BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig787

Length=876
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           176   6e-47   Nicotiana sylvestris
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           172   9e-46   Nicotiana tomentosiformis
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               168   3e-44   Solanum tuberosum [potatoes]
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               164   1e-42   Solanum tuberosum [potatoes]
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           162   4e-42   
gb|KDO43361.1|  hypothetical protein CISIN_1g0369161mg                  154   2e-40   Citrus sinensis [apfelsine]
ref|XP_006471190.1|  PREDICTED: cytochrome P450 82A3-like               152   2e-40   Citrus sinensis [apfelsine]
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           157   3e-40   Nicotiana sylvestris
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               157   4e-40   Nicotiana tomentosiformis
ref|XP_007017415.1|  Cytochrome P450, putative                          156   5e-40   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           157   1e-39   
gb|KDO57198.1|  hypothetical protein CISIN_1g044206mg                   149   1e-39   Citrus sinensis [apfelsine]
gb|KJB63762.1|  hypothetical protein B456_010G014800                    154   2e-39   Gossypium raimondii
ref|XP_006431672.1|  hypothetical protein CICLE_v10001614mg             151   4e-39   
ref|XP_007017413.1|  Cytochrome P450                                    154   4e-39   
gb|KJB63759.1|  hypothetical protein B456_010G014500                    154   5e-39   Gossypium raimondii
ref|XP_002510311.1|  cytochrome P450, putative                          154   5e-39   Ricinus communis
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               154   5e-39   Citrus sinensis [apfelsine]
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             153   6e-39   
ref|XP_012081502.1|  PREDICTED: cytochrome P450 CYP82D47-like           153   7e-39   Jatropha curcas
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           153   8e-39   Nelumbo nucifera [Indian lotus]
ref|XP_002510308.1|  cytochrome P450, putative                          152   1e-38   Ricinus communis
ref|XP_006375023.1|  hypothetical protein POPTR_0014s03670g             146   1e-38   
ref|XP_006387541.1|  hypothetical protein POPTR_0875s00200g             150   1e-38   
gb|AGO03797.1|  cytochrome P450-like protein                            152   1e-38   Tanacetum cinerariifolium [pyrethrum]
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               152   2e-38   Glycine max [soybeans]
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           152   2e-38   Solanum lycopersicum
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               151   4e-38   Malus domestica [apple tree]
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         151   4e-38   Jatropha curcas
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               151   5e-38   Citrus sinensis [apfelsine]
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               151   5e-38   Solanum tuberosum [potatoes]
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           151   5e-38   Solanum lycopersicum
ref|XP_004291926.1|  PREDICTED: cytochrome P450 CYP82D47-like           150   6e-38   Fragaria vesca subsp. vesca
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               150   1e-37   Citrus sinensis [apfelsine]
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               150   1e-37   Citrus sinensis [apfelsine]
gb|KJB63751.1|  hypothetical protein B456_010G014900                    148   1e-37   Gossypium raimondii
ref|XP_007017411.1|  Cytochrome P450, putative                          149   1e-37   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           149   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               149   2e-37   Glycine max [soybeans]
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           149   3e-37   Prunus mume [ume]
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     149   3e-37   
ref|XP_004308852.2|  PREDICTED: cytochrome P450 CYP82D47-like           149   3e-37   Fragaria vesca subsp. vesca
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           149   3e-37   Eucalyptus grandis [rose gum]
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     148   4e-37   Eucalyptus grandis [rose gum]
gb|KHN34164.1|  Cytochrome P450 82A4                                    148   4e-37   Glycine soja [wild soybean]
dbj|BAF98469.1|  cytochrome P450                                        148   4e-37   Coptis japonica var. dissecta
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    148   4e-37   Populus euphratica
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    148   4e-37   Populus euphratica
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               148   5e-37   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             148   6e-37   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               148   6e-37   Citrus sinensis [apfelsine]
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             147   7e-37   Citrus clementina [clementine]
ref|XP_011030937.1|  PREDICTED: cytochrome P450 CYP82H23-like           144   7e-37   Populus euphratica
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               147   8e-37   
gb|KHN19614.1|  Cytochrome P450 82A4                                    147   1e-36   Glycine soja [wild soybean]
gb|KDO42969.1|  hypothetical protein CISIN_1g048689mg                   142   1e-36   Citrus sinensis [apfelsine]
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           147   1e-36   Eucalyptus grandis [rose gum]
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     147   1e-36   Eucalyptus grandis [rose gum]
emb|CAN74205.1|  hypothetical protein VITISV_031127                     147   1e-36   Vitis vinifera
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     149   1e-36   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   146   2e-36   Citrus sinensis [apfelsine]
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           146   2e-36   Vitis vinifera
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             146   2e-36   Citrus clementina [clementine]
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               146   2e-36   Vitis vinifera
gb|KJB14542.1|  hypothetical protein B456_002G130200                    145   3e-36   Gossypium raimondii
ref|XP_006432715.1|  hypothetical protein CICLE_v10003834mg             140   3e-36   
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             145   3e-36   
gb|KDO36922.1|  hypothetical protein CISIN_1g041575mg                   141   3e-36   Citrus sinensis [apfelsine]
ref|XP_012071999.1|  PREDICTED: cytochrome P450 CYP82D47-like           145   4e-36   Jatropha curcas
ref|XP_012071745.1|  PREDICTED: cytochrome P450 CYP82D47-like           145   4e-36   Jatropha curcas
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               145   4e-36   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               145   4e-36   
gb|KDO44281.1|  hypothetical protein CISIN_1g037130mg                   140   4e-36   Citrus sinensis [apfelsine]
gb|KJB63753.1|  hypothetical protein B456_010G014200                    142   4e-36   Gossypium raimondii
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           145   5e-36   Pyrus x bretschneideri [bai li]
gb|KJB63755.1|  hypothetical protein B456_010G014200                    142   5e-36   Gossypium raimondii
gb|KJB63756.1|  hypothetical protein B456_010G014200                    142   5e-36   Gossypium raimondii
ref|XP_010060881.1|  PREDICTED: cytochrome P450 82A3-like               141   5e-36   Eucalyptus grandis [rose gum]
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               145   6e-36   Malus domestica [apple tree]
emb|CAN74206.1|  hypothetical protein VITISV_031128                     141   6e-36   Vitis vinifera
gb|KJB63765.1|  hypothetical protein B456_010G015200                    145   6e-36   Gossypium raimondii
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     144   7e-36   Eucalyptus grandis [rose gum]
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           145   7e-36   Vitis vinifera
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     144   7e-36   Eucalyptus grandis [rose gum]
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           145   8e-36   Eucalyptus grandis [rose gum]
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               147   8e-36   
gb|ABB20912.1|  P450 mono-oxygenase                                     144   9e-36   Stevia rebaudiana
ref|XP_012071747.1|  PREDICTED: cytochrome P450 CYP82D47-like           144   1e-35   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               144   1e-35   
gb|KHG26594.1|  Cytochrome P450                                         144   1e-35   Gossypium arboreum [tree cotton]
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           144   1e-35   
ref|XP_010106083.1|  Cytochrome P450 82A3                               144   1e-35   Morus notabilis
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         144   1e-35   Jatropha curcas
ref|XP_004306669.1|  PREDICTED: cytochrome P450 CYP82D47-like           144   1e-35   Fragaria vesca subsp. vesca
gb|KJB63754.1|  hypothetical protein B456_010G014200                    143   1e-35   Gossypium raimondii
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               144   1e-35   Glycine max [soybeans]
gb|KHN13272.1|  Cytochrome P450 82A4                                    144   1e-35   Glycine soja [wild soybean]
ref|XP_010092357.1|  Cytochrome P450 82A3                               144   2e-35   Morus notabilis
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               144   2e-35   Glycine max [soybeans]
gb|KJB59837.1|  hypothetical protein B456_009G274900                    144   2e-35   Gossypium raimondii
gb|KJB63763.1|  hypothetical protein B456_010G015000                    146   2e-35   Gossypium raimondii
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           144   2e-35   Eucalyptus grandis [rose gum]
ref|XP_006375027.1|  putative cytochrome P450 family protein            137   2e-35   
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           143   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               143   2e-35   Solanum tuberosum [potatoes]
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           143   2e-35   Populus euphratica
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     143   2e-35   Eucalyptus grandis [rose gum]
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             143   2e-35   Phaseolus vulgaris [French bean]
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           143   3e-35   Eucalyptus grandis [rose gum]
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             143   3e-35   Citrus clementina [clementine]
gb|KJB63760.1|  hypothetical protein B456_010G014600                    142   4e-35   Gossypium raimondii
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               142   4e-35   Solanum tuberosum [potatoes]
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               142   4e-35   Glycine max [soybeans]
gb|KJB63758.1|  hypothetical protein B456_010G014400                    138   4e-35   Gossypium raimondii
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           142   5e-35   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             142   5e-35   Citrus clementina [clementine]
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   142   5e-35   Citrus sinensis [apfelsine]
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             142   5e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                142   5e-35   Vitis vinifera
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   142   6e-35   Citrus sinensis [apfelsine]
ref|XP_006486513.1|  PREDICTED: cytochrome P450 82A3-like               140   6e-35   
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             142   8e-35   Phaseolus vulgaris [French bean]
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             142   8e-35   Phaseolus vulgaris [French bean]
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           142   8e-35   Solanum lycopersicum
ref|XP_012092501.1|  PREDICTED: cytochrome P450 CYP82D47-like           142   8e-35   Jatropha curcas
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           142   8e-35   Vitis vinifera
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               141   9e-35   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             142   9e-35   Citrus clementina [clementine]
ref|XP_012072001.1|  PREDICTED: cytochrome P450 82A3-like               141   1e-34   Jatropha curcas
emb|CAN76287.1|  hypothetical protein VITISV_027433                     141   1e-34   Vitis vinifera
ref|XP_012071743.1|  PREDICTED: cytochrome P450 CYP82D47-like           141   1e-34   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               141   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             141   1e-34   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             141   1e-34   Citrus clementina [clementine]
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               140   1e-34   Solanum tuberosum [potatoes]
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               141   1e-34   
gb|KHN16363.1|  Cytochrome P450 82A4                                    141   1e-34   Glycine soja [wild soybean]
gb|KHN22283.1|  Cytochrome P450 82C4                                    140   2e-34   Glycine soja [wild soybean]
ref|XP_006432703.1|  hypothetical protein CICLE_v10003959mg             140   2e-34   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             140   2e-34   Populus trichocarpa [western balsam poplar]
sp|H2DH23.1|C7H23_PANGI  RecName: Full=Cytochrome P450 CYP82H23         136   2e-34   Panax ginseng [Asiatic ginseng]
gb|KJB63757.1|  hypothetical protein B456_010G014300                    140   2e-34   Gossypium raimondii
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     140   3e-34   Eucalyptus grandis [rose gum]
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             140   3e-34   Phaseolus vulgaris [French bean]
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   140   3e-34   Citrus sinensis [apfelsine]
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               140   3e-34   Populus euphratica
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               140   4e-34   Citrus sinensis [apfelsine]
gb|KJB63761.1|  hypothetical protein B456_010G014700                    140   4e-34   Gossypium raimondii
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             139   4e-34   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           140   4e-34   Eucalyptus grandis [rose gum]
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           139   4e-34   Cucumis melo [Oriental melon]
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             139   4e-34   Phaseolus vulgaris [French bean]
ref|XP_011042272.1|  PREDICTED: cytochrome P450 82A4-like               137   4e-34   Populus euphratica
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             139   4e-34   Citrus clementina [clementine]
emb|CBI19611.3|  unnamed protein product                                142   5e-34   Vitis vinifera
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           139   6e-34   Eucalyptus grandis [rose gum]
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    139   6e-34   Populus euphratica
ref|XP_010106082.1|  Cytochrome P450 82A3                               139   6e-34   
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             139   6e-34   Phaseolus vulgaris [French bean]
ref|XP_006486182.1|  PREDICTED: cytochrome P450 82A3-like               137   7e-34   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           139   7e-34   Populus euphratica
gb|KHG16624.1|  Cytochrome P450                                         137   7e-34   Gossypium arboreum [tree cotton]
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     139   8e-34   Eucalyptus grandis [rose gum]
gb|KJB43594.1|  hypothetical protein B456_007G208800                    139   8e-34   Gossypium raimondii
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             139   8e-34   
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             139   9e-34   
ref|XP_003554857.2|  PREDICTED: cytochrome P450 82A4-like               141   1e-33   
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           138   1e-33   Eucalyptus grandis [rose gum]
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             138   1e-33   Phaseolus vulgaris [French bean]
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               138   1e-33   Cicer arietinum [garbanzo]
ref|XP_011025653.1|  PREDICTED: cytochrome P450 CYP82H23-like           135   1e-33   Populus euphratica
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             138   1e-33   Citrus clementina [clementine]
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               138   2e-33   
ref|XP_002510312.1|  cytochrome P450, putative                          138   2e-33   Ricinus communis
ref|XP_003618354.1|  Cytochrome P450                                    138   2e-33   Medicago truncatula
ref|XP_006435901.1|  hypothetical protein CICLE_v10031635mg             137   2e-33   
ref|XP_007151149.1|  hypothetical protein PHAVU_004G022000g             138   2e-33   Phaseolus vulgaris [French bean]
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                138   2e-33   Vitis vinifera
emb|CAN81092.1|  hypothetical protein VITISV_004720                     137   3e-33   Vitis vinifera
ref|XP_007017409.1|  Cytochrome P450, family 82, subfamily C, pol...    137   3e-33   
gb|KJB63767.1|  hypothetical protein B456_010G015400                    137   3e-33   Gossypium raimondii
ref|XP_011652396.1|  PREDICTED: cytochrome P450 CYP82D47-like           137   3e-33   Cucumis sativus [cucumbers]
ref|XP_003618361.1|  Cytochrome P450                                    137   3e-33   Medicago truncatula
gb|KEH30993.1|  cytochrome P450 family protein                          137   4e-33   Medicago truncatula
ref|XP_002510313.1|  cytochrome P450, putative                          137   4e-33   Ricinus communis
gb|KJB43593.1|  hypothetical protein B456_007G208700                    137   4e-33   Gossypium raimondii
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             137   4e-33   Phaseolus vulgaris [French bean]
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           137   5e-33   Vitis vinifera
ref|XP_007017412.1|  Cytochrome P450, putative                          136   5e-33   
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               136   5e-33   Malus domestica [apple tree]
emb|CBI40977.3|  unnamed protein product                                136   6e-33   Vitis vinifera
ref|XP_008388076.1|  PREDICTED: cytochrome P450 CYP82D47-like           136   6e-33   
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                136   7e-33   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     136   7e-33   Vitis vinifera
ref|XP_004291928.1|  PREDICTED: cytochrome P450 CYP82D47-like           136   8e-33   Fragaria vesca subsp. vesca
ref|NP_001240077.1|  cytochrome P450 82A2                               136   8e-33   Glycine max [soybeans]
ref|XP_010106088.1|  Cytochrome P450 82A4                               135   1e-32   
gb|KHG08974.1|  Cytochrome P450                                         134   1e-32   Gossypium arboreum [tree cotton]
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    135   1e-32   
ref|XP_010664941.1|  PREDICTED: cytochrome P450 82A4-like               130   1e-32   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    135   1e-32   
gb|KDO40895.1|  hypothetical protein CISIN_1g038677mg                   129   1e-32   Citrus sinensis [apfelsine]
ref|XP_002519132.1|  cytochrome P450, putative                          133   1e-32   
ref|XP_008378984.1|  PREDICTED: cytochrome P450 82A3-like               134   2e-32   
gb|AGN54072.1|  cytochrome P450 monooxygenase                           135   2e-32   Artemisia annua [sweet Annie]
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               135   2e-32   Solanum lycopersicum
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                135   2e-32   Vitis vinifera
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           135   2e-32   Populus euphratica
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               135   2e-32   Nicotiana tomentosiformis
emb|CBI32510.3|  unnamed protein product                                135   2e-32   Vitis vinifera
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               135   2e-32   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     135   2e-32   Vitis vinifera
gb|KCW67760.1|  hypothetical protein EUGRSUZ_F01497                     134   2e-32   Eucalyptus grandis [rose gum]
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               135   2e-32   
ref|XP_007223263.1|  hypothetical protein PRUPE_ppa004464mg             134   2e-32   
emb|CAN65890.1|  hypothetical protein VITISV_018868                     135   3e-32   Vitis vinifera
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               134   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   3e-32   Eucalyptus grandis [rose gum]
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               134   3e-32   Glycine max [soybeans]
ref|XP_006428106.1|  hypothetical protein CICLE_v10027086mg             133   3e-32   
ref|XP_010106079.1|  Cytochrome P450 82A3                               134   3e-32   Morus notabilis
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         134   3e-32   Jatropha curcas
gb|KDP38433.1|  hypothetical protein JCGZ_04358                         134   4e-32   Jatropha curcas
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    134   4e-32   Glycine max [soybeans]
ref|XP_010060879.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   4e-32   Eucalyptus grandis [rose gum]
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               134   5e-32   
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             134   5e-32   Phaseolus vulgaris [French bean]
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    135   5e-32   
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    133   6e-32   
ref|XP_003546624.1|  PREDICTED: cytochrome P450 82A2-like               133   7e-32   Glycine max [soybeans]
ref|XP_002510297.1|  cytochrome P450, putative                          133   8e-32   
gb|AGC29951.1|  CYP82D61                                                132   9e-32   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             132   1e-31   Prunus persica
ref|XP_003611841.1|  Cytochrome P450 82A3                               130   1e-31   
ref|XP_007047112.1|  Cytochrome P450                                    134   1e-31   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    132   1e-31   Vitis vinifera
emb|CBI19610.3|  unnamed protein product                                135   1e-31   Vitis vinifera
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               132   1e-31   Solanum tuberosum [potatoes]
gb|KHN44000.1|  Cytochrome P450 82A4                                    132   2e-31   Glycine soja [wild soybean]
ref|XP_007225086.1|  hypothetical protein PRUPE_ppa017464mg             132   2e-31   
gb|KDP38436.1|  hypothetical protein JCGZ_04361                         132   2e-31   Jatropha curcas
ref|XP_012071746.1|  PREDICTED: cytochrome P450 82C4-like               132   2e-31   Jatropha curcas
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    132   2e-31   
gb|AFK38862.1|  unknown                                                 132   2e-31   Lotus japonicus
ref|XP_004147804.1|  PREDICTED: cytochrome P450 CYP82D47-like           132   2e-31   Cucumis sativus [cucumbers]
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               132   2e-31   Pyrus x bretschneideri [bai li]
ref|NP_001240972.1|  cytochrome P450 82A3                               132   2e-31   Glycine max [soybeans]
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             132   2e-31   
ref|XP_010026987.1|  PREDICTED: cytochrome P450 CYP82D47-like           131   2e-31   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               134   3e-31   
gb|KJB47835.1|  hypothetical protein B456_008G044400                    131   3e-31   Gossypium raimondii
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           131   3e-31   Prunus mume [ume]
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           131   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_006443548.1|  hypothetical protein CICLE_v10019706mg             130   3e-31   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         131   3e-31   Jatropha curcas
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           131   3e-31   
gb|KCW44328.1|  hypothetical protein EUGRSUZ_L02217                     131   4e-31   Eucalyptus grandis [rose gum]
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     131   4e-31   Eucalyptus grandis [rose gum]
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           131   4e-31   Cucumis melo [Oriental melon]
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                131   4e-31   Vitis vinifera
ref|XP_010064547.1|  PREDICTED: cytochrome P450 CYP82D47-like           130   5e-31   Eucalyptus grandis [rose gum]
ref|XP_009365832.1|  PREDICTED: cytochrome P450 CYP82D47-like           130   5e-31   Pyrus x bretschneideri [bai li]
gb|AFO67235.1|  putative cytochrome P450                                124   6e-31   Aralia elata
gb|KEH30995.1|  cytochrome P450 family protein                          129   6e-31   Medicago truncatula
ref|XP_010070483.1|  PREDICTED: cytochrome P450 CYP82D47-like           130   6e-31   Eucalyptus grandis [rose gum]
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    130   7e-31   Glycine max [soybeans]
gb|KHG29695.1|  Cytochrome P450                                         130   7e-31   Gossypium arboreum [tree cotton]
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               130   7e-31   Pyrus x bretschneideri [bai li]
emb|CBI32505.3|  unnamed protein product                                133   7e-31   Vitis vinifera
gb|KHN36187.1|  Cytochrome P450 82A3                                    130   8e-31   Glycine soja [wild soybean]
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               130   8e-31   Cicer arietinum [garbanzo]
ref|XP_010106080.1|  Cytochrome P450 82A3                               131   8e-31   
ref|XP_003618363.1|  Cytochrome P450                                    130   9e-31   Medicago truncatula
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             130   9e-31   Citrus clementina [clementine]
ref|XP_006856218.1|  PREDICTED: cytochrome P450 82C4                    130   1e-30   Amborella trichopoda
ref|XP_007136642.1|  hypothetical protein PHAVU_009G061400g             130   1e-30   Phaseolus vulgaris [French bean]
gb|KJB58366.1|  hypothetical protein B456_009G207100                    130   1e-30   Gossypium raimondii
ref|XP_003618345.1|  Cytochrome P450                                    130   1e-30   Medicago truncatula
ref|XP_011465960.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    130   1e-30   Fragaria vesca subsp. vesca
ref|XP_007047111.1|  Cytochrome P450                                    130   1e-30   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             129   1e-30   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               129   1e-30   
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           129   1e-30   
gb|AAS90126.1|  cytochrome P450                                         129   1e-30   
gb|AII31759.1|  cytochrome P450 monooxygenase                           129   1e-30   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               129   1e-30   
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             129   2e-30   
ref|XP_012071739.1|  PREDICTED: cytochrome P450 82C4-like               129   2e-30   
ref|XP_007217488.1|  hypothetical protein PRUPE_ppa027160mg             129   2e-30   
ref|XP_012072000.1|  PREDICTED: cytochrome P450 82C4-like               132   2e-30   
ref|XP_003619141.1|  Cytochrome P450                                    129   2e-30   
ref|XP_004147803.2|  PREDICTED: cytochrome P450 CYP82D47-like           129   2e-30   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   129   2e-30   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    129   2e-30   
ref|XP_002510298.1|  cytochrome P450, putative                          129   2e-30   
emb|CDP15065.1|  unnamed protein product                                129   2e-30   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           129   2e-30   
ref|XP_003589812.1|  Cytochrome P450                                    129   2e-30   
ref|XP_002510314.1|  conserved hypothetical protein                     126   2e-30   
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               129   3e-30   
ref|XP_004489342.1|  PREDICTED: cytochrome P450 82A1-like               129   3e-30   
ref|XP_010040234.1|  PREDICTED: cytochrome P450 CYP82D47-like           129   3e-30   
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             128   3e-30   
gb|KJB58364.1|  hypothetical protein B456_009G206900                    128   3e-30   
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               128   3e-30   
ref|XP_006435894.1|  hypothetical protein CICLE_v10033457mg             128   4e-30   
gb|KGN59912.1|  Cytochrome P450                                         127   4e-30   
gb|KDO37275.1|  hypothetical protein CISIN_1g012878mg                   128   4e-30   
gb|KCW45363.1|  hypothetical protein EUGRSUZ_L00956                     128   4e-30   
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           128   4e-30   
gb|KCW59285.1|  hypothetical protein EUGRSUZ_H01963                     127   5e-30   
gb|KHG24650.1|  Cytochrome P450 protein                                 128   5e-30   
gb|KDP38435.1|  hypothetical protein JCGZ_04360                         122   7e-30   
ref|XP_002510306.1|  cytochrome P450, putative                          127   7e-30   
ref|XP_010070486.1|  PREDICTED: cytochrome P450 CYP82D47-like           127   7e-30   
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     130   7e-30   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               127   7e-30   
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           127   7e-30   
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             127   7e-30   
gb|KHN16362.1|  Cytochrome P450 82A3                                    127   9e-30   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             127   9e-30   
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             127   9e-30   
ref|XP_003554074.1|  PREDICTED: cytochrome P450 82A3-like               127   9e-30   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 CYP82D47-like           126   1e-29   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            127   2e-29   
ref|XP_011627781.1|  PREDICTED: cytochrome P450 82C2                    127   2e-29   
ref|XP_004489341.1|  PREDICTED: cytochrome P450 82A3-like               126   2e-29   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               126   2e-29   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   126   2e-29   
ref|XP_012092500.1|  PREDICTED: methyltetrahydroprotoberberine 14...    125   2e-29   
gb|KJB58361.1|  hypothetical protein B456_009G206600                    126   2e-29   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               126   2e-29   
ref|XP_007151140.1|  hypothetical protein PHAVU_004G021100g             125   2e-29   
ref|XP_003618351.1|  Cytochrome P450 82A1                               126   3e-29   
gb|KGN59916.1|  hypothetical protein Csa_3G853140                       124   3e-29   
gb|KDO38174.1|  hypothetical protein CISIN_1g0106221mg                  124   3e-29   
ref|XP_008219217.1|  PREDICTED: cytochrome P450 82A3-like               125   3e-29   
gb|AAG09208.1|AF175278_1  wound-inducible P450 hydroxylase              126   3e-29   
gb|ERN17682.1|  hypothetical protein AMTR_s00059p00202900               127   3e-29   
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           125   4e-29   
ref|XP_012071738.1|  PREDICTED: cytochrome P450 82C4-like               125   4e-29   
sp|Q43068.2|C82A1_PEA  RecName: Full=Cytochrome P450 82A1; AltNam...    125   4e-29   
ref|XP_010106089.1|  Cytochrome P450 82C4                               125   4e-29   
prf||2209439B  cytochrome P450 monooxygenase                            125   4e-29
ref|XP_008464768.1|  PREDICTED: cytochrome P450 CYP82D47-like           125   4e-29   
ref|XP_004147820.1|  PREDICTED: cytochrome P450 CYP82D47-like           125   4e-29   
gb|KHN04536.1|  Cytochrome P450 82A1                                    125   5e-29   
emb|CDP16080.1|  unnamed protein product                                125   5e-29   
emb|CDP07595.1|  unnamed protein product                                127   6e-29   
gb|KHG07801.1|  Cytochrome P450                                         125   7e-29   
ref|XP_010034443.1|  PREDICTED: cytochrome P450 CYP82D47-like           124   8e-29   
gb|KJB78289.1|  hypothetical protein B456_012G164400                    124   8e-29   
gb|KHG01290.1|  Cytochrome P450                                         124   8e-29   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             124   9e-29   
ref|XP_006581227.1|  PREDICTED: cytochrome P450 82A1-like               124   9e-29   
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               124   9e-29   
gb|KJB60932.1|  hypothetical protein B456_009G331600                    124   1e-28   
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           124   1e-28   
ref|XP_010070484.1|  PREDICTED: cytochrome P450 CYP82D47-like           124   1e-28   
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             124   1e-28   
gb|AJZ68877.1|  gossypol pathway P450 hydroxylase                       124   1e-28   
ref|XP_007216265.1|  hypothetical protein PRUPE_ppa017300mg             124   1e-28   
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           124   1e-28   
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           124   1e-28   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           124   1e-28   
ref|XP_003604789.1|  Cytochrome P450                                    124   1e-28   
ref|XP_010106085.1|  Cytochrome P450 82C4                               124   1e-28   
gb|KHN42045.1|  Cytochrome P450 82C4                                    123   1e-28   
ref|XP_003619137.1|  Cytochrome P450                                    124   2e-28   
ref|XP_008464762.1|  PREDICTED: cytochrome P450 CYP82D47-like           124   2e-28   
gb|AII31758.1|  cytochrome P450 monooxygenase                           124   2e-28   
ref|XP_007017407.1|  Cytochrome P450                                    124   2e-28   
gb|KHG29694.1|  Cytochrome P450                                         124   2e-28   
ref|XP_011652397.1|  PREDICTED: cytochrome P450 CYP82D47-like           123   2e-28   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             123   2e-28   
gb|EYU23763.1|  hypothetical protein MIMGU_mgv1a023100mg                123   2e-28   
gb|KEH30997.1|  cytochrome P450 family protein                          123   2e-28   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               123   2e-28   
ref|XP_004293232.2|  PREDICTED: cytochrome P450 CYP82D47-like           123   2e-28   
gb|KDP46184.1|  hypothetical protein JCGZ_10024                         123   2e-28   
gb|KHN22284.1|  Cytochrome P450 82A3                                    122   3e-28   
ref|XP_007017405.1|  Cytochrome P450                                    123   3e-28   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           122   4e-28   
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               122   4e-28   
gb|ACO90217.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   118   5e-28   
ref|XP_011627782.1|  PREDICTED: cytochrome P450 82C2-like               118   6e-28   
ref|XP_004147805.2|  PREDICTED: cytochrome P450 CYP82D47-like           122   6e-28   
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               121   7e-28   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     122   8e-28   
ref|XP_004147821.1|  PREDICTED: cytochrome P450 CYP82D47-like           122   8e-28   
gb|KHN22285.1|  Cytochrome P450 82A4                                    122   8e-28   
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                121   9e-28   
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           121   1e-27   
ref|XP_003618365.1|  Cytochrome P450                                    121   1e-27   
gb|AES74583.2|  cytochrome P450 family 82 protein                       121   1e-27   
ref|XP_006375029.1|  putative cytochrome P450 family protein            121   1e-27   
ref|XP_009364154.1|  PREDICTED: cytochrome P450 CYP82D47-like           121   1e-27   
gb|AII31760.1|  cytochrome P450 monooxygenase                           121   1e-27   
ref|XP_002522370.1|  cytochrome P450, putative                          121   1e-27   
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               120   2e-27   
gb|KDP38425.1|  hypothetical protein JCGZ_04350                         119   2e-27   
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             120   2e-27   
ref|XP_004147824.1|  PREDICTED: cytochrome P450 CYP82D47                120   2e-27   
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           120   2e-27   
gb|KHN42044.1|  Cytochrome P450 82A3                                    120   2e-27   
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                120   3e-27   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   120   4e-27   
emb|CBI29738.3|  unnamed protein product                                121   4e-27   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               120   4e-27   
ref|XP_010026402.1|  PREDICTED: cytochrome P450 82C4-like               119   4e-27   
gb|KJB58365.1|  hypothetical protein B456_009G207000                    120   4e-27   
gb|KHN00733.1|  Cytochrome P450 82A4                                    119   4e-27   
ref|XP_012092498.1|  PREDICTED: cytochrome P450 CYP82D47-like           119   4e-27   
ref|XP_008345296.1|  PREDICTED: cytochrome P450 CYP82D47-like           120   4e-27   
ref|XP_011458158.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    119   5e-27   
ref|XP_003519977.1|  PREDICTED: cytochrome P450 82A4-like               119   5e-27   
ref|XP_002869302.1|  CYP82C4                                            119   5e-27   
ref|XP_010026988.1|  PREDICTED: cytochrome P450 82A4-like               118   5e-27   
gb|KHN36186.1|  Cytochrome P450 82A3                                    119   6e-27   
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    119   6e-27   
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    119   7e-27   
gb|KCW67755.1|  hypothetical protein EUGRSUZ_F01490                     118   8e-27   
gb|AJD25200.1|  cytochrome P450 CYP82D70                                118   1e-26   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    119   1e-26   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    118   1e-26   
ref|XP_010089020.1|  Cytochrome P450 82A3                               118   1e-26   
ref|XP_012071740.1|  PREDICTED: cytochrome P450 82C4-like               118   1e-26   
ref|XP_010248151.1|  PREDICTED: cytochrome P450 82C4-like               118   1e-26   
emb|CAN65652.1|  hypothetical protein VITISV_016780                     117   1e-26   
gb|ERN17686.1|  hypothetical protein AMTR_s00059p00204120               118   1e-26   
ref|XP_008464770.1|  PREDICTED: cytochrome P450 CYP82D47-like           118   1e-26   
ref|XP_002510305.1|  cytochrome P450, putative                          118   2e-26   
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    118   2e-26   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   118   2e-26   
emb|CDY53704.1|  BnaC03g67210D                                          117   2e-26   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               117   2e-26   
emb|CDY23316.1|  BnaA08g12300D                                          117   2e-26   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           117   2e-26   
ref|XP_006379221.1|  hypothetical protein POPTR_0009s11200g             113   2e-26   
ref|XP_010070481.1|  PREDICTED: cytochrome P450 CYP82D47-like           117   3e-26   
ref|XP_011459594.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    115   3e-26   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           117   3e-26   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           117   3e-26   
gb|EPS58631.1|  hypothetical protein M569_16182                         116   4e-26   
emb|CDP03915.1|  unnamed protein product                                116   4e-26   
ref|XP_011459726.1|  PREDICTED: cytochrome P450 CYP82D47-like           117   4e-26   
emb|CAN81014.1|  hypothetical protein VITISV_025152                     117   4e-26   
gb|KFK29808.1|  hypothetical protein AALP_AA7G181800                    111   5e-26   
ref|XP_012085527.1|  PREDICTED: cytochrome P450 82G1-like               116   5e-26   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    116   6e-26   
ref|XP_002869304.1|  CYP82C4                                            116   6e-26   
gb|KCW59278.1|  hypothetical protein EUGRSUZ_H01953                     115   6e-26   
ref|XP_011073058.1|  PREDICTED: cytochrome P450 CYP82D47-like           116   7e-26   
gb|EYU23760.1|  hypothetical protein MIMGU_mgv1a026908mg                116   7e-26   
ref|XP_011083776.1|  PREDICTED: cytochrome P450 CYP82D47-like           116   7e-26   
ref|XP_002264520.2|  PREDICTED: cytochrome P450 82C4                    116   8e-26   
gb|KDP20666.1|  hypothetical protein JCGZ_03866                         115   8e-26   
ref|XP_007033359.1|  Cytochrome P450                                    115   8e-26   
ref|XP_010070482.1|  PREDICTED: cytochrome P450 CYP82D47-like           116   9e-26   
emb|CDP15728.1|  unnamed protein product                                115   1e-25   
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               115   1e-25   
ref|XP_008235731.1|  PREDICTED: cytochrome P450 CYP82H23-like           114   1e-25   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               115   1e-25   
gb|ABK55756.1|  P450 monooxygenase-like protein                         115   1e-25   
ref|XP_007049681.1|  Cytochrome P450                                    115   1e-25   
emb|CDP15727.1|  unnamed protein product                                116   1e-25   
ref|XP_002264473.1|  PREDICTED: cytochrome P450 82C4-like               115   1e-25   
gb|KEH18125.1|  cytochrome P450 family protein                          115   1e-25   
ref|XP_006435896.1|  hypothetical protein CICLE_v10031875mg             114   1e-25   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    115   2e-25   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             115   2e-25   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             115   2e-25   
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             115   2e-25   
ref|XP_004147801.1|  PREDICTED: cytochrome P450 CYP82D47-like           115   2e-25   
ref|XP_006435897.1|  hypothetical protein CICLE_v10031875mg             114   2e-25   
ref|XP_006384481.1|  hypothetical protein POPTR_0004s15460g             110   2e-25   
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                115   2e-25   
ref|XP_006856217.2|  PREDICTED: LOW QUALITY PROTEIN: methyltetrah...    109   2e-25   
gb|KEH37856.1|  cytochrome P450 family protein                          115   2e-25   
ref|XP_003548652.1|  PREDICTED: cytochrome P450 82C4-like               115   2e-25   
emb|CAN61061.1|  hypothetical protein VITISV_018742                     115   2e-25   
emb|CBI37514.3|  unnamed protein product                                117   3e-25   
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           114   3e-25   
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             114   3e-25   
emb|CDP00859.1|  unnamed protein product                                114   3e-25   
emb|CBI36491.3|  unnamed protein product                                115   3e-25   
gb|AES74584.2|  cytochrome P450 family protein                          114   4e-25   
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               114   4e-25   
gb|EYU23762.1|  hypothetical protein MIMGU_mgv1a004588mg                114   5e-25   
gb|KCW68809.1|  hypothetical protein EUGRSUZ_F02408                     113   5e-25   
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           114   5e-25   
gb|KDO65988.1|  hypothetical protein CISIN_1g011292mg                   113   5e-25   
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           114   6e-25   
gb|KHG07864.1|  Cytochrome P450 protein                                 113   6e-25   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         114   6e-25   
gb|ERM94234.1|  hypothetical protein AMTR_s00010p00212030               112   6e-25   
ref|XP_003618366.1|  Cytochrome P450                                    114   7e-25   
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             113   7e-25   
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               113   7e-25   
ref|XP_004517185.1|  PREDICTED: cytochrome P450 82C4-like               113   7e-25   



