTLNLLSFFKDL  74

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAV++KI+ P+VW MCLYIC+  N
Sbjct  75   GANVGVLSGLINEVTPPWVVLSMGAALNFFGYFMIWLAVSQKIAKPQVWHMCLYICIGAN  134

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+FANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  135  SQAFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGND  184



>ref|XP_003536696.1| PREDICTED: uncharacterized protein LOC100776865 [Glycine max]
 gb|KHN05588.1| Putative transporter MCH1 [Glycine soja]
Length=586

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             + SL+V +I GRWF+VFA+ LIM+AAGATYMFGLYS D+K  LGYDQ+TL+LLSFFKDL
Sbjct  11   DIKSLSVQVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQSTLDLLSFFKDL  70

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            GSNVG+LSGLINE+TPPWVVL IGA LNFFGYFM+WL+VTKKI+ PKVWQMCLYIC+  N
Sbjct  71   GSNVGILSGLINELTPPWVVLAIGAILNFFGYFMIWLSVTKKIAKPKVWQMCLYICIGAN  130

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQL+HA+Y  D
Sbjct  131  SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYHAIYYDD  180



>ref|NP_181454.1| major facilitator protein [Arabidopsis thaliana]
 gb|AAL31925.1|AF419593_1 At2g39210/T16B24.15 [Arabidopsis thaliana]
 gb|AAC28987.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09646.1| major facilitator protein [Arabidopsis thaliana]
Length=601

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GGS   M SL + I+ GRWFM F + LIMS AGATYMFG+YSGD+K+ LGYDQT
Sbjct  1    MVAASPGGS---MKSLTIQILTGRWFMFFGSLLIMSTAGATYMFGIYSGDIKETLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GL+NEVTPPW +L IGA LNFFGYFM+WLAVT++IS P+VW
Sbjct  58   TLNLLSFFKDLGANVGVLAGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTERISKPQVW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYICV  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A YG 
Sbjct  118  HMCLYICVGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGE  177

Query  657  D  659
            D
Sbjct  178  D  178



>ref|XP_011655862.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Cucumis sativus]
Length=585

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             MGS+ VHII GRWF++FA+ LIM+ +GATYMF LYS DLK  LGYDQTTLNLLSF KDL
Sbjct  12   DMGSIVVHIITGRWFILFASLLIMAVSGATYMFSLYSNDLKSILGYDQTTLNLLSFSKDL  71

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVG+LSGL+N+VTPPWVVL IGA +NFFGYFM+WLA+T +ISTPKVWQMCLYIC+  N
Sbjct  72   GANVGILSGLVNQVTPPWVVLSIGAIMNFFGYFMIWLAITNRISTPKVWQMCLYICIGAN  131

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSF+NTG++VT VKNFP+SRG VLG+LKG+VGLSGAI+TQLFHA YG D
Sbjct  132  SQSFSNTGSIVTCVKNFPQSRGAVLGILKGYVGLSGAIITQLFHAFYGAD  181



>ref|XP_006293868.1| hypothetical protein CARUB_v10022856mg [Capsella rubella]
 gb|EOA26766.1| hypothetical protein CARUB_v10022856mg [Capsella rubella]
Length=597

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 154/181 (85%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GGS   M  LAV I+ GRWFM F + LIMS AGATYMFG+YS D+K  LGYDQT
Sbjct  1    MVAASPGGS---MKGLAVQILTGRWFMFFGSLLIMSTAGATYMFGIYSTDIKKTLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GL+NEVTPPW +L IGA LNFFGYFM+WLAVTK+IS P+VW
Sbjct  58   TLNLLSFFKDLGANVGVLAGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQVW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYIC+  NSQSFANTG+LVT VKNFPESRGV+LG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  118  HMCLYICIGANSQSFANTGSLVTCVKNFPESRGVILGILKGYVGLSGAIITQLYHAFYGE  177

Query  657  D  659
            D
Sbjct  178  D  178



>ref|XP_006345994.1| PREDICTED: uncharacterized protein LOC102592436 [Solanum tuberosum]
Length=582

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M +L + ++ GRWFMVFAT LI+SA+GATY+FG+YS D+K +LGYDQTTLNLLSFFKDLG
Sbjct  1    MKNLTLQVLTGRWFMVFATVLILSASGATYIFGIYSTDIKISLGYDQTTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
             NVG+LSGLINEVTPPWVVL  GA LNFFGYFM+WL+VTKKI  PK+W MCLYICV  NS
Sbjct  61   GNVGILSGLINEVTPPWVVLSFGAVLNFFGYFMIWLSVTKKIPKPKIWHMCLYICVGSNS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            QSFANTGALVT VKNFPESRG VLGLLKG+VGLSGA+LTQ++HA+YG D
Sbjct  121  QSFANTGALVTCVKNFPESRGAVLGLLKGYVGLSGAMLTQIYHAIYGND  169



>ref|XP_004250040.1| PREDICTED: uncharacterized protein LOC101265191 [Solanum lycopersicum]
Length=604

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            +L++ ++  RWFMVF T LI+SAAGATYMFGLYSGD+K +LGYDQTTLNLLSFFKDLGSN
Sbjct  4    NLSIRVLVSRWFMVFGTMLILSAAGATYMFGLYSGDIKSSLGYDQTTLNLLSFFKDLGSN  63

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VG+LSGLINE++PPWVVL IGA LNFFGYFM+W+AVTKK+ST KVW MCLYIC+ GNSQS
Sbjct  64   VGILSGLINEISPPWVVLSIGAILNFFGYFMIWMAVTKKMST-KVWLMCLYICIGGNSQS  122

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTGALVT VKNFPESRG VLGLLKGFVGLSGAI+TQ++HA+YG D
Sbjct  123  FANTGALVTCVKNFPESRGAVLGLLKGFVGLSGAIITQIYHAIYGND  169



>ref|XP_010509061.1| PREDICTED: uncharacterized protein LOC104785527 [Camelina sativa]
Length=594

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M SLA+ I+ GRWFM FA+ L+MS AGATYMF LYS D+K  LGYDQTTLN LSFFKDLG
Sbjct  10   MKSLAIQILTGRWFMFFASLLVMSMAGATYMFSLYSSDIKKTLGYDQTTLNPLSFFKDLG  69

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVGVL+GL+NEVTPPWVVL IGA LNFFGYFM+WLAVTK+IS P+VW MCLYICV  NS
Sbjct  70   ANVGVLAGLLNEVTPPWVVLLIGAVLNFFGYFMIWLAVTKRISKPQVWHMCLYICVGANS  129

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Q+FANTG+LVT VKNFPESRGV+LG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  130  QAFANTGSLVTCVKNFPESRGVILGILKGYVGLSGAIITQLYHAFYGED  178



>ref|XP_010067354.1| PREDICTED: uncharacterized protein LOC104454252 isoform X3 [Eucalyptus 
grandis]
Length=604

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + M  LAV +I GRWFMVFA  LIM+AAGATYMFGLYS D+K +LGYDQ+TLNLLSFFKD
Sbjct  17   SDMRHLAVQVIMGRWFMVFACFLIMAAAGATYMFGLYSEDIKHSLGYDQSTLNLLSFFKD  76

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAVTK+I+ P+VWQMCLYIC+  
Sbjct  77   LGANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRIAKPQVWQMCLYICIGA  136

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQ+FANTGALVT V+NFPESRGVVLG+LKG+VGLSGAI+TQLF+A Y  D
Sbjct  137  NSQAFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFYYKD  187



>ref|XP_010325963.1| PREDICTED: uncharacterized protein LOC101257997 [Solanum lycopersicum]
Length=615

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            G G   SM S   H+  GRWFMVFA  LIMS AGATYMFGLYS ++K +LGYDQTTLNLL
Sbjct  10   GHGGLNSMASFGHHVFTGRWFMVFANLLIMSMAGATYMFGLYSDEIKSSLGYDQTTLNLL  69

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
            SFFKDLG N+G++SGLINEVTPPWVVLFIGA +NFFGYFM+WL VT  I+ P++WQMCLY
Sbjct  70   SFFKDLGGNIGIISGLINEVTPPWVVLFIGAIMNFFGYFMIWLCVTGHIAKPRIWQMCLY  129

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+  NSQ+FANTGALVT VKNFPESRG +LGLLKGFVGLSGAI+TQL+HA YG +
Sbjct  130  ICIGANSQTFANTGALVTCVKNFPESRGSLLGLLKGFVGLSGAIITQLYHAFYGNN  185



>ref|XP_010067352.1| PREDICTED: uncharacterized protein LOC104454252 isoform X1 [Eucalyptus 
grandis]
Length=619

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + M  LAV +I GRWFMVFA  LIM+AAGATYMFGLYS D+K +LGYDQ+TLNLLSFFKD
Sbjct  17   SDMRHLAVQVIMGRWFMVFACFLIMAAAGATYMFGLYSEDIKHSLGYDQSTLNLLSFFKD  76

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAVTK+I+ P+VWQMCLYIC+  
Sbjct  77   LGANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRIAKPQVWQMCLYICIGA  136

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQ+FANTGALVT V+NFPESRGVVLG+LKG+VGLSGAI+TQLF+A Y  D
Sbjct  137  NSQAFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFYYKD  187



>ref|XP_006361693.1| PREDICTED: uncharacterized protein LOC102605820 [Solanum tuberosum]
Length=595

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            +L + ++  RWFMVF T LI+SAAGATYMFGLYS D+K +LGYDQTTLNLLSFFKDLGSN
Sbjct  4    NLPIRVLVSRWFMVFGTMLILSAAGATYMFGLYSSDIKSSLGYDQTTLNLLSFFKDLGSN  63

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VG+LSGLINE++PPWVVL IGA LNFFGYFM+W+AVTKK+ST KVW MCLYIC+ GNSQS
Sbjct  64   VGILSGLINEISPPWVVLSIGAILNFFGYFMIWMAVTKKMST-KVWLMCLYICIGGNSQS  122

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTGALVT VKNFPESRG VLGLLKGFVGLSGAILTQ+FHA+YG D
Sbjct  123  FANTGALVTCVKNFPESRGAVLGLLKGFVGLSGAILTQIFHALYGND  169



>ref|XP_002862889.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39148.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GGS   M SL + I+ GRWFM F + LIMS AGATYMFG+YSGD+K  LGYDQT
Sbjct  1    MVAASPGGS---MKSLTIQILTGRWFMFFGSLLIMSTAGATYMFGIYSGDIKKTLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GL+NEVTPPW +L IG  LNFFGYFM+WLAVT++IS P+VW
Sbjct  58   TLNLLSFFKDLGANVGVLAGLLNEVTPPWFILLIGGILNFFGYFMIWLAVTERISKPQVW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYICV  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A YG 
Sbjct  118  HMCLYICVGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGE  177

Query  657  D  659
            D
Sbjct  178  D  178



>ref|XP_008362281.1| PREDICTED: uncharacterized protein LOC103425934 [Malus domestica]
Length=598

 Score =   256 bits (654),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            +LA+ ++ GRWFM+FA+ LIMSAAGATYMFGLYSGD+KD LGYDQ+TLNLLSFFKDLGSN
Sbjct  17   TLALQVLYGRWFMMFASLLIMSAAGATYMFGLYSGDIKDVLGYDQSTLNLLSFFKDLGSN  76

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLINEVTPPWVVL +G  LNFFGYFM+W+AVTK+I+ P VWQMCLYIC+  NSQS
Sbjct  77   VGVLSGLINEVTPPWVVLSVGGVLNFFGYFMIWMAVTKRIARPXVWQMCLYICIGANSQS  136

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI TQL+ A Y  D
Sbjct  137  FANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIFTQLYSAFYYND  183



>gb|KFK36814.1| hypothetical protein AALP_AA4G174900 [Arabis alpina]
Length=591

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
            S  SL   II GRWFM FA+ L+MS AGATYMFG+YS D+K  LGYDQTTLNLLSFFKDL
Sbjct  10   STKSLPNQIITGRWFMFFASLLVMSTAGATYMFGIYSADIKGNLGYDQTTLNLLSFFKDL  69

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGVL+GLINEVTPPW VL IGA LNFFGYFM+WLAVTK+IS P+VW MCLYICV  N
Sbjct  70   GANVGVLAGLINEVTPPWFVLAIGAVLNFFGYFMIWLAVTKRISKPQVWHMCLYICVGAN  129

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTGALVT VKNFPESRG +LG+LKG+VGLSGAI+TQLF A+YG D
Sbjct  130  SQSFANTGALVTCVKNFPESRGTILGILKGYVGLSGAIITQLFRALYGDD  179



>ref|XP_010517258.1| PREDICTED: uncharacterized protein LOC104792736 [Camelina sativa]
Length=594

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GGS      LAV I+ GRWFM F + LIMS AGATYMFG+YS D+K  LGYDQT
Sbjct  1    MVAASPGGSTKG---LAVQILTGRWFMFFGSLLIMSTAGATYMFGIYSSDIKKTLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVG+L+GL+NEVTPPW +L IGA LNFFGYFM+WLAVTK+IS P++W
Sbjct  58   TLNLLSFFKDLGANVGILAGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQIW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYIC+  NSQSFANTG+LVT VKNFPESRGV+LG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  118  HMCLYICIGANSQSFANTGSLVTCVKNFPESRGVILGILKGYVGLSGAIITQLYHAFYGE  177

Query  657  D  659
            D
Sbjct  178  D  178



>ref|XP_010557206.1| PREDICTED: uncharacterized protein LOC104826258 [Tarenaya hassleriana]
Length=599

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = +3

Query  129  AGG-GSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLN  305
            AGG G+ A+M S AV  I GRWFM F + L+MS++GATYMFGLYS ++K +LGYDQTT+ 
Sbjct  7    AGGVGAPATMKSFAVQTITGRWFMFFVSLLVMSSSGATYMFGLYSNEIKRSLGYDQTTVT  66

Query  306  LLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMC  485
            LLSFFKDLG+NVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAVT +I  P VW MC
Sbjct  67   LLSFFKDLGANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTNRIPKPHVWHMC  126

Query  486  LYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            LYICV  NSQSFANTGALVT VKNFPESRGVVLG+LKG+VGLSGAI+TQLFHA YG D
Sbjct  127  LYICVGANSQSFANTGALVTCVKNFPESRGVVLGILKGYVGLSGAIITQLFHAFYGDD  184



>ref|XP_002881636.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57895.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=576

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GGS   M SL + I+ GRWFM F + LIMS AGATYMFG+YSGD+K  LGYDQT
Sbjct  1    MVAASPGGS---MKSLTIQILTGRWFMFFGSLLIMSTAGATYMFGIYSGDIKKTLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GL+NEVTPPW +L IG  LNFFGYFM+WLAVT++IS P+VW
Sbjct  58   TLNLLSFFKDLGANVGVLAGLLNEVTPPWFILLIGGILNFFGYFMIWLAVTERISKPQVW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYICV  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A YG 
Sbjct  118  HMCLYICVGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGE  177

Query  657  D  659
            D
Sbjct  178  D  178



>ref|XP_010068847.1| PREDICTED: uncharacterized protein LOC104455819 [Eucalyptus grandis]
Length=619

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + +  LAV +I GRWFMVFA+ LIM+AAGATYMFGLYS D+KD+LGYDQ+TLNLLSFFKD
Sbjct  17   SDVRHLAVKVIMGRWFMVFASFLIMAAAGATYMFGLYSEDIKDSLGYDQSTLNLLSFFKD  76

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG NVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAVTK+I+ P+VWQMCLYIC+  
Sbjct  77   LGGNVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRIAKPQVWQMCLYICIGA  136

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVY  650
            NSQ+FANTGALVT V+NFPESRGVVLG+LKG+VGLSGAI+TQLF+A Y
Sbjct  137  NSQTFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFY  184



>ref|XP_012082447.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Jatropha 
curcas]
 gb|KDP29179.1| hypothetical protein JCGZ_16568 [Jatropha curcas]
Length=618

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = +3

Query  129  AGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            +GGG R  M    + +I GRWFMVFA+ LIM+ AGATYMFGLYS D+K +LGYDQTTLNL
Sbjct  9    SGGGWR-EMKGFFLKMILGRWFMVFASILIMAVAGATYMFGLYSNDIKTSLGYDQTTLNL  67

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            LSFFKDLG NVGVLSGLINEVTPPWVVL IGA +NFFGYFM+WLAVT  I  PKVWQMCL
Sbjct  68   LSFFKDLGGNVGVLSGLINEVTPPWVVLSIGAIMNFFGYFMIWLAVTGHIPKPKVWQMCL  127

Query  489  YICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            YIC+  NSQ+FANTGALVT VKNFPESRG VLGLLK FVGLSGAI TQ++HA+YG D
Sbjct  128  YICIGANSQAFANTGALVTCVKNFPESRGAVLGLLKSFVGLSGAIFTQIYHALYGYD  184



>ref|XP_007142881.1| hypothetical protein PHAVU_007G024800g [Phaseolus vulgaris]
 gb|ESW14875.1| hypothetical protein PHAVU_007G024800g [Phaseolus vulgaris]
Length=636

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL + +I GRWF+VFA+ LIM+AAGATYMFGLYSGD+K  LGYDQTTLNLLSFFKDL
Sbjct  51   DMKSLTLQVITGRWFVVFASFLIMAAAGATYMFGLYSGDIKTTLGYDQTTLNLLSFFKDL  110

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGVLSGLINE+TPPWVVL IGA LNFFGYFM+WL+VT+KI+ P+VWQMCLYIC+  N
Sbjct  111  GTNVGVLSGLINELTPPWVVLAIGAVLNFFGYFMIWLSVTQKIAKPQVWQMCLYICIGAN  170

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A+Y  D
Sbjct  171  SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYSAIYYDD  220



>ref|XP_012080984.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Jatropha 
curcas]
 gb|KDP30491.1| hypothetical protein JCGZ_16170 [Jatropha curcas]
Length=608

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A M +L V +I GRWFMVFA+ LIM+AAGATYMF LYS D+K ALGYDQTT+ LLSFFKD
Sbjct  20   ADMKNLTVQVITGRWFMVFASFLIMAAAGATYMFALYSNDIKTALGYDQTTITLLSFFKD  79

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WLAVT+KIS   VW MCLYIC+  
Sbjct  80   LGANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTRKISGVHVWHMCLYICIGA  139

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQ+FANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQ++HAVYG D
Sbjct  140  NSQAFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQIYHAVYGDD  190



>ref|XP_006354409.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Solanum 
tuberosum]
Length=579

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M S   H+  GRWFMVFA  LIMS AGATYMFGLYS ++K +LGYDQTTLNLLSFFKDLG
Sbjct  1    MASFGHHVFTGRWFMVFANLLIMSMAGATYMFGLYSDEIKSSLGYDQTTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
             NVG++SGLINEVTPPWVVLFIGA +NFFGYFM+WL VT  I+ P++WQMCLYIC+  NS
Sbjct  61   GNVGIISGLINEVTPPWVVLFIGAIMNFFGYFMIWLCVTGHIAKPRIWQMCLYICIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Q+FANTGALVT VKNFPESRG +LGLLKGFVGLSGAI+TQL+HA YG +
Sbjct  121  QTFANTGALVTCVKNFPESRGSLLGLLKGFVGLSGAIITQLYHAFYGNN  169



>ref|XP_010505589.1| PREDICTED: uncharacterized protein LOC104782373 [Camelina sativa]
Length=599

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV  + GGS   M  LAV  + GRWFM F + LIMS AGATYMF +YS D+K  LGYDQT
Sbjct  1    MVAASPGGS---MKGLAVQTLTGRWFMFFGSLLIMSTAGATYMFSIYSSDIKKTLGYDQT  57

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNLLSFFKDLG+NVGVL+GL+NEVTPPW +L IGA LNFFGYFM+WLAVTK+IS P+VW
Sbjct  58   TLNLLSFFKDLGANVGVLAGLLNEVTPPWFILLIGAVLNFFGYFMIWLAVTKRISKPQVW  117

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
             MCLYICV  NSQ+FANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG 
Sbjct  118  HMCLYICVGANSQAFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGE  177

Query  657  D  659
            D
Sbjct  178  D  178



>ref|XP_009765800.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Nicotiana 
sylvestris]
Length=601

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +3

Query  138  GSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSF  317
            GS  SM +   H    RWFMVFA+ LIMS AGATYMFGLYSG++K +LGYDQTTLNLLSF
Sbjct  6    GSLRSMANFVHHFFTSRWFMVFASLLIMSMAGATYMFGLYSGEIKSSLGYDQTTLNLLSF  65

Query  318  FKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYIC  497
            FKDLG NVG++SGLINEVTPPWVVLFIGA +NFFGYFM+WL+V+  I+ P +WQMCLYIC
Sbjct  66   FKDLGGNVGIISGLINEVTPPWVVLFIGAIMNFFGYFMIWLSVSGHIAKPAIWQMCLYIC  125

Query  498  VAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            +  NSQ+FANTGALVT VKNFPESRG VLGLLKGFVGLSGAI+TQL+HA YG +
Sbjct  126  IGANSQTFANTGALVTCVKNFPESRGSVLGLLKGFVGLSGAIITQLYHAFYGNN  179



>gb|KCW65468.1| hypothetical protein EUGRSUZ_G02878, partial [Eucalyptus grandis]
Length=607

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + +  LAV +I GRWFMVFA+ LIM+AAGATYMFGLYS D+KD+LGYDQ+TLNLLSFFKD
Sbjct  17   SDVRHLAVQVIMGRWFMVFASFLIMAAAGATYMFGLYSEDIKDSLGYDQSTLNLLSFFKD  76

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG NVGV+SGLINEVTPPWVVL +GA LNF+GYFM+WLAVTK+I+ P+VWQMCLYIC+  
Sbjct  77   LGGNVGVISGLINEVTPPWVVLSMGALLNFYGYFMIWLAVTKRIAKPQVWQMCLYICIGA  136

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVY  650
            NSQ+FANTGALVT V+NFPESRGVVLG+LKG+VGLSGAI+TQLF+A Y
Sbjct  137  NSQTFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFY  184



>ref|XP_010068870.1| PREDICTED: uncharacterized protein LOC104455846 [Eucalyptus grandis]
Length=619

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + +  LAV +I GRWFMVFA+ LIM+AAGATYMFGLYS D+KD+LGYDQ+TLNLLSFFKD
Sbjct  17   SDVRHLAVQVIMGRWFMVFASFLIMAAAGATYMFGLYSEDIKDSLGYDQSTLNLLSFFKD  76

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG NVGV+SGLINEVTPPWVVL +GA LNF+GYFM+WLAVTK+I+ P+VWQMCLYIC+  
Sbjct  77   LGGNVGVISGLINEVTPPWVVLSMGALLNFYGYFMIWLAVTKRIAKPQVWQMCLYICIGA  136

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVY  650
            NSQ+FANTGALVT V+NFPESRGVVLG+LKG+VGLSGAI+TQLF+A Y
Sbjct  137  NSQTFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFY  184



>ref|XP_007220549.1| hypothetical protein PRUPE_ppa003180mg [Prunus persica]
 gb|EMJ21748.1| hypothetical protein PRUPE_ppa003180mg [Prunus persica]
Length=595

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            +L + ++ GRWFM+FA+ LIMSAAGATYMFG+YSGD+K  LGYDQTTLNLLSFFKDLG+N
Sbjct  17   ALTLQVLNGRWFMMFASLLIMSAAGATYMFGIYSGDIKTVLGYDQTTLNLLSFFKDLGAN  76

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLINEVTPPWVVL IGA LNFFGYFM+W+AVTKKI+ P+VW MCLYIC+  NSQS
Sbjct  77   VGVLSGLINEVTPPWVVLSIGAVLNFFGYFMIWMAVTKKIARPQVWHMCLYICIGANSQS  136

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQ ++A Y  D
Sbjct  137  FANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQFYYAFYYKD  183



>ref|XP_002519465.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42879.1| conserved hypothetical protein [Ricinus communis]
Length=624

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            G G    M   +  +I GRWFMVFA+ LIMS AGATYMFGLYS D+K +LGYDQ+TLNLL
Sbjct  12   GSGWWRDMKGFSFRVILGRWFMVFASLLIMSVAGATYMFGLYSNDIKTSLGYDQSTLNLL  71

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
            SFFKDLG NVG+LSGLINEVTPPWVVL IGA +NFFGYFM+WLAVT  I+ P VWQMCLY
Sbjct  72   SFFKDLGGNVGILSGLINEVTPPWVVLSIGAVMNFFGYFMIWLAVTGHIAKPTVWQMCLY  131

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+  NSQSFANTGALVT VKNFPESRG +LGLLKGFVGLSGAILTQL+HA+YG +
Sbjct  132  ICIGANSQSFANTGALVTCVKNFPESRGSILGLLKGFVGLSGAILTQLYHAIYGDN  187



>ref|XP_009630642.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Nicotiana 
tomentosiformis]
Length=608

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = +3

Query  135  GGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLS  314
            GG RA M +   H   GRWFMVFA+ LIMS AGATYMFGLYSG++K +LGYDQTTLNLLS
Sbjct  10   GGLRA-MANFGHHFFTGRWFMVFASLLIMSMAGATYMFGLYSGEIKSSLGYDQTTLNLLS  68

Query  315  FFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYI  494
            FFKDLG NVG+++GLINEVTPPWVVLFIGA +NFFGYFM+WL+V+  I+ P +WQMCLYI
Sbjct  69   FFKDLGGNVGIIAGLINEVTPPWVVLFIGAIMNFFGYFMIWLSVSGHIAKPAIWQMCLYI  128