>ref|XP_009804510.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=525

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 133/204 (65%), Gaps = 15/204 (7%)
 Frame = +2

Query  14   MDFLSPPCNNIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSga--lpi  187
            MDFL      +I I  TLA +LV  FFL N+ F     K NNG+  K  PE +GA  +  
Sbjct  1    MDFL------LIAI--TLASSLVFKFFLYNQFFST---KRNNGQRIKRVPEAAGAWPIFG  49

Query  188  lghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLAT  367
              HL       + PH +LA MA+KYGPIF ++LG  +  VVS+ K+AKECFTTND +LA 
Sbjct  50   HLHLLTGTESDQLPHKVLARMAEKYGPIFGLKLGVYKVVVVSDPKVAKECFTTNDLALAN  109

Query  368  RTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKR  547
            R K+LASEI+GYN+ +F VAPYGPYWR+IRK   +E LS RRI+ L+  RE+ V+ +IK 
Sbjct  110  RPKSLASEIIGYNHAMFGVAPYGPYWREIRKIATIEFLSSRRIEMLKHIREFEVKSAIKE  169

Query  548  MFEHWSDNKDAAT--GAVTVEMKQ  613
             + +W  NK +++  GAV +EMK+
Sbjct  170  TYNYWLKNKSSSSLNGAVKMEMKE  193



>ref|XP_009606708.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=523

 Score =   172 bits (436),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 129/194 (66%), Gaps = 7/194 (4%)
 Frame = +2

Query  41   NIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSga--lpilghlhllia  214
            + + I  TLA +LV LF + N+       K NNG+ ++V PE +GA  +    HL     
Sbjct  2    DFVLIAITLASSLVFLFLIYNQFLST---KRNNGQRKRV-PEAAGAWPIIGHLHLLSGSE  57

Query  215  ggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  394
              + PH +LA MA+KYGPIF ++LG  +  VVS+ KIAKECFTTND +LA R K+LASEI
Sbjct  58   SDQLPHKVLARMAEKYGPIFGLKLGVYKAVVVSDPKIAKECFTTNDLALANRPKSLASEI  117

Query  395  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNK  574
            +GYN+ +F VAPYGPYWR+IRK   +E LS RRI+ L+  RE+ V+ +IK  +E W  NK
Sbjct  118  IGYNHAMFGVAPYGPYWREIRKIATIEFLSTRRIEVLKHIREFEVKSAIKESYEFWLKNK  177

Query  575  DAA-TGAVTVEMKQ  613
             ++  GAV +EMK+
Sbjct  178  SSSLNGAVKMEMKE  191



>ref|XP_006364811.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 128/193 (66%), Gaps = 12/193 (6%)
 Frame = +2

Query  56   ISTLACTLV---LLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKP  226
            +S +A TL    L FF   K F A  H  N G      PEP+GA PI+GHLHLL    + 
Sbjct  3    LSVIALTLAISFLSFFYLRKFFFA-AHTRNRG-----VPEPTGAWPIIGHLHLLNGS-QM  55

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH I   MA+KYGPIFR++LG  Q  +VS+ KIAKECFTTND++ A R K+LASEI+GYN
Sbjct  56   PHKIFGQMAEKYGPIFRLKLGVNQVVIVSDHKIAKECFTTNDRAFANRPKSLASEILGYN  115

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA-  583
            Y +F + PYGPYWR+IRK V +E LS RRI  L+  RE+ V+ +++  +E+W  N  ++ 
Sbjct  116  YAMFGLGPYGPYWREIRKIVTIEFLSARRIKMLKHVREFEVKLAVRETYEYWLKNNSSSN  175

Query  584  -TGAVTVEMKQTF  619
              GAV +EMK+ F
Sbjct  176  LNGAVKMEMKEWF  188



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH I   MA+KYGPIFR++LG     +VS+ KIAKECFTTNDK+ A R K++ASEI+GYN
Sbjct  56   PHKIFGQMAEKYGPIFRLKLGVNDVVIVSDHKIAKECFTTNDKAFANRPKSIASEILGYN  115

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
            Y +F + PYGPYWR+IRK V  E LS RRI+ L+  RE+ V+ ++K  +E+W  N     
Sbjct  116  YAMFGLGPYGPYWREIRKIVTTEFLSARRIEMLKHVREFEVKSAVKETYEYWLKNN--LN  173

Query  587  GAVTVEMKQTF  619
            GAV +EMK+ F
Sbjct  174  GAVKIEMKEWF  184



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 128/188 (68%), Gaps = 4/188 (2%)
 Frame = +2

Query  59   STLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLI  238
            S +A     L F C  LF  ++++  +G  +K APE SGA P LGHLHLL    KP H++
Sbjct  10   SWMAGVFAFLIF-CYLLFTRVINRTGSGMKRK-APEASGARPFLGHLHLLGGS-KPAHVV  66

Query  239  LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  418
            L  +AD YGPIF IRLG + T VVSN +IAKECFTTNDK+ A R + LA+E++GYNY +F
Sbjct  67   LGDLADTYGPIFTIRLGVRLTLVVSNWEIAKECFTTNDKAFANRPRTLAAELLGYNYAMF  126

Query  419  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDN-KDAATGAV  595
              +PYGPYWRQIRK V LE+LS  R++ L+  RE  VR SIK +++   +   ++++G V
Sbjct  127  GFSPYGPYWRQIRKIVTLEVLSNHRLEKLKHIRESEVRTSIKELYKLGVEGVSNSSSGKV  186

Query  596  TVEMKQTF  619
             VEMK+ F
Sbjct  187  LVEMKRWF  194



>gb|KDO43361.1| hypothetical protein CISIN_1g0369161mg, partial [Citrus sinensis]
Length=328

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 109/162 (67%), Gaps = 1/162 (1%)
 Frame = +2

Query  137  NGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSN  316
            N  ++K  PEP GA P++GHLHLL       H+ L ++ADK+GPIF I+LG  +  +VSN
Sbjct  35   NSTDKKTVPEPGGAWPLIGHLHLLGGQKPAAHVTLGSIADKHGPIFMIKLGMHRALIVSN  94

Query  317  SKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRI  496
             +IAKECFTTNDK    R KALA EI+GYNY +F  +PYGPYWRQIRK   LE+LS  R+
Sbjct  95   WEIAKECFTTNDKVFCNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATLEILSNHRL  154

Query  497  DSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTFD  622
            + L+  RE  VR S+K +++ W   +   +G   VEMK+ F+
Sbjct  155  EMLKHVRESEVRTSMKELYDEWMKLR-GDSGKALVEMKEIFN  195



>ref|XP_006471190.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=240

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 117/179 (65%), Gaps = 3/179 (2%)
 Frame = +2

Query  86   LFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYG  265
            LF L   L   +  +  N  ++K  PEP GA P++GHLHLL    KP ++ L  +A+K G
Sbjct  40   LFLLVYSLL-WLSRRHRNSIDKKPVPEPGGAWPLIGHLHLLGGQ-KPAYVTLGNIAEKCG  97

Query  266  PIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYW  445
            PIF I+LG  +  +VSN +IAKECFTTNDK  + R KALA EI+GYNY +F  +PYGPYW
Sbjct  98   PIFMIKLGMHRALIVSNWEIAKECFTTNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYW  157

Query  446  RQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTFD  622
            RQIRK   LE+LS  R++ L+  RE  VR S+K +++ W  + D  +G   VEMK+ F+
Sbjct  158  RQIRKIATLEVLSNHRLEMLKHVRESEVRTSMKELYDEWMKHSD-GSGKALVEMKERFN  215



>ref|XP_009795251.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 120/194 (62%), Gaps = 9/194 (5%)
 Frame = +2

Query  41   NIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliagg  220
            ++  I  TLA + ++ FFL  + F A   K  N +  K A         +     L+ G 
Sbjct  2    DLFFIAITLASSFLVSFFLFKQFFSA---KTQNRKVPKAA-----GAWPIIGHLHLLNGS  53

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            + PH I   MA+KYGPIFRI+LG  Q  VVS++KIAKECFTTND + A R K++ASEI+G
Sbjct  54   QMPHKIFGHMAEKYGPIFRIKLGVNQVVVVSDAKIAKECFTTNDMAFANRPKSIASEIIG  113

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YNY +F + PYGPYWR+IRK   +E LS R+++     RE  V+ +IK ++E+W  +K +
Sbjct  114  YNYAMFGLGPYGPYWREIRKIATIEFLSTRQVEISSHIRELEVKSAIKEIYEYWLKSKSS  173

Query  581  ATG-AVTVEMKQTF  619
            +   AV +EMK+ F
Sbjct  174  SLNVAVKIEMKEWF  187



>ref|XP_009624056.1| PREDICTED: cytochrome P450 82A3-like, partial [Nicotiana tomentosiformis]
Length=510

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH I   MA+K+GPIFRI+LG  Q  VVS++KIAKECFTTND + A R K++ASEI+GYN
Sbjct  56   PHKIFGHMAEKHGPIFRIKLGVNQVVVVSDAKIAKECFTTNDMAFANRPKSIASEIIGYN  115

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA-  583
            Y +F + PYGPYWR+IRK   +E LS R+++     RE+ V+ +IK ++E+W  +K  + 
Sbjct  116  YAMFGLGPYGPYWREIRKIATIEFLSTRQVEMSSHIREFEVKSAIKEIYEYWLKSKSTSL  175

Query  584  TGAVTVEMKQTF  619
             GAV +EMK+ F
Sbjct  176  NGAVKMEMKEWF  187



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 125/188 (66%), Gaps = 4/188 (2%)
 Frame = +2

Query  59   STLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLI  238
            S +A     L F C  LF  ++++  +G  +K APE SGA P LGHLHLL    KP H++
Sbjct  10   SWMAGVFAFLIF-CYLLFTRLINRTGSGMKRK-APEVSGARPFLGHLHLLGGS-KPAHVV  66

Query  239  LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  418
            L  +AD  GPIF IRLG   T VVSN +IAKECFTTNDK+ A R + +A+E++GYNY +F
Sbjct  67   LGDLADTNGPIFTIRLGMHPTLVVSNWEIAKECFTTNDKAFANRPRTIAAELLGYNYAMF  126

Query  419  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDN-KDAATGAV  595
              +PYGPYWRQIRK   LE+LS  R++ L+  RE  VR SIK ++E   +   ++++G V
Sbjct  127  GFSPYGPYWRQIRKIATLEVLSNHRLEKLKHIRESEVRTSIKELYELGVEGVSNSSSGKV  186

Query  596  TVEMKQTF  619
             VEMK+ F
Sbjct  187  LVEMKRWF  194



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KP H++L  +AD YGPIF IRLG + T VVSN +IAKECFTTNDK+ A R + LA+E++G
Sbjct  331  KPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEIAKECFTTNDKAFANRPRTLAAELLG  390

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDN-KD  577
            YNY +F  +PYGPYWRQIRK V LE+LS  R++ L+  RE  VR SIK +++   +   +
Sbjct  391  YNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKHIRESEVRTSIKELYKLGVEGVSN  450

Query  578  AATGAVTVEMKQTF  619
            +++G V VEMK+ F
Sbjct  451  SSSGKVLVEMKRWF  464


 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KP  ++L  +AD YGPIF IRLG Q T VVSN ++AKECFTTN K+   R + LA+E++G
Sbjct  25   KPAQVVLGDLADTYGPIFTIRLGMQSTLVVSNWEMAKECFTTNHKAFVNRPRTLAAELLG  84

Query  401  YNYTIFAVA  427
            YNY +  + 
Sbjct  85   YNYAMMVIG  93


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH++L  MA+KYG IF I++G  +  VV+N + AKEC TTNDK+ A+R K LA E + 
Sbjct  205  QPPHIVLGDMAEKYGSIFTIKMGVYRALVVNNWETAKECLTTNDKAFASRPKTLAMEFLS  264

Query  401  YNYTIFA  421
            + +T+  
Sbjct  265  FEHTMVG  271



>gb|KDO57198.1| hypothetical protein CISIN_1g044206mg, partial [Citrus sinensis]
Length=245

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  MAD+YGPIF+I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI+G
Sbjct  65   EPSHWVLGKMADEYGPIFKIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+IRK   LELLS  R+  LR  REY ++ S+K ++E W  NK +
Sbjct  125  YNFSMFGFSPYGSYWREIRKIATLELLSNHRLGKLRHVREYELKTSLKDLYELWDKNK-S  183

Query  581  ATGAVTVEMKQTF  619
                + VEMK+ F
Sbjct  184  TNKMLLVEMKRWF  196



>gb|KJB63762.1| hypothetical protein B456_010G014800 [Gossypium raimondii]
Length=525

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  +ADKYG IF IRLG  +  VVSN +IAKEC T NDK+ A+R K  +SEI+G
Sbjct  60   QPPHISLGNLADKYGGIFAIRLGVNRALVVSNWEIAKECLTINDKAFASRPKLASSEILG  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  + A+APYGPYWRQ+RK   +ELLS  R++ L+P RE  V+ S++++++ W+  K +
Sbjct  120  YNCAMIALAPYGPYWRQVRKFATIELLSNHRLELLKPVRESEVKASLQQLYQLWNKKKSS  179

Query  581  ATGAVTVEMKQTF  619
              G V VEMK+ F
Sbjct  180  NCGKVMVEMKRWF  192



>ref|XP_006431672.1| hypothetical protein CICLE_v10001614mg [Citrus clementina]
 gb|ESR44912.1| hypothetical protein CICLE_v10001614mg [Citrus clementina]
Length=361

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 117/179 (65%), Gaps = 3/179 (2%)
 Frame = +2

Query  86   LFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYG  265
            LF L   L   +  +  N  ++K  PEP GA P++GHLHLL    KP ++ L  +A+K G
Sbjct  40   LFLLVYSLLW-LSRRHRNSIDKKPVPEPGGAWPLIGHLHLLGGQ-KPAYVTLGNIAEKCG  97

Query  266  PIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYW  445
            PIF I+LG  +  +VSN +IAKECFTTNDK  + R KALA EI+GYNY +F  +PYGPYW
Sbjct  98   PIFMIKLGMHRALIVSNWEIAKECFTTNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYW  157

Query  446  RQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTFD  622
            RQIRK   LE+LS  R++ L+  RE  VR S+K +++ W  + D  +G   VEMK+ F+
Sbjct  158  RQIRKIATLEVLSNHRLEMLKHVRESEVRTSMKELYDEWMKHSD-GSGKALVEMKERFN  215



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H++L  MA+KYGPIF I++G  +  VV+N + AKEC TTNDK+ A+R K LA E++ 
Sbjct  63   QPAHIVLGDMAEKYGPIFTIKMGVYRALVVNNWETAKECLTTNDKAFASRPKTLAMELLS  122

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y++ +F  APYGPYWRQ+RK   LELLS  R+D L+  R+  ++ S+K +++HWS+NKD 
Sbjct  123  YDHAMFGFAPYGPYWRQMRKVATLELLSSYRLDRLKHVRQSEIKTSLKELYQHWSENKD-  181

Query  581  ATGAVTVEMKQTF  619
            ++  V VEMK  F
Sbjct  182  SSDKVLVEMKAWF  194



>gb|KJB63759.1| hypothetical protein B456_010G014500, partial [Gossypium raimondii]
Length=524

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  +ADKYG IF IRLG  +  VVSN +IAKEC T NDK+ ATR K  + EI+G
Sbjct  53   QPPHISLGNLADKYGGIFTIRLGVHRALVVSNWEIAKECLTINDKAFATRPKLASWEILG  112

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  + A APYGPYWRQ+RK   +ELLS  R++ L+P RE  V+ S++++++ W+  K +
Sbjct  113  YNSAMIAFAPYGPYWRQVRKFATIELLSNHRLELLKPVRESEVKASLQQLYQMWNKKKSS  172

Query  581  ATGAVTVEMKQTF  619
              G V VEMK+ F
Sbjct  173  NCGKVIVEMKRWF  185



>ref|XP_002510311.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52498.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  +ADKYGPIF I+LG  +T +VSN +IAKEC TTNDK+ A+R K+LA EI+G
Sbjct  55   QPPHITLGNLADKYGPIFTIKLGVHRTLIVSNGEIAKECLTTNDKAFASRPKSLAMEILG  114

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y++   +PYG YWRQ+RK + LELLS  R++ L+  RE  V+ +IK +++ W  ++++
Sbjct  115  YDYSMLGFSPYGEYWRQMRKIITLELLSKHRLEMLKRVREVEVKTAIKGLYQEWMKSRNS  174

Query  581  ATGAVTVEMKQTF  619
            +   + VEMK+ F
Sbjct  175  SN-KILVEMKKWF  186



>ref|XP_006471191.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=538

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 109/162 (67%), Gaps = 1/162 (1%)
 Frame = +2

Query  137  NGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSN  316
            N  ++K  PEP GA P++GHLHLL       H+ L ++ADK+GPIF I+LG  +  +VSN
Sbjct  35   NSTDKKTVPEPGGAWPLIGHLHLLGGQKPAAHVTLGSIADKHGPIFMIKLGLHRALIVSN  94

Query  317  SKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRI  496
             +IAKECFTTNDK    R KALA EI+GYNY +F  +PYGPYWRQIRK   LE+LS  R+
Sbjct  95   WEIAKECFTTNDKVFCNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATLEILSNHRL  154

Query  497  DSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTFD  622
            + L+  RE  VR S+K +++ W   +   +G   VEMK+ F+
Sbjct  155  EMLKHVRESEVRTSMKELYDEWMKLR-GDSGKALVEMKEIFN  195



>ref|XP_007207908.1| hypothetical protein PRUPE_ppa019731mg, partial [Prunus persica]
 gb|EMJ09107.1| hypothetical protein PRUPE_ppa019731mg, partial [Prunus persica]
Length=502

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  MADKYGPIF I+LG  +  VVSN +IAKE FTTNDK+ ATR K LA+EIMG
Sbjct  25   RPPHISLGNMADKYGPIFTIKLGVHRALVVSNWEIAKEFFTTNDKNFATRPKFLAAEIMG  84

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y +F  +PYGPYWRQ+RK   +ELLS  R++ L+  REY ++   K +++ W +NK  
Sbjct  85   YDYAMFGFSPYGPYWRQMRKIATVELLSNHRLELLKRVREYEIQTCTKHIYDLWEENK-G  143

Query  581  ATGAVTVEMKQTF  619
             +  V VEM + F
Sbjct  144  RSEKVLVEMNRWF  156



>ref|XP_012081502.1| PREDICTED: cytochrome P450 CYP82D47-like [Jatropha curcas]
 gb|KDP29948.1| hypothetical protein JCGZ_18517 [Jatropha curcas]
Length=525

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 124/203 (61%), Gaps = 10/203 (5%)
 Frame = +2

Query  14   MDFLSPPCNNI-ITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpil  190
            M+FLSP C ++ I I+S LA  ++  FFL        + +  +  N+K  P  +     +
Sbjct  1    MEFLSPLCESLDIIILSILAPVILFSFFL--------ISRKRSANNKKRLPPEAAGGWPI  52

Query  191  ghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATR  370
                 L++  K P++ L  +ADK GP+F IRLG  +  +VS+ ++AKEC++TND++ A+R
Sbjct  53   VGHLPLLSLSKAPYITLGKIADKLGPLFTIRLGVHRALIVSSWEMAKECYSTNDEAFASR  112

Query  371  TKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRM  550
             KAL  ++MGYNY +    PYG YWRQIRK   L+LLS  R+D LR  RE  V++++  +
Sbjct  113  PKALFFDVMGYNYAMIGATPYGEYWRQIRKISTLKLLSNYRLDLLRHVRETEVKEAVGGL  172

Query  551  FEHWSDNKDAATGAVTVEMKQTF  619
            ++ W  NK +++G + VEMK  F
Sbjct  173  YKKWMKNK-SSSGKLVVEMKNWF  194



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 121/192 (63%), Gaps = 9/192 (5%)
 Frame = +2

Query  50   TIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPP  229
            T I  L   LV +++L      +++ K    + +K+APE +     +     L+ G + P
Sbjct  9    TNIGALLAVLVFIYYLS-----SLISKNIEVKKRKMAPE-AAGAWPVIGHLPLLGGPELP  62

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H+ L AMADKYGP F IRLG ++  VVS+ ++AKECFT ND++LATR   +A + MGYNY
Sbjct  63   HITLGAMADKYGPAFTIRLGVRRALVVSDWEVAKECFTINDRALATRPSGVAMKHMGYNY  122

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +FA APYGPYWR++RK   LELLS RR++ L+  R   V  S++ ++  W  NK+ ATG
Sbjct  123  AMFAFAPYGPYWREVRKIATLELLSNRRLEMLKHVRVSEVNMSVRELYGLWLKNKN-ATG  181

Query  590  A--VTVEMKQTF  619
            A  V VEMK+ F
Sbjct  182  ADSVKVEMKRWF  193



>ref|XP_002510308.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52495.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  +ADKYGPIF I+LG  +T +VSN +IAKEC TTNDK+ A R K+LA EI+G
Sbjct  55   QPPHITLGNLADKYGPIFAIKLGVHRTLIVSNGEIAKECLTTNDKAFANRPKSLAMEILG  114

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y++   +PYG YWRQ+RK + LELLS  R++ L+  RE  V+ +IK +++ W  ++++
Sbjct  115  YDYSMLGFSPYGEYWRQMRKIITLELLSKHRLEMLKHVREVEVKTAIKGLYQEWMKSRNS  174

Query  581  ATGAVTVEMKQTF  619
            ++  + VEMK+ F
Sbjct  175  SS-KLLVEMKKWF  186



>ref|XP_006375023.1| hypothetical protein POPTR_0014s03670g, partial [Populus trichocarpa]
 gb|ERP52820.1| hypothetical protein POPTR_0014s03670g, partial [Populus trichocarpa]
Length=216

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  +ADKYGPIF ++LG  +T +VSN ++AKEC  TNDK+ ATR K LA +I+G
Sbjct  52   QPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEMAKECLRTNDKAFATRPKTLAMDILG  111

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YNY+I + +PYG YWR IRK V LE+LS  R++ L+  RE  VR ++  +++ W  NK +
Sbjct  112  YNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEMLKNVREDEVRDAVGALYQQWIGNK-S  170

Query  581  ATGAVTVEMKQTF  619
             +  + VEMK+ F
Sbjct  171  NSQKLLVEMKRWF  183



>ref|XP_006387541.1| hypothetical protein POPTR_0875s00200g [Populus trichocarpa]
 gb|ERP46455.1| hypothetical protein POPTR_0875s00200g [Populus trichocarpa]
Length=377

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 113/184 (61%), Gaps = 1/184 (1%)
 Frame = +2

Query  68   ACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAA  247
            A  +++LF       + +   P   R++K AP  +     L     L+ G +PPH+ L  
Sbjct  50   ATAVLILFAFITPSIYYLFRIPGKERSKKRAPPEAAGAWPLIGHLHLLGGSQPPHITLGN  109

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            +ADKYGPIF ++LG  +T +VSN ++AKEC  TNDK+ ATR K LA +I+GYNY+I + +
Sbjct  110  LADKYGPIFTVKLGVHRTLIVSNWEMAKECLRTNDKAFATRPKTLAMDILGYNYSILSFS  169

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR IRK V LE+LS  R++  +  RE  VR ++  +++ W  NK + +  + VEM
Sbjct  170  PYGTYWRLIRKIVTLEVLSNHRLEMFKHVREDEVRDAVGALYQQWIGNK-SNSQKLLVEM  228

Query  608  KQTF  619
            K+ F
Sbjct  229  KRWF  232



>gb|AGO03797.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=518

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 9/192 (5%)
 Frame = +2

Query  47   ITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKP  226
            +T ++T    LV+ F + NK+           R++  AP  +     +     L+AG +P
Sbjct  3    LTTLATFLFVLVIAFMILNKM--------RVNRSKHNAPPRAKGAWPIIGHLHLVAGSRP  54

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
               +L   ADKYGPIF I+LG  Q  VVS+++IAKECFTTNDK  A+R KA A EIMGYN
Sbjct  55   RQHVLGDWADKYGPIFTIKLGFHQALVVSSTEIAKECFTTNDKVFASRPKAKAVEIMGYN  114

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKD-AA  583
            Y +F +APYG YWRQ RK + LE+LS RR++ L   RE  +R S+K +   W +NK+   
Sbjct  115  YAMFGLAPYGDYWRQERKIITLEVLSPRRVEMLGHVRESEIRASLKDIHVAWENNKENEG  174

Query  584  TGAVTVEMKQTF  619
            +  V V+MKQ F
Sbjct  175  SNMVKVDMKQWF  186



>ref|XP_003527704.1| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=535

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KPPH+ L  MADKYGPIF +RLG  +T VVSN ++AK+CFT NDK+ A+R K++A E++G
Sbjct  65   KPPHVTLGNMADKYGPIFTLRLGVHKTLVVSNWEMAKQCFTVNDKAFASRPKSVAFEVLG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++   +PYG YWR +RK   LELLS  RID ++   E  V+ ++K +++ W D   +
Sbjct  125  YNFSMIGFSPYGSYWRHVRKIATLELLSSHRIDMIKHVMESEVKAAVKEIYDIWIDKNKS  184

Query  581  ATGAVTVEMKQTF  619
             +  VT EMK+ F
Sbjct  185  GSEKVTTEMKRWF  197



>ref|XP_004238201.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=520

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 119/193 (62%), Gaps = 8/193 (4%)
 Frame = +2

Query  41   NIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSga--lpilghlhllia  214
            ++  I+ TLA + +LLF L +K F+++  + ++ R     PE  GA  +    HL     
Sbjct  2    DLFLIVVTLATSFILLFIL-HKQFYSVKKQSSSSRK---VPEAGGAWPIIGHLHLLGGSE  57

Query  215  ggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  394
                PH +L  +ADKYGPIF ++LG  Q  VVS+ K+AKECFTTND +LA R K++ASEI
Sbjct  58   SDHLPHKMLGRLADKYGPIFGMKLGVHQVVVVSDHKLAKECFTTNDLALAGRPKSMASEI  117

Query  395  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNK  574
            +GY + +F +  YGPYWR+ RK   +EL S RRI+ L+  RE+ V+  IK ++ +W  N 
Sbjct  118  IGYKHAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIREFEVKSGIKEIYNNWEKNN  177

Query  575  DAATGAVTVEMKQ  613
                G V +EMK+
Sbjct  178  --LNGVVKMEMKE  188



>ref|XP_008343493.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=532

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 126/202 (62%), Gaps = 12/202 (6%)
 Frame = +2

Query  14   MDFLSPPCNNIITIIS-TLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpil  190
            MD+     + ++ +++ TLA +L L   LC +           G  +K  PE   A PI+
Sbjct  3    MDYFPLSYDLVVPLMAVTLAMSLFLYSLLCKQ----------GGVTRKAPPEAGRAWPII  52

Query  191  ghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATR  370
            GHLHLL +  +P HL+   +ADKYGPIF I+ G ++  VVS+S+IAK+CF TNDK  A+R
Sbjct  53   GHLHLLSSSTEPAHLLFGNLADKYGPIFTIKFGMKRAIVVSSSEIAKDCFKTNDKVFASR  112

Query  371  TKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRM  550
             K++A E++GYNY     +PYG Y+RQIRK   LE+LS  RI  L+  RE+ V+ S+K M
Sbjct  113  PKSIAGEVLGYNYAFLPFSPYGEYFRQIRKIATLEVLSQSRIGKLKHIREFEVKASMKEM  172

Query  551  FEHWS-DNKDAATGAVTVEMKQ  613
            +  W+ +NK + +  V VEMK+
Sbjct  173  YRRWTVNNKSSGSTKVLVEMKE  194



>gb|KDP38434.1| hypothetical protein JCGZ_04359 [Jatropha curcas]
Length=558

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 112/185 (61%), Gaps = 1/185 (1%)
 Frame = +2

Query  65   LACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILA  244
            +A  +  L FLC+  F          R++K A   +G    L     L+ G +P H++L 
Sbjct  1    MATVMAFLIFLCS-FFWISRSVLKTARSKKKAAPKAGGAWPLIGHLHLLGGPEPSHIVLG  59

Query  245  AMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAV  424
             MADKYGPIF I++G  +  VVSN +IAKEC TTNDK+ A R K LA E++GY+ ++F  
Sbjct  60   DMADKYGPIFTIKMGVHRNLVVSNWEIAKECLTTNDKAFANRPKILAMELLGYDRSMFGF  119

Query  425  APYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVE  604
            +PYG YWRQ+RK   LELLS  R++ LR  R+  V  ++K +++ W  NK ++   V VE
Sbjct  120  SPYGTYWRQLRKIATLELLSNHRLEMLRHVRQSEVTTALKELYKFWDKNKTSSNDKVLVE  179

Query  605  MKQTF  619
            MK+ F
Sbjct  180  MKRWF  184



>ref|XP_006471151.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=558

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 117/179 (65%), Gaps = 3/179 (2%)
 Frame = +2

Query  86   LFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYG  265
            LF L   L   +  +  N  ++K  PEP GA P++GHLHLL    KP ++ L  +A+K G
Sbjct  40   LFLLVYSLL-WLSRRHRNSIDKKPVPEPGGAWPLIGHLHLLGGQ-KPAYVTLGNIAEKCG  97

Query  266  PIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYW  445
            PIF I+LG  +  +VSN +IAKECFTTNDK  + R KALA EI+GYNY +F  +PYGPYW
Sbjct  98   PIFMIKLGMHRALIVSNWEIAKECFTTNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYW  157

Query  446  RQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTFD  622
            RQIRK   LE+LS  R++ L+  RE  VR S+K +++ W  + D + G   VEMK+ F+
Sbjct  158  RQIRKIATLEVLSNHRLEMLKHVRESEVRTSMKELYDEWMKHSDGS-GKALVEMKERFN  215



>ref|XP_006366471.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 116/195 (59%), Gaps = 8/195 (4%)
 Frame = +2

Query  41   NIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSga--lpilghlhllia  214
            ++  I  T+ C+L++ FFL  + F        + R  +  PE  GA  +    H      
Sbjct  2    DLFLIAVTVTCSLLVFFFLRKQFF-----TDKSERRIRTVPEAGGAWPIIGHLHFLRGSK  56

Query  215  ggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  394
              + PH  L+ MADKYG IF ++LG  Q  VVS+ K+AKECFTTND +LA R K++ SEI
Sbjct  57   TDQLPHRTLSRMADKYGSIFGMKLGVHQVVVVSDPKLAKECFTTNDLALAGRPKSMGSEI  116

Query  395  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNK  574
            MGY + +F +  YGPYWR+ RK   +ELLS RRI+ L+  RE+ V+  IK ++ +W+  K
Sbjct  117  MGYKHAMFGLCSYGPYWRETRKIATVELLSNRRIEMLKHIREFEVKSGIKEIYNNWA-AK  175

Query  575  DAATGAVTVEMKQTF  619
            +   G V +EMK+ F
Sbjct  176  NNLNGVVKMEMKEWF  190



>ref|XP_004238199.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=539

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 115/192 (60%), Gaps = 7/192 (4%)
 Frame = +2

Query  41   NIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKV-APEPSgalpilghlhlliag  217
            +I  I+  +A + V  FFL    F A +H     ++++V     +  +    HL      
Sbjct  22   DIFLIVIMVASSSVFFFFLRKHAFSAKIHS----KSKRVPGAGGAWPIIGHLHLLSGSET  77

Query  218  gKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIM  397
             + PH I+  MADKYGPIF ++LG  Q  VVS+ K+AKECFTTND +LA R K++ASEI+
Sbjct  78   EQLPHKIMGRMADKYGPIFGMKLGVHQVVVVSDPKLAKECFTTNDLALAGRPKSMASEIV  137

Query  398  GYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKD  577
            GY + +FA++ YGPYWR+ RK   +EL S RRI+ L+  RE+ V+  IK ++  W  N  
Sbjct  138  GYKHAMFALSAYGPYWRETRKIATIELFSARRIEMLKHIREFEVKSGIKEIYSDWGKNN-  196

Query  578  AATGAVTVEMKQ  613
               G V +EMK+
Sbjct  197  -LNGVVKMEMKE  207



>ref|XP_004291926.1| PREDICTED: cytochrome P450 CYP82D47-like [Fragaria vesca subsp. 
vesca]
Length=538

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ L  MADKYGP+F I+LG  ++ +VS+  +AKEC TTND+  A R K L SE+MGY
Sbjct  64   PPHITLGNMADKYGPVFTIKLGVHRSLIVSSWDMAKECLTTNDRVFANRPKLLVSEVMGY  123

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F  +PYGPYWRQ+RK   LELLS  R++SL   RE  V+  IK ++  W  NK+  
Sbjct  124  NYAMFGFSPYGPYWRQMRKVATLELLSNHRLESLNHVRESEVKTCIKNIYNLWKQNKN--  181

Query  584  TGAVTVEMKQTF  619
            +  V V+MK+ F
Sbjct  182  SDHVLVDMKRWF  193



>ref|XP_006471495.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L  MAD+YGPIF+I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI+G
Sbjct  65   EPPHRVLGKMADEYGPIFKIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   LELLS  R+  LR  REY ++ S+K ++E W  NK +
Sbjct  125  YNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLRHVREYELKTSLKDLYELWDKNK-S  183

Query  581  ATGAVTVEMKQTF  619
                + VEMK+ F
Sbjct  184  TNKMLLVEMKRWF  196



>ref|XP_006471496.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L  MAD+YGPIF+I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI+G
Sbjct  65   EPPHRVLGKMADEYGPIFKIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   LELLS  R+  LR  REY ++ S+K ++E W  NK +
Sbjct  125  YNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLRHVREYELKTSLKDLYELWDKNK-S  183

Query  581  ATGAVTVEMKQTF  619
                + VEMK+ F
Sbjct  184  TNKMLLVEMKRWF  196



>gb|KJB63751.1| hypothetical protein B456_010G014900 [Gossypium raimondii]
Length=408

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 90/133 (68%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ LA MADKYG IF I+LG  +  VVSN +IAKEC T NDK+ A+R K   SEIMG
Sbjct  60   QPPHISLANMADKYGRIFSIKLGVHRALVVSNWEIAKECLTINDKAFASRPKLAFSEIMG  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +   APYGPYWR +RK V +ELLS  R++ L+P R+  ++ S++ +++ W+  K  
Sbjct  120  YNGAMTGFAPYGPYWRPVRKIVTIELLSNHRLELLKPVRDSEIKTSLQHLYQQWNKKKST  179

Query  581  ATGAVTVEMKQTF  619
             +  V VEMK  F
Sbjct  180  NSDKVLVEMKGWF  192



>ref|XP_007017411.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14636.1| Cytochrome P450, putative [Theobroma cacao]
Length=525

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 116/190 (61%), Gaps = 5/190 (3%)
 Frame = +2

Query  50   TIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPP  229
            + ++ LA T V+LF  C   F       ++ RN++     +     +     L+ G +PP
Sbjct  8    STVAVLAFT-VILFLFCLLWFS---RTASSSRNKRRTATEASGAWPIIGHIPLLGGPRPP  63

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            HL LA MADK+G IF I+LG  +  VVSN +IAKEC TTNDK+ ATR K    EI+GYNY
Sbjct  64   HLSLANMADKFGTIFTIKLGVHRALVVSNWEIAKECLTTNDKAFATRPKLAGMEILGYNY  123

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             + A APYGPYWRQ+R+   ++LLS  R+D L+  RE  V  S++++++ W D K + + 
Sbjct  124  AMIAFAPYGPYWRQVRRFATVKLLSNHRLDMLKRVRESEVETSLQQLYQLW-DKKRSNSA  182

Query  590  AVTVEMKQTF  619
             V V+MK+ F
Sbjct  183  KVLVDMKRWF  192



>ref|XP_009374201.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=532

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 126/201 (63%), Gaps = 10/201 (5%)
 Frame = +2

Query  14   MDFLSPPCNNIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilg  193
            MD+     + ++T+   +A T  L  FL + L+       + G  +K  PE   A PI+G
Sbjct  3    MDYFPLSYDLMVTL---MAVTFALSLFLYSLLWK------HGGVIRKAPPEAGRAWPIIG  53

Query  194  hlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRT  373
            HLHLL +  +P HL+   +ADKYGPIF I+ G ++  VVS+S+IAKECF TNDK  A+R 
Sbjct  54   HLHLLSSSTEPAHLLFGNLADKYGPIFTIKFGVKRAIVVSSSEIAKECFKTNDKVFASRP  113

Query  374  KALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMF  553
            K++A E++GYNY  F  +PYG Y+RQIRK   LE+LS  RI+ L+  RE+ V+ S+K M 
Sbjct  114  KSIAGEVLGYNYAFFPFSPYGDYFRQIRKIATLEVLSQSRIEKLKHIREFEVKASMKEMR  173

Query  554  EHWSDN-KDAATGAVTVEMKQ  613
              W+ N K + +  V VEMK+
Sbjct  174  RRWTVNKKSSGSTKVLVEMKE  194



>ref|XP_003554859.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
 gb|KHN19616.1| Cytochrome P450 82A4 [Glycine soja]
Length=528

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH +L A+ADKYGPIF I+LGA++  V+SN +IAKECFTTND  +++R + +A+E MG
Sbjct  58   KAPHRVLGALADKYGPIFTIKLGAKKALVISNWEIAKECFTTNDIVVSSRPRLVAAENMG  117

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ I   +PYGPYWR++RK   LE+L+ RR++ L+  R   V+ SIK +F+ W   K+ 
Sbjct  118  YNHAILGFSPYGPYWRELRKITTLEILTSRRVEQLQHVRVSEVQSSIKELFDVWRSKKN-  176

Query  581  ATGAVTVEMKQTFDR  625
             +G   V++KQ F R
Sbjct  177  ESGYALVDLKQWFSR  191



>ref|XP_008236910.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=540

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  MADKYGPIF I+LG  +  VVSN + AKE FTTNDK+ ATR K LA+EIMG
Sbjct  63   RPPHISLGNMADKYGPIFTIKLGVHRALVVSNWETAKEFFTTNDKNFATRPKFLAAEIMG  122

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y +F  +PYGPYWRQ+RK   +ELLS  R++ L+   EY V+   K +++ W +NK  
Sbjct  123  YDYAMFGFSPYGPYWRQMRKIATVELLSNHRLELLKRVLEYEVQACTKHIYDLWEENK-G  181

Query  581  ATGAVTVEMKQTF  619
             +  V VEM + F
Sbjct  182  RSEKVLVEMNRWF  194



>ref|XP_007017410.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14635.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=628

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P HL L+AMADKYGPIF I+LG ++  VVS+ + AKEC TTNDK+ ATR K ++ E++G
Sbjct  165  QPAHLTLSAMADKYGPIFTIKLGVRRALVVSSWETAKECLTTNDKAFATRPKNISMEVLG  224

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ +F  APYGPYWR +RK   LELLS  R+D L+  RE  ++ S++ +++ W +NK+ 
Sbjct  225  YNHAMFGFAPYGPYWRNMRKITTLELLSNHRLDMLKHVRESEMKVSLQELYQLWKENKN-  283

Query  581  ATGAVTVEMKQTF  619
            ++  V VEM + F
Sbjct  284  SSDKVLVEMDKWF  296


 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +2

Query  236  ILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTI  415
            +L   A  YGPIF I+LG  Q  +VSN ++AKEC +TNDK  ATR K++A EI+GYNY +
Sbjct  22   LLFKRAGNYGPIFTIKLGLSQAVIVSNRELAKECLSTNDKVFATRPKSIAFEILGYNYAV  81

Query  416  FAVAPYGPYWRQIRK-TVVLELL  481
            F  +PYG YW  IRK   VL++L
Sbjct  82   FGFSPYGSYWHHIRKLATVLQVL  104



>ref|XP_004308852.2| PREDICTED: cytochrome P450 CYP82D47-like [Fragaria vesca subsp. 
vesca]
Length=544