Query  495  CVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            C+  NSQ+FANTGALVT VKNFPESRG +LGLLKGFVGLSGAI+TQL+HA YG +
Sbjct  129  CIGANSQTFANTGALVTCVKNFPESRGSLLGLLKGFVGLSGAIITQLYHAFYGNN  183



>ref|XP_008233256.1| PREDICTED: uncharacterized protein LOC103332309 [Prunus mume]
Length=600

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            +L + ++ GRWFM+FA+ LIMSAAGATYMFG+YS D+K  LGYDQTTLNLLSFFKDLG+N
Sbjct  17   ALTLQVLNGRWFMMFASLLIMSAAGATYMFGIYSSDIKSVLGYDQTTLNLLSFFKDLGAN  76

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLINEVTPPWVVL IGA LNFFGYFM+W+AVTKKI+ P+VW MCLYIC+  NSQS
Sbjct  77   VGVLSGLINEVTPPWVVLSIGAVLNFFGYFMIWMAVTKKIARPQVWHMCLYICIGANSQS  136

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQL++A Y  D
Sbjct  137  FANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYYAFYYDD  183



>gb|KJB73494.1| hypothetical protein B456_011G235000 [Gossypium raimondii]
Length=611

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            GGG+ ++  SLAV I++G W MVF + LIMSAAGATYMF LYSGD+K++LGYDQTTLN L
Sbjct  9    GGGAMSNSKSLAVQILKGPWLMVFGSLLIMSAAGATYMFSLYSGDIKESLGYDQTTLNYL  68

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
            SFFKDLG+NVGVLSGLI EVTPPW VL +GA LNFFGYFM+WLAVTK+I T KVWQMCLY
Sbjct  69   SFFKDLGTNVGVLSGLIAEVTPPWFVLSVGAGLNFFGYFMIWLAVTKRIPT-KVWQMCLY  127

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+  NSQSFANTG+LV  VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  128  ICIGANSQSFANTGSLVVCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGDD  183



>ref|XP_004307342.1| PREDICTED: uncharacterized protein LOC101306672 [Fragaria vesca 
subsp. vesca]
Length=597

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 151/179 (84%), Gaps = 2/179 (1%)
 Frame = +3

Query  129  AGGGSR--ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            AG G R  A   SL + ++ GRWFMVFA  LIMSAAGATYMFGLYS D+K AL YDQ+TL
Sbjct  2    AGSGPRGWADTKSLTLQVLNGRWFMVFACLLIMSAAGATYMFGLYSPDIKTALAYDQSTL  61

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            NLLSFFKD GSNVG+LSGL+NEVTPPWVVL +GA LNF GY M+WL+VTKKI+ PKVWQM
Sbjct  62   NLLSFFKDFGSNVGILSGLLNEVTPPWVVLLVGAVLNFLGYLMIWLSVTKKIARPKVWQM  121

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            CLYIC+  NSQSFANTG+LVT VKNFPESRGVVLGLLKG+VGLSGAI+TQ++ A Y  D
Sbjct  122  CLYICIGANSQSFANTGSLVTCVKNFPESRGVVLGLLKGYVGLSGAIITQMYFAFYYND  180



>gb|KEH44271.1| MFS transporter [Medicago truncatula]
Length=594

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL V  I GRWF++FA+ LIM+AAGATYMFGLYSGD+K  LGYDQ+TLNLLSFFKD 
Sbjct  14   DMKSLTVQFITGRWFVIFASFLIMAAAGATYMFGLYSGDIKTTLGYDQSTLNLLSFFKDF  73

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            GSNVGVL+GL+NE+ PPWVVL IGA LNFFGYFM+WL+VTKKI+ PKVWQMCLYIC+  N
Sbjct  74   GSNVGVLAGLVNELYPPWVVLTIGAILNFFGYFMIWLSVTKKIARPKVWQMCLYICIGAN  133

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQL+ A+Y  D
Sbjct  134  SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYSAIYYDD  183



>gb|KEH44270.1| MFS transporter [Medicago truncatula]
Length=588

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL V +I GRWF++FA+ LIMSAAGATYMFGLYS D+K+ LGYDQ+TL+LLSFFKD 
Sbjct  10   DMKSLTVQVITGRWFVIFASFLIMSAAGATYMFGLYSSDIKETLGYDQSTLDLLSFFKDF  69

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            GSNVG+L+GLINE++PPWVVL IGA LNFFGYFM+WL++TKKI+ P VWQMCLYIC+  N
Sbjct  70   GSNVGILAGLINEISPPWVVLAIGAILNFFGYFMIWLSITKKIARPHVWQMCLYICIGAN  129

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTG+LVT VKNFPESRG VLG+LKG++GLSGAI+TQL+ A+Y  D
Sbjct  130  SQSFANTGSLVTCVKNFPESRGAVLGILKGYLGLSGAIITQLYSAIYYND  179



>ref|XP_007142882.1| hypothetical protein PHAVU_007G024900g [Phaseolus vulgaris]
 gb|ESW14876.1| hypothetical protein PHAVU_007G024900g [Phaseolus vulgaris]
Length=596

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL + +I GRWF+VFA+ LIM+AAGATYMF LYSGD+K  LGYDQ+TLNLLSFFKDL
Sbjct  17   DMKSLTLQVITGRWFVVFASFLIMAAAGATYMFALYSGDIKTTLGYDQSTLNLLSFFKDL  76

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            GSNVG+L+GLINE TPPWVVL IGA LNFFGYFM+WL+VT+KI+ P+VWQMCLYIC+  N
Sbjct  77   GSNVGILAGLINEFTPPWVVLTIGAVLNFFGYFMIWLSVTQKIARPQVWQMCLYICIGAN  136

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQL+ A+Y  D
Sbjct  137  SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYSAIYYDD  186



>ref|XP_010435975.1| PREDICTED: uncharacterized protein LOC104719709 [Camelina sativa]
Length=587

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M  LA+ I+ GRWFM F++ LIMS AGATYMFG+YSGD+K  LGYDQTTLNL+SFFKDLG
Sbjct  1    MKGLAIQILTGRWFMFFSSILIMSTAGATYMFGIYSGDIKRTLGYDQTTLNLISFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVGVL+GL+NEVTPPW +L IGA LNFFGYFM+WLAVTK+IS P+VW MCLYICV  NS
Sbjct  61   ANVGVLTGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQVWHMCLYICVGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
              FANTG++VT VKNFPESRGVVLG+LKG++GLSGAI+TQL+HA YG D
Sbjct  121  LVFANTGSVVTCVKNFPESRGVVLGILKGYIGLSGAIITQLYHAFYGED  169



>ref|XP_004497124.1| PREDICTED: uncharacterized protein LOC101508657 [Cicer arietinum]
Length=607

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            SLAV  I GRWF+VFA+ LIM+AAGATYMFGLYS D+K  LGYDQ+TLNLLSFFKD GSN
Sbjct  17   SLAVQFITGRWFVVFASFLIMAAAGATYMFGLYSSDIKITLGYDQSTLNLLSFFKDFGSN  76

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLINE++PPWVVL IGA LNFFGYFM+WL+VTKKIS P+VWQMCLYIC+  NSQS
Sbjct  77   VGVLSGLINELSPPWVVLTIGAVLNFFGYFMIWLSVTKKISRPQVWQMCLYICIGANSQS  136

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A+Y  D
Sbjct  137  FANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYSAIYYDD  183



>gb|KDO37221.1| hypothetical protein CISIN_1g039263mg, partial [Citrus sinensis]
Length=492

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 154/185 (83%), Gaps = 4/185 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLA----VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALG  284
            MVV   GGS  S+  +     V ++ GRWFMVFA+ LIM+ AGATYMFGLYS D+K +LG
Sbjct  1    MVVSDFGGSCCSLREMKSSSLVGVLTGRWFMVFASLLIMAVAGATYMFGLYSSDIKTSLG  60

Query  285  YDQTTLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKIST  464
            YDQ+TLNLLSF KD+G NVGVLSGLINE+TPPWVVL IG+ +NFFGYFM+WLAVT +I  
Sbjct  61   YDQSTLNLLSFSKDVGGNVGVLSGLINEITPPWVVLAIGSIMNFFGYFMIWLAVTGRIPK  120

Query  465  PKVWQMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHA  644
            P+VWQMCLYIC+  NSQSFANTGALVT VKNFPESRG VLGLLKGFVGLSGAILTQL+HA
Sbjct  121  PQVWQMCLYICIGANSQSFANTGALVTCVKNFPESRGSVLGLLKGFVGLSGAILTQLYHA  180

Query  645  VYGTD  659
             YG +
Sbjct  181  FYGDN  185



>ref|XP_004240185.2| PREDICTED: uncharacterized protein LOC101262315 [Solanum lycopersicum]
Length=566

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M  L + +  GRWFMVFAT LI+S++GATY+FG+YS D+K +LGYDQTTLNLLSFFKDLG
Sbjct  1    MKKLTLQVFTGRWFMVFATILILSSSGATYIFGIYSTDIKTSLGYDQTTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
             NVG+LSGLINEVTPPWVVL  GA LN FGY M+WL+VTKKI  PK+W MCLYICV  NS
Sbjct  61   GNVGILSGLINEVTPPWVVLSFGAILNLFGYLMIWLSVTKKIPKPKIWHMCLYICVGSNS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            QSFANTGALVT VKNFPESRG VLGLLKG+VGLSGA+LTQ++HA+YG +
Sbjct  121  QSFANTGALVTCVKNFPESRGAVLGLLKGYVGLSGAMLTQIYHAIYGNE  169



>ref|XP_010450661.1| PREDICTED: uncharacterized protein LOC104732777 [Camelina sativa]
Length=588

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M  LA+ I+ GRWFM FA+ LIMS AGATYMFG+YS D+K  LGYDQTTLNL+SFFKDLG
Sbjct  1    MKGLAIQILTGRWFMFFASILIMSTAGATYMFGIYSDDIKRTLGYDQTTLNLISFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVGVL+GL+NEVTPPW +L IGA LNFFGYFM+WLAVTK+IS P+VW MCLYICV  NS
Sbjct  61   ANVGVLTGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQVWHMCLYICVGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
              FANTG++VT VKNFPESRGVVLG+LKG++GLSGAI+TQL+HA YG D
Sbjct  121  LVFANTGSVVTCVKNFPESRGVVLGILKGYIGLSGAIITQLYHAFYGED  169



>ref|XP_003637404.1| Nitrate and chloride transporter [Medicago truncatula]
Length=596

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL V  I GRWF++FA+ LIM+AAGATYMFGLYS D+K  LGYDQ+TLNLLSFFKD 
Sbjct  14   DMKSLTVQFITGRWFVIFASFLIMAAAGATYMFGLYSPDIKTTLGYDQSTLNLLSFFKDF  73

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            GSNVGVLSGLINE+ PPWVVL IGA LNFFGYFM+WL+VTKKI+ P+VWQMCLYIC+  N
Sbjct  74   GSNVGVLSGLINELYPPWVVLTIGAILNFFGYFMIWLSVTKKIARPQVWQMCLYICIGAN  133

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQL+ A+Y  D
Sbjct  134  SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYSAIYYDD  183



>gb|EPS72672.1| hypothetical protein M569_02085, partial [Genlisea aurea]
Length=548

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            V  I G+WFM+FATTLIM+AAGATY+FGLYS  +K +LGYDQTTLNLLSFFKDLG+NVGV
Sbjct  3    VQFISGQWFMIFATTLIMAAAGATYLFGLYSPVIKSSLGYDQTTLNLLSFFKDLGTNVGV  62

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            +SGLINEVTPPW VL IGA +NF GYFM+WLAV+++ISTP+VWQMCLYIC+  NSQSFAN
Sbjct  63   ISGLINEVTPPWFVLVIGAGMNFVGYFMIWLAVSRRISTPRVWQMCLYICIGANSQSFAN  122

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVTAVKNFPESRG +LGLLKG++GLSGAILTQ+++A+YG D
Sbjct  123  TGALVTAVKNFPESRGALLGLLKGYLGLSGAILTQIYNALYGND  166



>gb|KEH44269.1| MFS transporter [Medicago truncatula]
Length=596

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SL V  I GRWF++FA+ LIM+AAGATYMFGLYS D+K  LGYDQ+TLNLLSFFKD 
Sbjct  14   DMKSLTVQFITGRWFVIFASFLIMAAAGATYMFGLYSPDIKTTLGYDQSTLNLLSFFKDF  73

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            GSNVGVLSGLINE+ PPWVVL IGA LNFFGYFM+WL+VTKKI+ P+VWQMCLYIC+  N
Sbjct  74   GSNVGVLSGLINELYPPWVVLTIGAILNFFGYFMIWLSVTKKIARPQVWQMCLYICIGAN  133

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQL+ A+Y  D
Sbjct  134  SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYSAIYYDD  183



>emb|CAN63260.1| hypothetical protein VITISV_029213 [Vitis vinifera]
Length=613

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M    + ++ GRWFMVFA+ LIMS AGATYMF LYSG +K +LGYDQTTLNLLSFFKDLG
Sbjct  1    MRRFGLQVLVGRWFMVFASLLIMSVAGATYMFSLYSGXIKTSLGYDQTTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
             NVGVLSGLINEVTPPWVVL IGA +NFFGYFM+WLAVT +I+ P++WQMCLYIC+  NS
Sbjct  61   GNVGVLSGLINEVTPPWVVLCIGAVMNFFGYFMIWLAVTDRIAKPQIWQMCLYICIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            QSFANTGALVT V+NFPESRG+VLGLLKGFVGLSGAI+TQL+ A YG D
Sbjct  121  QSFANTGALVTCVRNFPESRGIVLGLLKGFVGLSGAIITQLYRAFYGDD  169



>ref|XP_007162787.1| hypothetical protein PHAVU_001G180500g [Phaseolus vulgaris]
 gb|ESW34781.1| hypothetical protein PHAVU_001G180500g [Phaseolus vulgaris]
Length=573

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M SL+ H+I GRWFM+FA+ LIMS AGATYMF +YS ++K +LGYDQ+TLNLLSFFKDLG
Sbjct  1    MKSLSYHVITGRWFMLFASLLIMSVAGATYMFAIYSNEVKTSLGYDQSTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVGV+SGL+NE+TPPWVVL IG  +NFFGYFM+WLAV+ +I+ P+VWQMCLYIC+  NS
Sbjct  61   ANVGVISGLVNEITPPWVVLSIGVLMNFFGYFMIWLAVSGRIAKPQVWQMCLYICIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYG  653
            Q+FANTGALVT VKNFPESRG +LGLLKG+VGLSGAI+TQL+HA YG
Sbjct  121  QTFANTGALVTCVKNFPESRGSLLGLLKGYVGLSGAIITQLYHAFYG  167



>ref|XP_002268663.2| PREDICTED: uncharacterized protein LOC100248651 [Vitis vinifera]
Length=638

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            + ++ GRWFMVFA+ LIMS AGATYMF LYSG++K +LGYDQTTLNLLSFFKDLG NVGV
Sbjct  20   LQVLVGRWFMVFASLLIMSVAGATYMFSLYSGEIKTSLGYDQTTLNLLSFFKDLGGNVGV  79

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGLINEVTPPWVVL IGA +NFFGYFM+WLAVT +I+ P++WQMCLYIC+  NSQSFAN
Sbjct  80   LSGLINEVTPPWVVLCIGAVMNFFGYFMIWLAVTDRIAKPQIWQMCLYICIGANSQSFAN  139

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT V+NFPESRG+VLGLLKGFVGLSGAI+TQL+ A YG D
Sbjct  140  TGALVTCVRNFPESRGIVLGLLKGFVGLSGAIITQLYRAFYGDD  183



>ref|XP_010067353.1| PREDICTED: uncharacterized protein LOC104454252 isoform X2 [Eucalyptus 
grandis]
 gb|KCW65467.1| hypothetical protein EUGRSUZ_G02877 [Eucalyptus grandis]
Length=604

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 158/187 (84%), Gaps = 6/187 (3%)
 Frame = +3

Query  117  MVVFAGGGSR------ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDA  278
            MV+    G R      +++  LA  +I GRWFMVFA+ LIM+AAGATYMFGLYS D+K +
Sbjct  1    MVIAGSPGGRGGLAGLSNVKHLAAQVIMGRWFMVFASLLIMAAAGATYMFGLYSEDIKTS  60

Query  279  LGYDQTTLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKI  458
            LGYDQ+TLNLLSFFKDLG +VG+ SGLINEV+PPWVVL IGA LNFFGYFM+WLAVTK+I
Sbjct  61   LGYDQSTLNLLSFFKDLGGSVGIPSGLINEVSPPWVVLSIGAVLNFFGYFMIWLAVTKRI  120

Query  459  STPKVWQMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLF  638
            +TP+VWQMCLYIC+  NSQ+FANTGALVT V+NFPESRGVVLG+LKG+VGLSGAI+TQL+
Sbjct  121  TTPQVWQMCLYICIGANSQAFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLY  180

Query  639  HAVYGTD  659
             AVY  D
Sbjct  181  LAVYYHD  187



>ref|XP_003535733.2| PREDICTED: uncharacterized protein LOC100787176 [Glycine max]
Length=622

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  AGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            A  GS      L V +I GRWF+VFA+ LIM+AAGATYMF LYSGD+K AL YDQTTLNL
Sbjct  35   AAIGSMLDTNGLTVQVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKSALAYDQTTLNL  94

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            LSFFKDLG NVGVLSGLINE+TPPWVVL IG+ LNFFGYFM+WLAVTKKI  P VW MCL
Sbjct  95   LSFFKDLGGNVGVLSGLINEITPPWVVLAIGSILNFFGYFMIWLAVTKKIPKPHVWHMCL  154

Query  489  YICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            YIC+  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A Y  D
Sbjct  155  YICLGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYFAFYYDD  211



>ref|XP_010267223.1| PREDICTED: uncharacterized protein LOC104604543 [Nelumbo nucifera]
Length=636

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            G G R   G  A  I+ GRWFMVFA+ LIMSAAGATYMFGLYS D+K +LGYDQTTLNLL
Sbjct  10   GAGWRDVRGVTA-QIVLGRWFMVFASFLIMSAAGATYMFGLYSNDIKTSLGYDQTTLNLL  68

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
            SFFKDLGSNVG+LSGLINEVTPPWVVL IGA +NF GYFM+WLAV+ +I+ P VW MC+Y
Sbjct  69   SFFKDLGSNVGILSGLINEVTPPWVVLVIGAVMNFSGYFMIWLAVSGRIARPHVWHMCIY  128

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+  NSQSFANTGALVT VKNFPESRGVVLGLLKGFVGLSGAI+TQ++HA+YG +
Sbjct  129  ICLGANSQSFANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIITQIYHALYGNN  184



>ref|XP_004142500.2| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Cucumis sativus]
Length=581

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            S+ VH+I  RWF++FA+ LIM  AG+TY+F LYS D+K  LGYDQTTLNLLSF KDLG+N
Sbjct  15   SIVVHVITRRWFVLFASLLIMGVAGSTYIFSLYSNDIKSTLGYDQTTLNLLSFSKDLGAN  74

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            +GVLSGLINEVTPPWVVL IGA +NFFGYFM+WLA+T +ISTPKVWQMCLYIC+  NSQS
Sbjct  75   IGVLSGLINEVTPPWVVLSIGALMNFFGYFMIWLAITNRISTPKVWQMCLYICIGANSQS  134

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG++VT V NFPESRGVVLG+LKG+ GLSGAI+TQLFHA YG D
Sbjct  135  FANTGSMVTCVMNFPESRGVVLGILKGYAGLSGAIITQLFHAFYGAD  181



>gb|KCW65302.1| hypothetical protein EUGRSUZ_G02759 [Eucalyptus grandis]
Length=621

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +3

Query  183  GRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVLSGLI  362
            GRWFMVFA+ LIM+AAGATYMFGLYS D+KD+LGYDQ+TLNLLSFFKDLG NVGVLSGLI
Sbjct  2    GRWFMVFASFLIMAAAGATYMFGLYSEDIKDSLGYDQSTLNLLSFFKDLGGNVGVLSGLI  61

Query  363  NEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANTGALV  542
            NEVTPPWVVL +GA LNFFGYFM+WLAVTK+I+ P+VWQMCLYIC+  NSQ+FANTGALV
Sbjct  62   NEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRIAKPQVWQMCLYICIGANSQTFANTGALV  121

Query  543  TAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVY  650
            T V+NFPESRGVVLG+LKG+VGLSGAI+TQLF+A Y
Sbjct  122  TCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFY  157



>ref|XP_003555885.1| PREDICTED: uncharacterized protein LOC100808975 [Glycine max]
Length=591

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  AGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            A  GS      L V +I GRWF+VFA+ LIM+AAGATYMF LYSGD+K AL YDQTTLNL
Sbjct  3    AAIGSMVDTNGLMVQVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKSALAYDQTTLNL  62

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            LSFFKDLG NVGVLSGLINE+TPPWVVL +G+ LNFFGYFM+WLAVTKKI  P VW MCL
Sbjct  63   LSFFKDLGGNVGVLSGLINEITPPWVVLAMGSVLNFFGYFMIWLAVTKKIPKPHVWHMCL  122

Query  489  YICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            YIC+  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A Y  D
Sbjct  123  YICIGSNSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYFAFYYDD  179



>ref|XP_003555225.2| PREDICTED: uncharacterized protein LOC100819121 [Glycine max]
Length=607

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SLAV +I GRWF+VFA+ LIM+AAGATYMFGLYS D+K  LGYDQTTLNLLSFFKDL
Sbjct  32   DMKSLAVQVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQTTLNLLSFFKDL  91

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGV+SGLINE+ PPWVVL IGA LNFFGYFM+WL+VT++I+ PKVWQMCLYIC+  N
Sbjct  92   GTNVGVISGLINELAPPWVVLAIGAVLNFFGYFMIWLSVTQRIAKPKVWQMCLYICIGAN  151

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+FANTG+LVT +KNFPE  GVVLG+LKG++GLSGAI+TQL+ A+Y  D
Sbjct  152  SQTFANTGSLVTCIKNFPERNGVVLGILKGYLGLSGAIITQLYSAIYYDD  201



>gb|KHN11443.1| Putative transporter MCH1 [Glycine soja]
Length=586

 Score =   248 bits (634),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M SLAV +I GRWF+VFA+ LIM AAGATYMFGLYS D+K  LGYDQTTLNLLSFFKDL
Sbjct  11   DMKSLAVQVITGRWFVVFASFLIMPAAGATYMFGLYSSDIKTTLGYDQTTLNLLSFFKDL  70

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGV+SGLINE+ PPWVVL IGA LNFFGYFM+WL+VT++I+ PKVWQMCLYIC+  N
Sbjct  71   GTNVGVISGLINELAPPWVVLAIGAVLNFFGYFMIWLSVTQRIAKPKVWQMCLYICIGAN  130

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+FANTG+LVT +KNFPE  GVVLG+LKG++GLSGAI+TQL+ A+Y  D
Sbjct  131  SQTFANTGSLVTCIKNFPERNGVVLGILKGYLGLSGAIITQLYSAIYYDD  180



>ref|XP_011031645.1| PREDICTED: uncharacterized protein LOC105130706 [Populus euphratica]
Length=609

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A M  L   I+ GRWFMVFA+ LIMSA+GATYMF LYS D+K ALGYDQTTLNLLSFFKD
Sbjct  16   ADMKILTTQIVTGRWFMVFASLLIMSASGATYMFALYSPDIKSALGYDQTTLNLLSFFKD  75

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            +GSNVGVLSGLINEVTPPWVVL +GA LNFFGYFM+WL+VTKKI+  +VW MCLYIC+  
Sbjct  76   VGSNVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLSVTKKITGVQVWHMCLYICIGA  135

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQSFANTG+LVT VKNFPESRG VLG+LKG+VGLSGAI+TQ + A YG D
Sbjct  136  NSQSFANTGSLVTCVKNFPESRGSVLGILKGYVGLSGAIITQFYLAFYGDD  186



>gb|KHN05591.1| hypothetical protein glysoja_035791 [Glycine soja]
Length=583

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  162  LAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNV  341
            L V +I GRWF+VFA+ LIM+AAGATYMF LYSGD+K AL YDQTTLNLLSFFKDLG NV
Sbjct  7    LMVQVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKSALAYDQTTLNLLSFFKDLGGNV  66

Query  342  GVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSF  521
            GVLSGLINE+TPPWVVL IG+ LNFFGYFM+WLAVTKKI  P VW MCLYIC+  NSQSF
Sbjct  67   GVLSGLINEITPPWVVLAIGSILNFFGYFMIWLAVTKKIPKPHVWHMCLYICLGANSQSF  126

Query  522  ANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            ANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A Y  D
Sbjct  127  ANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYFAFYYDD  172



>ref|NP_001236811.1| nitrate and chloride transporter [Glycine max]
 gb|AAW51884.1| nitrate and chloride transporter [Glycine max]
Length=598

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             + SL V +I GRWF+VFA+ LIM+AAGATYMFGLYS D+K  LGYDQTTLNLLSFFKDL
Sbjct  15   DIKSLTVQVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQTTLNLLSFFKDL  74

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGV+SGLINEV PPWVVL IGA LNFFGYFM+WL+VT+KI+ PKVWQMCLYIC+  N
Sbjct  75   GTNVGVISGLINEVAPPWVVLAIGAILNFFGYFMIWLSVTQKIAKPKVWQMCLYICIGAN  134

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+FANTG+LVT +KNFPE  GVVLG+LKG++GLSGAI+TQL+ A+Y  D
Sbjct  135  SQTFANTGSLVTCIKNFPERNGVVLGILKGYLGLSGAIITQLYSAIYYDD  184



>ref|XP_007142880.1| hypothetical protein PHAVU_007G024700g [Phaseolus vulgaris]
 gb|ESW14874.1| hypothetical protein PHAVU_007G024700g [Phaseolus vulgaris]
Length=586