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ILA MADKYGP+F I+LG  +  +VS+  +AKEC T NDK+ A R KAL +EI+G
Sbjct  65   QPPHIILANMADKYGPLFTIKLGVHRALIVSSWDVAKECLTINDKAFANRPKALCAEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y +F  +PYGPYWRQ+RK   L +LS  +++ L+  RE  ++ S K +F+ W  NK  
Sbjct  125  YDYALFGFSPYGPYWRQVRKIATLHILSNHKLELLKHVRESEMKLSTKLIFDMWEKNK-G  183

Query  581  ATGAVTVEMKQTF  619
             +  V VEMK+ F
Sbjct  184  VSNKVLVEMKRWF  196



>ref|XP_010064743.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 87/132 (66%), Gaps = 5/132 (4%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ L  MADKYGPIF I+LG+ Q  VVS S++AKECFTTNDK+   R K LA+E++GY
Sbjct  64   PPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKECFTTNDKAFCNRPKYLAAELLGY  123

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +   +PYGPYWR +RK   LELLS   ++ LR  RE  VR SIK  +E     +  A
Sbjct  124  NYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVREAVVRASIKEAYE-----RSNA  178

Query  584  TGAVTVEMKQTF  619
             G   +EMK  F
Sbjct  179  QGNTPIEMKSWF  190



>gb|KCW68803.1| hypothetical protein EUGRSUZ_F02402, partial [Eucalyptus grandis]
Length=525

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 87/132 (66%), Gaps = 5/132 (4%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ L  MADKYGPIF I+LG+ Q  VVS S++AKECFTTNDK+   R K LA+E++GY
Sbjct  64   PPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKECFTTNDKAFCNRPKYLAAELLGY  123

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +   +PYGPYWR +RK   LELLS   ++ LR  RE  VR SIK  +E     +  A
Sbjct  124  NYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVREAVVRASIKEAYE-----RSNA  178

Query  584  TGAVTVEMKQTF  619
             G   +EMK  F
Sbjct  179  QGNTPIEMKSWF  190



>gb|KHN34164.1| Cytochrome P450 82A4 [Glycine soja]
Length=525

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH +L A+ADKYGPIF I  G ++  V+SN +IAKECFT ND  +++R K LA E+M YN
Sbjct  60   PHKVLDALADKYGPIFTINYGVKKALVISNWEIAKECFTKNDIVVSSRPKLLAIELMCYN  119

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +F  APYGPYWR++RK V LE+LS RR++ L   R   V+ SIK +F  WS NK+  +
Sbjct  120  QAMFGFAPYGPYWRELRKIVNLEILSNRRVEQLENVRVSEVQSSIKELFNVWSSNKNNES  179

Query  587  GAVTVEMKQTFDR  625
            G   +E+KQ F +
Sbjct  180  GYALLELKQWFSQ  192



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L AMADKYGPIF+IR+G     VVSNS IAKECFTTNDK+ A+R  + AS+I+GY+Y
Sbjct  48   HKTLGAMADKYGPIFKIRIGVNHALVVSNSDIAKECFTTNDKAFASRPTSTASKILGYDY  107

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F +APYG YW ++RK  + ELLS RR++ L+  R+  +  SI+ +++ W  N D A G
Sbjct  108  VMFGMAPYGQYWVELRKITMSELLSNRRLELLKHVRDSEIDASIQDLYKVWK-NHDKAKG  166

Query  590  AVTVEMKQTF  619
             V V+MKQ F
Sbjct  167  PVLVDMKQWF  176



>ref|XP_011030954.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 114/185 (62%), Gaps = 1/185 (1%)
 Frame = +2

Query  68   ACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAA  247
            A  +++LF       + +   P  G ++K AP  +     L     L+ G +PPH+ L  
Sbjct  9    ATAVLILFAFITPSIYYLFRIPGKGISKKRAPPEAAGAWPLIGHLHLLRGSQPPHITLGN  68

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            +ADK+GPIF ++LG  +  +VSN ++AKEC   NDK+ ATR KALA++I+G+NY++   +
Sbjct  69   LADKHGPIFTVKLGVHRALIVSNWEMAKECLRINDKAFATRPKALATDILGFNYSMLGFS  128

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWRQIRK V LE+LS  R++  +  RE  VR ++  +++ W  NK + +  + VEM
Sbjct  129  PYGTYWRQIRKIVTLEVLSNHRLEMFKHVREDEVRDAVGALYQQWIGNK-SNSQKLLVEM  187

Query  608  KQTFD  622
            K+ F+
Sbjct  188  KRWFN  192



>ref|XP_011030947.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=528

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 114/185 (62%), Gaps = 1/185 (1%)
 Frame = +2

Query  68   ACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAA  247
            A  +++LF       + +   P  G ++K AP  +     L     L+ G +PPH+ L  
Sbjct  9    ATAVLILFAFITPSIYYLFRIPGKGISKKRAPPEAAGAWPLIGHLHLLRGSQPPHITLGN  68

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            +ADK+GPIF ++LG  +  +VSN ++AKEC   NDK+ ATR KALA++I+G+NY++   +
Sbjct  69   LADKHGPIFTVKLGVHRALIVSNWEMAKECLRINDKAFATRPKALATDILGFNYSMLGFS  128

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWRQIRK V LE+LS  R++  +  RE  VR ++  +++ W  NK + +  + VEM
Sbjct  129  PYGTYWRQIRKIVTLEVLSNHRLEMFKHVREDEVRDAVGALYQQWIGNK-SNSQKLLVEM  187

Query  608  KQTFD  622
            K+ F+
Sbjct  188  KRWFN  192



>ref|XP_008391540.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=531

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 114/183 (62%), Gaps = 7/183 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  HK       K++P  +     +     L  G  PPH+ L AMA
Sbjct  21   TVIIVFYYLSRRWRAANHK------GKLSPPEAKGGWPIFGHLHLFGGPTPPHITLGAMA  74

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG QQ+ V+S+S+IAKEC+TTND S+  R + + ++ + YNY +FA AP 
Sbjct  75   DKYGPIFTIRLGVQQSLVISSSEIAKECYTTNDLSILGRPEMVVADHVTYNYAMFAFAPP  134

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS-DNKDAATGAVTVEMK  610
            GPYWR+IRK V LE+LS R+++ L+  R   V   +K + E WS   KD +   V VE+K
Sbjct  135  GPYWREIRKIVTLEMLSVRKVELLKHIRVSEVATFLKELHELWSTKKKDGSKDGVVVELK  194

Query  611  QTF  619
            + F
Sbjct  195  EVF  197



>ref|XP_006375025.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
 gb|ERP52822.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
Length=569

 Score =   148 bits (374),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 112/184 (61%), Gaps = 1/184 (1%)
 Frame = +2

Query  68   ACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAA  247
            A  +++LF       + +   P    ++K AP  +     L     L+ G +PPH+ L  
Sbjct  50   ATAVLILFAFITPSIYYLFRIPGKETSKKRAPPEAAGAWPLIGHLHLLGGSQPPHITLGN  109

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            +ADKYGPIF ++LG  +T +VSN ++AKEC  TNDK+ ATR K LA +I+GYNY++   +
Sbjct  110  LADKYGPIFTVKLGVHRTLIVSNWEMAKECLRTNDKAFATRPKTLAMDILGYNYSMLGFS  169

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR IRK V LE+LS  R++  +  RE  VR ++  +++ W+ NK + +  + VEM
Sbjct  170  PYGTYWRLIRKIVTLEVLSNHRLEMFKHVREDEVRDAVGALYQQWTGNK-SNSQKLLVEM  228

Query  608  KQTF  619
            K+ F
Sbjct  229  KRWF  232



>ref|XP_006471473.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=525

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L  +AD+YGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI+G
Sbjct  65   EPPHWVLGKLADEYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   LELLS  R+  LR  REY ++ S+K ++E W  NK +
Sbjct  125  YNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLRHVREYELKTSLKDLYELWDKNK-S  183

Query  581  ATGAVTVEMKQTF  619
                + VEMK+ F
Sbjct  184  TNKMLLVEMKRWF  196



>ref|XP_006432669.1| hypothetical protein CICLE_v10000844mg [Citrus clementina]
 gb|ESR45909.1| hypothetical protein CICLE_v10000844mg [Citrus clementina]
Length=525

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L  +AD+YGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI+G
Sbjct  65   EPPHWVLGKLADEYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   LELLS  R+  LR  REY ++ S+K ++E W  NK +
Sbjct  125  YNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLRHVREYELKTSLKDLYELWDKNK-S  183

Query  581  ATGAVTVEMKQTF  619
                + VEMK+ F
Sbjct  184  TNKMLLVEMKRWF  196



>ref|XP_011030937.1| PREDICTED: cytochrome P450 CYP82H23-like [Populus euphratica]
Length=328

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 112/185 (61%), Gaps = 1/185 (1%)
 Frame = +2

Query  68   ACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAA  247
            A  +++LF       + +   P  G ++K AP  +     L     L+ G +PPH+ L  
Sbjct  9    ASAVLILFAFITPTIYYLFRIPGKGISKKRAPPEAAGAWPLIGHLHLLRGSQPPHITLGN  68

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            +ADK+GPIF ++LG  +  +VSN ++AKEC   NDK+ ATR K LA +I+GYNY+I + +
Sbjct  69   LADKHGPIFTVKLGVHRALIVSNWEMAKECLRINDKAFATRPKTLAMDILGYNYSILSFS  128

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR IRK V LE+LS  R++  +  RE  VR ++  +++ W  NK + +  + VEM
Sbjct  129  PYGTYWRLIRKIVTLEVLSNHRLEMFKHVREDEVRDAVGALYQQWILNK-SNSQKLLVEM  187

Query  608  KQTFD  622
            K+ F+
Sbjct  188  KRWFN  192



>ref|XP_008388170.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=526

 Score =   147 bits (372),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 7/183 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  H+       K++P  +     +     L  G  PPH+ L AMA
Sbjct  16   TVIIVFYYLSRRWRASNHE------GKLSPPEAKGGWPIFGHLHLFGGPTPPHITLGAMA  69

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG Q + V+S+S+IAKEC+TTND S+  R K + ++ + YNY +FA  P 
Sbjct  70   DKYGPIFTIRLGVQPSLVISSSEIAKECYTTNDLSILGRPKMVVADHVTYNYAMFAFGPP  129

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS-DNKDAATGAVTVEMK  610
            GPYWRQIRK V LELLS R+++ L+  R   V   +K + +HWS   K+ +   V VE+K
Sbjct  130  GPYWRQIRKIVTLELLSVRKVELLKHIRVSEVATFLKELHDHWSTKKKEGSKDGVVVELK  189

Query  611  QTF  619
            Q F
Sbjct  190  QWF  192



>gb|KHN19614.1| Cytochrome P450 82A4 [Glycine soja]
Length=520

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH +L A+ADKYGPIF I  G ++  V+SN +IAKECFTTND  +++R K LA E+M YN
Sbjct  60   PHKVLDALADKYGPIFTINNGVKKVLVISNWEIAKECFTTNDIVVSSRPKLLAIELMCYN  119

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +F  APYGPYWR++RK V LE+LS RR++ L   R   V+  IK +F  WS NK+  +
Sbjct  120  QAMFGFAPYGPYWRELRKIVNLEILSNRRVEQLENVRVSEVQSLIKGLFNVWSSNKNNES  179

Query  587  GAVTVEMKQTF  619
            G   VE+KQ F
Sbjct  180  GYALVELKQWF  190



>gb|KDO42969.1| hypothetical protein CISIN_1g048689mg, partial [Citrus sinensis]
Length=239

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  MADKYGPIF ++LG +Q  VVSN +IAKECFTTNDK+ A R K +A+E++G
Sbjct  66   EPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLG  125

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+ +   APYG YWRQ RK   +ELLS RR++ L+  RE  V+ SI+R++++
Sbjct  126  YNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKN  178



>ref|XP_010060877.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=535

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH  LA+MAD+YGPIF IRLG     VVS+S+IAKECFT +D +LA+R + LASE+MGYN
Sbjct  68   PHKTLASMADEYGPIFTIRLGLSPAVVVSSSEIAKECFTKHDLALASRPQLLASEVMGYN  127

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDS-LRPKREYHVRKSIKRMFEHWSDNKDAA  583
            +  FA APYGPYWR++RK   +ELLS RRI+S L P        +IK + + W++NK+  
Sbjct  128  HAFFAFAPYGPYWREVRKIATMELLSIRRIESLLNPVVAAATDSAIKELHKLWTENKN-D  186

Query  584  TGAVTVEMKQTFDR  625
            +G + V++KQ F R
Sbjct  187  SGHIRVDLKQWFAR  200



>gb|KCW67753.1| hypothetical protein EUGRSUZ_F01486 [Eucalyptus grandis]
Length=514

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH  LA+MAD+YGPIF IRLG     VVS+S+IAKECFT +D +LA+R + LASE+MGYN
Sbjct  47   PHKTLASMADEYGPIFTIRLGLSPAVVVSSSEIAKECFTKHDLALASRPQLLASEVMGYN  106

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDS-LRPKREYHVRKSIKRMFEHWSDNKDAA  583
            +  FA APYGPYWR++RK   +ELLS RRI+S L P        +IK + + W++NK+  
Sbjct  107  HAFFAFAPYGPYWREVRKIATMELLSIRRIESLLNPVVAAATDSAIKELHKLWTENKN-D  165

Query  584  TGAVTVEMKQTFDR  625
            +G + V++KQ F R
Sbjct  166  SGHIRVDLKQWFAR  179



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +2

Query  110  FHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLG  289
            +H ++ +   G++ ++APE SGA PI+GHLHLL      PHL+   MADKYGP+F IRLG
Sbjct  23   YHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLG  81

Query  290  AQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVV  469
             ++  VVS+ ++AKECFTT+D +LA+R + +A++ +GYNY +FA +P+G YWR++RK   
Sbjct  82   XKRAVVVSSWEMAKECFTTHDLALASRPEVVAAKYLGYNYAMFAFSPHGAYWREVRKIAT  141

Query  470  LELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            LELLS RR++ L+  R   V   +K +++ W++ K  A G V V+MKQ F
Sbjct  142  LELLSNRRLELLKNVRISEVETCMKELYKLWAEKKSEA-GVVLVDMKQWF  190



>ref|XP_007017414.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14639.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=755

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH++L  MADKYGPIF I++GA +  VVSN + AKEC TTNDK+ A+R K  A + + 
Sbjct  63   QPPHIVLGDMADKYGPIFTIKMGAYRALVVSNWETAKECLTTNDKAFASRPKTHAIDFLT  122

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y++ +F  A YGPYWRQ+RK   LELLS  R+D L+  R+  ++ S+K +++HWS+NK  
Sbjct  123  YDHAMFGFASYGPYWRQMRKVATLELLSNYRLDMLKHVRQSEIKTSLKELYQHWSENK-G  181

Query  581  ATGAVTVEMKQTF  619
            ++  V ++MK  F
Sbjct  182  SSDKVLLDMKAWF  194


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KP H+ L  + DKYGPIF I+LG +   V+SNS++AKEC TTN+++   R K+LA+E  G
Sbjct  682  KPAHITLGDLVDKYGPIFTIKLGMKPALVISNSELAKECLTTNNEAFVNRLKSLAAEFFG  741

Query  401  YNYTIFAVAPYGPY  442
            YNY +   +PYG Y
Sbjct  742  YNYAMLRFSPYGSY  755



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L  MADKYGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI+G
Sbjct  65   EPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   LELLS  R++ L+  REY ++  +K +++ W +NK +
Sbjct  125  YNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVREYELKTCLKELYQLWDNNK-S  183

Query  581  ATGAVTVEMKQ  613
                + VEMK+
Sbjct  184  TNKMLLVEMKR  194



>ref|XP_003634362.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = +2

Query  110  FHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLG  289
            +H ++ +   G++ ++APE SGA PI+GHLHLL      PHL+   MADKYGP+F IRLG
Sbjct  23   YHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLG  81

Query  290  AQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVV  469
             ++  VVS+ ++AKECFTT+D +LA+R + +A++ +GYNY++FA +P+G YWR++RK   
Sbjct  82   LKRAVVVSSWEMAKECFTTHDLALASRPQLVAAKYLGYNYSMFAFSPHGAYWREVRKIAT  141

Query  470  LELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            LELLS RR++ L+  R   V   +K +++ W++ K  A G V V+MKQ F
Sbjct  142  LELLSNRRLELLKNVRISEVETCMKELYKLWAETKSEA-GVVLVDMKQWF  190



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L  MADKYGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI+G
Sbjct  65   EPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   LELLS  R++ L+  REY ++  +K +++ W +NK +
Sbjct  125  YNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVREYELKTCLKELYQLWDNNK-S  183

Query  581  ATGAVTVEMKQ  613
                + VEMK+
Sbjct  184  TNKMLLVEMKR  194



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 118/170 (69%), Gaps = 2/170 (1%)
 Frame = +2

Query  110  FHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLG  289
            +H ++ +   G++ ++APE SGA PI+GHLHLL      PHL+   MADKYGP+F IRLG
Sbjct  23   YHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLG  81

Query  290  AQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVV  469
             ++  VVS+ ++AKECFTT+D +LA+R + +A++ +GYNY +F ++P+G YWR++RK   
Sbjct  82   LKRAVVVSSWEMAKECFTTHDLALASRPELVAAKYLGYNYAMFGLSPHGAYWREVRKIAT  141

Query  470  LELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            LELLS RR++ L+  R   V   +K ++E W+  K  A G V V+MKQ F
Sbjct  142  LELLSNRRLELLKNVRISEVETCMKELYELWAKKKSEA-GVVLVDMKQWF  190



>gb|KJB14542.1| hypothetical protein B456_002G130200 [Gossypium raimondii]
Length=410

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KPPH+IL+ MA+K GPIF I++G  +  +VS+ K AKEC T NDK+ A+R   LA E + 
Sbjct  60   KPPHIILSNMAEKCGPIFTIKMGVHRALIVSDHKTAKECLTINDKAFASRPSTLAMEYLS  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ +FA APYG +WRQ+RK   LELLS  R++ LR  RE  ++ S+K +++ W + KD 
Sbjct  120  YNHAMFAFAPYGNHWRQLRKLATLELLSTHRLEQLRHVRESEIKTSLKELYQFWEEKKD-  178

Query  581  ATGAVTVEMKQTF  619
             +  V VEMK+ F
Sbjct  179  GSDTVLVEMKKWF  191



>ref|XP_006432715.1| hypothetical protein CICLE_v10003834mg [Citrus clementina]
 gb|ESR45955.1| hypothetical protein CICLE_v10003834mg [Citrus clementina]
Length=219

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L  MADKYGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA+EI+G
Sbjct  8    EPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAAEILG  67

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PY  YWR+  K   LELLS  R++ L+  REY ++  +K +++ W +NK +
Sbjct  68   YNFSMFGFSPYDFYWRETHKIATLELLSNYRLEKLKHVREYELKTCLKELYQLWDNNK-S  126

Query  581  ATGAVTVEMKQ  613
                + VEMK+
Sbjct  127  TNKMLLVEMKR  137



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L +MADKYGPIF I++G  +  VVS+ ++AKEC TTNDK  A+R K LA EI+G
Sbjct  26   EPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMAKECLTTNDKIFASRPKTLAMEILG  85

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   LELLS  R++ LR  R+Y V+  +K ++E W  +K  
Sbjct  86   YNFSMFGSSPYGSYWRETRKIATLELLSKHRLEKLRHVRDYEVKTCLKELYELW--DKSK  143

Query  581  ATGAVTVEMKQTFD  622
            +T  + VEMK+ F+
Sbjct  144  STNKMLVEMKRWFE  157



>gb|KDO36922.1| hypothetical protein CISIN_1g041575mg, partial [Citrus sinensis]
Length=263

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 95/139 (68%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H IL  MA+KYGPIF +++G  +  VVSNS+I KECFTTNDK+LA+R + +A EI+G
Sbjct  12   EPTHRILGNMANKYGPIFTMKMGVNRALVVSNSEITKECFTTNDKALASRPRRMAMEILG  71

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+     +PYG YWR+ RK   +ELLS  R++ L+  RE  V  SIK +F+   D +++
Sbjct  72   YNFLATPSSPYGSYWRETRKIATVELLSNHRLEKLKHVRESEVTASIKGLFK---DCQNS  128

Query  581  ATGAVTVEMKQ-----TFD  622
            ATG V+VEMK      TFD
Sbjct  129  ATGKVSVEMKHWLEGTTFD  147



>ref|XP_012071999.1| PREDICTED: cytochrome P450 CYP82D47-like [Jatropha curcas]
Length=528

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 122/202 (60%), Gaps = 12/202 (6%)
 Frame = +2

Query  14   MDFLSPPCNNIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilg  193
            MDFL+           T+     LLFF C  L   +  K +  +N  + P P+GA P+LG
Sbjct  1    MDFLAG--------FPTIGLVAFLLFFSC--LLKILKQKISKKKNL-LPPRPNGAWPVLG  49

Query  194  hlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRT  373
            HL LL    K PH+ILA MADKYGPIF I+ G  ++ VVS+ ++AKECFTTNDK+ A R 
Sbjct  50   HLPLLRGP-KQPHVILANMADKYGPIFSIKTGVHRSLVVSSWELAKECFTTNDKAFANRP  108

Query  374  KALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMF  553
              LA+E+MGYN  +F  +PYG YWR IRK   +ELLS  R+ S R  RE  ++ ++  ++
Sbjct  109  NFLAAELMGYNSAMFGFSPYGQYWRVIRKIATVELLSNHRLQSFRHVRESEIKAAMNGIY  168

Query  554  EHWSDNKDAATGAVTVEMKQTF  619
            + W +N D     + V+MKQ F
Sbjct  169  QLWEENIDYNKADMVVKMKQWF  190



>ref|XP_012071745.1| PREDICTED: cytochrome P450 CYP82D47-like [Jatropha curcas]
 gb|KDP38430.1| hypothetical protein JCGZ_04355 [Jatropha curcas]
Length=532

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 124/188 (66%), Gaps = 6/188 (3%)
 Frame = +2

Query  71   CTLVLLFFLCNKLFHAIMHKPNNGRNQK----VAPEPSgalpilghlhlliaggKPPHLI  238
             ++ ++  L   L ++ + K    R +K    + PEPSG LP +GHLHLL    +PPH+ 
Sbjct  10   SSVFIVLALLTPLMYSFLMKSRKARGKKNGLPLPPEPSGKLPFIGHLHLLGGS-QPPHIT  68

Query  239  LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  418
            L  +A+K GPI+RI++G   T ++++S++AKECFT NDK+ A R KAL  ++M YNY +F
Sbjct  69   LGKIAEKLGPIYRIKVGVHPTLIITSSELAKECFTINDKAFAYRPKALFLDVMTYNYAMF  128

Query  419  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA-TGAV  595
              +PYG YWR+IRK   LELLS RR++ L+  RE  ++++I+ ++  W  NK+++ T  +
Sbjct  129  GASPYGDYWREIRKIASLELLSARRLELLKHVRENEIKEAIQGLYHGWLKNKNSSKTKQL  188

Query  596  TVEMKQTF  619
             VEMKQ F
Sbjct  189  EVEMKQWF  196



>ref|XP_009336438.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 112/183 (61%), Gaps = 7/183 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  HK       K++P  +     +     L  G  PPH+IL AMA
Sbjct  21   TVIIVFYYLSRRWRAANHK------GKLSPPEAKGGWPIFGHLHLFGGSTPPHIILGAMA  74

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF +RLG Q + VVS+S+IAKEC+TTND S+ +R K +  + + YNY +F   P 
Sbjct  75   DKYGPIFTVRLGVQPSLVVSSSEIAKECYTTNDLSILSRPKMVVVDHVSYNYAMFGFGPP  134

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS-DNKDAATGAVTVEMK  610
            GPYWR+IRK V LELLS R+++ L+  R   V   +K + + WS   K+ +   V VE+K
Sbjct  135  GPYWREIRKIVTLELLSVRKVELLKHVRVSEVATFLKELHQLWSAKKKEGSKDGVVVELK  194

Query  611  QTF  619
            Q F
Sbjct  195  QWF  197



>ref|XP_009364766.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 112/183 (61%), Gaps = 7/183 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  HK       K++P  +     +     L  G  PPH+IL AMA
Sbjct  21   TVIIVFYYLSRRWRAANHK------GKLSPPEAKGGWPIFGHLHLFGGSTPPHIILGAMA  74

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF +RLG Q + VVS+S+IAKEC+TTND S+ +R K +  + + YNY +F   P 
Sbjct  75   DKYGPIFTVRLGVQPSLVVSSSEIAKECYTTNDLSILSRPKMVVVDHVSYNYAMFGFGPP  134

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS-DNKDAATGAVTVEMK  610
            GPYWR+IRK V LELLS R+++ L+  R   V   +K + + WS   K+ +   V VE+K
Sbjct  135  GPYWREIRKIVTLELLSVRKVELLKHVRVSEVATFLKELHQLWSAKKKEGSKDGVVVELK  194

Query  611  QTF  619
            Q F
Sbjct  195  QWF  197



>gb|KDO44281.1| hypothetical protein CISIN_1g037130mg, partial [Citrus sinensis]
Length=252

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  MADKYGPIF ++LG +Q  VVSN +IAKECFTTNDK+ A+R K +A E++G
Sbjct  64   EPAHRVLGDMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFASRPKTMAMELLG  123

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFE  556
            YN+++ + APYG YWRQ RK  ++ELLS  R++ L+  RE  V+ SI+R+++
Sbjct  124  YNFSVISFAPYGNYWRQSRKIAIIELLSSHRLEKLKHVRESEVKASIQRLYK  175



>gb|KJB63753.1| hypothetical protein B456_010G014200 [Gossypium raimondii]
Length=327

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 104/165 (63%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  HKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTF  304
            H P N  N+K  P  +G    +     L+AG +PPH+ LA MADKYG +F I+LG  +T 
Sbjct  34   HAPTN-TNKKQTPPEAGGAWPIIGHLHLLAGPQPPHISLANMADKYGRMFTIKLGVHRTL  92

Query  305  VVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLS  484
            VV+N +IAKEC T NDK+ A+R K +  E++GYN  +   APYGPYWRQ+RK   +ELLS
Sbjct  93   VVNNWEIAKECLTINDKAFASRPKVVNMELLGYNNAMIVFAPYGPYWRQVRKCATIELLS  152

Query  485  GRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
              R+D  +  RE  V+ S++++++ W+  K      V VEMK+ F
Sbjct  153  THRLDLFKHVRESEVKTSLEQLYQIWNKKKGTNCDKVLVEMKRWF  197



>ref|XP_009365841.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=537

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+IL  MADKYGPIF I LG  +  +VS+ ++AK+CFTTNDK  ATR K LA +++G
Sbjct  57   QPPHVILGNMADKYGPIFTINLGQHKALIVSSWEMAKQCFTTNDKVFATRPKHLAGKLLG  116

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YNY++F  +PYGPYWR +RK   +ELLS  R++ LR  RE  V    K +++ W  N   
Sbjct  117  YNYSMFGFSPYGPYWRHVRKIATVELLSNHRLELLRHVRESEVNACTKDLYDKWERN-GG  175

Query  581  ATGAVTVEMKQTF  619
             +  V VEM + F
Sbjct  176  ESDWVLVEMNRWF  188



>gb|KJB63755.1| hypothetical protein B456_010G014200 [Gossypium raimondii]
Length=332

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 104/165 (63%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  HKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTF  304
            H P N  N+K  P  +G    +     L+AG +PPH+ LA MADKYG +F I+LG  +T 
Sbjct  34   HAPTN-TNKKQTPPEAGGAWPIIGHLHLLAGPQPPHISLANMADKYGRMFTIKLGVHRTL  92

Query  305  VVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLS  484
            VV+N +IAKEC T NDK+ A+R K +  E++GYN  +   APYGPYWRQ+RK   +ELLS
Sbjct  93   VVNNWEIAKECLTINDKAFASRPKVVNMELLGYNNAMIVFAPYGPYWRQVRKCATIELLS  152

Query  485  GRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
              R+D  +  RE  V+ S++++++ W+  K      V VEMK+ F
Sbjct  153  THRLDLFKHVRESEVKTSLEQLYQIWNKKKGTNCDKVLVEMKRWF  197



>gb|KJB63756.1| hypothetical protein B456_010G014200 [Gossypium raimondii]
Length=328

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 104/165 (63%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  HKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTF  304
            H P N  N+K  P  +G    +     L+AG +PPH+ LA MADKYG +F I+LG  +T 
Sbjct  34   HAPTN-TNKKQTPPEAGGAWPIIGHLHLLAGPQPPHISLANMADKYGRMFTIKLGVHRTL  92

Query  305  VVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLS  484
            VV+N +IAKEC T NDK+ A+R K +  E++GYN  +   APYGPYWRQ+RK   +ELLS
Sbjct  93   VVNNWEIAKECLTINDKAFASRPKVVNMELLGYNNAMIVFAPYGPYWRQVRKCATIELLS  152

Query  485  GRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
              R+D  +  RE  V+ S++++++ W+  K      V VEMK+ F
Sbjct  153  THRLDLFKHVRESEVKTSLEQLYQIWNKKKGTNCDKVLVEMKRWF  197



>ref|XP_010060881.1| PREDICTED: cytochrome P450 82A3-like [Eucalyptus grandis]
Length=273

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  LA+MAD++GPIF IRLG  +  VVS S+IAKECFT ND +L+TR + LA +I+ 
Sbjct  58   KLPHKTLASMADQFGPIFTIRLGMFRALVVSGSEIAKECFTKNDIALSTRPQQLAPKILA  117

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDS-LRPKREYHVRKSIKRMFEHWSDNKD  577
            Y Y +F   PYGPYWR++RK V LELLS RR++S L P +      +I+ + E W ++KD
Sbjct  118  YGYAMFGYVPYGPYWREVRKMVTLELLSNRRVNSLLNPIQASEADVAIQELHELWIESKD  177

Query  578  AATGAVTVEMKQTFDR  625
              +G + V++KQ F +
Sbjct  178  -DSGHIIVDLKQWFAK  192



>ref|XP_008388075.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=531

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 112/183 (61%), Gaps = 7/183 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  HK       K++P        +     L+ G  PPH+ L AMA
Sbjct  21   TVIIVFYYLSRRWRAANHK------GKLSPPEVKGGWPIFGHLHLLGGSTPPHITLGAMA  74

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG Q + V+S+S+IAKEC+TTND S+ +R K +  + + YNY +FA  P 
Sbjct  75   DKYGPIFTIRLGVQPSLVISSSEIAKECYTTNDLSILSRPKMVVVDHVSYNYAMFAFGPP  134

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS-DNKDAATGAVTVEMK  610
            GPYWR+IRK V LELLS R+++ L+  R   V   +K + E WS   K+ +   V VE+K
Sbjct  135  GPYWREIRKIVTLELLSVRKVELLKHIRVSEVATFLKELHELWSTKKKEGSKDGVVVELK  194

Query  611  QTF  619
            Q F
Sbjct  195  QWF  197



>emb|CAN74206.1| hypothetical protein VITISV_031128 [Vitis vinifera]
Length=284

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MADKYGP+F IRLG  +  VVS+ ++AKEC TTND++ ++R + LAS+ +GYNY +F  +
Sbjct  1    MADKYGPVFTIRLGVHRALVVSSWEMAKECLTTNDQAASSRPELLASKHLGYNYAMFGFS  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR++RK + LELLS RR++ L+  R   V  SIK ++E W + K+  +G V+VEM
Sbjct  61   PYGSYWREVRKIISLELLSNRRLELLKDVRASEVVTSIKELYELWEEKKN-ESGLVSVEM  119

Query  608  KQTF  619
            KQ F
Sbjct  120  KQWF  123



>gb|KJB63765.1| hypothetical protein B456_010G015200 [Gossypium raimondii]
Length=532

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ LA MADKYG IF I+LG  +  VVS+ +IAKEC T NDK+ A+R K  +SEI+G
Sbjct  60   QPPHISLANMADKYGRIFSIKLGVHRALVVSDWEIAKECLTVNDKAFASRPKLASSEILG  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
             N  +   APYGPYWRQIRK   +ELLS  R++ L+  RE  V+ S++++++ W+  + A
Sbjct  120  NNRAMLGFAPYGPYWRQIRKVATIELLSNHRLELLKHVRESEVKTSLQQLYQLWNKKRSA  179

Query  581  ATGAVTVEMKQTF  619
             +  V VEMK  F
Sbjct  180  NSDKVLVEMKGWF  192



>gb|KCW85809.1| hypothetical protein EUGRSUZ_B02554, partial [Eucalyptus grandis]
Length=487

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ILA+MADKYGPIF I+ G  +  +VS  +IAK+C T ND++ A+R K+++SE+M Y
Sbjct  23   PPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLTVNDRAFASRPKSVSSEVMAY  82

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F +APYGPYWRQ+RK  +LELLS  R++ L+  R   V+ S+  +++   ++   A
Sbjct  83   NYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRHSEVQASVTHLYKRCMESYTGA  142

Query  584  TGAVTVEMKQTF  619
               V V+MK+ F
Sbjct  143  PKKVLVDMKRWF  154



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+ L  MADKYGPIF IRLG  +  VVS+ ++AKECFTTND +++ R K +A E +GYN
Sbjct  65   PHVTLGTMADKYGPIFTIRLGVHRALVVSSREVAKECFTTNDSAVSGRPKLVAPEHLGYN  124

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
            Y +FA +PY  YWR++RK V  ELLS RR++ L+  R   V  SIK +++ W++ K+   
Sbjct  125  YAMFAFSPYDAYWREVRKIVNTELLSNRRLELLKDVRASEVETSIKELYKLWAEKKN-EL  183

Query  587  GAVTVEMKQTF  619
            G V VEMKQ F
Sbjct  184  GHVLVEMKQWF  194



>gb|KCW68807.1| hypothetical protein EUGRSUZ_F02406 [Eucalyptus grandis]
Length=502

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ILA+MADKYGPIF I+ G  +  +VSN +IAK+C T ND++ A+R K+++SE+M Y
Sbjct  38   PPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEVMAY  97

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F +APYGPYWR +RK  +LELLS  R++ L+  R   V+ S+  +++   ++   A
Sbjct  98   NYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHSEVQASVTHLYKRCMESYSGA  157

Query  584  TGAVTVEMKQTF  619
               V V+MK+ F
Sbjct  158  PMKVLVDMKRWF  169



>ref|XP_010064745.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ILA+MADKYGPIF I+ G  +  +VSN +IAK+C T ND++ A+R K+++SE+M Y
Sbjct  68   PPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEVMAY  127

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F +APYGPYWR +RK  +LELLS  R++ L+  R   V+ S+  +++   ++   A
Sbjct  128  NYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHSEVQASVTHLYKRCMESYSGA  187

Query  584  TGAVTVEMKQTF  619
               V V+MK+ F
Sbjct  188  PMKVLVDMKRWF  199



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   147 bits (372),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 130/203 (64%), Gaps = 12/203 (6%)
 Frame = +2

Query  11   TMDFLSPPCNNIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpil  190
            TMDFL          +  L   +V  F +    +H ++ +   G++ ++APE SGA PI+
Sbjct  528  TMDFL----------LQCLNPVMVGAFAILVLSYHLLLWRSGAGKS-RMAPEASGAWPII  576

Query  191  ghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATR  370
            GHLHLL      PHL+   MADKYGP+F IRLG ++  VVS+ ++AKECFTT+D +LA+R
Sbjct  577  GHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASR  636

Query  371  TKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRM  550
             + +A++ +GYNY +FA +P+G YWR++RK   LELLS RR++ L+  R   V   +K +
Sbjct  637  PELVAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKEL  696

Query  551  FEHWSDNKDAATGAVTVEMKQTF  619
            ++ W++ K  A G V V+MKQ F
Sbjct  697  YKLWAEKKSEA-GVVLVDMKQWF  718


 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = +2

Query  146  NQKVAPEPSgal-pilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSK  322
            N+K+APE + A   I     L     + PH+ L  MADKYGP+F IR+G  +  VVS+ +
Sbjct  34   NKKIAPEAAAAWPIIGHLHLLAGGSHQLPHITLGNMADKYGPVFTIRIGLHRAVVVSSWE  93

Query  323  IAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDS  502
            +AKEC T ND+  ++R + LAS+++GYNY +F  +PYG YWR++RK + LELLS  R++ 
Sbjct  94   MAKECSTANDQVSSSRPELLASKLLGYNYAMFGFSPYGSYWREMRKIISLELLSNSRLEL  153

Query  503  LRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            L+  R   V  SIK +++ W++ K+  +G V+VEMKQ F
Sbjct  154  LKDVRASEVVTSIKELYKLWAEKKN-ESGLVSVEMKQWF  191



>gb|ABB20912.1| P450 mono-oxygenase [Stevia rebaudiana]
Length=528

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H +L  +ADKYGPIF I+LG  Q  VVS++   K+CFTT+DK+ A+R K+ A EIMGYNY
Sbjct  62   HRVLGDLADKYGPIFTIKLGVYQVLVVSSADAVKDCFTTSDKAFASRPKSTAVEIMGYNY  121

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKD-AAT  586
             +F +APYG YWRQ+RK  VLE+LS +R+D L   R   VR S   +++ W  NK+   +
Sbjct  122  AMFGLAPYGEYWRQVRKIAVLEILSQKRVDMLEWARVSEVRTSTNEVYDAWRVNKENEGS  181

Query  587  GAVTVEMKQTF  619
              V V+MKQ F
Sbjct  182  DMVLVDMKQWF  192



>ref|XP_012071747.1| PREDICTED: cytochrome P450 CYP82D47-like [Jatropha curcas]
Length=518

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H+ L  +ADKYGPIF I+LG  +T VVS+  +AKEC TTND++ A+R K LA EI+G
Sbjct  48   QPAHITLGNLADKYGPIFTIKLGVYRTLVVSSRAMAKECLTTNDRAFASRPKGLAMEILG  107

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y++   +PYG YWRQ+RK V LELLS  R++ L+  RE  V+ +IK +++ W  NK +
Sbjct  108  YDYSMLGFSPYGEYWRQMRKIVTLELLSNHRLEMLKHVREAEVKMAIKALYQKWIKNK-S  166

Query  581  ATGAVTVEMKQTF  619
             +  ++ EMK+ F
Sbjct  167  NSNKLSAEMKRWF  179



>ref|XP_009336967.1| PREDICTED: cytochrome P450 82A4-like [Pyrus x bretschneideri]
Length=526

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 113/183 (62%), Gaps = 7/183 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  HK       K++P  +     +     L+ G  PPH+ L AMA
Sbjct  16   TVIVVFYYLSRRWRAANHK------GKLSPPEAKGGWPIFGHLHLLGGSTPPHITLGAMA  69

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG Q + V+S+S+IAKEC+TTND S+ +R K +  + + Y+Y +FA  P 
Sbjct  70   DKYGPIFTIRLGVQPSLVISSSEIAKECYTTNDLSILSRPKMVVVDHVSYDYAMFAFGPP  129

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS-DNKDAATGAVTVEMK  610
            GPYWR+IRK V LELLS R+++ L+  R   V   +K + E WS   K+ +   V VE+K
Sbjct  130  GPYWREIRKIVTLELLSVRKVELLKHVRVSEVATFLKELHELWSTKKKEGSKDGVVVELK  189

Query  611  QTF  619
            Q F
Sbjct  190  QWF  192



>gb|KHG26594.1| Cytochrome P450 [Gossypium arboreum]
Length=526

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KP H+ +   AD YGPIF  RLG   T VVSN ++AKECFTTNDK+ A+R + LA+E++G
Sbjct  61   KPAHITMGNFADAYGPIFTFRLGMHPTLVVSNWEMAKECFTTNDKAFASRPRTLAAELLG  120

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ +F  + YGPYWR +RK   LE+LS  R++ LR  RE  +R SIKR++E  ++N   
Sbjct  121  YNFAMFGFSSYGPYWRHVRKIATLEVLSNYRLEKLRHVRESEIRASIKRLYELVTNN---  177

Query  581  ATGAVTVEMKQTF  619
             +  V VEMK+ F
Sbjct  178  CSEPVVVEMKRWF  190



>ref|XP_010046449.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ILA+MADKYGPIF I+ G  +  +VS  +IAK+C T ND++ A+R K+++SE+M Y
Sbjct  68   PPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLTVNDRAFASRPKSVSSEVMAY  127

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F +APYGPYWRQ+RK  +LELLS  R++ L+  R   V+ S+  +++   ++   A
Sbjct  128  NYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRHSEVQASVTHLYKRCMESYTGA  187

Query  584  TGAVTVEMKQTF  619
               V V+MK+ F
Sbjct  188  PKKVLVDMKRWF  199



>ref|XP_010106083.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07353.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 114/185 (62%), Gaps = 11/185 (6%)
 Frame = +2

Query  71   CTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAM  250
            C +V +++   +++         G  +  AP  +     L     L+ G KP H+ L AM
Sbjct  20   CAIVFIYYFLTRMW---------GIGKGKAPPEALGGWPLFGHLSLLKGPKPSHINLGAM  70

Query  251  ADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAP  430
            AD  GPIF IR+G+ +  VVS+S++A+ECFTTND +LA+R   LA++ +GYNY +FA AP
Sbjct  71   ADICGPIFTIRIGSHRGLVVSSSEMARECFTTNDLALASRPNLLAAKHIGYNYAMFAFAP  130

Query  431  YGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSD--NKDAATGAVTVE  604
            +GP+WR+IRK   +ELLS RR++ L+  R   V   +K +++HW+   N +  +G  +VE
Sbjct  131  HGPFWREIRKIATVELLSNRRLELLKHIRISEVAAFVKELYQHWTTKWNDNDHSGQASVE  190

Query  605  MKQTF  619
            MKQ F
Sbjct  191  MKQRF  195



>gb|KDP38432.1| hypothetical protein JCGZ_04357 [Jatropha curcas]
Length=529

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H+ L  +ADKYGPIF I+LG  +T VVS+  +AKEC TTND++ A+R K LA EI+G
Sbjct  59   QPAHITLGNLADKYGPIFTIKLGVYRTLVVSSRAMAKECLTTNDRAFASRPKGLAMEILG  118

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y++   +PYG YWRQ+RK V LELLS  R++ L+  RE  V+ +IK +++ W  NK +
Sbjct  119  YDYSMLGFSPYGEYWRQMRKIVTLELLSNHRLEMLKHVREAEVKMAIKALYQKWIKNK-S  177

Query  581  ATGAVTVEMKQTF  619
             +  ++ EMK+ F
Sbjct  178  NSNKLSAEMKRWF  190



>ref|XP_004306669.1| PREDICTED: cytochrome P450 CYP82D47-like [Fragaria vesca subsp. 
vesca]
Length=539

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFT-TNDKSLATRTKALASEIM  397
            +PPH+ILA MA+KYGP+F I+LG  +  VVS+  +AKEC T TNDK+ A R KALA+EIM
Sbjct  62   QPPHVILANMANKYGPLFTIKLGVHRALVVSSWDVAKECLTSTNDKAFANRPKALAAEIM  121

Query  398  GYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKD  577
            GY+Y +F  +PYG YWRQ+RK  +L +LSG +++ L+  RE  V+   K + + W  NK 
Sbjct  122  GYDYAMFGFSPYGAYWRQVRKIAMLHILSGHKLEMLKHVRESEVKVCTKHIVDMWERNK-  180

Query  578  AATGAVTVEMKQTF  619
              +  V VEM++ F
Sbjct  181  GVSNKVMVEMRKWF  194



>gb|KJB63754.1| hypothetical protein B456_010G014200 [Gossypium raimondii]
Length=428

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 104/165 (63%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  HKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTF  304
            H P N  N+K  P  +G    +     L+AG +PPH+ LA MADKYG +F I+LG  +T 
Sbjct  34   HAPTN-TNKKQTPPEAGGAWPIIGHLHLLAGPQPPHISLANMADKYGRMFTIKLGVHRTL  92

Query  305  VVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLS  484
            VV+N +IAKEC T NDK+ A+R K +  E++GYN  +   APYGPYWRQ+RK   +ELLS
Sbjct  93   VVNNWEIAKECLTINDKAFASRPKVVNMELLGYNNAMIVFAPYGPYWRQVRKCATIELLS  152

Query  485  GRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
              R+D  +  RE  V+ S++++++ W+  K      V VEMK+ F
Sbjct  153  THRLDLFKHVRESEVKTSLEQLYQIWNKKKGTNCDKVLVEMKRWF  197



>ref|XP_003543523.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=547

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH +L A+ADKYGPIF I++G ++  V+SN +IAKECFTTND  +++R K +A E+M YN
Sbjct  84   PHRVLGALADKYGPIFTIKIGVKKALVISNWEIAKECFTTNDIVVSSRPKLVAIELMCYN  143

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +F  APYGPYWRQ+RK V LE+LS RR++ L+      V+ SIK +F  WS  K+  +
Sbjct  144  QAMFGFAPYGPYWRQLRKIVNLEILSNRRVEQLQHVHVSEVQSSIKELFNVWSSKKN-ES  202

Query  587  GAVTVEMKQTF  619
            G   VE+ Q F
Sbjct  203  GYALVELNQWF  213



>gb|KHN13272.1| Cytochrome P450 82A4 [Glycine soja]
Length=523

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH +L A+ADKYGPIF I++G ++  V+SN +IAKECFTTND  +++R K +A E+M YN
Sbjct  60   PHRVLGALADKYGPIFTIKIGVKKALVISNWEIAKECFTTNDIVVSSRPKLVAIELMCYN  119

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +F  APYGPYWRQ+RK V LE+LS RR++ L+      V+ SIK +F  WS  K+  +
Sbjct  120  QAMFGFAPYGPYWRQLRKIVNLEILSNRRVEQLQHVHVSEVQSSIKELFNVWSSKKN-ES  178

Query  587  GAVTVEMKQTF  619
            G   VE+ Q F
Sbjct  179  GYALVELNQWF  189



>ref|XP_010092357.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB51033.1| Cytochrome P450 82A3 [Morus notabilis]
Length=534

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+ LA +ADK GPIF +R+G+    VVS+S++AKECFT ND +LA+R   LA++ MGYN
Sbjct  63   PHITLANLADKCGPIFTVRIGSHPGLVVSSSEMAKECFTINDLALASRPNLLAAKHMGYN  122

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS---DNKD  577
            Y +F +AP+GP+WR+IRK   ++LLS RR++ L+  R   V   +K ++EHW+   ++ D
Sbjct  123  YAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIRISEVASFVKELYEHWTTKWNDND  182

Query  578  AATGAVTVEMKQTF  619
              +G  +VEMKQ F
Sbjct  183  HHSGQASVEMKQRF  196



>ref|XP_003554125.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=525

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            P  +L A+ADKYGPIF I  G ++  V+SN +IAKECFT ND  +++R K L  E+M YN
Sbjct  60   PDRVLGALADKYGPIFTINNGVKKVLVISNWEIAKECFTKNDIVVSSRPKLLGIELMCYN  119

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +F  APYGPYWR++RK V LE+LS RR++ L   R   V+ SIK +F  WS NK+  +
Sbjct  120  QAMFGFAPYGPYWRELRKIVNLEILSNRRVEQLENVRVSEVQSSIKELFNVWSSNKNNES  179

Query  587  GAVTVEMKQTFDR  625
            G   +E+KQ F +
Sbjct  180  GYALLELKQWFSQ  192



>gb|KJB59837.1| hypothetical protein B456_009G274900 [Gossypium raimondii]
Length=526

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 90/133 (68%), Gaps = 3/133 (2%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KP H+ L   AD YGPIF  RLG   T VVSN ++AKECFTTNDK+ A+R + LA+E++G
Sbjct  61   KPAHITLGNFADAYGPIFTFRLGMHPTLVVSNWEMAKECFTTNDKAFASRPRTLAAELLG  120

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ +F  + YGPYWR +RK   LE+LS  R+  LR  RE  +R SIKR++E  ++N   
Sbjct  121  YNFAMFGFSSYGPYWRHVRKIATLEVLSNYRLAKLRHVRESEIRASIKRLYELVTNN---  177

Query  581  ATGAVTVEMKQTF  619
             +  V VEMK+ F
Sbjct  178  CSEPVVVEMKRWF  190



>gb|KJB63763.1| hypothetical protein B456_010G015000, partial [Gossypium raimondii]
Length=985

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ LA MADKYG IF I+LG  +  VVSN +IAKEC T NDK+ A+R     SEIMG
Sbjct  64   QPPHISLANMADKYGRIFSIKLGVHRALVVSNWEIAKECLTINDKAFASRPMLACSEIMG  123

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +    PYGPYWRQ+RK V +ELLS  R++ L+P  E  ++ S++++++ W+  K  
Sbjct  124  YNGAMIGFVPYGPYWRQVRKIVTIELLSNHRLELLKPVMESEIKTSLQQLYQLWNKKKST  183

Query  581  ATGAVTVEMKQTF  619
             +  V VEMK  F
Sbjct  184  NSDKVLVEMKGWF  196


 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 10/133 (8%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ LA MADKYG IF I+LG  +  VVS+ +IAKEC T NDK  A+R K  +SEI+G
Sbjct  570  QPPHISLANMADKYGRIFSIKLGVHRALVVSDWEIAKECLTVNDKEFASRPKLASSEILG  629

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
             N  +   APYGPYWRQIRK   +ELLS  R++ L+  RE  V+ S++           A
Sbjct  630  NNRAMLGFAPYGPYWRQIRKVAAIELLSNHRLELLKHVRESEVKTSLQH----------A  679

Query  581  ATGAVTVEMKQTF  619
             +  V VEM+  F
Sbjct  680  NSDKVLVEMRGWF  692



>ref|XP_010061806.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=541

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ILA+MADKYGPIF I+ G  +  +VSN +IAK+C T ND++ A+R K+++SE+M Y
Sbjct  77   PPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEVMAY  136

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F +APYGPYWR +RK  +L+LLS  R++ L+  R+  V+ S+  +++   ++   A
Sbjct  137  NYAMFGLAPYGPYWRYVRKVTMLDLLSSHRLELLKHVRDSEVQASMTHLYKRCMESYSGA  196

Query  584  TGAVTVEMKQTF  619
               V V+MK+ F
Sbjct  197  PEKVLVDMKRWF  208



>ref|XP_006375027.1| putative cytochrome P450 family protein, partial [Populus trichocarpa]
 gb|ERP52824.1| putative cytochrome P450 family protein, partial [Populus trichocarpa]
Length=183

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 100/169 (59%), Gaps = 1/169 (1%)
 Frame = +2