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 151/177 (85%), Gaps = 1/177 (1%)
 Frame = +3

Query  129  AGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            AGG    + G L V +I GRWF+VFA+ LIM+AAGATYMF LYSGD+K AL YDQTTLNL
Sbjct  4    AGGDMVNTNGHL-VQVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKYALAYDQTTLNL  62

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            LSFFKDLG NVG+LSGLINE+TPPWVVL +G+ LNFFGYFM+WLAVTKKI  P VW MCL
Sbjct  63   LSFFKDLGGNVGILSGLINEITPPWVVLVMGSVLNFFGYFMIWLAVTKKIPKPHVWHMCL  122

Query  489  YICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            YIC+  NSQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL++A Y  D
Sbjct  123  YICIGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYYAFYYDD  179



>gb|KHN05589.1| Putative transporter MCH1 [Glycine soja]
Length=598

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             + SL V +I GRWF+VFA+ LIM+AAGATYMFGLYS D+K  LGYDQTTLNLLSFFKDL
Sbjct  15   DIKSLTVQVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQTTLNLLSFFKDL  74

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGV+SGLINEV PPWVVL IGA LNFFGYFM+WL+VT+KI+ PKVWQMCLYIC+  N
Sbjct  75   GTNVGVISGLINEVAPPWVVLAIGAILNFFGYFMIWLSVTQKIAKPKVWQMCLYICIGAN  134

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+FANTG+LVT +KNFPE  GVVLG+LKG++GLSGAI+TQL+ A+Y  D
Sbjct  135  SQTFANTGSLVTCIKNFPERNGVVLGILKGYLGLSGAIITQLYSAIYYDD  184



>ref|XP_010243234.1| PREDICTED: uncharacterized protein LOC104587357 [Nelumbo nucifera]
Length=633

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            SL   I+ GRWFMVFA+ LIMSAAGATYMF LYS D+K  LGYDQTTLNLLSF KD+G+N
Sbjct  22   SLTARILLGRWFMVFASFLIMSAAGATYMFALYSNDIKTTLGYDQTTLNLLSFAKDVGAN  81

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VG+LSGLINE+TPPWVVL IGA +NF GYFM+WLAVT++I+ P+VWQMCLYIC+  NSQ+
Sbjct  82   VGILSGLINEITPPWVVLVIGAIMNFGGYFMIWLAVTERIARPQVWQMCLYICIGANSQT  141

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRG+VLGLLKGFVGLSGAI+TQL+HA+YG +
Sbjct  142  FANTGSLVTCVKNFPESRGIVLGLLKGFVGLSGAIITQLYHALYGNN  188



>gb|KHN11444.1| hypothetical protein glysoja_015339 [Glycine soja]
Length=584

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  162  LAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNV  341
            L V +I GRWF+VFA+ LIM+AAGATYMF LYSGD+K AL YDQTTLNLLSFFKDLG NV
Sbjct  7    LMVQVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKSALAYDQTTLNLLSFFKDLGGNV  66

Query  342  GVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSF  521
            GVLSGLINE+TPPWVVL +G+ LNFFGYFM+WLAVTKKI  P VW MCLYIC+  NSQSF
Sbjct  67   GVLSGLINEITPPWVVLAMGSVLNFFGYFMIWLAVTKKIPKPHVWHMCLYICIGSNSQSF  126

Query  522  ANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            ANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+ A Y  D
Sbjct  127  ANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYFAFYYDD  172



>emb|CDP15282.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +3

Query  126  FAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLN  305
             +GGG   ++G     ++ GRWFMVFA+ LIM+ AGATYMFGLYSGD+K +LGYDQT++N
Sbjct  6    LSGGGCWRAVGGFGYQLLTGRWFMVFASNLIMAVAGATYMFGLYSGDIKSSLGYDQTSVN  65

Query  306  LLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMC  485
             LSFFKDLG NVG++SGLINE+TPPWVVL IGA +NF GYFM+WLAVT  ++ P +WQMC
Sbjct  66   YLSFFKDLGGNVGIISGLINEITPPWVVLIIGAAMNFAGYFMIWLAVTGHVAKPPLWQMC  125

Query  486  LYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            LYICV  +SQ+FANTGALVT VKNFPESRGVVLGLLKGFVGLSGAI+TQL+HA+YG +
Sbjct  126  LYICVGASSQTFANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIITQLYHALYGHN  183



>ref|XP_006491715.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Citrus 
sinensis]
Length=609

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 153/185 (83%), Gaps = 4/185 (2%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLA----VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALG  284
            MVV   GGS  S+  +     V ++ GRWFMVFA+ LIM+ AGATYMFGLYS D+K +LG
Sbjct  1    MVVSDFGGSCCSLREMKSSSLVGVLTGRWFMVFASLLIMAVAGATYMFGLYSSDIKTSLG  60

Query  285  YDQTTLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKIST  464
            YDQ+TLNLLSF KD+G NVGVLSGLINE+TPPWVVL IG+ +NF GYFM+WLAVT +I  
Sbjct  61   YDQSTLNLLSFSKDVGGNVGVLSGLINEITPPWVVLAIGSIMNFSGYFMIWLAVTGRIPK  120

Query  465  PKVWQMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHA  644
            P+VWQMCLYIC+  NSQSFANTGALVT VKNFPESRG VLGLLKGFVGLSGAILTQL+HA
Sbjct  121  PQVWQMCLYICIGANSQSFANTGALVTCVKNFPESRGSVLGLLKGFVGLSGAILTQLYHA  180

Query  645  VYGTD  659
             YG +
Sbjct  181  FYGDN  185



>ref|XP_010050677.1| PREDICTED: uncharacterized protein LOC104439293 [Eucalyptus grandis]
 gb|KCW89356.1| hypothetical protein EUGRSUZ_A01652 [Eucalyptus grandis]
Length=627

 Score =   246 bits (629),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            G G R +  SLA H + GRWFM FA  LIMS AGATY+F LYSGD+K +LGYDQT+LNLL
Sbjct  12   GSGWREAR-SLAAHALLGRWFMAFAAFLIMSVAGATYIFSLYSGDIKSSLGYDQTSLNLL  70

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
             FFKDLG+NVG++SGL+NEVTPPWVVL IGA +NFFGYFM+WLAVT + + P++W MCLY
Sbjct  71   GFFKDLGANVGIVSGLVNEVTPPWVVLSIGAAMNFFGYFMIWLAVTGRSARPRLWLMCLY  130

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            ICV  NSQSFANTGALVTAVKNFPESRG +LGLLKGFVGLSGAIL QL+HA YG D
Sbjct  131  ICVGANSQSFANTGALVTAVKNFPESRGAILGLLKGFVGLSGAILAQLYHAFYGDD  186



>ref|XP_010050685.1| PREDICTED: uncharacterized protein LOC104439301 [Eucalyptus grandis]
 gb|KCW89357.1| hypothetical protein EUGRSUZ_A01653 [Eucalyptus grandis]
Length=629

 Score =   246 bits (629),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            SLA H + GRWFM FA  LIMS AGATY+F LYSGD+K +LGYDQT+LNLL FFKDLG+N
Sbjct  21   SLAAHALLGRWFMAFAALLIMSVAGATYIFSLYSGDIKSSLGYDQTSLNLLGFFKDLGAN  80

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VG++SGL+NEVTPPWVVL IGA +NFFGYFM+WLAVT + + P++W MCLYIC+  NSQS
Sbjct  81   VGIVSGLVNEVTPPWVVLSIGAVMNFFGYFMIWLAVTGRSARPRLWLMCLYICIGANSQS  140

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTGALVTAVKNFPESRG +LGLLKGFVGLSGAIL QL+HA YG D
Sbjct  141  FANTGALVTAVKNFPESRGAILGLLKGFVGLSGAILAQLYHAFYGDD  187



>ref|XP_010098801.1| hypothetical protein L484_022566 [Morus notabilis]
 gb|EXB75889.1| hypothetical protein L484_022566 [Morus notabilis]
Length=219

 Score =   234 bits (598),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            S +  ++ GRWFM FA+ LI+SA+GATYMFGLYS D+K +LGYDQTTLNLLSFFKDLG+N
Sbjct  17   SFSYQVLLGRWFMFFASLLILSASGATYMFGLYSTDIKTSLGYDQTTLNLLSFFKDLGAN  76

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VG+ +GLINE+ PPWVVL  G  +NF GYFM+WLAVT +I+ P+VWQMCLYICV  NSQ+
Sbjct  77   VGIFAGLINEIMPPWVVLSAGVVMNFSGYFMIWLAVTGRITKPRVWQMCLYICVGANSQT  136

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            +ANTGA+VT VKNFP SRG VLGLLKGFVGLSGAI+TQL+HA YG D
Sbjct  137  YANTGAIVTCVKNFPGSRGSVLGLLKGFVGLSGAIITQLYHAFYGDD  183



>ref|XP_009377045.1| PREDICTED: uncharacterized protein LOC103965696 [Pyrus x bretschneideri]
Length=611

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +3

Query  126  FAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLN  305
            F  G     M S    ++ GRWFMVFA+ LI+S +GATYMFGLYS ++K +LGYDQTT+N
Sbjct  6    FTSGFGNKEMRSFGFQVLHGRWFMVFASMLILSMSGATYMFGLYSNEVKTSLGYDQTTVN  65

Query  306  LLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMC  485
            LLSFFKDLG NVG+++GLINEVT PWVVL IGA +NFFGYFM+WLAVT + S P++WQMC
Sbjct  66   LLSFFKDLGGNVGIIAGLINEVTGPWVVLLIGALMNFFGYFMIWLAVTGRTSKPRMWQMC  125

Query  486  LYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            LYIC+  NSQ+FANTGA+V+ VKNFPESRG VLG+LKG VGLSGAI+TQLFHA YG D
Sbjct  126  LYICIGANSQTFANTGAVVSCVKNFPESRGSVLGILKGLVGLSGAIITQLFHAFYGND  183



>ref|XP_004497125.1| PREDICTED: uncharacterized protein LOC101508976 [Cicer arietinum]
Length=591

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            +L   +I GRWF+VFA+ LIMSA+GATYMFGLYS D+K +L YDQTTLNLLSFFKDLG N
Sbjct  17   TLITQVITGRWFVVFASFLIMSASGATYMFGLYSSDIKTSLAYDQTTLNLLSFFKDLGGN  76

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
             GVLSGLINE+TPPWVVL +G+ LNFFGYFM+WLAVTKKI  P+VWQMCLYIC+  NSQS
Sbjct  77   FGVLSGLINELTPPWVVLAMGSLLNFFGYFMIWLAVTKKIKKPQVWQMCLYICIGANSQS  136

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPE+RGVVLG+LKG+VGLSGAI+TQL+ A+Y  D
Sbjct  137  FANTGSLVTCVKNFPETRGVVLGILKGYVGLSGAIITQLYSAIYFDD  183



>gb|KJB60522.1| hypothetical protein B456_009G310000 [Gossypium raimondii]
Length=620

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  144  RASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFK  323
            + SM S AV ++ G W + F + LIMSAAGATY+F LYS ++K +LGYDQTTLNLLSFFK
Sbjct  13   KLSMKSFAVQVLTGPWLIFFGSVLIMSAAGATYIFSLYSSEIKKSLGYDQTTLNLLSFFK  72

Query  324  DLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVA  503
            D+GSNVGVL+GL+ EVTPPW VL +GA LNFFGYFMMWLAVTK+I+ P+VWQMCLYIC+ 
Sbjct  73   DVGSNVGVLAGLMAEVTPPWFVLSVGAVLNFFGYFMMWLAVTKRIARPQVWQMCLYICIG  132

Query  504  GNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
             NSQ+FANTG+LVT VKNFP+SRGVVLG+LKG+VGLSGAILTQL+HA YG D
Sbjct  133  ANSQAFANTGSLVTCVKNFPKSRGVVLGILKGYVGLSGAILTQLYHAFYGDD  184



>ref|XP_008387534.1| PREDICTED: uncharacterized protein LOC103449994 [Malus domestica]
Length=612

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            GG     M S    ++ GRWFMVFA+ LI+S +GATYMFGLYS ++K +LGYDQTT+NLL
Sbjct  11   GGFGNKEMRSFGFQVLHGRWFMVFASMLILSMSGATYMFGLYSBEVKISLGYDQTTVNLL  70

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
            SFFKDLG NVG+++GLINEVT PWVVL IGA +NFFGYFM+W+AVT + S P+VWQMCLY
Sbjct  71   SFFKDLGGNVGIIAGLINEVTGPWVVLLIGALMNFFGYFMIWMAVTGRTSKPRVWQMCLY  130

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+  NSQ+F NTGA+V+ VKNFPESRG VLG+LKG VGLSGAI+TQLFHA YG D
Sbjct  131  ICIGANSQTFXNTGAVVSCVKNFPESRGSVLGILKGLVGLSGAIITQLFHAFYGND  186



>ref|XP_007027453.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY07955.1| Major facilitator superfamily protein [Theobroma cacao]
Length=611

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = +3

Query  126  FAG-GGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            F+G G +   M S  +++I GRWFMVFA+ LIMS +GATYMFGLYS  +K +LGYDQTTL
Sbjct  6    FSGVGCAWREMQSFGLNLIIGRWFMVFASLLIMSVSGATYMFGLYSTVIKSSLGYDQTTL  65

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            NLLSF KDLG NVGVLSGLINEVTPPWVVL IG+ +NFFGYFM+WLAVT + + P VWQM
Sbjct  66   NLLSFSKDLGGNVGVLSGLINEVTPPWVVLLIGSVMNFFGYFMIWLAVTGRTAKPHVWQM  125

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            C+YIC+  NSQ+FANTGALVT VKNFPESRG VLGLLK +VGLSGAILTQL+HA YG +
Sbjct  126  CVYICLGANSQAFANTGALVTCVKNFPESRGSVLGLLKSYVGLSGAILTQLYHAFYGEN  184



>ref|XP_011084395.1| PREDICTED: uncharacterized protein LOC105166653 [Sesamum indicum]
Length=588

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 150/183 (82%), Gaps = 3/183 (2%)
 Frame = +3

Query  120  VVFAGGGSRA---SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYD  290
            +V AG   R    S  +L + ++ GRWFMVFATTLIM  +GATYMFGLYS ++K  LGYD
Sbjct  1    MVLAGNHVRPRWPSTLALTLQVLTGRWFMVFATTLIMLTSGATYMFGLYSTEIKSNLGYD  60

Query  291  QTTLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPK  470
            QTTLN+LSFFKDLGSNVG+LS LINEVT PWVVL IGA LNFFGYFM+WLA++KKIS P 
Sbjct  61   QTTLNILSFFKDLGSNVGLLSSLINEVTSPWVVLSIGAALNFFGYFMIWLAISKKISRPH  120

Query  471  VWQMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVY  650
            VW MCLYI +  NSQS ANTGAL+TAVKNFPESRG VLGLLKGFV LSGAI+ Q++HA+Y
Sbjct  121  VWHMCLYIFIGANSQSSANTGALITAVKNFPESRGAVLGLLKGFVALSGAIIAQIYHAIY  180

Query  651  GTD  659
            G D
Sbjct  181  GND  183



>ref|XP_010933270.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Elaeis 
guineensis]
Length=626

 Score =   244 bits (623),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = +3

Query  120  VVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTT  299
            +V A GG RA    LAV +I+GRWFM FA+ LIM+A+GATY+F +YS D+K +LGYDQ+T
Sbjct  7    IVGATGGLRADAFRLAVQVIRGRWFMFFASFLIMAASGATYIFSIYSNDIKTSLGYDQST  66

Query  300  LNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQ  479
            LN LSFFKDLG+NVG+LSGLINEVTPPWVVL IG+ +N FGY M++ A+T +I+ P VWQ
Sbjct  67   LNTLSFFKDLGANVGILSGLINEVTPPWVVLAIGSVMNLFGYLMIYFAITGRIARPAVWQ  126

Query  480  MCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            MCLYIC+  NSQSFANTG+LVT VKNFPESRGVVLGLLKGFVGLSGAI TQL+ A+YG D
Sbjct  127  MCLYICIGANSQSFANTGSLVTCVKNFPESRGVVLGLLKGFVGLSGAIFTQLYSAIYGDD  186



>ref|XP_010050695.1| PREDICTED: uncharacterized protein LOC104439313 [Eucalyptus grandis]
 gb|KCW89358.1| hypothetical protein EUGRSUZ_A01654 [Eucalyptus grandis]
Length=629

 Score =   244 bits (622),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            SLA   + GRWFM FA  LIMS AGATY+F LYSGD+K +LGYDQT+LNLL FFKDLG+N
Sbjct  21   SLAARALLGRWFMAFAALLIMSVAGATYIFSLYSGDIKSSLGYDQTSLNLLGFFKDLGAN  80

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VG++SGL+NEVTPPWVVL IGA +NFFGYFM+WLAVT + + P++W MCLYIC+  NSQS
Sbjct  81   VGIVSGLVNEVTPPWVVLSIGAVMNFFGYFMIWLAVTGRSARPRLWLMCLYICIGANSQS  140

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTGALVTAVKNFPESRG +LGLLKGFVGLSGAIL QL+HA YG D
Sbjct  141  FANTGALVTAVKNFPESRGAILGLLKGFVGLSGAILAQLYHAFYGDD  187



>ref|XP_003521414.2| PREDICTED: uncharacterized protein LOC100797779 [Glycine max]
Length=616

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = +3

Query  126  FAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLN  305
            F  GG R  M +L+ H++ GRWFM+FA+ LIMS AGATYMFG+YS ++K +LGYDQ+TLN
Sbjct  36   FTSGGLRG-MKALSYHVLTGRWFMLFASLLIMSVAGATYMFGIYSNEVKTSLGYDQSTLN  94

Query  306  LLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMC  485
            LLSFFKDLG+NVGV+SGL+NEVTPP+VVL IG  +NFFGYFM++LAV+ +I  P+VWQMC
Sbjct  95   LLSFFKDLGANVGVISGLVNEVTPPFVVLSIGVIMNFFGYFMIFLAVSGRIDKPQVWQMC  154

Query  486  LYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYG  653
            LYIC+  NSQ+FANTGALVT VKNFP SRG +LG+LKG+VGLSGAI+TQL+HA YG
Sbjct  155  LYICIGANSQTFANTGALVTCVKNFPGSRGSILGILKGYVGLSGAIITQLYHAFYG  210



>gb|KEH44272.1| MFS transporter [Medicago truncatula]
Length=595

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            +L + +I GRWF+VFA+ LIMSA+GATYMFGLYS  +K +L YDQTTLNLLSFFKDLG N
Sbjct  16   NLIIQVITGRWFVVFASFLIMSASGATYMFGLYSSTIKTSLAYDQTTLNLLSFFKDLGGN  75

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            +GV SGLINE+TPP+VVL IG+ LNFFGYFM+WLAVTKKI  PKVWQMCLYIC+  NSQS
Sbjct  76   LGVFSGLINEITPPYVVLAIGSLLNFFGYFMIWLAVTKKIPKPKVWQMCLYICIGANSQS  135

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            F+NTG+LVT VKNFPE+RGVVLG+LKG+VGLSGAI+TQL+ A+Y  D
Sbjct  136  FSNTGSLVTCVKNFPETRGVVLGILKGYVGLSGAIITQLYSAIYFDD  182



>gb|KEH24041.1| MFS transporter [Medicago truncatula]
Length=618

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
             ++ GRWFM+FA++LIMS AGATYMFGLYS  +K +L YDQTTLNLLSFFKDLG+NVGV+
Sbjct  24   QLLTGRWFMLFASSLIMSVAGATYMFGLYSNQIKTSLSYDQTTLNLLSFFKDLGANVGVI  83

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGLINE+TPPWVVL  G  +NFFGYFM+WL+VTKKI TPKVWQMCLYIC+  NSQ+F NT
Sbjct  84   SGLINEITPPWVVLLTGTIMNFFGYFMIWLSVTKKIHTPKVWQMCLYICIGANSQTFTNT  143

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            GALVT VKNFP SRG VLGLLKG+VGLSGAI+TQ++H++Y  D
Sbjct  144  GALVTCVKNFPNSRGSVLGLLKGYVGLSGAIITQIYHSLYYGD  186



>ref|XP_007010014.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY18824.1| Major facilitator superfamily protein [Theobroma cacao]
Length=624

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
            +M S  V I+ G W MVF + LIMSAAGATYMF LYS ++K +LGYDQTTLNLLSFFKDL
Sbjct  13   NMKSFGVQILTGPWLMVFGSLLIMSAAGATYMFSLYSNEIKKSLGYDQTTLNLLSFFKDL  72

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGVLSGLI EVTPPW VL +GA LNFFGYFM+W+AV+K+I+  +VW MCLYIC+  N
Sbjct  73   GTNVGVLSGLIAEVTPPWFVLSVGAVLNFFGYFMIWMAVSKRIARTQVWHMCLYICIGAN  132

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQSFANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+HA YG D
Sbjct  133  SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGDD  182



>ref|XP_003554397.1| PREDICTED: uncharacterized protein LOC100818752 [Glycine max]
Length=581

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = +3

Query  126  FAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLN  305
            F  GG R  M + + H++ GRWFM+FA+ LIMS AGATYMFG+YS ++K +LGYDQ+TLN
Sbjct  6    FTSGGLRG-MKAFSYHVLTGRWFMLFASLLIMSVAGATYMFGIYSNEVKTSLGYDQSTLN  64

Query  306  LLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMC  485
            LLSFFKDLG+NVGV+SGL+NEVTPP+VVL IG  +NFFGYFM++LAV+ +I+ P+VWQMC
Sbjct  65   LLSFFKDLGANVGVISGLVNEVTPPFVVLSIGVIMNFFGYFMIFLAVSGRIAKPQVWQMC  124

Query  486  LYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            LYIC+  NSQ+FANTGALVT VKNFP SRG +LGLLKG+VGLSGAI+TQL+HA YG  
Sbjct  125  LYICIGANSQTFANTGALVTCVKNFPGSRGSILGLLKGYVGLSGAIITQLYHAFYGNH  182



>ref|XP_007204603.1| hypothetical protein PRUPE_ppa002810mg [Prunus persica]
 gb|EMJ05802.1| hypothetical protein PRUPE_ppa002810mg [Prunus persica]
Length=631

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = +3

Query  126  FAGGG-SRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            F GGG     M S  + ++ GRWFMVFA+ LI+S AGATYMF LYS D+K +LGYDQTT+
Sbjct  8    FGGGGLGHKEMRSFGLQVVHGRWFMVFASMLILSVAGATYMFALYSNDIKKSLGYDQTTI  67

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            NLLSFFKDLG NVGV++GLINE T PWVVL IGA +NFFGYFM+WLAVT + S P+VWQM
Sbjct  68   NLLSFFKDLGGNVGVIAGLINEFTAPWVVLLIGAVMNFFGYFMIWLAVTGRTSKPRVWQM  127

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            CLYIC+  NSQ+F+NTGA+V+ VKNFPESRG VLGLLKG VGLSGAI+TQLF A YG D
Sbjct  128  CLYICIGANSQTFSNTGAVVSCVKNFPESRGSVLGLLKGLVGLSGAIITQLFLAFYGRD  186



>ref|XP_008443577.1| PREDICTED: uncharacterized protein LOC103487133 [Cucumis melo]
Length=400

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  183  GRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVLSGLI  362
            GRWF VFA+ LIMS AGATYMF LYS D+K +LGYDQTTLNLLSFFKDLG NVGV+SGLI
Sbjct  21   GRWFSVFASILIMSVAGATYMFALYSSDIKSSLGYDQTTLNLLSFFKDLGGNVGVISGLI  80

Query  363  NEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANTGALV  542
            NEV P WVVL IGA +N FGY M+WLAVT +I  P++W MCLYIC+  NSQ+FANTGALV
Sbjct  81   NEVAPAWVVLLIGAVMNLFGYTMIWLAVTNRIPKPQIWHMCLYICLGANSQTFANTGALV  140

Query  543  TAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            T VKNFPESRG VLGLLKGFVGLSGAIL+QLFHA YG D
Sbjct  141  TCVKNFPESRGSVLGLLKGFVGLSGAILSQLFHAFYGND  179



>ref|XP_011018791.1| PREDICTED: uncharacterized protein LOC105121728 [Populus euphratica]
Length=607

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            GGG    M    + ++ GRWFMVFA+ LIM+ +GATYMF LYS D+K +LGYDQ+TLNLL
Sbjct  11   GGGGWREMKRFGLQVLLGRWFMVFASFLIMAMSGATYMFSLYSTDIKTSLGYDQSTLNLL  70

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
            SFFKD+G NVG+L G+INEV+PPWV+L  G  +NFFGYFM+WLA+T KI+ PKVWQMCLY
Sbjct  71   SFFKDVGGNVGLLPGVINEVSPPWVILSAGVVMNFFGYFMIWLAITGKIAKPKVWQMCLY  130

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+  NSQ+FA TGALVT VKNFPESRG VLGLLKGFVGLSGAI+TQ++HA YG D
Sbjct  131  ICIGANSQTFATTGALVTCVKNFPESRGSVLGLLKGFVGLSGAIMTQVYHAFYGDD  186



>gb|KJB36485.1| hypothetical protein B456_006G161500 [Gossypium raimondii]
Length=607

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = +3

Query  126  FAGGGSR-ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            F+GGG     + +  + +I GRWFMVFA+ LIMS +GATY+FGLYS  +K +LGYDQTTL
Sbjct  6    FSGGGCGWRDIKTFGLKLILGRWFMVFASLLIMSVSGATYIFGLYSNVIKTSLGYDQTTL  65

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            NLLSF KDLG NVG+LSGLINEVTPPWV+L IGA +NFFGYFM+WLAVT + + P VWQM
Sbjct  66   NLLSFSKDLGGNVGILSGLINEVTPPWVILLIGAVMNFFGYFMIWLAVTGRTAKPHVWQM  125

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            C+Y C+  NSQ+FANTGALVT VKNFPESRG VLGLLK +VGLSGAILTQL+HA YG +
Sbjct  126  CVYFCLGANSQAFANTGALVTCVKNFPESRGSVLGLLKSYVGLSGAILTQLYHAFYGDN  184



>ref|XP_004494077.1| PREDICTED: uncharacterized protein LOC101506073 [Cicer arietinum]
Length=588

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            S   H++ GRWFM+FA++LIMS AGATYMFGLYS  +K +L YDQTTLNLLSFFKDLG+N
Sbjct  6    SFTYHLLTGRWFMLFASSLIMSVAGATYMFGLYSNQIKTSLSYDQTTLNLLSFFKDLGAN  65

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGV+SGLINE+TPPWVVL  G  +NFFGYFM+WL+VTKKI  PKVW MCLYIC+  NSQ+
Sbjct  66   VGVISGLINEITPPWVVLSTGVIMNFFGYFMIWLSVTKKIHKPKVWLMCLYICIGANSQT  125

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVY  650
            F+NTGALVT VKNFP SRG VLG LKG+VGLSGAI+TQ++H++Y
Sbjct  126  FSNTGALVTCVKNFPNSRGSVLGFLKGYVGLSGAIITQIYHSLY  169



>ref|XP_011089957.1| PREDICTED: uncharacterized protein LOC105170752 [Sesamum indicum]
Length=579

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  135  GGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLS  314
             G RA + +  VH+I+GRWF +F++ LIM+ AGATY+FG+YS ++K  LGYDQTTLNLL 
Sbjct  7    AGRRAELLNFTVHVIRGRWFSLFSSFLIMAGAGATYLFGIYSKEIKATLGYDQTTLNLLG  66

Query  315  FFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYI  494
            FFKDLG+NVGVLSGLI EVTP W VL IG+ +NF GYFM+WLAVT +IS P VWQMC+YI
Sbjct  67   FFKDLGANVGVLSGLIAEVTPTWFVLLIGSAMNFTGYFMIWLAVTGQISRPAVWQMCIYI  126

Query  495  CVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            C+  NSQ+FANTGALVT+VKNFPESRG++LGLLKGF GLSGAILTQ++ AVYG D
Sbjct  127  CIGANSQNFANTGALVTSVKNFPESRGIMLGLLKGFTGLSGAILTQIYLAVYGND  181



>gb|KHN18681.1| Putative transporter MCH1 [Glycine soja]
Length=573

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M +L+ H++ GRWFM+FA+ LIMS AGATYMFG+YS ++K +LGYDQ+TLNLLSFFKDLG
Sbjct  1    MKALSYHVLTGRWFMLFASLLIMSVAGATYMFGIYSNEVKTSLGYDQSTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVGV+SGL+NEVTPP+VVL IG  +NFFGYFM++LAV+ +I  P+VWQMCLYIC+  NS
Sbjct  61   ANVGVISGLVNEVTPPFVVLSIGVIMNFFGYFMIFLAVSGRIDKPQVWQMCLYICIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYG  653
            Q+FANTGALVT VKNFP SRG +LG+LKG+VGLSGAI+TQL+HA YG
Sbjct  121  QTFANTGALVTCVKNFPGSRGSILGILKGYVGLSGAIITQLYHAFYG  167



>ref|XP_006369229.1| hypothetical protein POPTR_0001s19730g [Populus trichocarpa]
 gb|ERP65798.1| hypothetical protein POPTR_0001s19730g [Populus trichocarpa]
Length=323

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
              A+H I GRWF VFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+N
Sbjct  6    EFAIHAINGRWFSVFASFLIMAGAGATYLFGTYSKDIKATLGYDQTTLNLLGFFKDLGAN  65

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGV SGL+ EVTP W VL +G+ +NF GYFM+WLA+T+KI+ P VWQMCLYIC+  NSQ+
Sbjct  66   VGVFSGLLAEVTPTWFVLLVGSAMNFAGYFMIWLAMTQKIARPVVWQMCLYICIGANSQN  125

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTGALVT VKNFPESRGV+LGLLKGFVGLSGAILTQ + A+YGTD
Sbjct  126  FANTGALVTCVKNFPESRGVMLGLLKGFVGLSGAILTQFYLAIYGTD  172



>gb|EYU36146.1| hypothetical protein MIMGU_mgv1a018039mg [Erythranthe guttata]
Length=583

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            GG     + + A H+++GRWF +FA+ L+M+ AGATY+FG+YS D+K +LGYDQTTLNLL
Sbjct  11   GGRRGGDLLAFAAHVLRGRWFSLFASFLVMAGAGATYLFGVYSKDIKSSLGYDQTTLNLL  70

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
             FFKDLG+NVGVLSGLI EVTP W VL IG+ +NF GYFM+WL+VT K+S P+VWQMCLY
Sbjct  71   GFFKDLGANVGVLSGLIAEVTPTWFVLLIGSAMNFAGYFMIWLSVTGKVSKPRVWQMCLY  130

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+  NSQ+FANTGALVT+V+NFPESRGV+LGLLKGF GLSGAILTQ++ AVYG D
Sbjct  131  ICIGANSQNFANTGALVTSVRNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGND  186



>ref|XP_004249478.1| PREDICTED: uncharacterized protein LOC101244136 [Solanum lycopersicum]
Length=581

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  135  GGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLS  314
            GG +A+M   ++H +  +WFMVFA+ LIMS AGATY+F LYS ++K +LGYDQTTLNLLS
Sbjct  8    GGYKANMIGFSIHFLMSKWFMVFASLLIMSMAGATYLFSLYSNEIKSSLGYDQTTLNLLS  67

Query  315  FFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYI  494
            FFKDLG NVG++SG INEVTP WVVL +GA +NFFGYFM+WLA+  +I+ P VWQMC YI
Sbjct  68   FFKDLGGNVGMISGFINEVTPAWVVLLMGAIMNFFGYFMVWLAIVGRIAKPPVWQMCFYI  127

Query  495  CVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            C+  +SQ+FANTG LVT VKNFPESRG+VLGLLKGFVGLSGAI+TQL+HA YG D
Sbjct  128  CIGASSQTFANTGVLVTCVKNFPESRGIVLGLLKGFVGLSGAIITQLYHAFYGND  182



>ref|XP_010557355.1| PREDICTED: uncharacterized protein LOC104826384 [Tarenaya hassleriana]
Length=578

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +3

Query  135  GGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLS  314
            G     +    VH+  GRWFMVFA+ LIM+ AGATY+FG YS ++K  LGYDQTTLNLL 
Sbjct  4    GIESGEIPRFVVHLFNGRWFMVFASFLIMACAGATYLFGTYSKEIKATLGYDQTTLNLLG  63

Query  315  FFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYI  494
            FFKDLG+NVGVLSGLI EVTP W VL +G+ +NF GYFM+WLAVT KI+ PKVWQMCLYI
Sbjct  64   FFKDLGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFMIWLAVTGKIAKPKVWQMCLYI  123

Query  495  CVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            C+  NSQ+FANTGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YGTD
Sbjct  124  CIGANSQNFANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYLAIYGTD  178



>ref|XP_009368999.1| PREDICTED: uncharacterized protein LOC103958461 [Pyrus x bretschneideri]
 ref|XP_009369009.1| PREDICTED: uncharacterized protein LOC103958473 [Pyrus x bretschneideri]
Length=598

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            GG   ++  +L + ++ GRWF VFA+ LIMSA+GATYMFGLYS D+K  LGYDQ+TLNLL
Sbjct  8    GGWEWSNTKTLTLQVLNGRWFTVFASLLIMSASGATYMFGLYSSDIKSVLGYDQSTLNLL  67

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
            S FKD GSNVGVLSGLINEVTPPWVVL +G  LNFFGYFM+W+AVTKKI+ P+VW MC+Y
Sbjct  68   SLFKDFGSNVGVLSGLINEVTPPWVVLSVGGILNFFGYFMIWMAVTKKIAKPQVWHMCMY  127

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+   SQSFANTG+L+T+VKNFPESRG VLG LKG+ GLSG+I TQL+ A Y  D
Sbjct  128  ICMGATSQSFANTGSLITSVKNFPESRGSVLGFLKGYAGLSGSIFTQLYSAFYYDD  183



>ref|XP_008241388.1| PREDICTED: uncharacterized protein LOC103339814 [Prunus mume]
Length=631

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M S  + ++ GRWFMVFA+ LI+S AGATYMFGLYS D+K +LGYDQTT+NLLSFFKDL
Sbjct  17   EMRSFGLQVVHGRWFMVFASMLILSVAGATYMFGLYSNDIKTSLGYDQTTVNLLSFFKDL  76

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G NVGV++GLINE T PWVVL IGA +NFFGYFM+WLAVT + S P+VWQMCLYIC+  N
Sbjct  77   GGNVGVIAGLINEFTAPWVVLLIGAVMNFFGYFMIWLAVTGRTSKPRVWQMCLYICIGAN  136

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+F+NTGA+V+ VKNFPESRG VLGLLKG VGLSGAI+TQLF A YG D
Sbjct  137  SQTFSNTGAVVSCVKNFPESRGSVLGLLKGLVGLSGAIITQLFSAFYGGD  186



>ref|XP_006838710.1| PREDICTED: uncharacterized protein LOC18429361 [Amborella trichopoda]
 gb|ERN01279.1| hypothetical protein AMTR_s00002p00250920 [Amborella trichopoda]
Length=590

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 149/173 (86%), Gaps = 2/173 (1%)
 Frame = +3

Query  147  ASMGSL--AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFF  320
            A MG+L  A+ +++GRWFM FA+ LIMSAAGATY+FG+YS D+K +LGY Q  LN LSFF
Sbjct  2    AEMGALGVALAVVRGRWFMFFASFLIMSAAGATYIFGVYSEDIKSSLGYTQQNLNTLSFF  61

Query  321  KDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICV  500
            KDLG+NVGV+SGLINEVTPPWVVL +G  +N  GY M+WLAVT +I TPK+W MC+YICV
Sbjct  62   KDLGANVGVISGLINEVTPPWVVLAMGGVMNLGGYLMIWLAVTDRIPTPKLWHMCVYICV  121

Query  501  AGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
              NSQSFANTGALVTAVKNFPESRG+VLGLLKGFVGLSGAI+TQL+HA+YG D
Sbjct  122  GANSQSFANTGALVTAVKNFPESRGIVLGLLKGFVGLSGAIITQLYHALYGHD  174



>ref|XP_011094591.1| PREDICTED: uncharacterized protein LOC105174255 [Sesamum indicum]
Length=568

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            MV+     S  +  SL + ++  RWFMVFA  LIMS +GATY+FG+YS D+K +LGYDQT
Sbjct  1    MVMAEHSRSGGAAPSLGLEVLTSRWFMVFACLLIMSMSGATYIFGIYSNDIKTSLGYDQT  60

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNL+ FFKDLG N+GV+SG+INEVTPPWVVL IG  +NF GYFM+WLAVT +I+ P+VW
Sbjct  61   TLNLIGFFKDLGGNIGVMSGVINEVTPPWVVLAIGVAMNFSGYFMIWLAVTGRIAKPRVW  120

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
            +MCLYIC+  NSQ+F+NTGALVT VKNFPESRG+V+GLLKGF GLSGAI+TQLFHA YG 
Sbjct  121  EMCLYICIGANSQTFSNTGALVTCVKNFPESRGIVIGLLKGFTGLSGAIITQLFHAFYGH  180

Query  657  D  659
            +
Sbjct  181  N  181



>ref|XP_012080987.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Jatropha 
curcas]
 gb|KDP30493.1| hypothetical protein JCGZ_16172 [Jatropha curcas]
Length=599

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A M +L V  I GRWFMVFA+ +IM+A+GATYMFGLYS D+K ALGYDQTTL LLSFFKD
Sbjct  16   ADMKNLTVQAIAGRWFMVFASLVIMAASGATYMFGLYSNDIKTALGYDQTTLTLLSFFKD  75

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LGS++GV SGLINEVT PWVVL +GA LNFFGYFM+WLAVT KIS   VW MCLYI +  
Sbjct  76   LGSSLGVFSGLINEVTSPWVVLSMGAVLNFFGYFMIWLAVTGKISGVHVWHMCLYIYIGA  135

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQ+FANTG+LVT VKNFPESRG V+G+LKG+VGLSGAI+TQ+++AVYG D
Sbjct  136  NSQAFANTGSLVTCVKNFPESRGAVIGILKGYVGLSGAIITQIYYAVYGDD  186



>ref|XP_012080986.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like isoform X2 
[Jatropha curcas]
Length=573

 Score =   238 bits (606),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  141  SRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFF  320
            S A M +L V +I GRWFMVFA+ +IM+A+GATYMFGLYS D+K ALGYDQT L LLSFF
Sbjct  14   SLADMKNLTVQVINGRWFMVFASFVIMAASGATYMFGLYSNDIKTALGYDQTKLTLLSFF  73

Query  321  KDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICV  500
            KDLGS++GV SGLINE+TPPWVVL +GA LNFFGYFM+WLAV+ KIS    W MCLYI +
Sbjct  74   KDLGSSLGVFSGLINELTPPWVVLSMGAVLNFFGYFMIWLAVSGKISGVHFWHMCLYIYI  133

Query  501  AGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
              NSQ+FANTG+LVT VK FPESRG V+ +LKG+VGLSGAI+TQ++HA+YG D
Sbjct  134  GANSQAFANTGSLVTCVKTFPESRGAVIVILKGYVGLSGAIITQIYHAIYGDD  186



>emb|CBI30156.3| unnamed protein product [Vitis vinifera]
Length=601

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  195  MVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVLSGLINEVT  374
            MVFA+ LIMS AGATYMF LYSG++K +LGYDQTTLNLLSFFKDLG NVGVLSGLINEVT
Sbjct  1    MVFASLLIMSVAGATYMFSLYSGEIKTSLGYDQTTLNLLSFFKDLGGNVGVLSGLINEVT  60

Query  375  PPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANTGALVTAVK  554
            PPWVVL IGA +NFFGYFM+WLAVT +I+ P++WQMCLYIC+  NSQSFANTGALVT V+
Sbjct  61   PPWVVLCIGAVMNFFGYFMIWLAVTDRIAKPQIWQMCLYICIGANSQSFANTGALVTCVR  120

Query  555  NFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NFPESRG+VLGLLKGFVGLSGAI+TQL+ A YG D
Sbjct  121  NFPESRGIVLGLLKGFVGLSGAIITQLYRAFYGDD  155



>ref|XP_008379735.1| PREDICTED: uncharacterized protein LOC103442697 [Malus domestica]
Length=610

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            GG   ++  +L + ++ GRWF VFA+ LIMSA+GATYMFGLYS D+K  LGYDQ+TLNLL
Sbjct  8    GGWEXSNTKTLTLQVLNGRWFTVFASLLIMSASGATYMFGLYSSDIKSVLGYDQSTLNLL  67

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
            S FKD GSNVGVLSGLINEVT PWVVL +G  LNFFGYFM+W+AVTKKI+ P+VW MC+Y
Sbjct  68   SLFKDFGSNVGVLSGLINEVTSPWVVLSVGGVLNFFGYFMIWMAVTKKIAKPQVWHMCMY  127

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+   SQSFANTG+L+T+VKNFPESRG VLG LKG+ GLSGAI TQL+ A Y  D
Sbjct  128  ICMGATSQSFANTGSLITSVKNFPESRGSVLGFLKGYAGLSGAIFTQLYSAFYYDD  183



>ref|XP_006295838.1| hypothetical protein CARUB_v10024965mg [Capsella rubella]
 gb|EOA28736.1| hypothetical protein CARUB_v10024965mg [Capsella rubella]
Length=583

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H++ GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  11   IHLLNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  70

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGLI EVTP W VL IG+ +NF GYFM+WL VT K++ PKVWQMCLYIC+  NSQ+FAN
Sbjct  71   LSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQNFAN  130

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YG D
Sbjct  131  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGND  174



>ref|XP_011089961.1| PREDICTED: uncharacterized protein LOC105170755 [Sesamum indicum]
Length=573

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = +3

Query  138  GSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSF  317
            G R+ + S AVH+I+GRWF +FA+ LIM+ AGATY+FG+YS ++K  LGYDQTTLNLL  
Sbjct  8    GRRSQLMSFAVHVIRGRWFSLFASFLIMAGAGATYLFGVYSNEIKATLGYDQTTLNLLGS  67

Query  318  FKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYIC  497
            FKDLG+NVGVLSGLI EVTP W +L IGA +NF GYFM+WLAVT KIS P VWQMC+YIC
Sbjct  68   FKDLGANVGVLSGLIAEVTPTWFLLLIGAAMNFAGYFMIWLAVTGKISRPAVWQMCIYIC  127

Query  498  VAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            +  NSQ+FANTGALVT+VKNFP SRG++LGLLKGF GLSGAILTQ++ AVYG D
Sbjct  128  IGANSQNFANTGALVTSVKNFPVSRGIMLGLLKGFTGLSGAILTQIYLAVYGND  181



>ref|XP_012080985.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like isoform X1 
[Jatropha curcas]
 gb|KDP30492.1| hypothetical protein JCGZ_16171 [Jatropha curcas]
Length=605

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  141  SRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFF  320
            S A M +L V +I GRWFMVFA+ +IM+A+GATYMFGLYS D+K ALGYDQT L LLSFF
Sbjct  14   SLADMKNLTVQVINGRWFMVFASFVIMAASGATYMFGLYSNDIKTALGYDQTKLTLLSFF  73

Query  321  KDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICV  500
            KDLGS++GV SGLINE+TPPWVVL +GA LNFFGYFM+WLAV+ KIS    W MCLYI +
Sbjct  74   KDLGSSLGVFSGLINELTPPWVVLSMGAVLNFFGYFMIWLAVSGKISGVHFWHMCLYIYI  133

Query  501  AGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
              NSQ+FANTG+LVT VK FPESRG V+ +LKG+VGLSGAI+TQ++HA+YG D
Sbjct  134  GANSQAFANTGSLVTCVKTFPESRGAVIVILKGYVGLSGAIITQIYHAIYGDD  186



>ref|XP_010414589.1| PREDICTED: uncharacterized protein LOC104700725 isoform X1 [Camelina 
sativa]
 ref|XP_010414590.1| PREDICTED: uncharacterized protein LOC104700725 isoform X2 [Camelina 
sativa]
Length=572

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+  GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  11   IHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  70

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGLI EVTP W VL IG+ +NF GYFM+WL VT K++ PKVWQMCLYIC+  NSQ+FAN
Sbjct  71   LSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQNFAN  130

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YG D
Sbjct  131  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGND  174



>ref|XP_010510684.1| PREDICTED: uncharacterized protein LOC104786910 isoform X1 [Camelina 
sativa]
 ref|XP_010510685.1| PREDICTED: uncharacterized protein LOC104786910 isoform X2 [Camelina 
sativa]
 ref|XP_010510687.1| PREDICTED: uncharacterized protein LOC104786910 isoform X3 [Camelina 
sativa]
Length=572

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+  GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  11   IHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  70

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGLI EVTP W VL IG+ +NF GYFM+WL VT K++ PKVWQMCLYIC+  NSQ+FAN
Sbjct  71   LSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQNFAN  130

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YG D
Sbjct  131  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGND  174



>emb|CDY30506.1| BnaA04g16270D [Brassica napus]
Length=566

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+  GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  12   IHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  71

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            +SGLI EVTP W VL +G+ +NF GYFM+WL VT K+S PKVWQMCLYIC+  NSQ+FAN
Sbjct  72   MSGLIAEVTPTWFVLTVGSAMNFVGYFMIWLTVTGKVSKPKVWQMCLYICIGANSQNFAN  131

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YG D
Sbjct  132  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGND  175



>ref|XP_010470138.1| PREDICTED: uncharacterized protein LOC104750092 [Camelina sativa]
Length=570

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+  GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  11   IHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  70

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGLI EVTP W VL IG+ +NF GYFM+WL VT K++ PK+WQMCLYIC+  NSQ+FAN
Sbjct  71   LSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKIWQMCLYICIGANSQNFAN  130

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YG D
Sbjct  131  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGND  174



>ref|XP_002880951.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57210.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=573

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H   GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  11   IHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  70

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGLI EVTP W VL IG+ +NF GYFM+WL VT K++ PKVWQMCLYIC+  NSQ+FAN
Sbjct  71   LSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQNFAN  130

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAILTQL+ A+YG D
Sbjct  131  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAILTQLYFAIYGHD  174



>dbj|BAO45884.1| nitrate and chloride transporter [Acacia mangium]
Length=630

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 156/187 (83%), Gaps = 6/187 (3%)
 Frame = +3

Query  117  MVVFAGGGS-RASMG-----SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDA  278
            MVV AGG   R ++G      LA+ +I  RWF+VFA+ L+M+AAGATYMFGLYS D+K A
Sbjct  1    MVVVAGGSPVRGALGWSDVKGLAIQVILSRWFVVFASFLVMAAAGATYMFGLYSPDIKSA  60

Query  279  LGYDQTTLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKI  458
            +GYDQTTLNLLSFFKD+G+NVGVLSGLINE+TPPWVVL IGA LNFFGYFM+WLAVT+KI
Sbjct  61   MGYDQTTLNLLSFFKDVGANVGVLSGLINELTPPWVVLMIGAVLNFFGYFMIWLAVTQKI  120

Query  459  STPKVWQMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLF  638
              PKV  M LYI +  NSQ+FANTG+LVT VKNFPESRGVVLG+LKG+VGLSGAI+TQL+
Sbjct  121  PKPKVGLMYLYILIGANSQTFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLY  180

Query  639  HAVYGTD  659
            +A Y  D
Sbjct  181  YAFYYDD  187



>ref|XP_009140846.1| PREDICTED: uncharacterized protein LOC103864824 [Brassica rapa]
Length=581

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+  GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  12   IHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  71

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            +SGLI EVTP W VL +G+ +NF GYFM+WL VT K+S PKVWQMCLYIC+  NSQ+FAN
Sbjct  72   MSGLIAEVTPTWFVLTVGSAMNFVGYFMIWLTVTGKVSKPKVWQMCLYICIGANSQNFAN  131

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YG D
Sbjct  132  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGND  175



>ref|XP_006339088.1| PREDICTED: uncharacterized protein LOC102588077 [Solanum tuberosum]
Length=567

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M   ++H +  +WFMVFA+ LIMS AGATY+F LYS ++K +LGYDQTTLNLLSFFKDLG
Sbjct  1    MLGFSIHFLMSKWFMVFASLLIMSMAGATYLFSLYSNEIKSSLGYDQTTLNLLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
             NVG++SG INEVTPPWVVL +GA +NFFGYFM+WLA+  +I+ P VWQMC YIC+  +S
Sbjct  61   GNVGMISGFINEVTPPWVVLLMGAIMNFFGYFMVWLAIIGRIAKPPVWQMCFYICIGASS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Q+FANTG LVT VKNFPESRG+VLGLLKGFVGLSGAI+TQL+HA YG D
Sbjct  121  QTFANTGVLVTCVKNFPESRGIVLGLLKGFVGLSGAIITQLYHAFYGND  169



>ref|XP_006409833.1| hypothetical protein EUTSA_v10016458mg [Eutrema salsugineum]
 gb|ESQ51286.1| hypothetical protein EUTSA_v10016458mg [Eutrema salsugineum]
Length=560

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+  GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  16   IHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  75

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            +SGLI EVTP W VL IG+ +NF GYFM+WL VT K++ PKVWQMCLYIC+  NSQ+FAN
Sbjct  76   MSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVARPKVWQMCLYICIGANSQNFAN  135

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YG D
Sbjct  136  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGND  179



>ref|XP_008348275.1| PREDICTED: uncharacterized protein LOC103411418 [Malus domestica]
Length=402

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  141  SRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFF  320
            S   M  L + +++GRW MVFA+ L+M  AGA+YMFGLYS D+K  LGYDQT LNL+SFF
Sbjct  5    SCVDMKGLVLQVLKGRWLMVFASFLMMVTAGASYMFGLYSNDIKSVLGYDQTXLNLISFF  64

Query  321  KDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICV  500
            KDLG N+G+ SGLINEVTPPWV L IGA LNFFG+FM+WLAVT+KI  PKVW MC+YI +
Sbjct  65   KDLGGNIGIFSGLINEVTPPWVALSIGAVLNFFGHFMIWLAVTQKIPKPKVWHMCMYISI  124

Query  501  AGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
              NS +F NTGALVT VKNFPESRGVVLGLLK + G+S A++ QL+HA YG D
Sbjct  125  GSNSHTFTNTGALVTCVKNFPESRGVVLGLLKSYTGISAAVIAQLYHAAYGDD  177



>ref|XP_007208506.1| hypothetical protein PRUPE_ppa026488mg [Prunus persica]
 gb|EMJ09705.1| hypothetical protein PRUPE_ppa026488mg [Prunus persica]
Length=577

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = +3

Query  129  AGGGSR--ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            A  GSR  + +   AVH++QGRWF VFA+ LIM+ AGATY+FG+YS  +K +LGYDQTTL
Sbjct  9    ASNGSRKNSELLPFAVHVVQGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTL  68

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            NLL FFKDLG+NVGVLSGLI EVTP W VL IG+ +NF GYFM+WLAVT KI  PKVW M
Sbjct  69   NLLGFFKDLGANVGVLSGLIGEVTPTWFVLLIGSAMNFAGYFMIWLAVTAKIPKPKVWHM  128