Query  68   ACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAA  247
            A  +++LF       + +   P    N+K AP  +     L     L+ G +PPH+ L  
Sbjct  9    ATAVLILFAFITPSIYYLFRIPGK-ENKKRAPPEAAGAWPLIGHLHLLGGSQPPHITLGN  67

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            +ADKYGPIF ++L   +T +VSN ++AKEC  TNDK+ ATR K LA +I+GYNY++   +
Sbjct  68   LADKYGPIFTVKLEVHRTLIVSNWEMAKECLRTNDKAFATRPKTLAMDILGYNYSMLGFS  127

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNK  574
            PYG YWR IRK V LE+LS  R++     RE  VR +I  +++ W  NK
Sbjct  128  PYGTYWRLIRKIVTLEVLSNHRLEMFTHVREDEVRDAIGALYQQWIGNK  176



>ref|XP_009364178.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ L AMADKYGPIF IR+G   + V+S+S+IAKECFTTND SL +R K  A E +GY
Sbjct  58   PPHITLGAMADKYGPIFTIRIGVYPSLVISSSEIAKECFTTNDLSLNSRPKMAAVEHIGY  117

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSD-NKDA  580
            NY +F   P GPYWR+IRK V LELLS R+++ L+  R   V   ++ + + WS   K+ 
Sbjct  118  NYAMFGFGPSGPYWREIRKIVTLELLSIRKVELLKHIRVLEVTTFLEELHKTWSTRQKEG  177

Query  581  ATGAVTVEMKQTF  619
            +   V VE+KQ F
Sbjct  178  SNDGVVVELKQWF  190



>ref|XP_006366437.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=520

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 110/191 (58%), Gaps = 5/191 (3%)
 Frame = +2

Query  41   NIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliagg  220
            +   I  TLA + ++LFFL  + F A     +          P   +    HL       
Sbjct  2    DFFLIAVTLASSFIVLFFLHKQFFSAKKQSCSRKVPDAAGAWP---VIGHLHLLGGSESD  58

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            + PH +L  +ADKYG IF ++LG  Q  VVS+ K+AKECFTTND +LA R K++ASEI+G
Sbjct  59   QLPHKVLGRLADKYGSIFGMKLGVHQVVVVSDHKLAKECFTTNDLALANRPKSMASEIIG  118

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y + +F +  YGPYWR+ RK   +EL S RRI+ L+  R++ V  S+K ++ +W+ N   
Sbjct  119  YKHAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIRQFEVNSSVKEIYNNWAKNNLN  178

Query  581  ATGAVTVEMKQ  613
            A   V +EMK+
Sbjct  179  AV--VKMEMKE  187



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 94/137 (69%), Gaps = 4/137 (3%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L +MA+KYGPIF I++G  +  VVSN + AKECFTT+DK+ + R K LASE++ 
Sbjct  65   EPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDKAFSGRPKTLASELLT  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE  VR  +K +++ W DN+  
Sbjct  125  YDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRESEVRAFLKELYKLWDDNRGG  184

Query  581  ATGA----VTVEMKQTF  619
            A+ +    V VEM++ F
Sbjct  185  ASKSKGSMVLVEMERWF  201



>gb|KCW68808.1| hypothetical protein EUGRSUZ_F02407 [Eucalyptus grandis]
Length=562

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ILA+MADKYGPIF I+ G  +  +VSN +IAK+C T ND++ A+R K+++SE+M Y
Sbjct  98   PPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEVMAY  157

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F +APYGPYWR +RK  +L+LLS  R++ L+  R+  V+ S+  +++   ++   A
Sbjct  158  NYAMFGLAPYGPYWRYVRKVTMLDLLSSHRLELLKHVRDSEVQASMTHLYKRCMESYSGA  217

Query  584  TGAVTVEMKQTF  619
               V V+MK+ F
Sbjct  218  PEKVLVDMKRWF  229



>ref|XP_007151144.1| hypothetical protein PHAVU_004G021500g [Phaseolus vulgaris]
 gb|ESW23138.1| hypothetical protein PHAVU_004G021500g [Phaseolus vulgaris]
Length=519

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+ADKYGPIF I+LGA+   V++N + AKECFTTND  +++R K +A+E M 
Sbjct  52   KRPHRTLGALADKYGPIFTIKLGAKSALVINNWETAKECFTTNDIVVSSRPKLVAAEHMS  111

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +F VAPYGPYWR+IRK  V E+LS  R+  LR   E  V  SIK +F+ W  NK+ 
Sbjct  112  YNQAMFVVAPYGPYWRKIRKITVSEILSPLRVKQLRHVFESEVEGSIKELFDFWRSNKN-  170

Query  581  ATGAVTVEMKQTF  619
             +G   VE+KQ F
Sbjct  171  ESGYALVELKQWF  183



>ref|XP_010061805.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW68805.1| hypothetical protein EUGRSUZ_F02404 [Eucalyptus grandis]
Length=533

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH++LA MADKYGPIF +++G  +  +VSN +IAK+C T ND+  ATR K+++SEIM Y
Sbjct  69   PPHIVLANMADKYGPIFIVKMGIHRALIVSNWQIAKQCLTVNDRVFATRPKSISSEIMAY  128

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F +APYG YWR  RK  +LELLS  R++ L+  RE  V+ SI  ++    +N + A
Sbjct  129  NYAMFGLAPYGSYWRHARKLTMLELLSNHRLELLKHIRESEVQASINHIYRRCIENYNDA  188

Query  584  TGAVTVEMKQTF  619
               V V+MK+ F
Sbjct  189  PKKVLVDMKRRF  200



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L AMADK GPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI G
Sbjct  65   EPPHRVLGAMADKCGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEIFG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   +ELLS  R++ L+  R+Y V+  +K ++E W  NK +
Sbjct  125  YNFSMFGFSPYGSYWRETRKIATVELLSNHRLEKLKHVRDYEVKTCLKELYELWDKNK-S  183

Query  581  ATGAVTVEMKQTF  619
                + VE+K+ F
Sbjct  184  TNEMLLVELKRWF  196



>gb|KJB63760.1| hypothetical protein B456_010G014600 [Gossypium raimondii]
Length=525

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ LA MADKYG +F I+LG  +  VVS+ +IAKEC TTNDK+ A+R K  +SE++ 
Sbjct  60   QPPHISLANMADKYGRMFAIKLGVHRALVVSDWEIAKECLTTNDKAFASRPKLASSELLA  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +F  APYGPYWR +RK   +ELLS  R++ L+  RE  V+ S++++++ W+  + A
Sbjct  120  YNRAMFGFAPYGPYWRHMRKIATIELLSNHRLELLKHVRESEVKTSLQQLYQLWNKKRIA  179

Query  581  ATGAVTVEMKQTF  619
             +  V VEMK  F
Sbjct  180  NSDKVLVEMKGWF  192



>ref|XP_006366470.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=511

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 112/192 (58%), Gaps = 11/192 (6%)
 Frame = +2

Query  41   NIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSga-lpilghlhlliag  217
            +I+ I+ T+A +  +LFF   K          + ++++VA       +    HL      
Sbjct  2    DILLIVVTVAASSFILFFFLGK---------THSKSRRVAEAGGAWPIIGHLHLLGGSDT  52

Query  218  gKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIM  397
             + PH I+  MADKYGPIF ++LG  Q  VVS+ K+AKECFTTND +LA R K ++SEIM
Sbjct  53   DQLPHKIMGRMADKYGPIFGMKLGVHQVVVVSDHKLAKECFTTNDLALAGRPKLMSSEIM  112

Query  398  GYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKD  577
            GY    F +  YGPYWR+ +K   +EL S RRI+ L+  R++ V+  IK +  +W+ N +
Sbjct  113  GYKQAFFGLCSYGPYWRETKKIATIELFSTRRIEMLKHIRQFEVKSGIKEIHNNWAKNMN  172

Query  578  AATGAVTVEMKQ  613
               G V +EMK+
Sbjct  173  -LNGVVKMEMKE  183



>ref|XP_003554118.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=548

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            P  +L A+ADKYGPIF I  G ++  V+SN +IAKECFT ND  +++R K LA E+M YN
Sbjct  83   PDRVLGALADKYGPIFTINYGVKKALVISNWEIAKECFTKNDIVVSSRPKLLAIELMCYN  142

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +F  APYGPYWR+ RK   LE+L+ RR++ L+  R   V+ SIK +F  WS NK+  +
Sbjct  143  QAMFGFAPYGPYWREQRKITTLEILTSRRVEQLQHVRVSEVQSSIKELFNVWSSNKNNES  202

Query  587  GAVTVEMKQTFDR  625
            G   +E+KQ F +
Sbjct  203  GYALLELKQWFSQ  215



>gb|KJB63758.1| hypothetical protein B456_010G014400 [Gossypium raimondii]
Length=261

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKI-AKECFTTNDKSLATRTKALASEIM  397
            +PP + LA MADKYG +F I+LG  +  VVS+ +I AKEC TTNDK+ A+R K  +SE++
Sbjct  60   QPPQISLANMADKYGKMFTIKLGVHRALVVSDWEIIAKECLTTNDKAFASRPKLASSELL  119

Query  398  GYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKD  577
            GYN  +F  APYGPYWR IRK   +ELLS  R+  L+  RE  V+ S++++++ W+  + 
Sbjct  120  GYNRAMFGFAPYGPYWRHIRKIATIELLSNHRLKLLKHVRESEVKTSLQQLYQLWNKKRS  179

Query  578  AATGAVTVEMKQTF  619
            A +  V VEMK  F
Sbjct  180  ANSDKVFVEMKGWF  193



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +2

Query  110  FHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLG  289
            +H ++ +   G++ ++APE SGA PI+GHLHLL      PHL+   MADKYGP+F IRLG
Sbjct  23   YHLLLWRTGAGKS-RMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLG  81

Query  290  AQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVV  469
             ++  VV++ ++AKECFTT+D +LA+R +  A++ +GYNY +FA +P+G YWR++RK   
Sbjct  82   LKRAVVVNSWEMAKECFTTHDLALASRPEVEAAKYLGYNYAMFAFSPHGAYWREVRKIAT  141

Query  470  LELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            LELLS RR++ L+  R   V   +K +++ W++ K+ A G V V+MK+ F
Sbjct  142  LELLSNRRLELLKNVRISEVETCMKELYKLWAEKKNEA-GVVLVDMKEWF  190



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KPP+ +   MADKYGPIF IR+G     +VSN +IAKEC TT+DK  A R K LA EI+G
Sbjct  65   KPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEIAKECLTTHDKVFANRPKTLAMEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   L LLS  R++ L+  REY V+  +K ++E W  NK +
Sbjct  125  YNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKLKHVREYEVKTCLKELYELWHKNK-S  183

Query  581  ATGAVTVEMKQTF  619
                + VEMK+ F
Sbjct  184  TNKILLVEMKKWF  196



>gb|KDO42181.1| hypothetical protein CISIN_1g009844mg [Citrus sinensis]
Length=524

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KPP+ +   MADKYGPIF IR+G     +VSN +IAKEC TT+DK  A R K LA EI+G
Sbjct  65   KPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEIAKECLTTHDKVFANRPKTLAMEILG  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YWR+ RK   L LLS  R++ L+  REY V+  +K ++E W  NK +
Sbjct  125  YNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKLKHVREYEVKTCLKELYELWHKNK-S  183

Query  581  ATGAVTVEMKQTF  619
                + VEMK+ F
Sbjct  184  TNKILLVEMKKWF  196



>ref|XP_006375030.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
 gb|ERP52827.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
Length=538

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 95/137 (69%), Gaps = 4/137 (3%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L +MA+KYGPIF I++G  +  VVSN + AKECFTT+DK+ + R + LASE++ 
Sbjct  65   EPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDKAFSGRPRTLASELLT  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE  VR  +K +++ W +N+ +
Sbjct  125  YDGAMLGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRESEVRAFLKELYKLWDENRGS  184

Query  581  ATGA----VTVEMKQTF  619
            A+ +    V VEMK+ F
Sbjct  185  ASKSKSNLVLVEMKRWF  201



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH  L AMADKYGP+F I+LG Q+  ++SN ++AKECFTTNDK  A R K++A E++GYN
Sbjct  72   PHKTLGAMADKYGPVFLIKLGVQRVLMLSNWEMAKECFTTNDKVFANRPKSIAVEVLGYN  131

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
            Y +F   PYG YWRQ+RK V   LLS RR++ ++      V+ SI+ ++E W  NK + +
Sbjct  132  YAMFGFGPYGSYWRQVRKIVTTGLLSNRRLEIVKHVWISEVKASIRELYELWI-NKRSDS  190

Query  587  GAVTVEMKQTF  619
              V VEMK  F
Sbjct  191  NMVLVEMKDWF  201



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L +MADKYGPIF I++G  +  VVS+ ++AKEC TTNDK  A+R K LA EI+G
Sbjct  72   EPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMAKECLTTNDKIFASRPKTLAMEILG  131

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+++F  +PYG YW + RK   LELLS  R++ LR  R+Y V+  +K ++E W  +K  
Sbjct  132  YNFSMFGFSPYGSYWCETRKIATLELLSNHRLEKLRHVRDYEVKTCLKELYELW--DKSK  189

Query  581  ATGAVTVEMKQTF  619
            +T  + VEMK+ F
Sbjct  190  STNKMLVEMKRWF  202



>ref|XP_006486513.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=395

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  +ADKYG IF ++LG +Q  VVSN +IAKECFTTNDK+ A+R K +A E+MG
Sbjct  66   EPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWEIAKECFTTNDKAFASRPKRMAVELMG  125

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+++   APYG YWRQ RK V +ELLS RR++ L+  RE  V+ SI+R++++
Sbjct  126  YNFSVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRESEVKASIQRLYKN  178



>ref|XP_007151146.1| hypothetical protein PHAVU_004G021700g [Phaseolus vulgaris]
 gb|ESW23140.1| hypothetical protein PHAVU_004G021700g [Phaseolus vulgaris]
Length=524

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+ADKYGPIF I++G+++  +++N +IAKECFTT D  +++R K LASE+MG
Sbjct  57   KTPHRTLGALADKYGPIFTIKIGSKKALIINNWEIAKECFTTIDMVVSSRPKLLASELMG  116

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ +F  APYGPYWR++RK   LE+L+ RR++ L+  R   ++  IK+++  W   K +
Sbjct  117  YNHAMFGFAPYGPYWRELRKITTLEILTTRRVEQLQHVRVSELQNWIKQLYNVWCSQK-S  175

Query  581  ATGAVTVEMKQTF  619
             +G   VE+KQ F
Sbjct  176  ESGYALVELKQWF  188



>ref|XP_007151147.1| hypothetical protein PHAVU_004G021800g [Phaseolus vulgaris]
 gb|ESW23141.1| hypothetical protein PHAVU_004G021800g [Phaseolus vulgaris]
Length=524

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+A+KYGPIF I+LG+++  +++N +IAKECFTT D  +++R K LASE+MG
Sbjct  57   KSPHRTLGALAEKYGPIFTIQLGSKKALIINNWEIAKECFTTIDMVVSSRPKILASELMG  116

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ +F  APYGPYWR+IRK   LE+L+ RR++ L+  R   ++  IK+++  W   K +
Sbjct  117  YNHAMFGFAPYGPYWREIRKITTLEILTTRRVEQLQHVRVSELQNWIKQLYNVWCSQK-S  175

Query  581  ATGAVTVEMKQTF  619
             +G   VE+KQ F
Sbjct  176  ESGYALVELKQWF  188



>ref|XP_004238200.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=519

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 109/187 (58%), Gaps = 5/187 (3%)
 Frame = +2

Query  53   IISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPH  232
            I  TLA +  L+FFL  K F+++  K  +   +      +  +    HL         PH
Sbjct  6    IAVTLATSFFLIFFL-QKQFYSV--KKQSSSRKVPGAGGAWPIIGHLHLLAGSESDHLPH  62

Query  233  LILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYT  412
              L+ MADKYGPIF ++LG  Q  VVS+ K+ KECFTTND +LA R K++ SEI+GY   
Sbjct  63   KTLSRMADKYGPIFGMKLGVHQVVVVSDPKLVKECFTTNDLALANRPKSMVSEIIGYKDA  122

Query  413  IFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGA  592
            +F +  YGPYWR+ RK   +EL S RRI+ L+  RE+ V+ S+K ++ +W  N     G 
Sbjct  123  MFGLCSYGPYWRETRKIATIELFSARRIEMLKHIREFEVKSSVKEIYNNWGKNN--LNGF  180

Query  593  VTVEMKQ  613
            V +EMK+
Sbjct  181  VKMEMKE  187



>ref|XP_012092501.1| PREDICTED: cytochrome P450 CYP82D47-like [Jatropha curcas]
Length=526

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H+ L  +ADKYGPIF I+LG  +T VVS+  +AKEC TTND++ A+R K LA EI+G
Sbjct  56   QPAHITLGNLADKYGPIFTIKLGVYRTLVVSSRAMAKECLTTNDRAFASRPKGLAMEILG  115

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y++   +PYG YWRQ+RK V LELLS  R++ L+  RE  V+  I  +++ W  N+ +
Sbjct  116  YDYSMLGFSPYGEYWRQMRKIVTLELLSNHRLEMLKHVREAEVKMDITALYQKWIKNR-S  174

Query  581  ATGAVTVEMKQTF  619
            ++  ++ EMK+ F
Sbjct  175  SSNKLSAEMKRWF  187



>ref|XP_010664625.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=520

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH  L AMADKYGPIF I+LGA+   VVSN +IAKECFTTNDK+ A R K +A E+MGYN
Sbjct  59   PHKTLGAMADKYGPIFFIKLGARPVLVVSNWEIAKECFTTNDKAFANRPKLIAVEVMGYN  118

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +F  +PYG YWRQ+RK V   LLS R ++ L+  R   V+ +IK + E W  +K + +
Sbjct  119  NAMFGFSPYGSYWRQMRKIVTTHLLSNRSLEMLKLVRISEVKATIKELHELWV-SKKSDS  177

Query  587  GAVTVEMKQTF  619
              V+VEM++ F
Sbjct  178  NMVSVEMRRWF  188



>ref|XP_006464328.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=521

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 95/139 (68%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H IL  MA+KYGPIF +++G  +  VVSNS+I KECFTTNDK+LA+R + +A EI+G
Sbjct  63   EPTHRILGNMANKYGPIFTMKMGVNRALVVSNSEITKECFTTNDKALASRPRRMAMEILG  122

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+     +PYG YWR+ RK   +ELLS  R++ L+  RE  V  SIK +F+   D +++
Sbjct  123  YNFLATPSSPYGSYWRETRKIATVELLSNHRLEKLKHVRESEVTASIKGLFK---DCQNS  179

Query  581  ATGAVTVEMKQ-----TFD  622
            ATG V+VEMK      TFD
Sbjct  180  ATGKVSVEMKHWLEGTTFD  198



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 109/194 (56%), Gaps = 9/194 (5%)
 Frame = +2

Query  59   STLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLI  238
            S +A  L L+ FL   L        N   N+K    P          HL + G  P H +
Sbjct  9    SAVAAILTLIIFLYTLLLFV---SRNYASNKKKRGPPEAGGAWPVIGHLHLLGRFPLHRV  65

Query  239  LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  418
            L  MADKYGPIF IR+G  +  VVSN ++AKEC TT+D+  A+R KAL +EI+G+N+++F
Sbjct  66   LGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMF  125

Query  419  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG---  589
              +PYGP+WRQIRK   LELLS  R++ L+  RE  V+  +K ++E W    +  +    
Sbjct  126  GFSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYEFWERTNNYKSSDHN  185

Query  590  ---AVTVEMKQTFD  622
                V VEM + F+
Sbjct  186  NNKKVLVEMNKWFE  199



>ref|XP_012072001.1| PREDICTED: cytochrome P450 82A3-like [Jatropha curcas]
 gb|KDP38438.1| hypothetical protein JCGZ_04363 [Jatropha curcas]
Length=526

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KP H+IL  MADK GPIF+I+LG   T VVSN ++AK+C TTND+  ATR K LAS ++G
Sbjct  61   KPLHIILGKMADKMGPIFKIKLGMHPTLVVSNWEMAKQCLTTNDQVFATRPKTLASVLVG  120

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +   +PYGPYWRQ+RK  +LELLS +RI +    RE  VR  +K +++ W  NK++
Sbjct  121  YNRAMLPFSPYGPYWRQMRKIAILELLSNQRIQTQSRVRESEVRTFLKELYKFWDKNKNS  180

Query  581  ATGAVTVEMKQTF  619
                V VEM + F
Sbjct  181  QN-KVLVEMVRWF  192



>emb|CAN76287.1| hypothetical protein VITISV_027433 [Vitis vinifera]
Length=538

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 117/170 (69%), Gaps = 2/170 (1%)
 Frame = +2

Query  110  FHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLG  289
            +H ++ +   G++ ++APE SGA PI+GHLHLL      PHL+   MADKYGP+F IRLG
Sbjct  12   YHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLG  70

Query  290  AQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVV  469
             ++   VS+ ++AKECFTT+D +LA+R + +A++ +GYNY +F  +P+G YWR++RK   
Sbjct  71   LKRAVXVSSWEMAKECFTTHDLALASRPZLVAAKYLGYNYXMFXXSPHGAYWREVRKIAT  130

Query  470  LELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            LELLS RR++ L+  R   V   +K +++ W++ K  A G V V+MKQ F
Sbjct  131  LELLSNRRLELLKNVRISEVETCMKELYKLWAEXKSEA-GVVLVDMKQWF  179



>ref|XP_012071743.1| PREDICTED: cytochrome P450 CYP82D47-like [Jatropha curcas]
 gb|KDP38429.1| hypothetical protein JCGZ_04354 [Jatropha curcas]
Length=498

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H+ L  MA+KYGPIF I+LG   T +VS+ ++AKEC TTNDK+ A+R K LA EI+G
Sbjct  29   QPAHITLGNMAEKYGPIFTIKLGVHPTLIVSSREMAKECLTTNDKAFASRPKGLAMEILG  88

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YNY +   +PYG YWR +RK + LELLS  R++ L+  RE  V+ +IK +++ W  NK  
Sbjct  89   YNYCMVGFSPYGDYWRHMRKIITLELLSNHRLEMLKNVREAEVKMAIKGLYKEWIKNK-T  147

Query  581  ATGAVTVEMKQTF  619
             +  + VE+K  F
Sbjct  148  NSDKILVELKTWF  160



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ L AMADKYGP++ IRLG   + V+S+S+IAKECFTTND S+ +R K    + +GY
Sbjct  60   PPHITLGAMADKYGPLYTIRLGVYPSLVISSSEIAKECFTTNDLSVNSRPKMAVVDHIGY  119

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSD-NKDA  580
            NY +F  AP GPYWR+IRK   LELLS RR++ L+  R   V   +K + + WS   K+ 
Sbjct  120  NYAMFGFAPSGPYWREIRKITTLELLSNRRVELLKHIRVSEVTTFLKELHKTWSTRQKEG  179

Query  581  ATGAVTVEMKQTF  619
            +   V VE+KQ F
Sbjct  180  SNDGVVVELKQWF  192



>ref|XP_007224171.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
 gb|EMJ25370.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
Length=517

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KPPHL+L  MA++YGPIF + +G Q+  +VS+S+IAKECFTTNDK  A+R K +A+EIM 
Sbjct  40   KPPHLVLGKMAERYGPIFTVNIGVQKALIVSSSEIAKECFTTNDKVFASRPKFMAAEIMA  99

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YNY +F  +PY  Y RQ+RK V+LE+LS  R++ L+  RE  V+ S+K ++E    N  +
Sbjct  100  YNYALFPFSPYSHYSRQVRKIVLLEVLSNSRLEMLKHVRESEVKASMKGIYERCVTNGKS  159

Query  581  ATGA--VTVEMKQTF  619
            +T +    VEM++ F
Sbjct  160  STSSNKALVEMREWF  174



>ref|XP_006435903.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
 gb|ESR49143.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
Length=528

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  MADKYGPIF ++LG +Q  VVSN +IAKECFTTNDK+ A R K +A+E++G
Sbjct  66   EPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLG  125

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+ +   APYG YWRQ RK   +ELLS RR++ L+  RE  V+ SI+R++++
Sbjct  126  YNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKN  178



>ref|XP_006366469.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=455

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MA+KYGPIFR++LG  +  +VS+ KI KECFTTND++ ATR K++ SEI+GYNY +F + 
Sbjct  1    MAEKYGPIFRLKLGVNEVVIVSDHKIVKECFTTNDRAFATRPKSIGSEILGYNYAMFGLG  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYGPYWR+IRK V +E  S RRI  L+  +++ V+ ++K ++     N     G V +EM
Sbjct  61   PYGPYWREIRKIVTIEFFSARRIKMLQHIKQFEVKSAVKEIYNSSISN---LNGVVKMEM  117

Query  608  KQTF  619
            K+ F
Sbjct  118  KEWF  121



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  MADKYGPIF ++LG +Q  VVSN +IAKECFTTNDK+ A R K +A+E++G
Sbjct  66   EPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMATELLG  125

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+ +   APYG YWRQ RK   +ELLS RR++ L+  RE  V+ SI+R++++
Sbjct  126  YNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQRLYKN  178



>gb|KHN16363.1| Cytochrome P450 82A4 [Glycine soja]
Length=522

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH  L  +ADKYGPIF I+LG ++  V+SN +IAKECFTTND  +++R K +A E MGYN
Sbjct  60   PHRALGDLADKYGPIFTIKLGVKKALVISNWEIAKECFTTNDIFVSSRPKLVAVEYMGYN  119