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            CLYIC+  NSQ+FANTGALVT VKNFP SRGV+LGLLKGF GLSGAI TQ++ AVYG +
Sbjct  129  CLYICIGANSQNFANTGALVTCVKNFPASRGVMLGLLKGFTGLSGAIFTQIYLAVYGNN  187



>ref|XP_012064708.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Jatropha 
curcas]
Length=561

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            + AVH+I GRWF VFA+ LIM+ AGATY+FG YS D+K+ LGYDQ+TLNL+ FFKDLG+N
Sbjct  6    AFAVHVINGRWFSVFASFLIMAGAGATYLFGTYSKDIKETLGYDQSTLNLIGFFKDLGAN  65

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            +GVLSGLI EVTP W VL IG+ +NF GYFM+WL VT+KI+ P++WQMCLYIC+  NSQ+
Sbjct  66   IGVLSGLIAEVTPTWFVLLIGSAMNFIGYFMIWLVVTRKIAKPEIWQMCLYICIGANSQN  125

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTGALVT V NFPESRGV+LGLLKGFVGLSGAI+TQL+ A+YG D
Sbjct  126  FANTGALVTCVLNFPESRGVMLGLLKGFVGLSGAIMTQLYLAIYGND  172



>gb|KFK32342.1| hypothetical protein AALP_AA6G229300 [Arabis alpina]
Length=578

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = +3

Query  132  GGGSRASMGSLA--VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLN  305
            G G+  S  ++   +HI  GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLN
Sbjct  2    GNGNHQSNETVRFLIHIFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLN  61

Query  306  LLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMC  485
            L+ FFKDLG+NVGV+SGLI EVTP W VL IG+ +NF GYFM+WL+VT K++ PKVWQMC
Sbjct  62   LMGFFKDLGANVGVMSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLSVTGKVAKPKVWQMC  121

Query  486  LYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            LYIC+  NSQ+FANTGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YG D
Sbjct  122  LYICIGANSQNFANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYLAIYGHD  179



>emb|CDX77158.1| BnaC04g39530D [Brassica napus]
Length=548

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+  GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  12   IHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  71

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            +SGLI EVTP W VL +G+ +NF GYFM+WL VT K++ PKVWQMCLYIC+  NSQ+FAN
Sbjct  72   MSGLIAEVTPTWFVLTVGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQNFAN  131

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI+TQL+ A+YG D
Sbjct  132  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGND  175



>ref|XP_007208449.1| hypothetical protein PRUPE_ppa003535mg [Prunus persica]
 gb|EMJ09648.1| hypothetical protein PRUPE_ppa003535mg [Prunus persica]
Length=567

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            AV +I+GRWF VFA+ LIM+ AGATY+FG+YS D+K  LGYDQTTLNLL FFKDLG+NVG
Sbjct  21   AVQVIKGRWFTVFASFLIMAGAGATYLFGVYSKDIKSTLGYDQTTLNLLGFFKDLGANVG  80

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLI EVTP W VL +G+ +NF GYFM+WL+VT+KI+ PKVWQMCLYIC+  NSQ+FA
Sbjct  81   VLSGLIGEVTPAWFVLLVGSAMNFAGYFMIWLSVTEKIAKPKVWQMCLYICLGANSQNFA  140

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRGV+LGLLKGF GLSGAI TQL+ A+Y  D
Sbjct  141  NTGALVTCVKNFPESRGVMLGLLKGFTGLSGAIFTQLYLAIYPND  185



>ref|XP_006381386.1| hypothetical protein POPTR_0006s12430g [Populus trichocarpa]
 gb|ERP59183.1| hypothetical protein POPTR_0006s12430g [Populus trichocarpa]
Length=610

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             M    + ++ GRWFMVFA+ LIM+ +GATYMF LYS D+K +LGYDQ+TLNLLSFFKD+
Sbjct  20   EMKRFGLQVLLGRWFMVFASFLIMAMSGATYMFSLYSTDIKRSLGYDQSTLNLLSFFKDV  79

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G NVG+L G+INEV+PPWV+L  G  +NFFGYFM+WLA+T KI+ PKVWQMCLYIC+  N
Sbjct  80   GGNVGLLPGVINEVSPPWVILSAGVVMNFFGYFMIWLAITGKIAKPKVWQMCLYICIGAN  139

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+FA TGALVT VKNFPESRG VLGLLKGFVGLSGAI+TQ++HA YG D
Sbjct  140  SQTFATTGALVTCVKNFPESRGSVLGLLKGFVGLSGAIMTQVYHAFYGDD  189



>ref|XP_010111839.1| hypothetical protein L484_020631 [Morus notabilis]
 gb|EXC31804.1| hypothetical protein L484_020631 [Morus notabilis]
Length=573

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            A +   AVH+I+GRWF VFA+ LIM  AGATY+FG+YS  +K +LGYDQ TLNL+ FFKD
Sbjct  2    AELLRFAVHVIKGRWFSVFASFLIMFGAGATYLFGVYSKQIKSSLGYDQKTLNLIGFFKD  61

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVGVLSGLI EVTP W VL IG+ +NF GYFM+WLAVT KI+ PKVWQMCLYIC+  
Sbjct  62   LGANVGVLSGLIAEVTPTWFVLLIGSAMNFAGYFMIWLAVTGKIAKPKVWQMCLYICIGA  121

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQ+FANTGALVT VKNFPESRGVVLGLLKGFVGLSGA++TQL+ A+YG D
Sbjct  122  NSQNFANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAVMTQLYLAIYGDD  172



>ref|XP_008443578.1| PREDICTED: uncharacterized protein LOC103487134 [Cucumis melo]
Length=342

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
            H++ GRWF VFA+ LIMS +GATYMFGLYS  +K +L YDQTTLNLLSFFKDLG+N+GV+
Sbjct  11   HLLFGRWFSVFASILIMSVSGATYMFGLYSSHIKSSLAYDQTTLNLLSFFKDLGANIGVI  70

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGL+NEV P WVVL IG  +N FGY M+WLAVT +I  P++W MCLYIC+  NSQ+FANT
Sbjct  71   SGLVNEVAPAWVVLLIGVVMNLFGYTMIWLAVTNRIPNPQIWHMCLYICIGANSQTFANT  130

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
             AL+T VKNFPESRG +LGL KGFVGLSGAIL+QLFHA YG +
Sbjct  131  AALITCVKNFPESRGSILGLFKGFVGLSGAILSQLFHAFYGNN  173



>ref|XP_010691116.1| PREDICTED: uncharacterized protein LOC104904540 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  135  GGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLS  314
            GG        A+ +I GRWFMVF+T L+MSAAGATYMFG YS D+K +LGYDQ+TLNLLS
Sbjct  5    GGGSGGWPHFAIRVITGRWFMVFSTLLVMSAAGATYMFGSYSPDIKKSLGYDQSTLNLLS  64

Query  315  FFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYI  494
            FFKDLGS VG+ SGL+ E+ PPWVVL +GA LNFFGYFM+WLAV+  I+ P VWQMCLYI
Sbjct  65   FFKDLGSTVGIPSGLLMEIAPPWVVLAVGAVLNFFGYFMVWLAVSGHIARPAVWQMCLYI  124

Query  495  CVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYG  653
            CV  NSQ+FANTGALVT VKNFPESRGVVLGLLKGFVGLSGAI+TQ + A+YG
Sbjct  125  CVGANSQAFANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIITQFYFALYG  177



>ref|XP_006384953.1| nodulin family protein [Populus trichocarpa]
 gb|ABK95139.1| unknown [Populus trichocarpa]
 gb|ERP62750.1| nodulin family protein [Populus trichocarpa]
Length=559

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
              AVH I GRWF VFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+N
Sbjct  6    EFAVHAINGRWFSVFASFLIMAGAGATYLFGTYSKDIKATLGYDQTTLNLLGFFKDLGAN  65

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGV SGL+ EVTP W VL +G+ +NF GYFM+WLAVT+KI+ P VWQMCLYIC+  NSQ+
Sbjct  66   VGVFSGLLAEVTPTWFVLLVGSAMNFAGYFMIWLAVTQKIARPAVWQMCLYICIGANSQN  125

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTGALVT VKNFPESRGV+LGLLKGFVGLSGAILTQ + A+YGTD
Sbjct  126  FANTGALVTCVKNFPESRGVMLGLLKGFVGLSGAILTQFYLAIYGTD  172



>ref|XP_008227863.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Prunus 
mume]
Length=567

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            AV +I+GRWF VFA+ LIM+ AGATY+FG+YS D+K  LGYDQTTLNLL FFKDLG+NVG
Sbjct  21   AVQVIKGRWFTVFASFLIMAGAGATYLFGVYSKDIKSTLGYDQTTLNLLGFFKDLGANVG  80

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLI EVTP W VL +G+ +NF GYFM+WL+VT+KI+ PKVWQMCLYIC+  NSQ+FA
Sbjct  81   VLSGLIGEVTPAWFVLLVGSAMNFAGYFMIWLSVTEKIAKPKVWQMCLYICLGANSQNFA  140

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRGV+LGLLKGF GLSGAI TQ++ A+Y  D
Sbjct  141  NTGALVTCVKNFPESRGVMLGLLKGFTGLSGAIFTQIYLAIYPND  185



>ref|NP_180379.1| major facilitator protein [Arabidopsis thaliana]
 gb|AAC98454.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAL14413.1| At2g28120/F24D13.9 [Arabidopsis thaliana]
 gb|AAL32615.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAM13326.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC08082.1| major facilitator protein [Arabidopsis thaliana]
Length=577

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H   GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  11   IHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  70

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGLI EVTP W VL IG+ +NF GYFM+WL VT K++ PKVWQMCLYIC+  NSQ+FAN
Sbjct  71   LSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQNFAN  130

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI TQL+ A+YG D
Sbjct  131  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYFAIYGHD  174



>ref|XP_008226501.1| PREDICTED: uncharacterized protein LOC103326070 [Prunus mume]
Length=577

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = +3

Query  129  AGGGSR--ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            A  GSR  + +   AVH+++GRWF VFA+ LIM+ AGATY+FG+YS  +K +LGYDQTTL
Sbjct  9    ASNGSRKNSELLPFAVHVVRGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTL  68

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            NLL FFKDLG+NVGVLSGLI EVTP W VL IG+ +NF GYFM+WLAVT KI  PKVW M
Sbjct  69   NLLGFFKDLGANVGVLSGLIGEVTPTWFVLLIGSAMNFAGYFMIWLAVTAKIPKPKVWHM  128

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            CLYIC+  NSQ+FANTGALVT VKNFP SRGV+LGLLKGF GLSGAI TQ++ AVYG +
Sbjct  129  CLYICIGANSQNFANTGALVTCVKNFPASRGVMLGLLKGFTGLSGAIFTQIYLAVYGNN  187



>emb|CDP07039.1| unnamed protein product [Coffea canephora]
Length=593

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = +3

Query  138  GSRASMGSL--AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            G R   G++  AVH+++GRWF +FA+ LIM+ AGATY+FG YS ++K +LGYDQTTLNLL
Sbjct  13   GHRGGHGAIPFAVHVVRGRWFSLFASFLIMAGAGATYLFGTYSKEIKSSLGYDQTTLNLL  72

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
             FFKD G+NVGVLSGLI+EV P W+VL IGA +NF GYFM+WLAVT +I+ PKVW MC+Y
Sbjct  73   GFFKDFGANVGVLSGLIDEVVPTWLVLLIGAGMNFAGYFMIWLAVTGRIAKPKVWMMCIY  132

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            ICV  NSQ+FANTGALVT+VKNFPESRG+++GLLKGF GLSGAILTQ++ AVYG D
Sbjct  133  ICVGANSQNFANTGALVTSVKNFPESRGIMIGLLKGFTGLSGAILTQVYLAVYGND  188



>ref|XP_009103645.1| PREDICTED: uncharacterized membrane protein YMR155W [Brassica 
rapa]
Length=572

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H   GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  16   IHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  75

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            +SGLI EVTP W VL IG+ +NF GYFM+WL VT K++ P+VWQMCLYIC+  NSQ+FAN
Sbjct  76   MSGLIAEVTPTWFVLVIGSAMNFVGYFMIWLTVTGKVAKPRVWQMCLYICIGANSQNFAN  135

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI TQL+ A+YG D
Sbjct  136  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYFAIYGND  179



>emb|CDY04538.1| BnaA07g13640D [Brassica napus]
Length=572

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H   GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  16   IHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  75

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            +SGLI EVTP W VL IG+ +NF GYFM+WL VT K++ P+VWQMCLYIC+  NSQ+FAN
Sbjct  76   MSGLIAEVTPTWFVLVIGSAMNFVGYFMIWLTVTGKVAKPRVWQMCLYICIGANSQNFAN  135

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI TQL+ A+YG D
Sbjct  136  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYFAIYGND  179



>emb|CDX71381.1| BnaC04g16160D [Brassica napus]
Length=572

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H   GRWFMVFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  16   IHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVGV  75

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            +SGLI EVTP W VL IG+ +NF GYFM+WL VT K++ P+VWQMCLYIC+  NSQ+FAN
Sbjct  76   MSGLIAEVTPTWFVLVIGSAMNFVGYFMIWLTVTGKVAKPRVWQMCLYICIGANSQNFAN  135

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGV+LGLLKG+VGLSGAI TQL+ A+YG D
Sbjct  136  TGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYFAIYGND  179



>ref|XP_011028256.1| PREDICTED: uncharacterized protein LOC105128342 [Populus euphratica]
 ref|XP_011012690.1| PREDICTED: uncharacterized protein LOC105116886 [Populus euphratica]
Length=559

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
              AVH I GRWF VFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+N
Sbjct  6    EFAVHAINGRWFSVFASFLIMAGAGATYLFGTYSKDIKATLGYDQTTLNLLGFFKDLGAN  65

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGV SGL+ EVTP W VL +G+ +NF GYFM+WLAVT+KI+ P VWQMCLYIC+  NSQ+
Sbjct  66   VGVFSGLLAEVTPTWFVLLVGSAMNFAGYFMIWLAVTQKIARPAVWQMCLYICMGANSQN  125

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTGALVT VKNFPESRGV+LGLLKGFVGLSGAILTQ + A+YGTD
Sbjct  126  FANTGALVTCVKNFPESRGVMLGLLKGFVGLSGAILTQFYLAIYGTD  172



>ref|XP_010098800.1| hypothetical protein L484_022565 [Morus notabilis]
 gb|EXB75888.1| hypothetical protein L484_022565 [Morus notabilis]
Length=621

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A+ +  G+WFMVFAT LIMS  G++YMFGLYS D+K +LGYDQ+TLNL+SFFKDLG N+G
Sbjct  14   ALQVFAGKWFMVFATILIMSVNGSSYMFGLYSNDIKSSLGYDQSTLNLISFFKDLGGNLG  73

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VL+GLINEV+PPWVVL +GA +NFFGYFM+W+++   I+ P VWQMCLYIC+A NS SF 
Sbjct  74   VLAGLINEVSPPWVVLSVGAAMNFFGYFMIWMSIAGHIAKPHVWQMCLYICIAANSLSFP  133

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NT ALV  VKNFPESRG V+G LKG + LSGAILTQL+HA+Y  D
Sbjct  134  NTAALVACVKNFPESRGSVIGFLKGLIVLSGAILTQLYHAIYKDD  178



>ref|XP_011094731.1| PREDICTED: uncharacterized protein LOC105174351 [Sesamum indicum]
Length=578

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            SL + ++  RWFMVFA  LIMS +GATY+FG+YS D+K +LGYDQTTLNL+ FFKDLGSN
Sbjct  15   SLGLKVLTSRWFMVFACLLIMSMSGATYIFGVYSNDIKTSLGYDQTTLNLIGFFKDLGSN  74

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            +GV+SG+INE+ PPWVVL IG  +NF GYFM+WLAVT +I+ P VWQMCLYIC+  NSQ+
Sbjct  75   IGVMSGIINELMPPWVVLAIGVAMNFSGYFMIWLAVTGRIAKPLVWQMCLYICIGANSQT  134

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            F+NTGALVT VKNFPESRG+V+GLLKGF GLSGAI++QLFHA YG +
Sbjct  135  FSNTGALVTCVKNFPESRGIVIGLLKGFTGLSGAIISQLFHAFYGHN  181



>ref|XP_006339087.1| PREDICTED: uncharacterized protein LOC102587756 [Solanum tuberosum]
Length=569

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M +  +H++ GRWFM FA+ LI+S AG TY+FGLYS ++K +LGYDQTTLNLL FFKDLG
Sbjct  1    MENFGLHMLVGRWFMFFASILILSVAGGTYIFGLYSEEVKISLGYDQTTLNLLGFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVG++SGLINEVTPPWVV+ +GA +NFFGYF +WLAVTKK S PKVW+MC  I +  NS
Sbjct  61   ANVGIISGLINEVTPPWVVILLGAFMNFFGYFSIWLAVTKKFSNPKVWEMCFCIFIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Q+F NTG +VT VKNFPESRG+V+GLLKGFVGLSGAILTQL+HA YG+D
Sbjct  121  QTFVNTGVIVTCVKNFPESRGIVIGLLKGFVGLSGAILTQLYHAFYGSD  169



>ref|XP_010267225.1| PREDICTED: uncharacterized protein LOC104604545 [Nelumbo nucifera]
Length=589

 Score =   233 bits (594),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  144  RASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFK  323
            R   G   +H+I+GRWFMVFA+  IM+ AGATY+FG+YS D+K +LGYDQ+TLNLL F K
Sbjct  10   RGQGGGFLLHLIRGRWFMVFASFWIMAGAGATYLFGIYSKDIKASLGYDQSTLNLLGFCK  69

Query  324  DLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVA  503
            DLG+NVGVLSGLI EVTP W VL +G+ +NF GYFM+WLAVT +I+ P+VWQMCLYIC+ 
Sbjct  70   DLGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFMIWLAVTGRIAKPQVWQMCLYICIG  129

Query  504  GNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
             NSQ+FANTG+LVT VKNFPESRG++LGL+KGFVGLSGA++TQL+ A+YG D
Sbjct  130  ANSQNFANTGSLVTCVKNFPESRGIMLGLMKGFVGLSGAVMTQLYLAIYGND  181



>ref|XP_007144375.1| hypothetical protein PHAVU_007G151000g [Phaseolus vulgaris]
 gb|ESW16369.1| hypothetical protein PHAVU_007G151000g [Phaseolus vulgaris]
Length=588

 Score =   233 bits (594),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  AGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            AG    A   +   H+I GRWFM+FA+ LIM+ +GATYMFGLYS ++K +LGYDQ+TLNL
Sbjct  2    AGEEELAKTKAFIRHVITGRWFMIFASCLIMAVSGATYMFGLYSNEVKASLGYDQSTLNL  61

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            +SFFKDLG+N+G+ SGLINE++PPWV+L +GAT+NF GYFM+WL+VT +I+ P+VWQMCL
Sbjct  62   ISFFKDLGANLGIFSGLINEISPPWVILAMGATMNFVGYFMIWLSVTSRIAKPQVWQMCL  121

Query  489  YICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Y  +  NSQSFANTGALV  V++FP SRG V+GLLKG+VGLSGAI TQL+HA YG D
Sbjct  122  YFYIGANSQSFANTGALVNCVQSFPRSRGSVIGLLKGYVGLSGAIFTQLYHAFYGED  178



>gb|EYU29889.1| hypothetical protein MIMGU_mgv1a003835mg [Erythranthe guttata]
Length=561

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            GGG    +  L + ++ GRWFMVFA  LIMS +GATY+FG+YS D+K +LGYDQTTLNL+
Sbjct  10   GGG----ITRLGLQVVTGRWFMVFACLLIMSMSGATYIFGIYSNDIKTSLGYDQTTLNLI  65

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
             FFKDLG N+G++SG+INEVTPPWVVL IG  +NF GYF++WLAVT +   P VWQMCLY
Sbjct  66   GFFKDLGGNIGIVSGVINEVTPPWVVLAIGVAMNFTGYFLIWLAVTGRTPKPHVWQMCLY  125

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            ICV  NSQ+F+NTGALVT VKNFPESRG+V+GLLKGF GLSGAI+TQLF A YG +
Sbjct  126  ICVGANSQTFSNTGALVTCVKNFPESRGIVIGLLKGFTGLSGAIITQLFRAFYGHN  181



>ref|XP_009413295.1| PREDICTED: uncharacterized protein LOC103994629 [Musa acuminata 
subsp. malaccensis]
Length=631

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            AV +++GRWFM+F++ LIM+AAGATY+F +YS D+K +LGYDQ+TLN LSFFKDLG+NVG
Sbjct  25   AVRVVRGRWFMLFSSFLIMAAAGATYIFSIYSKDIKSSLGYDQSTLNTLSFFKDLGANVG  84

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLINEVTPPWVVL +GA +N FGY M++LA+T + + P VW MCLYICV  NSQ+FA
Sbjct  85   VLSGLINEVTPPWVVLAMGAGMNLFGYLMIYLAITGRTAPPHVWLMCLYICVGANSQTFA  144

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRG+VLGLLKGFVGLSGAI+TQL++A+YG D
Sbjct  145  NTGALVTCVKNFPESRGIVLGLLKGFVGLSGAIMTQLYYAIYGDD  189



>ref|XP_008462497.1| PREDICTED: uncharacterized protein LOC103500834 [Cucumis melo]
Length=587

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            G   R+ M + AV ++ GRWF  FA+ LIMS +GA+YMF LYS D+K +L YDQTTLNL+
Sbjct  19   GQRRRSQMSNFAVQVLLGRWFTAFASLLIMSVSGASYMFALYSSDIKSSLNYDQTTLNLV  78

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
             FFKDLGSNVGV SGLINE+TPPWVVLFIG  +NFFGYFM+WL+VT +IS PK+  MCL+
Sbjct  79   GFFKDLGSNVGVFSGLINEITPPWVVLFIGGVMNFFGYFMIWLSVTHRISKPKLPAMCLF  138

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            I +  NSQ+FANTGAL+ +VKNFP++RG VLGLLKGFVGLSGAILTQ++HA YG D
Sbjct  139  IFLGANSQTFANTGALIPSVKNFPQNRGNVLGLLKGFVGLSGAILTQIYHAFYGDD  194



>ref|XP_011469614.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
 ref|XP_004307337.2| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
Length=597

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  138  GSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSF  317
            GS   M +  + ++ GRW M+FA+ L+M++AGA+YMFGLYS D+K +LGY QTTLNL+SF
Sbjct  2    GSWTKMKAFTLQVLTGRWLMLFASFLMMASAGASYMFGLYSNDIKSSLGYSQTTLNLISF  61

Query  318  FKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYIC  497
            FKDLG+N+G+ SGLINEVTPPWVVL IGA  NFFGYFM+WLAVTKKI+ P+VW MC YI 
Sbjct  62   FKDLGANIGIFSGLINEVTPPWVVLSIGAAFNFFGYFMIWLAVTKKIAKPQVWHMCTYIA  121

Query  498  VAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            +  NS +F NTGALVT VKNFP SRG++LGLL G++GLS A++ QL+HA+YG D
Sbjct  122  MGANSHTFINTGALVTCVKNFPRSRGLLLGLLNGYIGLSAAVIAQLYHALYGDD  175



>ref|XP_002519464.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42878.1| conserved hypothetical protein [Ricinus communis]
Length=581

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  AGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            A GG    M    + ++ GRWFMVF++ LIM+ AG  YMFG+YS D+K +LGYDQTTLNL
Sbjct  9    ADGGGWREMKGFVLTVLVGRWFMVFSSLLIMAMAGTGYMFGMYSNDIKTSLGYDQTTLNL  68

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            LSFFKD+G NVG+LSGLINEV+PPWVVL IGA +NF GYFM+W++VT +I+ PKVWQMCL
Sbjct  69   LSFFKDVGGNVGILSGLINEVSPPWVVLSIGAIMNFLGYFMIWISVTGRITKPKVWQMCL  128

Query  489  YICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Y+ ++ N+Q+F+NTGALVT VKNFPESRG V+GLLK FVGLSGAI+TQ +HA YG +
Sbjct  129  YMYLSTNAQAFSNTGALVTCVKNFPESRGGVIGLLKSFVGLSGAIMTQFYHAFYGDN  185



>gb|KHN39024.1| Putative transporter MCH1 [Glycine soja]
Length=555

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
            H+I GRWFM+FA+ LIM+ +GATYMFGLYS ++K +LGYDQ+TLNL+SFFKDLG+N+G+ 
Sbjct  9    HVITGRWFMIFASCLIMAVSGATYMFGLYSNEVKASLGYDQSTLNLISFFKDLGANLGIF  68

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGLINE++PPWV+L +GAT+NF GYFM+WL+VT +I+ P+VWQMCLY  +  NSQSFANT
Sbjct  69   SGLINEISPPWVILAMGATMNFIGYFMIWLSVTSRIAKPQVWQMCLYFYIGANSQSFANT  128

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            GALV  VK+FP SRG V+GLLKG+VGLSGAI TQ +HA YG D
Sbjct  129  GALVNCVKSFPRSRGSVIGLLKGYVGLSGAIFTQFYHAFYGDD  171



>ref|XP_011469615.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
Length=583

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M SL + +++GRW +VFA+ L+M  AGA+YMFGLYS D+K  LGYDQTTLNL+SF KDLG
Sbjct  1    MKSLVLQVLKGRWLIVFASFLMMVTAGASYMFGLYSNDIKSVLGYDQTTLNLISFSKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +N+G+LSGLINEVTPPWVVL IGA LNFFG+FM+WLAV +KI  P+VW MC+Y+ +  NS
Sbjct  61   ANIGILSGLINEVTPPWVVLSIGAVLNFFGHFMIWLAVAQKIHKPQVWHMCMYMGIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
             +F NTGALVT VKNFPESRG+VLGLLK + G+S A++ QL+HAVYG D
Sbjct  121  HTFTNTGALVTCVKNFPESRGIVLGLLKSYTGISAAVVAQLYHAVYGDD  169



>ref|XP_010691115.1| PREDICTED: uncharacterized protein LOC104904540 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
             ++ GRWF+VF+T L+MSAAGATYMFG YS D+K +LGYDQTTLNLLSFFKDLGS VG+ 
Sbjct  17   RVLMGRWFLVFSTLLVMSAAGATYMFGSYSKDIKTSLGYDQTTLNLLSFFKDLGSTVGIP  76

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            +GL+ E+ PPW VL +GA LNFFGYFM+WL+VT++I+ P VWQMCLYICV  NSQ+FANT
Sbjct  77   AGLLMEIAPPWFVLAVGAVLNFFGYFMIWLSVTRRIAKPAVWQMCLYICVGANSQAFANT  136

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYG  653
            GALVT VKNFPESRGVVLGLLKGFVGLSGAI+TQ + A+YG
Sbjct  137  GALVTCVKNFPESRGVVLGLLKGFVGLSGAIITQFYFALYG  177



>gb|KJB73493.1| hypothetical protein B456_011G234900, partial [Gossypium raimondii]
Length=523

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  117  MVVFAGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQT  296
            M   A G S        + +I GRWFM+FA+ LIM+ AGATY+FG+YS D+K  LGYDQ+
Sbjct  7    MATTASGSSGYVCCRFFLQVITGRWFMMFASFLIMACAGATYLFGVYSKDIKSTLGYDQS  66

Query  297  TLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVW  476
            TLNL+S FKDLG+NVGVLSGL+ EVTP W VL +GA +NF GYFM+WLAVTK+++TPKVW
Sbjct  67   TLNLMSTFKDLGANVGVLSGLLAEVTPTWFVLLVGALMNFTGYFMIWLAVTKRVATPKVW  126

Query  477  QMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGT  656
            QMC YIC+  NSQ+FANTG+LVT VKNFP+SRG++LGL+KGFVGLSGAI  Q+++A+YG 
Sbjct  127  QMCAYICIGANSQNFANTGSLVTCVKNFPQSRGMMLGLMKGFVGLSGAIFPQIYYAIYGN  186

Query  657  D  659
            D
Sbjct  187  D  187



>ref|XP_009356932.1| PREDICTED: uncharacterized protein LOC103947713 [Pyrus x bretschneideri]
Length=575

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
              A+ +++GRWF VFA+ LIM+ AGATY+FG+YS D+K  LGYDQTTLN+L FFKDLG+N
Sbjct  20   EFALQVVKGRWFTVFASFLIMAGAGATYLFGVYSKDIKSTLGYDQTTLNMLGFFKDLGAN  79

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLI EVTP W VL +G+ LNF GYFM++LAVT+KI+ PKVWQMCLYICV  NSQ+
Sbjct  80   VGVLSGLIGEVTPTWFVLLLGSGLNFVGYFMIYLAVTEKIAKPKVWQMCLYICVGANSQN  139

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            F NTGALVT VKNFPESRGV+LGLLKGF GLSGAI TQL+ A+Y  D
Sbjct  140  FVNTGALVTCVKNFPESRGVMLGLLKGFTGLSGAIFTQLYLAIYPND  186



>ref|XP_003537006.1| PREDICTED: uncharacterized protein LOC100782396 [Glycine max]
Length=580

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
            H+I GRWFM+FA+ LIM+ +GATYMFGLYS ++K +LGYDQ+TLNL+SFFKDLG+N+G+ 
Sbjct  9    HVITGRWFMIFASCLIMAVSGATYMFGLYSNEVKASLGYDQSTLNLISFFKDLGANLGIF  68

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGLINE++PPWV+L +GAT+NF GYFM+WL+VT +I+ P+VWQMCLY  +  NSQSFANT
Sbjct  69   SGLINEISPPWVILAMGATMNFIGYFMIWLSVTSRIAKPQVWQMCLYFYIGANSQSFANT  128

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            GALV  VK+FP SRG V+GLLKG+VGLSGAI TQ +HA YG D
Sbjct  129  GALVNCVKSFPRSRGSVIGLLKGYVGLSGAIFTQFYHAFYGDD  171



>ref|XP_004304474.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
Length=600

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  AGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            +G      M S  + ++ GRWFM+FA+ LI+S AGATY+FGLYS  +K +LGYDQTTLNL
Sbjct  8    SGAFGSKEMRSFGLQVLHGRWFMLFASMLILSVAGATYIFGLYSNVIKTSLGYDQTTLNL  67

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            LSFFKDLG NVG+++GL+NEVT PWVVL IG+ +NFFGYFM+WLAVT + S P+VWQMCL
Sbjct  68   LSFFKDLGGNVGIIAGLVNEVTGPWVVLLIGSVMNFFGYFMIWLAVTGRTSKPRVWQMCL  127

Query  489  YICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            YICV  NSQ+F+NTGA+V+ VKNFP SRG VLGLLKG VGLSGAI+TQL++A YG D
Sbjct  128  YICVGANSQTFSNTGAVVSCVKNFPSSRGSVLGLLKGLVGLSGAIITQLYNAFYGKD  184



>ref|XP_002313536.1| nodulin family protein [Populus trichocarpa]
 gb|EEE87491.1| nodulin family protein [Populus trichocarpa]
Length=559

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A+H + GRWF VFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVG
Sbjct  8    ALHAVDGRWFSVFASFLIMAGAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGANVG  67

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGL+ EVTP W VL +G+ +NF GYFM+W++VT++I+ P VWQMCLYIC+  NSQ+FA
Sbjct  68   VLSGLLAEVTPTWFVLVVGSAMNFAGYFMIWMSVTQRIAKPAVWQMCLYICIGANSQNFA  127

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRGV+LG+LKGFVGLSGAI TQ + A+YGTD
Sbjct  128  NTGALVTCVKNFPESRGVMLGMLKGFVGLSGAIFTQFYLAIYGTD  172



>ref|XP_009627404.1| PREDICTED: uncharacterized protein LOC104117959 [Nicotiana tomentosiformis]
 ref|XP_009627405.1| PREDICTED: uncharacterized protein LOC104117959 [Nicotiana tomentosiformis]
 ref|XP_009627406.1| PREDICTED: uncharacterized protein LOC104117959 [Nicotiana tomentosiformis]
Length=594

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = +3

Query  144  RASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFK  323
            R  +   A+H+++GRWF +FA+ LIM+ AGATY+FG YS ++K +LGYDQTTLNLL FFK
Sbjct  17   RHEVLQFALHVVRGRWFSLFASFLIMAGAGATYLFGTYSKEIKGSLGYDQTTLNLLGFFK  76

Query  324  DLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVA  503
            DLG+NVGVLSGLI EVTP W VL +GA +NF GY M+WLAV  KIS PKVW+MC+YIC+ 
Sbjct  77   DLGANVGVLSGLIAEVTPTWFVLLVGAAMNFTGYLMIWLAVVGKISKPKVWKMCIYICLG  136

Query  504  GNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
             NSQ+FANTGALVT+++NFPESRG ++GLLKGF GLSGAI+TQL+ AVYG D
Sbjct  137  ANSQNFANTGALVTSIRNFPESRGNMIGLLKGFTGLSGAIMTQLYLAVYGND  188



>ref|XP_004143363.2| PREDICTED: uncharacterized protein LOC101203981 [Cucumis sativus]
Length=589

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            G   R+ M + AV ++ GRWF VFA+ LIMS +GATYMF LYS D+K +L YDQTTLNL+
Sbjct  19   GQRRRSQMSNFAVQVLLGRWFTVFASLLIMSVSGATYMFALYSSDIKSSLNYDQTTLNLV  78

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
             FFKDLGSNVGV SGLINE+TPPWVVLFIG  +NFFGYFM+WL+VT +I  PK+  MCL+
Sbjct  79   GFFKDLGSNVGVFSGLINEITPPWVVLFIGGVMNFFGYFMIWLSVTHRIPKPKLPAMCLF  138

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
              +  NSQ+FANTGAL+ +VKNFP++RG VLGLLKGFVGLSGAILTQ++HA YG D
Sbjct  139  TFLGANSQTFANTGALIPSVKNFPQNRGYVLGLLKGFVGLSGAILTQIYHAFYGDD  194



>ref|XP_003553561.1| PREDICTED: uncharacterized protein LOC100798313 [Glycine max]
 gb|KHN02306.1| Putative transporter MCH1 [Glycine soja]
Length=571

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M +L  H++ GRWFM+FA+ LIM+AAGA YMFG+YS ++K +LGYDQTTLNL SFFKD+G
Sbjct  1    MKTLIYHVLTGRWFMLFASLLIMAAAGAAYMFGMYSNEVKTSLGYDQTTLNLFSFFKDVG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            + VG++SGL+NE+TPPWVVL IG  +NFFGYFM++LAVT +I+ P+VWQMCLYIC+  NS
Sbjct  61   ATVGIISGLVNEITPPWVVLSIGVIMNFFGYFMIFLAVTGRIAKPQVWQMCLYICIGSNS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYG  653
            Q+FANTG  VT VKNFP SRG VLGLLKG+VGLSGAI+ QL+HA YG
Sbjct  121  QTFANTGGTVTCVKNFPGSRGNVLGLLKGYVGLSGAIIAQLYHAFYG  167



>ref|XP_009356931.1| PREDICTED: uncharacterized protein LOC103947712 [Pyrus x bretschneideri]
Length=559

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            AVH+++GRWF VFA+ LIM+ AGATY+FG+YS  +K +LGYDQTTLNLL FFKDLG+NVG
Sbjct  13   AVHVVKGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNLLGFFKDLGANVG  72

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLI EVTP W VL IG+ +NF GYFM+WLAVT KI  PKVW MCLYIC+  NSQ+FA
Sbjct  73   VLSGLIGEVTPTWFVLLIGSAMNFAGYFMIWLAVTAKIPKPKVWHMCLYICIGANSQNFA  132

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFP SRGV+LGLLKGF GLSGA+ TQ++ AVYG +
Sbjct  133  NTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAVYGNN  177



>ref|XP_004249479.1| PREDICTED: uncharacterized protein LOC101244433 [Solanum lycopersicum]
Length=569

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M +  +H++ GRWFM FA+ LI+S AG TY+FGLYS ++K +LGYDQTTLNLL FFKDLG
Sbjct  1    MENFGIHLLSGRWFMFFASILILSVAGGTYIFGLYSEEVKISLGYDQTTLNLLGFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVG++SGLINE+TPPWVV+ +GA +NFFGYF +WLAVTKK S PKVW+MC  I +  NS
Sbjct  61   ANVGIISGLINEITPPWVVILLGAFMNFFGYFSIWLAVTKKFSNPKVWEMCFCIFIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Q+F NTG +VT VKNFP+SRG+V+GLLKGFVGLSGA+LTQ +HA YG+D
Sbjct  121  QTFVNTGVIVTCVKNFPQSRGIVIGLLKGFVGLSGAVLTQFYHAFYGSD  169



>ref|XP_003541428.1| PREDICTED: uncharacterized protein LOC100814000 [Glycine max]
Length=588

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
            H+I GRWFM+FA+ LIM+ +GATYMFGLYS ++K +LGYDQ+TLNL+SFFKDLG+N+G+ 
Sbjct  9    HVITGRWFMIFASCLIMAVSGATYMFGLYSNEVKTSLGYDQSTLNLISFFKDLGANLGIF  68

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGLINE++PPWV+L +GAT+NF GYFM+WL+VT +I+ P+VWQMCLY  +  NSQSFANT
Sbjct  69   SGLINEISPPWVILAMGATMNFIGYFMIWLSVTSRIAKPQVWQMCLYFYIGANSQSFANT  128

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            GALV  VK+FP SRG V+GLLKG+VGLSGAI TQ +HA YG D
Sbjct  129  GALVNCVKSFPRSRGSVIGLLKGYVGLSGAIFTQFYHAFYGDD  171



>ref|XP_008794008.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Phoenix 
dactylifera]
Length=627

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  162  LAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNV  341
            LAV +++GRWFM FA+ LIM+A+GATY+F +YSGD+K +LGYDQ+TLN LSFFKDLG+NV
Sbjct  21   LAVQVVRGRWFMFFASFLIMAASGATYIFSIYSGDIKTSLGYDQSTLNTLSFFKDLGANV  80

Query  342  GVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSF  521
            G+LSGLINEVTPPWVVL +GA +N FGY M++L++T +I+ P VWQM LYIC+  NSQSF
Sbjct  81   GILSGLINEVTPPWVVLSMGAGMNLFGYLMIYLSITGRIARPAVWQMYLYICIGANSQSF  140

Query  522  ANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            ANTG+LVT+VKNFPESRG+VLGLLKGFVGLSGAI  QL+ A+YG D
Sbjct  141  ANTGSLVTSVKNFPESRGIVLGLLKGFVGLSGAIFNQLYFAIYGDD  186



>ref|XP_008385511.1| PREDICTED: uncharacterized protein LOC103448054 [Malus domestica]
Length=572

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
              A+ +++GRWF VFA+ LIM+ AGATY+FG+YS D+K  LGYDQTTLN+L FFKDLG+N
Sbjct  17   EFALQVVKGRWFTVFASFLIMAGAGATYLFGVYSKDIKSTLGYDQTTLNMLGFFKDLGAN  76

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLI E+TP W VL +G+ LNF GYFM++LA+T+KI+ PKVWQMCLYICV  NSQ+
Sbjct  77   VGVLSGLIGEITPTWFVLLLGSGLNFVGYFMIYLAITEKIAKPKVWQMCLYICVGANSQN  136

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            F NTGALVT VKNFPESRGV+LGLLKGF GLSGAI TQL+ A+Y  D
Sbjct  137  FVNTGALVTCVKNFPESRGVMLGLLKGFTGLSGAIFTQLYLAIYPND  183



>ref|XP_007010021.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY18831.1| Major facilitator superfamily protein [Theobroma cacao]
Length=591

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +3

Query  135  GGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLS  314
            GGS          +I GRWFM+FA+ LIM+ AGATY+FG+YS D+K  LGYDQ+TLNL+S
Sbjct  9    GGSGCGCCRFLCQVINGRWFMMFASFLIMAGAGATYLFGVYSKDIKATLGYDQSTLNLMS  68

Query  315  FFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYI  494
             FKDLG+NVGVLSGL+ EVTP W VL +GA +NF GYFM+W AVTKKI TP+VW MC YI
Sbjct  69   TFKDLGANVGVLSGLLAEVTPTWFVLLVGAVMNFAGYFMIWCAVTKKIPTPQVWHMCAYI  128

Query  495  CVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            C+  NSQ+FANTG+LVT VKNFPESRG++LGL+KGFVGLSGA+ TQL++A+YG D
Sbjct  129  CIGANSQNFANTGSLVTCVKNFPESRGIMLGLMKGFVGLSGALFTQLYYAIYGND  183



>ref|XP_011032303.1| PREDICTED: uncharacterized protein LOC105131167 [Populus euphratica]
 ref|XP_011032304.1| PREDICTED: uncharacterized protein LOC105131167 [Populus euphratica]
Length=559

 Score =   229 bits (585),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A+H + GRWF VFA+ LIM+ AGATY+FG YS D+K  LGYDQTTLNLL FFKDLG+NVG
Sbjct  8    ALHAVDGRWFSVFASFLIMAGAGATYLFGTYSKDIKATLGYDQTTLNLLGFFKDLGANVG  67

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGL+ EVTP W VL +G+ +NF GYFM+W++VT++I+ P VWQMCLYIC+  NSQ+FA
Sbjct  68   VLSGLLAEVTPTWFVLVVGSAMNFAGYFMIWMSVTQRIAKPAVWQMCLYICIGANSQNFA  127

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRGV+LG+LKGFVGLSGAI TQ + A+YGTD
Sbjct  128  NTGALVTCVKNFPESRGVMLGMLKGFVGLSGAIFTQFYLAIYGTD  172



>ref|XP_008385512.1| PREDICTED: uncharacterized protein LOC103448055 [Malus domestica]
Length=559

 Score =   229 bits (585),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A+H+++GRWF VFA+ LIM+ AGATY+FG+YS  +K +LGYDQTTLNLL FFKDLG+NVG
Sbjct  13   AIHVVKGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNLLGFFKDLGANVG  72

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLI EVTP W VL IG+ +NF GYFM+WLAVT KI  PKVW MCLYIC+  NSQ+FA
Sbjct  73   VLSGLIGEVTPTWFVLLIGSAMNFAGYFMIWLAVTAKIPKPKVWHMCLYICIGANSQNFA  132

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFP SRGV+LGLLKGF GLSGA+ TQ++ AVYG +
Sbjct  133  NTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAVYGDN  177



>ref|XP_006436519.1| hypothetical protein CICLE_v10031022mg [Citrus clementina]
 ref|XP_006485348.1| PREDICTED: uncharacterized protein LOC102612195 [Citrus sinensis]
 gb|ESR49759.1| hypothetical protein CICLE_v10031022mg [Citrus clementina]
 gb|KDO47546.1| hypothetical protein CISIN_1g007665mg [Citrus sinensis]
Length=594

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            S  + +++GRWFM+FA+ LIM+ AGATY+FG YS ++K  LGYDQTTLNLLS  KDLG+N
Sbjct  15   SFLLQVLRGRWFMMFASFLIMAGAGATYLFGTYSKEIKSTLGYDQTTLNLLSTCKDLGAN  74

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGL+ EVTPPW+VL +G+ +NF GYFM+WLAV KKI+ PKVWQMCLYIC+  NSQ+
Sbjct  75   VGVLSGLLAEVTPPWLVLLVGSAMNFGGYFMIWLAVMKKIAKPKVWQMCLYICIGANSQN  134

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRG++LGL+KGFVGLSGA+ TQ++ A+YG D
Sbjct  135  FANTGSLVTCVKNFPESRGMMLGLMKGFVGLSGAVFTQIYLAIYGND  181



>ref|XP_009606524.1| PREDICTED: uncharacterized protein LOC104100872 [Nicotiana tomentosiformis]
Length=568

 Score =   229 bits (584),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M +  +H++ GRWFMVFA+ LI+S AG TY+FGLYS ++K +LGYDQTTLNLL FFKDLG
Sbjct  1    MENFGMHMLVGRWFMVFASLLILSVAGGTYIFGLYSEEVKTSLGYDQTTLNLLGFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVG++SGLINEVTPPWVVL +GA +NF GYF +WLA T K++ PKVWQMC  I +  NS
Sbjct  61   ANVGIISGLINEVTPPWVVLLLGAIMNFSGYFSIWLATTGKLTKPKVWQMCFCIFIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Q+FANTG LVT VKNFPESRG+V+GLLKGFVGLSGAILTQL+HA YG +
Sbjct  121  QTFANTGVLVTCVKNFPESRGIVIGLLKGFVGLSGAILTQLYHAFYGNN  169



>ref|XP_002523712.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38652.1| conserved hypothetical protein [Ricinus communis]
Length=558

 Score =   229 bits (584),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            AVH+I GRWF VFA+ LIM+ AGATY+FG YS D+K  LGYDQ TLNLL FFKDLG+NVG
Sbjct  8    AVHVINGRWFSVFASFLIMAGAGATYLFGTYSKDIKATLGYDQQTLNLLGFFKDLGANVG  67

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLI EVTP W VL +G+ +NF GYFM+WL VT +I+ P VWQMCLYIC+  NSQ+FA
Sbjct  68   VLSGLIAEVTPTWFVLLMGSAMNFTGYFMIWLTVTGRIAKPAVWQMCLYICIGANSQNFA  127

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT V NFPESRGV+LGLLKGFVGLSGAI TQL+ A+YGTD
Sbjct  128  NTGALVTCVINFPESRGVMLGLLKGFVGLSGAIFTQLYLAIYGTD  172



>ref|XP_008465591.1| PREDICTED: uncharacterized protein LOC103503227 [Cucumis melo]
Length=592

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
             + +I GRWF VFAT LIM+ AGATY+FG+YS  +K ALGYDQTTLNL+ FFKDLG+NVG
Sbjct  21   PLQVITGRWFTVFATFLIMAGAGATYLFGVYSKQIKSALGYDQTTLNLMGFFKDLGANVG  80

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGL+ EVTP W VL +G+ LNF GYFM+WLAVT +I+ PKVWQMCLYICV  NSQ+FA
Sbjct  81   VLSGLVAEVTPTWFVLLLGSALNFTGYFMIWLAVTGRIAKPKVWQMCLYICVGANSQNFA  140

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT ++NFPESRG ++GLLKGF GLSGAILT+++ AVY  D
Sbjct  141  NTGALVTCIQNFPESRGAMMGLLKGFTGLSGAILTEIYRAVYADD  185



>ref|XP_010651774.1| PREDICTED: uncharacterized protein LOC100244770 [Vitis vinifera]
Length=670

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            GG     +G  AVH+I+GRWF V+A+ LIM  AGATY+FG+YS ++K ++GYDQ+TLNL+
Sbjct  92   GGCGSGEVGRFAVHVIRGRWFSVYASFLIMVGAGATYLFGIYSKEIKSSMGYDQSTLNLI  151

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
             FFKDLG+NVGV +GLI EVTP W VL +G+ LNF G+FM+WLAVT +I+ PKVWQ+C Y
Sbjct  152  GFFKDLGANVGVPAGLIAEVTPTWFVLLVGSALNFSGFFMIWLAVTGQIAKPKVWQICAY  211

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            ICV  NSQ+FANTGALVT+VKNFPESRGV+LGLLKGFVGLSGAI+TQ++ AVYG D
Sbjct  212  ICVGANSQNFANTGALVTSVKNFPESRGVMLGLLKGFVGLSGAIMTQIYFAVYGND  267



>ref|XP_009783152.1| PREDICTED: uncharacterized protein LOC104231797 [Nicotiana sylvestris]
Length=568

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M +  +H++ GRWFMVFA+ LI+S AG TY+FGLYS ++K +LGYDQTTLNLL FFKDLG
Sbjct  1    MENFGMHMLVGRWFMVFASLLILSVAGGTYIFGLYSEEVKTSLGYDQTTLNLLGFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVG++SGLINEVTPPWVVL +GA +NF GYF +WLA T K++ PKVWQMC  I +  NS
Sbjct  61   ANVGIISGLINEVTPPWVVLLLGAFMNFSGYFSIWLATTGKLTKPKVWQMCFCIFIGANS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Q+FANTG LVT VKNFPESRG+V+GLLKGFVGLSGAILTQL+HA YG +
Sbjct  121  QTFANTGVLVTCVKNFPESRGIVIGLLKGFVGLSGAILTQLYHAFYGNN  169



>ref|XP_010321905.1| PREDICTED: uncharacterized protein LOC101251293 [Solanum lycopersicum]
Length=583

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+++GRWF +FA+ LIMS AGATY+FG+YS ++K+ LGYDQTTL LL FFKDLG+NVGV
Sbjct  17   LHVLRGRWFSLFASFLIMSGAGATYLFGIYSQEIKNTLGYDQTTLVLLGFFKDLGANVGV  76

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGL+ EV+P W VL +GA +NF GYFM+WL+V  KIS PKVWQMC+YIC+  NSQ+FAN
Sbjct  77   LSGLLAEVSPTWFVLLVGAAMNFTGYFMIWLSVIGKISKPKVWQMCIYICLGANSQNFAN  136

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT+V+NFPESRG ++GLLKGF GLSGAILTQL+ AVYG D
Sbjct  137  TGALVTSVRNFPESRGNMIGLLKGFTGLSGAILTQLYLAVYGND  180



>ref|XP_004147280.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Cucumis sativus]
 gb|KGN64786.1| hypothetical protein Csa_1G097655 [Cucumis sativus]
Length=594

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            + +I GRWF VFAT LIM+ AGATY+FG+YS  +K ALGYDQTTLNL+ FFKDLG+NVGV
Sbjct  22   LQVITGRWFTVFATFLIMAGAGATYLFGVYSKQIKSALGYDQTTLNLMGFFKDLGANVGV  81

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGL+ EVTP W VL +G+ LNF GYFM+WLAV+ +I+ PKVWQMCLYICV  NSQ+FAN
Sbjct  82   LSGLVAEVTPTWFVLLLGSALNFTGYFMIWLAVSGRIAKPKVWQMCLYICVGANSQNFAN  141

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT ++NFPESRG ++GLLKGF GLSGAILT+++ AVY  D
Sbjct  142  TGALVTCIQNFPESRGAMMGLLKGFTGLSGAILTEIYRAVYADD  185



>ref|XP_010658347.1| PREDICTED: uncharacterized protein LOC100256418 isoform X1 [Vitis 
vinifera]
Length=587

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = +3

Query  135  GGSRASMGSLAVHIIQGRWFMVFATTLIM-SAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            G +RA M SLA  I+ GRW MVFA  L+M +AA AT MFGLYS  +K ALGYDQTTLNLL
Sbjct  14   GFNRADMRSLAFQILTGRWLMVFAAILVMFAAASATSMFGLYSSAIKAALGYDQTTLNLL  73

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
             FFKDLG+NVGVLSGLINEVTPPWVVL +GA +N FGY M+WLAV+ K++ P+VW MCLY
Sbjct  74   GFFKDLGANVGVLSGLINEVTPPWVVLSMGAAMNLFGYLMIWLAVSGKMAKPRVWHMCLY  133