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +   APYGPYWR++RK   LE+LS RR++ L+  R   V+ SIK +F  W   K+  +
Sbjct  120  QAMLGFAPYGPYWRELRKVATLEILSNRRVEQLQDVRVSEVQHSIKDLFNVWCSKKN-ES  178

Query  587  GAVTVEMKQTF  619
            G   VE+KQ F
Sbjct  179  GYALVELKQWF  189



>gb|KHN22283.1| Cytochrome P450 82C4 [Glycine soja]
Length=462

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MADKYGPIF +RLG  +T VVSN ++AK+CFT NDK+ A+R K++A E++GYN+++   +
Sbjct  1    MADKYGPIFTLRLGVHKTLVVSNWEMAKQCFTVNDKAFASRPKSVAFEVLGYNFSMIGFS  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR +RK   LELLS  RID ++   E  V+ ++K +++ W D   + +  VT EM
Sbjct  61   PYGSYWRHVRKIATLELLSSHRIDMIKHVMESEVKAAVKEIYDIWIDKNKSGSEKVTTEM  120

Query  608  KQTF  619
            K+ F
Sbjct  121  KRWF  124



>ref|XP_006432703.1| hypothetical protein CICLE_v10003959mg [Citrus clementina]
 gb|ESR45943.1| hypothetical protein CICLE_v10003959mg [Citrus clementina]
Length=428

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  MADKYGPIF IR+G  +  VVSN +IAKEC TT+DK  A R K LA +I+G
Sbjct  5    EPAHRVLGNMADKYGPIFTIRMGINRALVVSNWEIAKECLTTHDKVFANRPKTLAMDILG  64

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y +++F   PYG YWR+ RK   LELLS  R++ L+  REY ++  +K ++E W+ NK +
Sbjct  65   YKFSMFGFRPYGSYWRETRKIATLELLSNHRLEKLKNVREYELKTCLKELYELWNKNK-S  123

Query  581  ATGAVTVEMKQ  613
                + VEMK+
Sbjct  124  TDKLLLVEMKR  134



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 95/137 (69%), Gaps = 4/137 (3%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L +MA+KYGPIF I++G  +  VVSN + AKECFTT+DK+ + R + LASE++ 
Sbjct  65   EPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDKAFSGRPRTLASELLT  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE  VR  +K +++ W +N+ +
Sbjct  125  YDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRESEVRAFLKELYKLWDENRCS  184

Query  581  ATGA----VTVEMKQTF  619
            A+ +    V VEMK+ F
Sbjct  185  ASKSKSSLVLVEMKRWF  201



>sp|H2DH23.1|C7H23_PANGI RecName: Full=Cytochrome P450 CYP82H23, partial [Panax ginseng]
 gb|AEY75220.1| cytochrome P450 CYP82H23, partial [Panax ginseng]
Length=245

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 1/124 (1%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MADKYGPIF ++LG  +T VVS+  +AKECFTT+DK   TR K+LA + MGY++++F   
Sbjct  1    MADKYGPIFSLQLGIHKTIVVSSWAVAKECFTTHDKVFLTRPKSLAGKHMGYDHSVFLFL  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
             YGPYWR  RK +++ELLS RR+D L+  RE  V   ++ M+E W  N    + AV VEM
Sbjct  61   AYGPYWRDTRKLLIVELLSNRRLDVLKHVRESEVNSFVREMYEQWISNGGGGSKAV-VEM  119

Query  608  KQTF  619
            K+ F
Sbjct  120  KERF  123



>gb|KJB63757.1| hypothetical protein B456_010G014300 [Gossypium raimondii]
Length=526

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  MAD+YG +  I+LGA++  VVS+ +IAK+C T +DK+ ATR KA+A E++ 
Sbjct  60   QPPHISLGNMADQYGRMLTIKLGARRALVVSSWEIAKDCLTIHDKAFATRPKAVAQELLS  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ + A APYGPYWRQ+RK   +ELLS  R++ L+  RE  V+ S++++++ W+  K +
Sbjct  120  YNHAMIATAPYGPYWRQMRKFATVELLSNHRLNLLKHVRESEVKTSLQQLYQLWNKKKSS  179

Query  581  ATGAVTVEMKQTF  619
             +  V VEMK+ F
Sbjct  180  NSDKVLVEMKRWF  192



>gb|KCW60845.1| hypothetical protein EUGRSUZ_H03582 [Eucalyptus grandis]
Length=520

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  LA+MAD+ GPIF +R+G  Q  VVS S++ KECFT ND +L+TR + +A +I+G
Sbjct  58   KLPHKTLASMADQCGPIFTVRVGTFQALVVSGSEMVKECFTKNDIALSTRPRHVAQKILG  117

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDS-LRPKREYHVRKSIKRMFEHWSDNKD  577
            Y+Y +F  APYGPYWR++RK V LELLS RR+ S L P +      +I+ + E W +NKD
Sbjct  118  YSYAMFPFAPYGPYWREVRKMVTLELLSSRRVKSFLNPIQASEADVAIQELHELWIENKD  177

Query  578  AATGAVTVEMKQTF  619
              +G V V++KQ F
Sbjct  178  -DSGHVIVDLKQWF  190



>ref|XP_007151145.1| hypothetical protein PHAVU_004G021600g [Phaseolus vulgaris]
 gb|ESW23139.1| hypothetical protein PHAVU_004G021600g [Phaseolus vulgaris]
Length=530

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+ADKYGPIF I+LG+++  +++N +IAKECFTT D  +++R K LASE+MG
Sbjct  59   KTPHRTLGALADKYGPIFTIQLGSKKALIINNWEIAKECFTTIDMVVSSRPKILASELMG  118

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ +F  APYGPYWR++RK   LE+LS R ++ L+  R   ++  IK +++ W   K +
Sbjct  119  YNHAMFGFAPYGPYWRELRKITTLEILSPRPVEQLQHVRVSELQNWIKELYDVWCSQK-S  177

Query  581  ATGAVTVEMKQTF  619
             +G   VE+KQ F
Sbjct  178  ESGYALVELKQWF  190



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 109/194 (56%), Gaps = 9/194 (5%)
 Frame = +2

Query  59   STLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLI  238
            S +A  L L+ FL   L        N   N+K    P          HL + G  P H +
Sbjct  9    SAVAAILTLIIFLYTLLLFV---SRNYASNKKKRGPPEAGGAWPVIGHLHLLGRFPLHRV  65

Query  239  LAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIF  418
            L  MADKYGPIF IR+G  +  VVSN ++AKEC TT+D+  A+R KAL +EI+G+N+++F
Sbjct  66   LGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMF  125

Query  419  AVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG---  589
              +PYGP+WRQIRK   LELLS  R++ L+  RE  V+  +K +++ W    +  +    
Sbjct  126  GFSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYDFWERTNNYKSSDHN  185

Query  590  ---AVTVEMKQTFD  622
                V VEM + F+
Sbjct  186  NNKKVLVEMNKWFE  199



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 122/182 (67%), Gaps = 4/182 (2%)
 Frame = +2

Query  80   VLLFFLCNKLFHAIMHKPNNGRNQ-KVAPEPSgalpilghlhlliaggKPPHLILAAMAD  256
            + LFF C  L++A++ K +   NQ K APEP+GA PI+GHLHLL  G +  +  L AMAD
Sbjct  10   IALFFSCILLYNALIKKNSCKGNQIKEAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMAD  69

Query  257  KYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYG  436
            K+G  F IRLG+++ FVVS+ ++ KECFT NDK+LA+R   +A++ MGYNY +F  APY 
Sbjct  70   KHGSAFTIRLGSRRAFVVSSWEVVKECFTINDKALASRPTTVAAKHMGYNYAVFGFAPYS  129

Query  437  PYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQT  616
             +WR++RK   +ELLS RR++ L+  R   V   I+ ++  W++N   ++  V VE+KQ 
Sbjct  130  AFWREMRKIATIELLSNRRLEMLKHVRASEVDIGIRELYNSWANN---SSSPVVVELKQW  186

Query  617  FD  622
             +
Sbjct  187  LE  188



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 122/194 (63%), Gaps = 5/194 (3%)
 Frame = +2

Query  41   NIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliagg  220
            ++  ++S++     LL FL N        K +N R  K APEP+GA PI+GHLHLL  G 
Sbjct  2    DLFLLLSSIVVVFSLLLFLYNASLRG--RKSSNVRKTKKAPEPAGAWPIIGHLHLLGGGD  59

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +  +  L AMADK+GP F IRLG++  FVVS+ ++ KECFT NDK+LA+R K  A++ MG
Sbjct  60   QLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMG  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y +F  APY P+WR++RK   LELLS RR+++L+  R   V   ++ +   W+ N   
Sbjct  120  YDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRISEVEMGLRELHGLWAKNN--  177

Query  581  ATGAVTVEMKQTFD  622
             +  V VE+K+  +
Sbjct  178  -SRPVLVELKKWLE  190



>gb|KJB63761.1| hypothetical protein B456_010G014700 [Gossypium raimondii]
Length=559

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  +ADKYG IF I+LG  +  VVSN +IAKEC T NDK+ ATR K  +SE  G
Sbjct  60   QPPHISLGNLADKYGRIFTIKLGLHRALVVSNWEIAKECLTINDKAFATRPKLTSSEHFG  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +   APYGPYWRQ+RK   +ELLS  R++ L+  RE  V+ S++++++ W+  K +
Sbjct  120  YNCAMIGFAPYGPYWRQVRKFSTIELLSNHRLELLKHVRELEVKTSLQQLYQLWNKKKSS  179

Query  581  ATGAVTVEMKQTF  619
                V V+MK+ F
Sbjct  180  TCDKVLVDMKRWF  192



>ref|XP_006432705.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
 gb|ESR45945.1| hypothetical protein CICLE_v10001118mg [Citrus clementina]
Length=452

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MAD+YGPIF+I++G  +  VVSN ++AKEC TT+DK  A+R K LA EI+GYN+++F  +
Sbjct  1    MADEYGPIFKIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEILGYNFSMFGFS  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR+ RK   LELLS  R+  LR  REY ++ S+K ++E W  NK +    + VEM
Sbjct  61   PYGSYWRETRKIATLELLSNHRLGKLRHVREYELKTSLKDLYELWDKNK-STNKMLLVEM  119

Query  608  KQTF  619
            K+ F
Sbjct  120  KRWF  123



>ref|XP_010060880.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW67758.1| hypothetical protein EUGRSUZ_F01493 [Eucalyptus grandis]
Length=540

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  LA+MAD+YGPIF I+LG  ++ VVS S++AKECFT ND +L+TR + LA +I+G
Sbjct  75   KLPHKTLASMADQYGPIFTIQLGMFRSVVVSGSEMAKECFTKNDIALSTRPQQLAQKILG  134

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDS-LRPKREYHVRKSIKRMFEHWSDNKD  577
            Y++ +F  APYGPYWR++RK   LELLS RR++S L P +      +I+ + E W ++KD
Sbjct  135  YSFAMFPFAPYGPYWRELRKMATLELLSNRRVNSLLNPIQASEADVAIQELHELWIESKD  194

Query  578  AATGAVTVEMKQTF  619
              +G + V++KQ F
Sbjct  195  -DSGHIIVDLKQWF  207



>ref|XP_008464766.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=521

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 121/190 (64%), Gaps = 11/190 (6%)
 Frame = +2

Query  50   TIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPP  229
            T+++ +   L+ L+ L N     I  +      +K+ PEP+G  P++GHLHLL A  +P 
Sbjct  11   TVVTGIFSLLLFLYTLFN-----ISTRVVGAHRKKLPPEPAGHWPVIGHLHLLSAT-EPA  64

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H+ LA +AD YGPIF ++LG  +  VVS+ +IAKECFTTND+  A+R K +AS+++GYNY
Sbjct  65   HITLAKLADTYGPIFTLKLGMSKALVVSSWEIAKECFTTNDRIFASRPKLVASKLLGYNY  124

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +  ++PYGPYWR IRK   LELL+ RR+   +  RE+ V+ SIK+++E    NK A   
Sbjct  125  NMLGLSPYGPYWRHIRKLATLELLTNRRLHQFQHIREFEVQTSIKKLYESCIRNKKA---  181

Query  590  AVTVEMKQTF  619
               VEM   F
Sbjct  182  --LVEMNTWF  189



>ref|XP_007151143.1| hypothetical protein PHAVU_004G021400g [Phaseolus vulgaris]
 gb|ESW23137.1| hypothetical protein PHAVU_004G021400g [Phaseolus vulgaris]
Length=520

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+ADKYGPIF I+LGA++  V++N +IAKECFTTND  +  R K ++ E+M 
Sbjct  57   KSPHRTLGALADKYGPIFTIKLGAKRAVVINNWEIAKECFTTNDTVVFGRPKLVSVELMS  116

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +FA+APYGPYWR+IRK  + E+LS +++   R   E  V++SIK +F+ W  NK+ 
Sbjct  117  YNQAMFALAPYGPYWRKIRKLTISEILSPQQVRQQRHLFESEVQESIKELFDLWRSNKN-  175

Query  581  ATGAVTVEMKQTF  619
             +G   V++KQ F
Sbjct  176  ESGYALVDLKQWF  188



>ref|XP_011042272.1| PREDICTED: cytochrome P450 82A4-like [Populus euphratica]
Length=318

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 93/137 (68%), Gaps = 5/137 (4%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L +MA+KYGPIF I++G  +  VVSN + A ECFTT+DK+ + R K LASE++ 
Sbjct  53   EPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETA-ECFTTHDKAFSGRPKTLASELLT  111

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE  VR  +K +++ W DN+  
Sbjct  112  YDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRESEVRAFLKELYKLWDDNRGG  171

Query  581  ATGA----VTVEMKQTF  619
            A+ +    V VEM++ F
Sbjct  172  ASKSKGSMVLVEMERWF  188



>ref|XP_006435899.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
 gb|ESR49139.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
Length=528

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  +ADKYG IF ++LG +Q  VVSN +IAKECFTTNDK+ A+R K +A E+MG
Sbjct  66   EPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWEIAKECFTTNDKAFASRPKRMAVELMG  125

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+++   APYG YWRQ RK V +ELLS RR++ L+  RE  V+ SI+R++++
Sbjct  126  YNFSVIGFAPYGKYWRQSRKIVTIELLSNRRLEKLKHVRESEVKASIQRLYKN  178



>emb|CBI19611.3| unnamed protein product [Vitis vinifera]
Length=929

 Score =   142 bits (358),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH  L AMADKYGPIF I+LGA+   VVSN +IAKECFTTNDK+ A R K +A E+MGYN
Sbjct  59   PHKTLGAMADKYGPIFFIKLGARPVLVVSNWEIAKECFTTNDKAFANRPKLIAVEVMGYN  118

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +F  +PYG YWRQ+RK V   LLS R ++ L+  R   V+ +IK + E W  +K + +
Sbjct  119  NAMFGFSPYGSYWRQMRKIVTTHLLSNRSLEMLKLVRISEVKATIKELHELWV-SKKSDS  177

Query  587  GAVTVEMKQTF  619
              V+VEM++ F
Sbjct  178  NMVSVEMRRWF  188



>ref|XP_010064744.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=529

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 88/133 (66%), Gaps = 5/133 (4%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            P ++ L  MADKYGPIF I+LG+Q+  VVS S++AKECFTTNDK+   R K LA++++GY
Sbjct  67   PAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKECFTTNDKAFCNRPKYLAAKLLGY  126

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F  +PYGPYWR +RK   LELLS   +++LR  RE  VR S K  +E     +  A
Sbjct  127  NYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVREAVVRASTKEAYE-----RSNA  181

Query  584  TGAVTVEMKQTFD  622
                 +EMK  F+
Sbjct  182  QENTPIEMKSWFN  194



>ref|XP_011030958.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X3 [Populus 
euphratica]
Length=527

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 110/185 (59%), Gaps = 2/185 (1%)
 Frame = +2

Query  68   ACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAA  247
            A  + +LF       + +   P    N+K AP  +     L     L+ G +PPH+ L  
Sbjct  9    ATAVPILFAFITTTIYYLFRIPGK-ENKKRAPPEAAGAWPLIGHLHLLRGSQPPHITLGN  67

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            +ADK+GPIF ++LG  +  +VSN ++AKEC   NDK+ ATR K LA +I+GYNY+I + +
Sbjct  68   LADKHGPIFTVKLGVHRALIVSNWEMAKECLRINDKAFATRPKTLAMDILGYNYSILSFS  127

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR IRK V LE+LS  R++  +  RE  VR ++  +++ W  NK + +  + VEM
Sbjct  128  PYGTYWRLIRKIVTLEVLSNHRLEMFKHVREDEVRDAVGALYQQWILNK-SNSQKLLVEM  186

Query  608  KQTFD  622
            K+ F+
Sbjct  187  KRWFN  191



>ref|XP_010106082.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07352.1| Cytochrome P450 82A3 [Morus notabilis]
Length=532

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+ LA +ADK+GPIF IR+G+ +  VVS+S++AKECFT ND + A+R   LA++ +GY 
Sbjct  63   PHITLANLADKWGPIFTIRIGSYRGLVVSSSEMAKECFTINDLASASRPNLLAAKHLGYK  122

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSD--NKDA  580
            Y +F +AP+GP+WR+IRK   ++LLS RR++ L+  R   V   +K ++EHW+   N + 
Sbjct  123  YAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIRISEVASFVKELYEHWTTKWNDND  182

Query  581  ATGAVTVEMKQTF  619
             +G  +VEMKQ F
Sbjct  183  HSGQASVEMKQRF  195



>ref|XP_007151148.1| hypothetical protein PHAVU_004G021900g [Phaseolus vulgaris]
 gb|ESW23142.1| hypothetical protein PHAVU_004G021900g [Phaseolus vulgaris]
Length=545

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+ADKYGPIF I+LG+++  V++N + AKECFTTND ++++R K +A+E+MG
Sbjct  74   KRPHRTLGALADKYGPIFTIQLGSKRALVINNWETAKECFTTNDMAVSSRPKLVAAELMG  133

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN+ +   APYGPYWR++RK + LE+L+ RR++ L+  R   ++  IK+++  W   K +
Sbjct  134  YNHAMLVFAPYGPYWRELRKILTLEILTTRRVEQLQHVRVSELQNWIKQLYNVWCSQK-S  192

Query  581  ATGAVTVEMKQTF  619
             +G   VE++Q F
Sbjct  193  ESGYALVELQQWF  205



>ref|XP_006486182.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=358

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  +ADKYG IF ++ G +Q  VVSN +IAKECFTTNDK+ A R K +A E+MG
Sbjct  66   EPAHRVLGNLADKYGTIFTMKWGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMAVELMG  125

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+ +   APYG YWRQ RK V +ELLS RR++ L+  RE  V+ SI+R++++
Sbjct  126  YNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRESEVKASIQRLYKN  178



>ref|XP_011030916.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 4/137 (3%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L +MA+KYGPIF I++G  +  VVS  + AKECFTT+DK+ + R K LASE++ 
Sbjct  65   EPPHKVLGSMAEKYGPIFTIKMGVHRALVVSRWETAKECFTTHDKAFSGRPKTLASELLT  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE  VR  +K +++ W  N+  
Sbjct  125  YDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDIRESEVRTFLKELYKLWDKNRGG  184

Query  581  ATGA----VTVEMKQTF  619
            A+ +    V VEMK+ F
Sbjct  185  ASKSKSNMVLVEMKRWF  201



>gb|KHG16624.1| Cytochrome P450 [Gossypium arboreum]
Length=358

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L  MADKYGP+F +RLG+ +  V+++ ++AKECFT +DK  +TR    AS+I+GY++
Sbjct  60   HKTLGGMADKYGPVFSLRLGSHEVLVLNSWEMAKECFTVHDKVFSTRPIITASKILGYDF  119

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  APYGPYWR+IRK   +ELLS  RID L+  R   V+ +I+ +++ W    +  +G
Sbjct  120  AMFGFAPYGPYWREIRKITTIELLSNHRIDMLKHIRVSEVKSAIRELYKSWLSKGNGGSG  179

Query  590  AVTVEMKQTF  619
             V+V+MKQ F
Sbjct  180  -VSVDMKQWF  188



>gb|KCW68806.1| hypothetical protein EUGRSUZ_F02405 [Eucalyptus grandis]
Length=524

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 88/133 (66%), Gaps = 5/133 (4%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            P ++ L  MADKYGPIF I+LG+Q+  VVS S++AKECFTTNDK+   R K LA++++GY
Sbjct  62   PAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKECFTTNDKAFCNRPKYLAAKLLGY  121

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY +F  +PYGPYWR +RK   LELLS   +++LR  RE  VR S K  +E     +  A
Sbjct  122  NYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVREAVVRASTKEAYE-----RSNA  176

Query  584  TGAVTVEMKQTFD  622
                 +EMK  F+
Sbjct  177  QENTPIEMKSWFN  189



>gb|KJB43594.1| hypothetical protein B456_007G208800 [Gossypium raimondii]
Length=585

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L  MADKYGP+F +RLG+ +  V+++S++AKECFT +DK  +TR    AS+I+GY++
Sbjct  119  HKTLGGMADKYGPVFSLRLGSHEVLVLNSSEMAKECFTVHDKVFSTRPIITASKILGYDF  178

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  APYGPYWR+IRK   +ELLS  RID L+  R   V+ +I+ +++ W    +  +G
Sbjct  179  AMFGFAPYGPYWREIRKITTIELLSNHRIDMLKHIRVSEVKSAIRELYKSWLSKGNGGSG  238

Query  590  AVTVEMKQTF  619
             V+V+MKQ F
Sbjct  239  -VSVDMKQWF  247



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 94/137 (69%), Gaps = 4/137 (3%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH +L  MA+KYGPIF I++G  +  VVSN + AKECFTT+DK+ + R + LASE++ 
Sbjct  65   EPPHKVLGNMAEKYGPIFTIKMGVHRALVVSNWETAKECFTTHDKAFSGRPRTLASELLT  124

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+  +   +PYGPYWRQ+RK   +ELLS  R++ L+  RE  VR  +K +++ W +N+ +
Sbjct  125  YDGAMVGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRESEVRAFLKELYKLWDENRGS  184

Query  581  ATGAVT----VEMKQTF  619
            A+ + +    VEMK+ F
Sbjct  185  ASKSKSNLALVEMKRWF  201



>ref|XP_007224041.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
 gb|EMJ25240.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
Length=517

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KPPHL+L  MA++YGPIF + +G  +  +VS+S+IAKECFTTNDK  A+R K +A+EIM 
Sbjct  40   KPPHLVLGKMAERYGPIFTVNIGVHKALIVSSSEIAKECFTTNDKVFASRPKFMAAEIMA  99

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YNY     +PY  Y RQ+RK V+LE+LS  R++ L+  RE  V+ S+K ++E    N  +
Sbjct  100  YNYAFLPFSPYSHYSRQVRKIVLLEVLSNSRLEMLKHVRESEVKASMKGIYERCVTNGKS  159

Query  581  ATGA--VTVEMKQTF  619
            +TG+    VEM++ F
Sbjct  160  STGSNKALVEMREWF  174



>ref|XP_003554857.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=866

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH  L  +ADKYGPIF I+LG ++  V+SN +IAKECFTTND  +++R K +A E MGYN
Sbjct  60   PHRALGDLADKYGPIFTIKLGVKKALVISNWEIAKECFTTNDIFVSSRPKLVAVEYMGYN  119

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +   APYGPYWR++RK   LE+LS RR++ L+  R   V+ SIK +F  W   K+  +
Sbjct  120  QAMLGFAPYGPYWRELRKVATLEILSNRRVEQLQDVRVSEVQHSIKDLFNVWCSKKN-ES  178

Query  587  GAVTVEMKQTF  619
            G   VE+KQ F
Sbjct  179  GYALVELKQWF  189



>ref|XP_010028533.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW55288.1| hypothetical protein EUGRSUZ_I01215 [Eucalyptus grandis]
Length=524

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 89/130 (68%), Gaps = 3/130 (2%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H ILAAMA++YGP F IRLG  Q  VVSN ++AKECFT+ND+   TR ++L+ ++MGY++
Sbjct  62   HRILAAMANQYGPAFSIRLGIHQVLVVSNWEVAKECFTSNDRVFPTRPRSLSVKLMGYDH  121

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  APYGPYWR +RK  V+ELLS  R+D L+  R+      +K ++E W  N +    
Sbjct  122  AMFGFAPYGPYWRGMRKLAVVELLSNHRLDLLKHVRDAETNLFVKGLYEKWLSNGE---N  178

Query  590  AVTVEMKQTF  619
             VTVEM++ F
Sbjct  179  PVTVEMEKNF  188



>ref|XP_007133366.1| hypothetical protein PHAVU_011G173200g [Phaseolus vulgaris]
 gb|ESW05360.1| hypothetical protein PHAVU_011G173200g [Phaseolus vulgaris]
Length=527

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+ADKYGPIF I+LG+++  V++N ++AKECFTTND ++++R K +A E+MG
Sbjct  57   KRPHRTLGALADKYGPIFTIQLGSKKALVINNWEMAKECFTTNDMAVSSRPKLIAIELMG  116

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +F   PYGPYWR++RK V LE+L+ RR++ L+  R   ++ SIK + + W   K +
Sbjct  117  YN-AMFGFVPYGPYWRELRKIVTLEILTTRRVEQLQHVRVSELQNSIKELHDVWCSQK-S  174