Query  492  ICVAGNSQSFANTGALVTAVKNFPESR-gvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+  NSQ+FA TGALVT VKNFPE+R  V+  L      L+GAI+TQ++HA Y  D
Sbjct  134  ICIGSNSQAFATTGALVTCVKNFPENRGAVLGILKGYQGALTGAIITQMYHAFYRND  190



>ref|XP_002267992.3| PREDICTED: uncharacterized protein LOC100256418 isoform X2 [Vitis 
vinifera]
Length=581

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = +3

Query  135  GGSRASMGSLAVHIIQGRWFMVFATTLIM-SAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            G +RA M SLA  I+ GRW MVFA  L+M +AA AT MFGLYS  +K ALGYDQTTLNLL
Sbjct  8    GFNRADMRSLAFQILTGRWLMVFAAILVMFAAASATSMFGLYSSAIKAALGYDQTTLNLL  67

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
             FFKDLG+NVGVLSGLINEVTPPWVVL +GA +N FGY M+WLAV+ K++ P+VW MCLY
Sbjct  68   GFFKDLGANVGVLSGLINEVTPPWVVLSMGAAMNLFGYLMIWLAVSGKMAKPRVWHMCLY  127

Query  492  ICVAGNSQSFANTGALVTAVKNFPESR-gvvlgllkgfvglSGAILTQLFHAVYGTD  659
            IC+  NSQ+FA TGALVT VKNFPE+R  V+  L      L+GAI+TQ++HA Y  D
Sbjct  128  ICIGSNSQAFATTGALVTCVKNFPENRGAVLGILKGYQGALTGAIITQMYHAFYRND  184



>ref|XP_007016870.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY34489.1| Major facilitator superfamily protein [Theobroma cacao]
Length=646

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            V  ++GRWF +FA+ LIM+ AGATY+FG YS ++K  LGYDQTTLNLL FFKDLG+NVGV
Sbjct  92   VQFLRGRWFALFASFLIMAGAGATYLFGTYSKEIKATLGYDQTTLNLLGFFKDLGANVGV  151

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGL+ EVTP W VL +GA LNF GYFM+WLAVT KI+ PKVWQMC+YICV  NSQ+FAN
Sbjct  152  LSGLVAEVTPTWFVLLLGAVLNFGGYFMIWLAVTGKIAKPKVWQMCIYICVGANSQNFAN  211

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT+VKNFPESRG +LGLLKGF GLSGA++TQL+ A+YG D
Sbjct  212  TGALVTSVKNFPESRGAMLGLLKGFTGLSGAVMTQLYLAIYGND  255



>ref|XP_006366091.1| PREDICTED: uncharacterized protein LOC102598479 [Solanum tuberosum]
Length=580

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+++GRWF +FA+ LIMS AGATY+FG+YS ++K+ LGYDQTTL LL FFKDLG+NVGV
Sbjct  17   LHVLRGRWFSLFASFLIMSGAGATYLFGVYSQEIKNTLGYDQTTLVLLGFFKDLGANVGV  76

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGLI EV+P W VL +GA +NF GYFM+WL+V  KIS PKVWQMC+YIC+  NSQ+FAN
Sbjct  77   LSGLIAEVSPTWFVLLVGAAMNFTGYFMIWLSVIGKISKPKVWQMCIYICLGANSQNFAN  136

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT+V+NFPESRG ++GLLKGF GLSGAI+TQL+ AVYG D
Sbjct  137  TGALVTSVRNFPESRGNMIGLLKGFTGLSGAIMTQLYLAVYGND  180



>ref|XP_009356979.1| PREDICTED: uncharacterized protein LOC103947752 [Pyrus x bretschneideri]
Length=554

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + +G  + HI+ GRWF VFA+ LIM+ AGATY++G YS ++K  LGYDQT +N+L F KD
Sbjct  4    SEIGQFSWHILNGRWFSVFASFLIMAGAGATYLYGTYSKEIKATLGYDQTEINMLGFSKD  63

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVGVLSGLI EVTP W VL +GA +NF GYFM+WLAVT++I  PKVWQMC+YIC+  
Sbjct  64   LGANVGVLSGLIGEVTPVWFVLIVGAVMNFAGYFMIWLAVTQRIPKPKVWQMCVYICIGA  123

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQ+FANTGALVT VKNFPESRGV+LGLLKGF GLSGAILTQ++ AVYG D
Sbjct  124  NSQNFANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGND  174



>ref|XP_009335989.1| PREDICTED: uncharacterized protein LOC103928636 [Pyrus x bretschneideri]
Length=559

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A+H++QGRWF VFA+ LIM+ AGATY+FG+YS  +K +LGYDQTTLNLL  FKDLG+NVG
Sbjct  13   AIHLLQGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNLLGSFKDLGANVG  72

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLI EVTP W VL IG+ +NF GYFM+WLAVT KI  PKVW MCLYIC+  NSQ+FA
Sbjct  73   VLSGLIGEVTPTWFVLLIGSAMNFTGYFMIWLAVTAKIPKPKVWHMCLYICIGANSQNFA  132

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFP SRGV+LGLLKGF GLSGA+ TQ++ AVYG +
Sbjct  133  NTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAVYGNN  177



>ref|XP_009345750.1| PREDICTED: uncharacterized protein LOC103937531 [Pyrus x bretschneideri]
Length=559

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A+H++QGRWF VFA+ LIM+ AGATY+FG+YS  +K +LGYDQTTLNLL  FKDLG+NVG
Sbjct  13   AIHLLQGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNLLGSFKDLGANVG  72

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLI EVTP W VL IG+ +NF GYFM+WLAVT KI  PKVW MCLYIC+  NSQ+FA
Sbjct  73   VLSGLIGEVTPTWFVLLIGSAMNFTGYFMIWLAVTAKIPKPKVWHMCLYICIGANSQNFA  132

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFP SRGV+LGLLKGF GLSGA+ TQ++ AVYG +
Sbjct  133  NTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAVYGNN  177



>ref|XP_010691114.1| PREDICTED: uncharacterized protein LOC104904539 [Beta vulgaris 
subsp. vulgaris]
Length=585

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            + +++G+WFMV +  L++S AGATYMFG YS D+K +LGYDQTTLNLLSFFKDLGS  G+
Sbjct  17   LRVLRGQWFMVHSALLVLSMAGATYMFGSYSKDIKTSLGYDQTTLNLLSFFKDLGSIAGI  76

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
             SGL+ EVTPPWVVL +GA LNFFGYFMMWLAVT +I+ P VWQMC+YIC+  NSQ+F+N
Sbjct  77   PSGLLLEVTPPWVVLVVGALLNFFGYFMMWLAVTHRIAKPAVWQMCMYICIGANSQAFSN  136

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRGVVLGLLKG VGLSGAI+TQL+ A YGT 
Sbjct  137  TGALVTCVKNFPESRGVVLGLLKGCVGLSGAIITQLYFAFYGTK  180



>gb|KCW65298.1| hypothetical protein EUGRSUZ_G027541, partial [Eucalyptus grandis]
Length=330

 Score =   221 bits (562),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            + A+ +++GRWFM+FA+ LIM+ AGATY+FG+YS D+K  LGY+Q+TLNLLS  KDLG+N
Sbjct  16   AFALQVLRGRWFMMFASFLIMAGAGATYLFGVYSKDIKSTLGYNQSTLNLLSSCKDLGTN  75

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLI EV P W+VL +G+ +NF  YF++WLAVT++I  P VWQMC+YICV  NSQ+
Sbjct  76   VGVLSGLIAEVAPTWLVLLVGSAMNFADYFLIWLAVTRRIPRPAVWQMCVYICVGANSQN  135

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRG++LGL+KGFVGLSGA++TQL++A+YG D
Sbjct  136  FANTGSLVTYVKNFPESRGIMLGLMKGFVGLSGAMMTQLYYAIYGDD  182



>gb|KDP29178.1| hypothetical protein JCGZ_16567 [Jatropha curcas]
Length=577

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
            +M SLA+ I  GRWF+VFA+ LIMS  G +YM+GLYSG++K +LGYDQTTLN+LSFFKDL
Sbjct  2    AMNSLALQIFTGRWFIVFASLLIMSVNGTSYMYGLYSGEIKSSLGYDQTTLNILSFFKDL  61

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G N+GV +GL+ EVTPPWVV+ IGA +NF  YF++W++VT  I+ P +WQMCLY+C+A N
Sbjct  62   GGNLGVSAGLVYEVTPPWVVIVIGAVMNFSAYFLIWVSVTGHIAKPHIWQMCLYMCLATN  121

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            S S+ NT ALVT+V NFPESRG V+GLLKG +GLSGAI+TQ++HA+YGTD
Sbjct  122  SASYPNTAALVTSVSNFPESRGSVIGLLKGLIGLSGAIMTQIYHALYGTD  171



>ref|XP_008233255.1| PREDICTED: uncharacterized protein LOC103332307 [Prunus mume]
Length=576

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  138  GSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSF  317
            G+ A +   A+ ++ GRW M+FA+ L+M++AGA+YMFGLYS D+K  LGY+Q+TLN++SF
Sbjct  5    GTWADIKGFALQVLTGRWLMLFASFLMMASAGASYMFGLYSNDIKSVLGYNQSTLNMISF  64

Query  318  FKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYIC  497
            FKDLG+NVG+ SGLINEVTPPWVVL IGA  NFFGYFM+WLAVT+KI+ P+VW MCLYI 
Sbjct  65   FKDLGANVGIFSGLINEVTPPWVVLSIGAAFNFFGYFMIWLAVTEKIAKPQVWHMCLYIT  124

Query  498  VAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            +  NS +F NTGA VT VKNFP SRG+++GLL G++GLS A++ QL+HA YG D
Sbjct  125  MGANSHTFINTGAFVTCVKNFPRSRGLLIGLLNGYIGLSAAVIAQLYHAFYGDD  178



>ref|XP_004288935.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=561

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            AV ++QGRWF VFA+ LIM+ AGATY+FG+YS  +K  LGYDQ+TLNLL FFKDLG+NVG
Sbjct  16   AVQVVQGRWFTVFASFLIMAGAGATYLFGVYSKQIKSTLGYDQSTLNLLGFFKDLGANVG  75

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLI EVTP W VL +G+ +NF GYFM++LAVT KI+ PKVWQMC+YIC+  NSQ+FA
Sbjct  76   VLSGLIGEVTPTWFVLLVGSAMNFTGYFMIFLAVTGKIAKPKVWQMCMYICIGANSQNFA  135

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRGV+LGLLKGF GLSGA+  Q++ A+YG D
Sbjct  136  NTGALVTCVKNFPESRGVMLGLLKGFTGLSGAMFNQIYLALYGND  180



>ref|XP_008379570.1| PREDICTED: uncharacterized protein LOC103442545 [Malus domestica]
Length=607

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = +3

Query  129  AGGGSR--ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            +G G R  A M   AV +I GRW M+FA+ L+M++AGA+YMFGLYS D+K  LGY Q+TL
Sbjct  9    SGNGVRTWADMKGFAVQVITGRWLMLFASFLMMASAGASYMFGLYSNDIKSVLGYSQSTL  68

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            N +SFFKDLG+N+G+ SGLINEVTPPWVVL IGA  NFFGYFM+WLAV +KI+ P+VW M
Sbjct  69   NTISFFKDLGANIGIFSGLINEVTPPWVVLSIGAAFNFFGYFMIWLAVAEKIAKPQVWHM  128

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            CLYI +  NS +F NTGALVT VKNFP +RG+++GLL+G++GLS A++ Q++HA+YG D
Sbjct  129  CLYITMGANSHTFINTGALVTCVKNFPRNRGLLIGLLEGYIGLSAAVIAQIYHALYGND  187



>gb|EPS63290.1| hypothetical protein M569_11492, partial [Genlisea aurea]
Length=541

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
             +I+GRWF +FA+ LIM+ AGATY+FG YS ++K+ LGYDQTTLNLL FFKDLG+NVGV+
Sbjct  6    EVIRGRWFSLFASFLIMAGAGATYLFGTYSQEIKNNLGYDQTTLNLLGFFKDLGANVGVM  65

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGLI EVTP W VL +GA +NF GYFM+WLAV  +IS P+VW+MC+YIC   NSQ+FANT
Sbjct  66   SGLIAEVTPTWFVLLVGAAMNFGGYFMIWLAVAGRISKPRVWEMCVYICAGANSQNFANT  125

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            GALVTAV NFPESRGV+LGLLKG+VGLSGAILTQ++ AVYG D
Sbjct  126  GALVTAVMNFPESRGVMLGLLKGYVGLSGAILTQIYLAVYGND  168



>ref|XP_012082602.1| PREDICTED: uncharacterized protein LOC105642394 [Jatropha curcas]
Length=575

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M SLA+ I  GRWF+VFA+ LIMS  G +YM+GLYSG++K +LGYDQTTLN+LSFFKDLG
Sbjct  1    MNSLALQIFTGRWFIVFASLLIMSVNGTSYMYGLYSGEIKSSLGYDQTTLNILSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
             N+GV +GL+ EVTPPWVV+ IGA +NF  YF++W++VT  I+ P +WQMCLY+C+A NS
Sbjct  61   GNLGVSAGLVYEVTPPWVVIVIGAVMNFSAYFLIWVSVTGHIAKPHIWQMCLYMCLATNS  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
             S+ NT ALVT+V NFPESRG V+GLLKG +GLSGAI+TQ++HA+YGTD
Sbjct  121  ASYPNTAALVTSVSNFPESRGSVIGLLKGLIGLSGAIMTQIYHALYGTD  169



>ref|XP_008385510.1| PREDICTED: uncharacterized protein LOC103448053 [Malus domestica]
Length=560

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + +G  + H++ GRWF VFA+ LIM+ AGATY++G YS ++K  LGYDQT +N+L F KD
Sbjct  10   SEIGQFSWHMLNGRWFSVFASFLIMAGAGATYLYGTYSKEIKATLGYDQTEINMLGFSKD  69

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
            LG+NVGVLSGLI EVTP W VL +GA +NF GYFM+WLAVT++I  PKVWQMC+YIC+  
Sbjct  70   LGANVGVLSGLIGEVTPVWFVLIVGAVMNFAGYFMIWLAVTQRIPKPKVWQMCVYICIGA  129

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQ+FANTGALVT VKNFPESRGV+LGLLKGF GLSGAILTQ++ AVYG D
Sbjct  130  NSQNFANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGND  180



>ref|XP_004150375.2| PREDICTED: uncharacterized protein LOC101208506 [Cucumis sativus]
Length=590

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  144  RASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFK  323
            RA   S  V ++ G WFMVFA+ LIMS AG  YMFGLYSG +K  LGYDQ+TLNL+SFFK
Sbjct  9    RAITTSFFVEVLTGPWFMVFASFLIMSTAGTPYMFGLYSGAIKSVLGYDQSTLNLISFFK  68

Query  324  DLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVA  503
            DLG+NVG+++GLI E+ PPWVVL IGA +NF GYFM+WL+VT+K++ P VW MCLYIC+ 
Sbjct  69   DLGTNVGIIAGLIAEIMPPWVVLAIGAGMNFVGYFMIWLSVTEKVAAPPVWLMCLYICIG  128

Query  504  GNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
             NS SFANTGALVT VKN+P  RG VLG+LKG+VGLSGAI+TQ +HA+YG D
Sbjct  129  ANSTSFANTGALVTCVKNYPARRGAVLGILKGYVGLSGAIMTQFYHAIYGDD  180



>ref|XP_010068872.1| PREDICTED: uncharacterized protein LOC104455848 [Eucalyptus grandis]
Length=596

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            + A+ +++GRWFM+FA+ LIM+ AGATY+FG+YS D+K  LGYDQ+TLNLLS  KDLG+N
Sbjct  14   AFALQVLRGRWFMMFASFLIMAGAGATYLFGVYSKDIKSTLGYDQSTLNLLSSCKDLGAN  73

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLI EV P W+VL +G+ +NF GYF++WLAVT++I  P VWQMC+YICV  NSQ+
Sbjct  74   VGVLSGLIAEVAPTWLVLLVGSAMNFAGYFLIWLAVTRRIPRPAVWQMCVYICVGANSQN  133

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRG++LGL+KGFVGLSGA++TQL++A+YG D
Sbjct  134  FANTGSLVTCVKNFPESRGIMLGLMKGFVGLSGAMMTQLYYAIYGDD  180



>ref|XP_007219108.1| hypothetical protein PRUPE_ppa015620mg [Prunus persica]
 gb|EMJ20307.1| hypothetical protein PRUPE_ppa015620mg [Prunus persica]
Length=601

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  138  GSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSF  317
            G+ A +   A+ ++ GRW M+FA+ L+M++AGA+YMFGLYS D+K  LGY+Q+TLN++SF
Sbjct  5    GTWADIKGFALQVLTGRWLMLFASFLMMASAGASYMFGLYSNDIKSVLGYNQSTLNMISF  64

Query  318  FKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYIC  497
            FKDLG+N+G+ SGLINEVTPPWVVL IGA  NFFGYFM+WLAVT+KI+ P+VW MCLYI 
Sbjct  65   FKDLGANIGIFSGLINEVTPPWVVLSIGAAFNFFGYFMIWLAVTEKIAKPQVWHMCLYIT  124

Query  498  VAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            +  NS +F NTGA VT VKNFP SRG+++GLL G++GLS A++ QL+HA YG D
Sbjct  125  MGANSHTFINTGAFVTCVKNFPRSRGLLIGLLNGYIGLSAAVIAQLYHAFYGDD  178



>ref|XP_009612261.1| PREDICTED: uncharacterized protein LOC104105617 isoform X2 [Nicotiana 
tomentosiformis]
Length=582

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  138  GSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSF  317
            G+   +   A H+++GRWF +FA+ LIM+ AGATY+FG YS ++K +LGYDQTTLNLL F
Sbjct  7    GNGREIFHFANHVVKGRWFSLFASFLIMAGAGATYLFGTYSKEIKASLGYDQTTLNLLGF  66

Query  318  FKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYIC  497
            FKDLG+NVGV SGLI EVTP W VL +GA +NF GYFM+WL+V  KI  PKVW MC+YIC
Sbjct  67   FKDLGANVGVFSGLIAEVTPTWFVLLVGAAMNFTGYFMIWLSVVGKIPKPKVWHMCIYIC  126

Query  498  VAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            +  NSQ+FANTGALVT+V+NFPESRG ++GLLKGF GLSGAI+TQL+ AVYG D
Sbjct  127  LGANSQNFANTGALVTSVRNFPESRGNMIGLLKGFTGLSGAIMTQLYLAVYGND  180



>gb|KCW65471.1| hypothetical protein EUGRSUZ_G02881 [Eucalyptus grandis]
Length=602

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            + A+ +++GRWFM+FA+ LIM+ AGATY+FG+YS D+K  LGYDQ+TLNLLS  KDLG+N
Sbjct  16   AFALQVLRGRWFMMFASFLIMAGAGATYLFGVYSKDIKSTLGYDQSTLNLLSSCKDLGAN  75

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            VGVLSGLI EV P W+VL +G+ +NF GYF++WLAVT++I  P VWQMC+YICV  NSQ+
Sbjct  76   VGVLSGLIAEVAPTWLVLLVGSAMNFAGYFLIWLAVTRRIPRPAVWQMCVYICVGANSQN  135

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTG+LVT VKNFPESRG++LGL+KGFVGLSGA++TQL++A+YG D
Sbjct  136  FANTGSLVTCVKNFPESRGIMLGLMKGFVGLSGAMMTQLYYAIYGDD  182



>ref|XP_008456537.1| PREDICTED: uncharacterized protein LOC103496460 [Cucumis melo]
Length=600

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  144  RASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFK  323
            RA   S  V ++ G WFMVFA+ L+MS AG  YMFGLYSG +K  LGYDQ+TLNL+SFFK
Sbjct  26   RAITTSFFVEVLTGPWFMVFASFLVMSTAGTPYMFGLYSGAIKSVLGYDQSTLNLISFFK  85

Query  324  DLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVA  503
            DLG+NVG+++GLI E+ PPWVVL IGA +NF GYFM+WL+VT+K++ P VW MCLYIC+ 
Sbjct  86   DLGTNVGIIAGLIAEIMPPWVVLAIGAGMNFVGYFMIWLSVTEKVAAPPVWLMCLYICIG  145

Query  504  GNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
             NS SFANTGALVT VKN+P  RG VLG+LKG+VGLSGAI+TQ +HA+YG D
Sbjct  146  ANSTSFANTGALVTCVKNYPARRGAVLGILKGYVGLSGAIMTQFYHAIYGDD  197



>ref|XP_009621656.1| PREDICTED: uncharacterized protein LOC104113249 [Nicotiana tomentosiformis]
Length=376

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  159  SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSN  338
            S ++H++  RWFM F++ +I+S AGAT++FGLYSG++K +LGYDQTTLNL+SFFKDLG N
Sbjct  17   SFSLHLLTSRWFMAFSSLMILSMAGATFIFGLYSGEIKSSLGYDQTTLNLISFFKDLGGN  76

Query  339  VGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQS  518
            + ++SGLI E+ PP  VL IGA LN FGYFM+WLAVT +IS P VWQMCLYIC+  NSQS
Sbjct  77   LAIISGLIMEIIPPRAVLAIGAILNVFGYFMIWLAVTGRISKPHVWQMCLYICIGANSQS  136

Query  519  FANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            FANTGA VT VKNFP SRG+VLGLLKG VGLSGAI+TQL+ A YG +
Sbjct  137  FANTGATVTCVKNFPNSRGIVLGLLKGAVGLSGAIMTQLYLAFYGDN  183



>ref|XP_009612260.1| PREDICTED: uncharacterized protein LOC104105617 isoform X1 [Nicotiana 
tomentosiformis]
Length=600

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 11/184 (6%)
 Frame = +3

Query  141  SRASMGSL-----------AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGY  287
             R  MG L           A H+++GRWF +FA+ LIM+ AGATY+FG YS ++K +LGY
Sbjct  15   KRGDMGELPMGNGREIFHFANHVVKGRWFSLFASFLIMAGAGATYLFGTYSKEIKASLGY  74

Query  288  DQTTLNLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTP  467
            DQTTLNLL FFKDLG+NVGV SGLI EVTP W VL +GA +NF GYFM+WL+V  KI  P
Sbjct  75   DQTTLNLLGFFKDLGANVGVFSGLIAEVTPTWFVLLVGAAMNFTGYFMIWLSVVGKIPKP  134

Query  468  KVWQMCLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAV  647
            KVW MC+YIC+  NSQ+FANTGALVT+V+NFPESRG ++GLLKGF GLSGAI+TQL+ AV
Sbjct  135  KVWHMCIYICLGANSQNFANTGALVTSVRNFPESRGNMIGLLKGFTGLSGAIMTQLYLAV  194

Query  648  YGTD  659
            YG D
Sbjct  195  YGND  198



>ref|XP_008355198.1| PREDICTED: uncharacterized protein LOC103418866 [Malus domestica]
Length=559

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A+H++QGRWF VFA+ LIM+ AGATY+FG+YS  +K +LGYDQTTLN L  FKDLG+NVG
Sbjct  13   AIHVLQGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNXLGSFKDLGANVG  72

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLI EVTP W VL IG+ +NF GYFM+WLA+T KI  PKVW MCLYIC+  NSQ+FA
Sbjct  73   VLSGLIGEVTPTWFVLLIGSAMNFTGYFMIWLAITAKIPKPKVWHMCLYICIGANSQNFA  132

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFP SRGV+LGLLKGF GLSGA+ TQ++ A+YG +
Sbjct  133  NTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAIYGNN  177



>ref|XP_006349027.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Solanum 
tuberosum]
Length=573

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
            H+IQGRWF +FA+ LIM+ AGATY+FG YS ++K +LGYDQTTLNLL FFKDLG+NVGV 
Sbjct  18   HVIQGRWFSLFASFLIMAGAGATYLFGTYSKEIKSSLGYDQTTLNLLGFFKDLGANVGVF  77

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGL+ EVTP W VL +GA++NF GYFM+W +V  KI  P VW MC+YIC+  NSQ+FANT
Sbjct  78   SGLLAEVTPTWFVLLVGASMNFTGYFMIWFSVVGKIQKPNVWLMCMYICLGANSQNFANT  137

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            GALVT+VKNFPESRG ++GLLKGF GLSGAI+TQL+ AVYG D
Sbjct  138  GALVTSVKNFPESRGNLIGLLKGFTGLSGAIMTQLYLAVYGND  180



>ref|XP_009368937.1| PREDICTED: uncharacterized protein LOC103958409 [Pyrus x bretschneideri]
 ref|XP_009368984.1| PREDICTED: uncharacterized protein LOC103958445 [Pyrus x bretschneideri]
Length=607

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = +3

Query  129  AGGGSRA--SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTL  302
            +G G R    M   AV +I GRW M+FA+ L+M++AGA+YMFGLYS D+K  LGY Q+TL
Sbjct  9    SGNGVRTWTDMKGFAVQVITGRWLMLFASFLMMASAGASYMFGLYSNDIKSVLGYSQSTL  68

Query  303  NLLSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQM  482
            N +SFFKDLG+N+G+ SGL+NEVTPPWVVL IGA  NFFGYFM+WLAV +KI+ P+VW M
Sbjct  69   NTISFFKDLGANIGIFSGLVNEVTPPWVVLSIGAAFNFFGYFMIWLAVAQKIAKPQVWHM  128

Query  483  CLYICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            CLYI +  NS +F NTGALVT VKNFP +RG+++GLL+G++GLS A++ Q++HA+YG D
Sbjct  129  CLYITMGANSHTFINTGALVTCVKNFPRNRGLLIGLLEGYIGLSAAVIVQIYHALYGND  187



>ref|XP_008226513.1| PREDICTED: uncharacterized protein LOC103326077 [Prunus mume]
Length=554

 Score =   224 bits (570),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + +G  + H++ GRWF VFA+ LIM+ AGATY++G YS ++K  LGYDQT +N+L F KD
Sbjct  4    SEIGRFSWHMLTGRWFSVFASFLIMAGAGATYLYGTYSKEIKSTLGYDQTEINMLGFSKD  63

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
             G+NVGVLSGLI EVTP W VL IGA +NF GYFM+WLAVT +I  PKVWQMC+YIC+  
Sbjct  64   FGANVGVLSGLIGEVTPVWFVLIIGAVMNFVGYFMIWLAVTGRIPKPKVWQMCIYICIGA  123

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQ+FANTGALVT VKNFPESRGV+LGLLKGF GLSGAILTQ++ AVYG D
Sbjct  124  NSQNFANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGND  174



>ref|XP_011651970.1| PREDICTED: uncharacterized protein LOC101216551 [Cucumis sativus]
 gb|KGN58997.1| hypothetical protein Csa_3G742600 [Cucumis sativus]
Length=580

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  183  GRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVLSGLI  362
            GRWF V A+ LIMS AGATYMF LYS D+K +LGYDQTTLNLLSFFKDLG NVGV+SGL 
Sbjct  21   GRWFSVLASILIMSVAGATYMFALYSSDIKSSLGYDQTTLNLLSFFKDLGGNVGVISGLT  80

Query  363  NEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANTGALV  542
            NEV P WVVL IGA +N FGY M+WLAVTK+I  P++W MCLYI +  NSQ+FANTGALV
Sbjct  81   NEVAPAWVVLLIGAVMNLFGYTMIWLAVTKRIPKPQIWHMCLYITIGANSQTFANTGALV  140

Query  543  TAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            T VKNFPESRG VLGLLKGFVGLSGAIL+QL+ A YG +
Sbjct  141  TCVKNFPESRGSVLGLLKGFVGLSGAILSQLYRAFYGNN  179



>ref|XP_002464077.1| hypothetical protein SORBIDRAFT_01g011890 [Sorghum bicolor]
 gb|EER91075.1| hypothetical protein SORBIDRAFT_01g011890 [Sorghum bicolor]
Length=647

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  AGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            A G   AS    A+H+++GRWFM FA+ LIM+AAG TY+FG+YS  +K +LGYDQ TLN 
Sbjct  13   APGADAASTMRFALHVMRGRWFMFFASILIMAAAGGTYIFGIYSKAIKTSLGYDQQTLNT  72

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            LSFFKD+G+NVG+L GLINEVTPPWVVL  GA +N  GY M++LA+T + + P VW MC+
Sbjct  73   LSFFKDVGANVGILPGLINEVTPPWVVLLCGAGMNLVGYLMIYLAITGRTAQPPVWLMCV  132

Query  489  YICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            YI V  NSQSFANTG+LVTAVKNFPE RGVVLGLLKGFVGLSGAI TQL+ A+YGTD
Sbjct  133  YIAVGANSQSFANTGSLVTAVKNFPEDRGVVLGLLKGFVGLSGAIFTQLYRAIYGTD  189



>ref|XP_008665606.1| PREDICTED: uncharacterized protein LOC103644190 [Zea mays]
 tpg|DAA51972.1| TPA: hypothetical protein ZEAMMB73_438867 [Zea mays]
 tpg|DAA51973.1| TPA: hypothetical protein ZEAMMB73_438867 [Zea mays]
Length=647

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = +3

Query  129  AGGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            A GG +         ++QGRWFMVFA  LI+SA+GATY+F +YS  LK  LGYDQ TLN 
Sbjct  43   AAGGPQVLTARFVRQVVQGRWFMVFACLLILSASGATYIFSIYSKVLKSTLGYDQRTLNT  102

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            LSFFKDLG+NVGV+SGLINEVTPPWVVL +GA +N  GY M++LA+  + + P VW MC+
Sbjct  103  LSFFKDLGANVGVISGLINEVTPPWVVLAMGAAMNLAGYLMIYLAIDGRTARPPVWLMCI  162

Query  489  YICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            YICV  NSQSFANTGALVT VKNFPESRGVVLGLLKGFVGLSGAI TQL+ A+YG D
Sbjct  163  YICVGANSQSFANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIFTQLYLAIYGDD  219



>ref|XP_004250977.1| PREDICTED: uncharacterized membrane protein YMR155W [Solanum 
lycopersicum]
Length=555

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
            H+IQGRWF +FA+ LIM+ AGATY+FG YS ++K +LGYDQTTLNLL FFKDLG+NVGV 
Sbjct  18   HVIQGRWFSLFASFLIMAGAGATYLFGTYSKEIKSSLGYDQTTLNLLGFFKDLGANVGVF  77

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGL+ E+TP W VL +GA++NF GYFM+WL+V  KI  PKVW M +YIC+  NSQ+FANT
Sbjct  78   SGLLAEITPTWFVLLVGASMNFIGYFMIWLSVAGKIQKPKVWLMSMYICIGANSQNFANT  137

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            GALVT+V+NFP+SRG ++GLLKGF GLSGAILTQL+ A+YG D
Sbjct  138  GALVTSVRNFPQSRGNMIGLLKGFTGLSGAILTQLYLALYGND  180



>dbj|BAJ86921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A  ++ GRWFMVFA  LI+SA+GATY+FGLYS  LK ALGYDQ TLN  +FFKDLG+NVG
Sbjct  28   ARQVVLGRWFMVFACLLILSASGATYIFGLYSKVLKSALGYDQQTLNTFAFFKDLGANVG  87

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLINEVTPPWVVL +GA +N  GY M++LA+  + S P VW MC+YICV  NSQSFA
Sbjct  88   VLSGLINEVTPPWVVLAMGAAMNLVGYLMIYLAIDGRTSRPPVWLMCVYICVGANSQSFA  147

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRGVVLGLLKGFVGLSGAI TQL+ A+YG D
Sbjct  148  NTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIFTQLYIAIYGDD  192



>dbj|BAJ93275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A  ++ GRWFMVFA  LI+SA+GATY+FGLYS  LK ALGYDQ TLN  +FFKDLG+NVG
Sbjct  28   ARQVVLGRWFMVFACLLILSASGATYIFGLYSKVLKSALGYDQQTLNTFAFFKDLGANVG  87

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            VLSGLINEVTPPWVVL +GA +N  GY M++LA+  + S P VW MC+YICV  NSQSFA
Sbjct  88   VLSGLINEVTPPWVVLAMGAAMNLVGYLMIYLAIDGRTSRPPVWLMCVYICVGANSQSFA  147

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRGVVLGLLKGFVGLSGAI TQL+ A+YG D
Sbjct  148  NTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIFTQLYIAIYGDD  192



>gb|EPS59101.1| hypothetical protein M569_15705, partial [Genlisea aurea]
Length=549

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            A   +  RWFMVFA  LIMS +GA+Y+FG+YS D+K ALGYDQTTLNL+ FFKDLG N+G
Sbjct  2    ARQFLTSRWFMVFACLLIMSMSGASYIFGIYSNDMKRALGYDQTTLNLVGFFKDLGGNIG  61

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            ++SG+INEVTPPWVVL IG ++NF GYF++WLAVT + + P +WQMC+YIC+  NSQ+F+
Sbjct  62   IVSGVINEVTPPWVVLAIGMSMNFAGYFLIWLAVTGRTAKPPLWQMCMYICIGANSQTFS  121

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRG+V+GLLKGF GLSGAI+TQ+F   +G D
Sbjct  122  NTGALVTCVKNFPESRGIVIGLLKGFTGLSGAIITQIFRGFFGND  166



>ref|XP_010045310.1| PREDICTED: uncharacterized protein LOC104434056 [Eucalyptus grandis]
 gb|KCW87472.1| hypothetical protein EUGRSUZ_B03936 [Eucalyptus grandis]
Length=599

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
            H++QGRWF VFA+ L+M  AGATY+FG+YS  +K  LGYDQTTLNLL FFKDLG+NVGVL
Sbjct  18   HLLQGRWFTVFASFLVMFGAGATYLFGIYSKQIKSTLGYDQTTLNLLGFFKDLGANVGVL  77

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGLI EVTP W VL  G+ +NF GYF++WL VT KI+ P VWQMC+YIC+  NSQ+FANT
Sbjct  78   SGLIAEVTPTWFVLLTGSAMNFAGYFLIWLVVTGKIARPAVWQMCIYICIGANSQNFANT  137

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            GALVT VKNFPE RGV+LGLLKGFVGLSGA++TQ++ A+YG D
Sbjct  138  GALVTCVKNFPEGRGVMLGLLKGFVGLSGAVMTQMYLAIYGND  180



>emb|CAN71485.1| hypothetical protein VITISV_025339 [Vitis vinifera]
Length=546

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 136/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIM-SAAGATYMFGLYSGDLKDALGYDQTTLNL  308
            G G  A + +L + ++ GRWFM FA+ L+M  A+GA   FGLYS  +K +LGYDQTTLNL
Sbjct  7    GSGHWAEVRALTLDVLAGRWFMAFASILVMFVASGANSTFGLYSNAIKSSLGYDQTTLNL  66

Query  309  LSFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCL  488
            LSFFKDLG+NVG+L+GLINEVTPPWVVL I A +NFFGYFM+WLAVT KI  P++W MCL
Sbjct  67   LSFFKDLGANVGILAGLINEVTPPWVVLSISAAMNFFGYFMIWLAVTGKIXHPQLWHMCL  126

Query  489  YICVAGNSQSFANTGALVTAVKNFPESR-gvvlgllkgfvglSGAILTQLFHAVYGTD  659
            YI +  NSQSFA TGALVT VKNFPESR  V+  L     GLS AI+TQLFHA+Y  D
Sbjct  127  YILIGSNSQSFATTGALVTCVKNFPESRGPVLGILKGYQGGLSAAIITQLFHALYAND  184



>ref|XP_006424462.1| hypothetical protein CICLE_v10028100mg [Citrus clementina]
 gb|ESR37702.1| hypothetical protein CICLE_v10028100mg [Citrus clementina]
Length=568

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  162  LAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNV  341
            L +H+I+GRWF VFA+ LIM+ AGATY+FG YS D+K +LGYDQ+TLNLL FFKDLG+NV
Sbjct  15   LMLHVIRGRWFSVFASFLIMAGAGATYLFGTYSKDIKASLGYDQSTLNLLGFFKDLGANV  74

Query  342  GVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSF  521
            GV SGL+ E+TP W VL +G+ +NF GY M+WLAVT KI  P VW MC YIC+  NSQ+F
Sbjct  75   GVPSGLLGEITPTWFVLLVGSGMNFAGYLMIWLAVTGKIPKPAVWHMCAYICIGANSQNF  134

Query  522  ANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            ANTGALVT VKNFPESRG ++GLLKGF GLSGAILTQ++ AVYG D
Sbjct  135  ANTGALVTCVKNFPESRGNMIGLLKGFTGLSGAILTQVYLAVYGND  180



>ref|XP_009782107.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Nicotiana 
sylvestris]
Length=565

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            + +  +  ++GRWFM+FA+ LIM+ AGATY+FG+YS  +K  LGYDQ+TLNLL   KDLG
Sbjct  13   LCNFTLQFLRGRWFMMFASFLIMAGAGATYLFGVYSKVIKSTLGYDQSTLNLLGTCKDLG  72

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVGVLSGL+ EVTP W VL +G+ +NF GYF++WLAVTKKI+TPKVWQMC+YIC+  NS
Sbjct  73   ANVGVLSGLLAEVTPTWFVLLVGSVMNFAGYFLIWLAVTKKIATPKVWQMCIYICIGANS  132

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Q+FANTG+LVT VKNFPESRG++LGL+KGFVGLSGAI TQL+ A+YG D
Sbjct  133  QNFANTGSLVTCVKNFPESRGMMLGLMKGFVGLSGAIFTQLYLAIYGND  181



>ref|XP_007206680.1| hypothetical protein PRUPE_ppa022835mg [Prunus persica]
 gb|EMJ07879.1| hypothetical protein PRUPE_ppa022835mg [Prunus persica]
Length=554

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  147  ASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKD  326
            + +G  + +++ GRWF VFA+ LIM+ AGATY++G YS ++K  LGYDQT +N+L F KD
Sbjct  4    SEIGRFSRYMLTGRWFSVFASFLIMAGAGATYLYGTYSKEIKSTLGYDQTEINMLGFSKD  63

Query  327  LGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAG  506
             G+NVGVLSGLI EVTP W VL IGA +NF GYFM+WLAVT +I  PKVWQMC+YIC+  
Sbjct  64   FGANVGVLSGLIGEVTPVWFVLIIGAVMNFVGYFMIWLAVTGRIPKPKVWQMCVYICIGA  123

Query  507  NSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NSQ+FANTGALVT VKNFPESRGV+LGLLKGF GLSGAILTQ++ AVYG D
Sbjct  124  NSQNFANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGND  174



>ref|XP_007027450.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY07952.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=550

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  132  GGGSRASMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLL  311
            GGGSR  M S  + ++  R FMVFAT +IMS  G+ YMFGLYS D+K  LGYDQTTLNLL
Sbjct  8    GGGSRREMKSFFLAVLSSRLFMVFATIIIMSVNGSGYMFGLYSNDIKTTLGYDQTTLNLL  67

Query  312  SFFKDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLY  491
            SFFKDLG N+G+LSGLI EV PPWVVL +G+ LNFFGYFM+WL+VT + + P+VWQMCLY
Sbjct  68   SFFKDLGGNLGILSGLIYEVVPPWVVLSMGSVLNFFGYFMIWLSVTSRTAKPQVWQMCLY  127

Query  492  ICVAGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYG  653
            + +A NSQSF NTGALVT VKNFP SRG VLGLLKGF+GLSGAI+TQ  +   G
Sbjct  128  MWIAANSQSFPNTGALVTCVKNFPGSRGCVLGLLKGFIGLSGAIMTQFLYIALG  181



>ref|XP_003559292.1| PREDICTED: uncharacterized protein LOC100830563 [Brachypodium 
distachyon]
Length=634

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = +3

Query  144  RASMG-SLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFF  320
            R SM    A  ++ GRWFMVFA  LI+SA+GATY+FG+YS +LK  LGYDQ TLN LSFF
Sbjct  24   RNSMTLQFARQVVTGRWFMVFACLLILSASGATYIFGIYSKELKSTLGYDQRTLNTLSFF  83

Query  321  KDLGSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICV  500
            KDLG+NVGVLSGLINEVTPPWVVL +GA +N  GY M++LA+  K   P VW MC+YICV
Sbjct  84   KDLGANVGVLSGLINEVTPPWVVLSMGAAMNLAGYLMIYLAIDGKTRRPPVWLMCIYICV  143

Query  501  AGNSQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
              NSQSF NTGALVT VKNFPESRGVVLGLLKGFVGLSGAI TQL+ A+YG D
Sbjct  144  GANSQSFTNTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIFTQLYIAIYGDD  196



>ref|XP_006488014.1| PREDICTED: uncharacterized protein LOC102630186 [Citrus sinensis]
Length=568

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            +H+I+GRWF VFA+ LIM+ AGATY+FG YS D+K +LGYDQ+TLNLL FFKDLG+NVGV
Sbjct  17   LHVIRGRWFSVFASFLIMAGAGATYLFGTYSKDIKASLGYDQSTLNLLGFFKDLGANVGV  76

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
             SGL+ E+TP W VL +G+ +NF GY M+WLAVT KI+ P VW MC YIC+  NSQ+FAN
Sbjct  77   PSGLLGEITPTWFVLLVGSGMNFAGYLMIWLAVTGKIAKPAVWHMCAYICIGANSQNFAN  136

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT VKNFPESRG ++GLLKGF GLSGAILTQ++ AVYG D
Sbjct  137  TGALVTCVKNFPESRGNMIGLLKGFTGLSGAILTQVYLAVYGND  180



>ref|XP_009614669.1| PREDICTED: uncharacterized protein LOC104107543 [Nicotiana tomentosiformis]
Length=577

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            + +  +  ++GRWFM+FA+ LIM+ AGATY+FG+YS  +K  LGYDQ+TLNLL   KDLG
Sbjct  9    LCNFTLQFLRGRWFMMFASFLIMAGAGATYLFGVYSKVIKSTLGYDQSTLNLLGTCKDLG  68

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
            +NVGVLSGL+ E+TP W VL +G+ +NF GYF++WLAVTKKI+TPKVWQMC+YIC+  NS
Sbjct  69   ANVGVLSGLLAEITPTWFVLLVGSVMNFAGYFLIWLAVTKKIATPKVWQMCIYICIGANS  128

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            Q+FANTG+LVT VKNFPESRG++LGL+KGFVGLSGAI TQL+ A+YG D
Sbjct  129  QNFANTGSLVTCVKNFPESRGMMLGLMKGFVGLSGAIFTQLYLAIYGND  177



>ref|XP_003590250.1| Nodule-specific protein Nlj70 [Medicago truncatula]
 gb|AES60501.1| MFS transporter [Medicago truncatula]
Length=597

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +3

Query  168  VHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGV  347
            + ++ GRWFMVF++ +IMS +GA+YMFGLYS ++K  LGYDQ+TL LLSFFKDLGSN+G+
Sbjct  18   LQVLTGRWFMVFSSFMIMSVSGASYMFGLYSREIKSVLGYDQSTLTLLSFFKDLGSNIGI  77

Query  348  LSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFAN  527
            LSGL+NE+TPPWVVL IG  LNFFGYFM+WLAVT+KI  P +W MCLYI +  NS    N
Sbjct  78   LSGLLNEITPPWVVLTIGGLLNFFGYFMIWLAVTRKIPKPPIWNMCLYIFIGANSHCSTN  137

Query  528  TGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            TGALVT+VKNFP SRGVV+GLL G++GLSGAI+TQL++A YG D
Sbjct  138  TGALVTSVKNFPGSRGVVIGLLSGYLGLSGAIITQLYYAFYGND  181



>ref|XP_002301218.2| hypothetical protein POPTR_0002s13500g, partial [Populus trichocarpa]
 gb|EEE80491.2| hypothetical protein POPTR_0002s13500g, partial [Populus trichocarpa]
Length=503

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = +3

Query  153  MGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLG  332
            M S ++ I+  RWF +FA+ LIMS  G +YMFGLYSGD+K +LGYDQTTLN LSFFKDLG
Sbjct  1    MRSFSLQILSSRWFTIFASLLIMSVNGTSYMFGLYSGDIKTSLGYDQTTLNTLSFFKDLG  60

Query  333  SNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNS  512
             N+GV +GL+ E+ PPWVVL IGA +NF  YF++W+ VT +I+ P++WQ+CLY+C+A N+
Sbjct  61   GNLGVSAGLVYEIMPPWVVLSIGAVMNFSAYFLIWVTVTGRINKPRLWQVCLYMCLATNA  120

Query  513  QSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
             S+ NTGALVT VKNFPESRG V+GLLKG + LSGAI+TQL+HA YG D
Sbjct  121  ASYPNTGALVTCVKNFPESRGSVIGLLKGLISLSGAIMTQLYHAFYGND  169



>ref|XP_010689140.1| PREDICTED: uncharacterized protein LOC104902902 [Beta vulgaris 
subsp. vulgaris]
Length=599

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  165  AVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVG  344
            AV +I+GRWF VFA+ LIM+ AGATY+F +YS ++K +LGY+Q+TLNLL FFKDLG+NVG
Sbjct  13   AVQVIKGRWFTVFASFLIMAGAGATYLFAIYSKEIKSSLGYNQSTLNLLGFFKDLGANVG  72

Query  345  VLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFA  524
            V SGLI EV P W VL IG+ +NF GYFM+WLAVT KIS PKVW MCLYI +  NSQ+FA
Sbjct  73   VFSGLIAEVIPTWAVLLIGSAMNFAGYFMIWLAVTYKISRPKVWHMCLYIMMGANSQNFA  132

Query  525  NTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            NTGALVT VKNFPESRGV+LGLLKG+VGLSGA++TQ++ A+YG D
Sbjct  133  NTGALVTCVKNFPESRGVMLGLLKGYVGLSGAVMTQIYLAIYGND  177



>ref|XP_011084394.1| PREDICTED: uncharacterized protein LOC105166652 [Sesamum indicum]
Length=603

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
             ++ GRWFM+FA+ LIM+ AGATY+FG+YS  +K  LGYDQ+TLNLL  FKDLG+NVGVL
Sbjct  25   QVLVGRWFMMFASFLIMAGAGATYLFGVYSKVIKSTLGYDQSTLNLLGSFKDLGANVGVL  84

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGL+ EVTP W VL +G+ +NF GYFM+WLAVTKKIS P VWQMC+YIC+  NSQ+FANT
Sbjct  85   SGLMAEVTPTWFVLLVGSAMNFAGYFMIWLAVTKKISKPSVWQMCIYICMGANSQNFANT  144

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            G+LVT VKNFPESRG+++GL+KGF+GLSGA+ TQL+ A+YG D
Sbjct  145  GSLVTCVKNFPESRGMLIGLMKGFIGLSGAVFTQLYLAIYGND  187



>ref|XP_004142503.1| PREDICTED: uncharacterized protein LOC101205503 [Cucumis sativus]
Length=596

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
            +M S  + +I+G WFM+FA+ LIMS AG  YMFGLYS  +K  LGYDQTTLN +SFFKD+
Sbjct  5    NMKSFTLKLIKGSWFMMFASFLIMSMAGIPYMFGLYSSTIKTVLGYDQTTLNFISFFKDV  64

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+ VGV++GLINEVTPPW +L +GA LNFFGYFM+WL+V+KKIST  VW MCLYICV  N
Sbjct  65   GTTVGVVAGLINEVTPPWSILAMGAALNFFGYFMIWLSVSKKIST-HVWLMCLYICVGAN  123

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            + +FANTGALVT VKN+P+ RGVV+G+LKG++GLSGAI+TQL+HA+YG D
Sbjct  124  ATTFANTGALVTCVKNYPQRRGVVIGILKGYMGLSGAIVTQLYHAIYGKD  173



>ref|XP_004981407.1| PREDICTED: uncharacterized protein LOC101759573 [Setaria italica]
Length=622

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +3

Query  171  HIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGSNVGVL  350
             ++ GRWFMVFA  LI+SA+GATY+FG+YS  LK +LGYDQ TLN LSFFKDLG+NVGVL
Sbjct  23   QVVLGRWFMVFACLLILSASGATYIFGIYSKVLKSSLGYDQRTLNTLSFFKDLGANVGVL  82

Query  351  SGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQSFANT  530
            SGLINEVTPPWVVL +GA +N  GY M++LA+  + + P VW MC+YICV  NSQSFANT
Sbjct  83   SGLINEVTPPWVVLAMGAAMNLVGYLMIYLAIDGRTARPPVWLMCIYICVGANSQSFANT  142

Query  531  GALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            GALVT VKNFPESRG+VLGLLKGFVGLSGAI TQL+ A+YG D
Sbjct  143  GALVTCVKNFPESRGIVLGLLKGFVGLSGAIFTQLYLAIYGDD  185



>ref|XP_006361717.1| PREDICTED: uncharacterized protein LOC102585444 [Solanum tuberosum]
Length=582

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = +3

Query  150  SMGSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDL  329
             + +  +  ++GRWFM+FA+ LIM+ AGATY+FG+YS  +K  LGYDQTTLNLLS FKDL
Sbjct  6    KLCNFTLQFLRGRWFMMFASYLIMAGAGATYLFGVYSKTIKSTLGYDQTTLNLLSTFKDL  65

Query  330  GSNVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGN  509
            G+NVGVLSGL+ EVTP W VL IG+ +N  GY ++WLAVTKKI+TPK+W MC+YIC+  N
Sbjct  66   GANVGVLSGLLAEVTPTWFVLLIGSLMNISGYLLIWLAVTKKIATPKIWHMCVYICIGAN  125

Query  510  SQSFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            SQ+FANTG+LVT VKNFP SRG++LGL+KGFVGLSGAI TQL+ A+YG D
Sbjct  126  SQNFANTGSLVTCVKNFPHSRGMMLGLMKGFVGLSGAIFTQLYLAIYGND  175



>emb|CDP14418.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  156  GSLAVHIIQGRWFMVFATTLIMSAAGATYMFGLYSGDLKDALGYDQTTLNLLSFFKDLGS  335
            G+  +H++  RWFMVFAT LIMS +GATYMFG+YSGD+K +LGYDQTTLNL+SFFKD+G+
Sbjct  16   GAFVLHLLNSRWFMVFATLLIMSMSGATYMFGIYSGDIKSSLGYDQTTLNLVSFFKDVGA  75

Query  336  NVGVLSGLINEVTPPWVVLFIGATLNFFGYFMMWLAVTKKISTPKVWQMCLYICVAGNSQ  515
            N+G+++GL+NEV PPW+VL  GA +NFFGYFM+WL VT +I+ P VWQ+ LYIC+  NSQ
Sbjct  76   NIGIVAGLVNEVAPPWLVLSCGAIMNFFGYFMIWLVVTHRIAKPPVWQIYLYICIGANSQ  135

Query  516  SFANTGALVTAVKNFPESRgvvlgllkgfvglSGAILTQLFHAVYGTD  659
            +FA   ALV+ VKN PESRGVVLG+LKGF+GLSGAI+TQL+ A YG +
Sbjct  136  TFAGVVALVSCVKNCPESRGVVLGILKGFIGLSGAIITQLYLAFYGHN  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1049455598775