Query  581  ATGAVTVEMKQTF  619
             +G   VE+KQ F
Sbjct  175  ESGYALVELKQWF  187



>ref|XP_004505090.1| PREDICTED: cytochrome P450 82A3-like [Cicer arietinum]
Length=533

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 115/198 (58%), Gaps = 8/198 (4%)
 Frame = +2

Query  38   NNIITIISTLA---CTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhll  208
            NNI ++   +A   C  +L  F+  +L  +  H    G   K  P  +G    L     L
Sbjct  4    NNIPSLPGVVAVTICATLLFIFILFRLRRSNSH----GVATKTPPPEAGGAWPLIGHLHL  59

Query  209  iaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  388
            ++  +PPH+ L  MA+KYGPIF +RLG  +T VVS+S+IAK+CFT ND +LA+R  ++A 
Sbjct  60   LSVSQPPHVTLGNMAEKYGPIFTVRLGVHKTLVVSSSEIAKQCFTVNDGALASRPNSVAF  119

Query  389  EIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSD  568
            EI+GYNY +F  +PYG YWR +RK   + +LS ++ID L+   E  V++++K  +  W  
Sbjct  120  EILGYNYAMFGFSPYGSYWRTMRKIATVHVLSAQQIDKLKHVMESEVKEAVKNSYSFWLK  179

Query  569  NKDAATGAVTV-EMKQTF  619
             K+       + EMK+ F
Sbjct  180  LKNEGNSERAITEMKKWF  197



>ref|XP_011025653.1| PREDICTED: cytochrome P450 CYP82H23-like [Populus euphratica]
Length=324

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 117/195 (60%), Gaps = 5/195 (3%)
 Frame = +2

Query  38   NNIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliag  217
            ++++  +  L  TL+ L F    ++   + +P  G+ +  +  P          H+ + G
Sbjct  2    DSLLQFLLILFSTLLALLF---SVYFYGLKRPTTGKARSFSSAPQAGGAWPIIGHMHLFG  58

Query  218  gKP-PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  394
            GK   H IL AMADKYGP+F I+LG+ +  VV++ ++A++CFT +D++ ++R    AS++
Sbjct  59   GKQLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDCFTVHDRAFSSRPSIAASKL  118

Query  395  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNK  574
            +GY+  +F  APYGPYWR++RK   +ELLS  RID LR  R   V  +I+ + + W  +K
Sbjct  119  LGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIRASEVETAIRDLHKMWV-SK  177

Query  575  DAATGAVTVEMKQTF  619
             +A   VTV+MKQ F
Sbjct  178  GSAESGVTVDMKQWF  192



>ref|XP_006435895.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
 gb|ESR49135.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
Length=528

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  +ADKYG IF ++LG +Q  VVSN +IAKECFTTNDK+ A R K +A E+MG
Sbjct  66   EPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWEIAKECFTTNDKAFAGRPKTMAVELMG  125

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+ +   APYG YWRQ RK V +ELLS RR++ L+  RE  V+ SI+R++++
Sbjct  126  YNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRESEVKASIQRLYKN  178



>ref|XP_008351399.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=526

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 108/183 (59%), Gaps = 7/183 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  H        K++P  +     +     L  G  PPH+ L AMA
Sbjct  16   TVIIVFYYLSRRWRAXNHX------GKLSPPEAKGGWPIFGHLHLFGGPTPPHITLGAMA  69

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG Q + V+S+S+IAKEC+TTND S+  R K + ++ + YNY +FA  P 
Sbjct  70   DKYGPIFTIRLGVQXSLVISSSEIAKECYTTNDLSILGRPKMVVADHVTYNYAMFAFXPP  129

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT-GAVTVEMK  610
            GPYWR+IRK V LE LS R+++ L+  R   V   +K +   WS  K   +   V VE+K
Sbjct  130  GPYWRZIRKIVTLEXLSVRKVELLKHIRVSEVATFLKELHXXWSTKKKXGSKDGVVVELK  189

Query  611  QTF  619
            + F
Sbjct  190  ZXF  192



>ref|XP_002510312.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52499.1| cytochrome P450, putative [Ricinus communis]
Length=522

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+IL  MADKYGPIF I++G  Q+  +S+ ++ KECFT NDK  A R   LA+E+MGYN
Sbjct  54   PHVILGNMADKYGPIFTIKMGVHQSLTISSWELVKECFTINDKIFANRPNFLAAELMGYN  113

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
              +F  +PYG YWRQ+RK   LELLS  R+ + +  RE  VR  I  +++ W  +++   
Sbjct  114  SAMFGFSPYGQYWRQMRKITTLELLSNHRLQTFKHVRESEVRAGIIDIYQLWEKSREDNK  173

Query  587  GAVTVEMKQTF  619
            G V V+MKQ F
Sbjct  174  G-VIVKMKQWF  183



>ref|XP_003618354.1| Cytochrome P450 [Medicago truncatula]
 gb|AES74572.1| cytochrome P450 family protein [Medicago truncatula]
Length=535

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            + PH +L  +ADKYGP+F I+LG+++  +++N ++AKECFTT+D  +++R K +A++ +G
Sbjct  61   QSPHRVLGTLADKYGPLFTIKLGSKRALILNNWEMAKECFTTHDMVVSSRPKLVATKHLG  120

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS--DNK  574
            YN  +F   PYGPYWRQ+RK V LE+L+ RRI+  +  R   VR SIK +F+ WS  +N+
Sbjct  121  YNGAMFGFGPYGPYWRQLRKIVTLEVLTNRRIEQQQHVRVSEVRASIKELFDVWSTKNNE  180

Query  575  DAATGAVTVEMKQTF  619
              ++  V VE+ Q F
Sbjct  181  SYSSNYVLVELDQWF  195



>ref|XP_006435901.1| hypothetical protein CICLE_v10031635mg [Citrus clementina]
 gb|ESR49141.1| hypothetical protein CICLE_v10031635mg [Citrus clementina]
Length=423

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  +ADKYG IF ++LG +   VVSN +IAKECFTTNDK+ A R K +A E+MG
Sbjct  66   EPAHRVLGNLADKYGTIFTMKLGVKHALVVSNWEIAKECFTTNDKAFAGRPKTMAVELMG  125

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+ +   APYG YWRQ RK V +ELLS RR++ L+  RE  V+ SI+R++++
Sbjct  126  YNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRESEVKASIQRLYKN  178



>ref|XP_007151149.1| hypothetical protein PHAVU_004G022000g [Phaseolus vulgaris]
 gb|ESW23143.1| hypothetical protein PHAVU_004G022000g [Phaseolus vulgaris]
Length=544

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 123/202 (61%), Gaps = 15/202 (7%)
 Frame = +2

Query  14   MDFLSPPCNNIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilg  193
            MDF+    N   T I+ L+  L  LFF          + P N  + K AP  +GA PILG
Sbjct  18   MDFVQNYLNT--TTIALLSLILFCLFF----------YNPFNFFHTKEAPTVAGAWPILG  65

Query  194  hlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRT  373
            HL LL    K PH  L A+ADKYGPIF I+LGA++  V++N + AKECFTTND ++++R 
Sbjct  66   HLPLLSGS-KRPHRTLGALADKYGPIFTIQLGAKRALVINNWETAKECFTTNDMAVSSRP  124

Query  374  KALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMF  553
            K +A E+MGYN  +F   PYGPYWR++RK V LE+L+ RR++ L+  R   ++ SIK + 
Sbjct  125  KLIAIELMGYN-AMFGFVPYGPYWRELRKIVTLEILTTRRVEQLQHVRVSELQNSIKELH  183

Query  554  EHWSDNKDAATGAVTVEMKQTF  619
              W   K   +G   VE+KQ F
Sbjct  184  NVWCSQK-RESGYALVELKQWF  204



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L  MADKYGPIF I LG ++  VVS+ ++AKEC+TTNDK  ATR ++LA ++MG
Sbjct  60   KLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKECYTTNDKVFATRPRSLAVKLMG  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y++ +   APYGPYWR +RK  ++ELLS R+++ L+  ++  V   IK ++  W+ NKD+
Sbjct  120  YDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLKHVQDSEVEFLIKELYGQWARNKDS  179

Query  581  ATGAVTVEMKQTF  619
                  VEMK+ F
Sbjct  180  PA---LVEMKERF  189



>emb|CAN81092.1| hypothetical protein VITISV_004720 [Vitis vinifera]
Length=496

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L  MADKYGPIF I LG ++  VVS+ ++AKEC+TTNDK  ATR ++LA ++MG
Sbjct  60   KLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKECYTTNDKVFATRPRSLAVKLMG  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y++ +   APYGPYWR +RK  ++ELLS R+++ L+  ++  V   IK ++  W+ NKD+
Sbjct  120  YDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLKHVQDSEVEFLIKELYGQWARNKDS  179

Query  581  ATGAVTVEMKQTF  619
                  VEMK+ F
Sbjct  180  PA---LVEMKERF  189



>ref|XP_007017409.1| Cytochrome P450, family 82, subfamily C, polypeptide 4, putative 
[Theobroma cacao]
 gb|EOY14634.1| Cytochrome P450, family 82, subfamily C, polypeptide 4, putative 
[Theobroma cacao]
Length=514

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+ L AMADK+GP+F IRLG  Q  VVS+S IAKE FT ND ++++R+K  A+E +GYN
Sbjct  76   PHVTLGAMADKHGPVFMIRLGVHQAAVVSSSDIAKEIFTVNDMAVSSRSKMAAAEHLGYN  135

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
            Y +F  +PYG +WR++RK  +LELLS  RI+ LR      +  S+K +++ W + K+  +
Sbjct  136  YAMFGFSPYGQFWREMRKITMLELLSNHRIEKLRNVFVSEIEGSLKDLYKFWLEEKN-DS  194

Query  587  GAVTVEMKQTF  619
            G V VEMK+ F
Sbjct  195  GHVFVEMKKQF  205



>gb|KJB63767.1| hypothetical protein B456_010G015400 [Gossypium raimondii]
Length=521

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H+ L A+ADK GP F IRLG     VVS+ ++AKE FTTND ++++R+K  A+E MGYNY
Sbjct  58   HVTLGALADKLGPAFMIRLGVHPALVVSSREVAKEIFTTNDMAVSSRSKMAAAEHMGYNY  117

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  +PYG YWR++RK  +LE+LS  RID L+      +  SIK +++ W   KD  +G
Sbjct  118  AMFGFSPYGQYWREMRKITMLEVLSNHRIDQLKKVFVSEIEGSIKDLYKFWVKEKDGESG  177

Query  590  AVTVEMKQTF  619
               VEMK+ F
Sbjct  178  LAAVEMKKRF  187



>ref|XP_011652396.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis sativus]
 gb|KGN59915.1| Cytochrome P450 [Cucumis sativus]
Length=521

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 91/133 (68%), Gaps = 5/133 (4%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H+ LA  AD YGPIF ++LG  +  VVS+ +IAKECFTTND+  A+R K +AS+++G
Sbjct  62   EPAHITLAKFADTYGPIFTLKLGMNKALVVSSWEIAKECFTTNDRIFASRPKLVASKLLG  121

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YNYT+F ++PYG YWR IRK   LELL+ RR+  L+  RE+ V+ SIK+++E    NK +
Sbjct  122  YNYTMFGLSPYGSYWRHIRKLATLELLTNRRLHQLQHIREFEVQTSIKKLYELCIRNKKS  181

Query  581  ATGAVTVEMKQTF  619
                  VEM   F
Sbjct  182  -----LVEMNTWF  189



>ref|XP_003618361.1| Cytochrome P450 [Medicago truncatula]
 gb|AES74579.1| cytochrome P450 family protein [Medicago truncatula]
Length=533

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            + PH +L  +ADKYGP+F I+LG +   +++N ++AKECFTTND  +++R K +A+E +G
Sbjct  60   QSPHRVLGTLADKYGPLFTIKLGTKHALILNNWEMAKECFTTNDTVVSSRPKLVATEHLG  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS--DNK  574
            YN  +F +APYGPYWRQ+RK V LE+L+ RR+   +  R   V+ SIK +F  W+  +N+
Sbjct  120  YNGAMFGLAPYGPYWRQLRKIVTLEVLTNRRVKQQQHVRVPEVQASIKELFNVWTSKNNE  179

Query  575  DAATGAVTVEMKQTF  619
              ++  V VE+ Q F
Sbjct  180  SYSSNYVLVELDQWF  194



>gb|KEH30993.1| cytochrome P450 family protein [Medicago truncatula]
Length=526

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  +ADKYGPIF +RLG  +T VVS+ ++ K+CFT NDK+ A+R K++A EIMG
Sbjct  66   QPPHVTLGNLADKYGPIFTVRLGVHKTLVVSSYEMVKQCFTVNDKTFASRPKSIAFEIMG  125

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN ++F ++PYG YWR +RK   + +LS +RID L+   E  V++++K  +  W   K+ 
Sbjct  126  YNSSMFGLSPYGSYWRTVRKIATVHVLSAQRIDMLKHVMESEVKEAMKESYSFWLKMKNE  185

Query  581  ATGA-VTVEMKQTF  619
                 V  EMK+ F
Sbjct  186  GNSERVFTEMKEWF  199



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H++   MADKYGPIF I++G   T V SN ++AKECFTTNDK+ A R   LA +++G
Sbjct  58   QPSHIVFGNMADKYGPIFTIKMGVHPTLVASNWEMAKECFTTNDKAFANRPNILAMDLLG  117

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y  ++FA +PYG YWRQIRK   LELLS  R+      RE  V  ++K +++ W  NK  
Sbjct  118  YGRSMFAFSPYGNYWRQIRKISTLELLSNHRLQMFNHVRESEVGTALKELYKLWEKNKTT  177

Query  581  -ATGAVTVEMKQTF  619
             +   V VEMK+ F
Sbjct  178  NSNNKVLVEMKRWF  191



>gb|KJB43593.1| hypothetical protein B456_007G208700 [Gossypium raimondii]
Length=525

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L  MADKYGP+F +RLG+ +  V+++ ++AKECFT +DK  +TR    AS+I+GY++
Sbjct  60   HKTLGGMADKYGPVFSLRLGSHEVLVLNSWEMAKECFTVHDKVFSTRPSITASKILGYDF  119

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  APYGPYWR+IRK   +ELLS  RID L+  R   V+ +I+ +++ W    +  +G
Sbjct  120  AMFGFAPYGPYWREIRKITTIELLSNHRIDMLKHIRVSEVKSAIRELYKSWLSKGNGGSG  179

Query  590  AVTVEMKQTF  619
             ++V+MKQ F
Sbjct  180  -LSVDMKQWF  188



>ref|XP_007151142.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
 gb|ESW23136.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
Length=519

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+ADKYGPIF I+LGA++  V++N + AKECFTTND  +++R K +A+E M 
Sbjct  52   KSPHRTLGALADKYGPIFTIKLGAKKALVINNWETAKECFTTNDIVVSSRPKLVAAEHMS  111

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +FA+AP GPYW++IRK  V E+LS +R+  LR   E  V +SIK +   W  NK+ 
Sbjct  112  YNKAMFALAPCGPYWQKIRKITVSEILSPQRVKQLRHVFESEVEESIKELSNFWCSNKN-  170

Query  581  ATGAVTVEMKQTF  619
             +G   VE+KQ F
Sbjct  171  ESGYALVELKQWF  183



>ref|XP_002282118.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 117/170 (69%), Gaps = 2/170 (1%)
 Frame = +2

Query  110  FHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLG  289
            ++ ++ +   G+  ++APE +GA PI+GHLHLL      PHL+L  MADKYG +F +RLG
Sbjct  23   YYLLLWRSGAGKG-RMAPEAAGAWPIIGHLHLLGGSKNLPHLLLGTMADKYGAVFSVRLG  81

Query  290  AQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVV  469
             ++  VVS+ ++AKECFTT+D +LA+R + + S+ +GYN  +FA +P+G YWR++RK   
Sbjct  82   LERAVVVSSWQMAKECFTTHDLALASRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIAT  141

Query  470  LELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            LELLS RR++ L+  R   V   +K +++ W++ K+ A G V V+MKQ F
Sbjct  142  LELLSNRRLELLKNVRISEVETCMKELYKLWAEKKNEA-GVVLVDMKQWF  190



>ref|XP_007017412.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14637.1| Cytochrome P450, putative [Theobroma cacao]
Length=497

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PP++ LA MADK+G  F I+LG  +  VVSNS+IAK+C TTNDK+ ATR K  A EI+G
Sbjct  64   RPPYITLANMADKFGTFFAIKLGVHRALVVSNSEIAKQCLTTNDKAFATRPKLTAMEILG  123

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN +I A APYGPYWRQ+RK V +ELLS  R+D L+   +  V+ S++++++     K  
Sbjct  124  YNNSIIAFAPYGPYWRQVRKFVNIELLSNHRLDMLKHVLDSEVKSSLQQLYQ-LCGKKRT  182

Query  581  ATGAVTVEMKQTF  619
             +  V V+M++ F
Sbjct  183  NSDEVLVDMQRWF  195



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 109/170 (64%), Gaps = 0/170 (0%)
 Frame = +2

Query  62   TLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLIL  241
            ++  T++ LF     L  + + K       + APEP+G  PI+GHLHLL  G +  +  L
Sbjct  4    SIQLTVISLFVSLIFLIRSFLKKKVQDSKSREAPEPAGGWPIIGHLHLLGGGDQLLYRTL  63

Query  242  AAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFA  421
             AMADKYGP F IRLG+++ FVVS+ ++AK+CFT ND++LA+R   +A++ MGYNY +F 
Sbjct  64   GAMADKYGPAFNIRLGSRRAFVVSSWEVAKDCFTVNDRALASRPTTVAAKHMGYNYAVFG  123

Query  422  VAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDN  571
             APY P+WR++RK   LELLS RR+D LR  R   +   IK ++  W  N
Sbjct  124  FAPYSPFWREMRKIATLELLSNRRLDMLRHVRTSELDMGIKELYSLWVQN  173



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L AMADKYGP+F IRLG  +  V+S+S++A+ECFTT+D+  +TR    AS+I+GY++
Sbjct  92   HKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFTTHDRVFSTRPSVTASKILGYDF  151

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  APYG YWR++RK V +ELLS  R+D L+  R   V  SI+ ++E W   +    G
Sbjct  152  AMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRASEVGTSIRELYEMWVSER-GTDG  210

Query  590  AVTVEMKQTF  619
             V V+MK+ F
Sbjct  211  RVFVDMKRWF  220



>ref|XP_008388076.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=497

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 7/181 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  HK      +K++P  +     +     L  G  PPHL L AMA
Sbjct  16   TVIIVFYYLSRRWRAANHK------RKLSPPEAKGGWPIFGHLPLFGGSIPPHLTLGAMA  69

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG   + V+S+S+IAKECFTT D S+ +R + +  + + Y+Y +F   P 
Sbjct  70   DKYGPIFTIRLGVHPSLVISSSEIAKECFTTKDLSIISRPRMVVLDHVSYDYAMFGFGPG  129

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS-DNKDAATGAVTVEMK  610
            GP+WR+IRK V LELLS R+++ L+  R   V   +K + E WS   K+ +   V VE+K
Sbjct  130  GPFWREIRKLVTLELLSVRKVELLKHIRVSEVATFLKELHELWSTKKKEGSKDGVVVELK  189

Query  611  Q  613
            Q
Sbjct  190  Q  190



>ref|XP_002282133.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=525

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 117/170 (69%), Gaps = 2/170 (1%)
 Frame = +2

Query  110  FHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLG  289
            ++ ++ +   G+  ++APE +GA PI+GHLHLL      PHL+L  MADKYG +F +RLG
Sbjct  23   YYLLLWRSGAGKG-RMAPEAAGAWPIIGHLHLLGGSKNLPHLLLGTMADKYGAVFSVRLG  81

Query  290  AQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVV  469
             ++  VVS+ ++AKECFTT+D +LA+R + + S+ +GYN  +FA +P+G YWR++RK   
Sbjct  82   LKRAVVVSSWQMAKECFTTHDLALASRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIAT  141

Query  470  LELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            LELLS RR++ L+  R   V   +K +++ W++ K+ A G V V+MKQ F
Sbjct  142  LELLSNRRLELLKNVRISEVETCMKELYKLWAEKKNEA-GVVLVDMKQWF  190



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L AMADKYGP+F IRLG  +  V+S+S++A+ECFTT+D+  +TR    AS+I+GY++
Sbjct  63   HKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFTTHDRVFSTRPSVTASKILGYDF  122

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  APYG YWR++RK V +ELLS  R+D L+  R   V  SI+ ++E W   +    G
Sbjct  123  AMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRASEVGTSIRELYEMWVSER-GTDG  181

Query  590  AVTVEMKQTF  619
             V V+MK+ F
Sbjct  182  RVFVDMKRWF  191



>ref|XP_004291928.1| PREDICTED: cytochrome P450 CYP82D47-like [Fragaria vesca subsp. 
vesca]
Length=536

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 87/134 (65%), Gaps = 3/134 (2%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+ L A+  KYGPIF I +G   T V+S  + AKECFT ND  +++R   L ++ +GYN
Sbjct  65   PHITLGALTHKYGPIFTINIGIHSTLVLSTWEAAKECFTINDSVVSSRPATLVAKHLGYN  124

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKD---  577
            Y +F  +PY PYWR+IRK + LELLS RR++ L+  R   V  S+K++++ W   KD   
Sbjct  125  YAMFGFSPYSPYWREIRKLISLELLSNRRLELLKHVRVSEVEMSLKQLYKQWRQRKDIIS  184

Query  578  AATGAVTVEMKQTF  619
             +TG V VEMKQ F
Sbjct  185  TSTGQVPVEMKQWF  198



>ref|NP_001240077.1| cytochrome P450 82A2 [Glycine max]
 sp|O81972.1|C82A2_SOYBN RecName: Full=Cytochrome P450 82A2; AltName: Full=Cytochrome 
P450 CP4 [Glycine max]
 emb|CAA71515.1| putative cytochrome P450 [Glycine max]
Length=522

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L  +ADKYGPIF I++GA+   VVSN ++AKEC+TTND ++++    +++ ++ 
Sbjct  57   KTPHKTLGDLADKYGPIFSIKIGAKNAVVVSNWEMAKECYTTNDIAVSSLPDLISANLLC  116

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN ++  VAPYGPYWRQ+RK ++ E LS  R++ L   R   V+ SI  +F  W  NK+ 
Sbjct  117  YNRSMIVVAPYGPYWRQLRKILMSEFLSPSRVEQLHHVRVSEVQSSITELFRDWRSNKNV  176

Query  581  ATGAVTVEMKQTF  619
             +G  TVE+KQ F
Sbjct  177  QSGFATVELKQWF  189



>ref|XP_010106088.1| Cytochrome P450 82A4 [Morus notabilis]
 gb|EXC07358.1| Cytochrome P450 82A4 [Morus notabilis]
Length=525

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+ LA +ADKYGPIF I +G   T V+S+ + AKECFTT+D +++TR K ++SEI+G+N
Sbjct  63   PHITLANLADKYGPIFTIHIGVHPTLVISSWESAKECFTTHDLAVSTRPKLISSEILGWN  122

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
            Y  F  APYGPYWR+IRK    ELLS +R++ LR  RE  V   +K +++ W+  ++  +
Sbjct  123  YASFGFAPYGPYWREIRKITTSELLSNKRLEKLRHVRESEVESFVKNLYKLWT-KRETGS  181

Query  587  GAVTVEMKQ  613
              V VEM +
Sbjct  182  DRVMVEMGK  190



>gb|KHG08974.1| Cytochrome P450 [Gossypium arboreum]
Length=358

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L  MA KYGP+F +RLG+ +  V+++ ++AKECFT +DK  +TR    AS+I+GY++
Sbjct  60   HKTLGGMAAKYGPVFSLRLGSHEVLVLNSWEMAKECFTVHDKVFSTRPIITASKILGYDF  119

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  APYGPYWR+IRK   +ELLS  RID L+  R   V+ +I+ +++ W    +  +G
Sbjct  120  AMFGFAPYGPYWREIRKITTIELLSNHRIDMLKHIRVSEVKSAIRELYKSWLSKGNGGSG  179

Query  590  AVTVEMKQTF  619
             V+V+MKQ F
Sbjct  180  -VSVDMKQWF  188



>ref|XP_006486180.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
Length=526

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  MADKYGPIF ++LG +Q  +VSN +IAKECFTTNDK+ A+R K +A E++ 
Sbjct  64   EPAHRVLGDMADKYGPIFTMKLGVKQALMVSNWEIAKECFTTNDKAFASRPKTMAMELLE  123

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+++ + APYG YWRQ  K   +ELLS  R++ L+  REY V+ SI+R++++
Sbjct  124  YNFSVISFAPYGNYWRQSLKIATIELLSSHRLEKLKHVREYEVKASIQRLYKN  176



>ref|XP_010664941.1| PREDICTED: cytochrome P450 82A4-like [Vitis vinifera]
Length=201

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MADKYGP+F IR+G  +  VVS+ ++AKEC T ND+  ++R + LAS+ +GYNY +F  +
Sbjct  1    MADKYGPVFTIRIGLHRALVVSSWEMAKECSTANDQVSSSRPELLASKHLGYNYAMFGFS  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR++RK + LELLS  R++ L+  R   V  SIK +++ W++ K+  +G V+VEM
Sbjct  61   PYGSYWREMRKIISLELLSNSRLELLKDVRASEVVTSIKELYKLWAEKKN-ESGLVSVEM  119

Query  608  KQTF  619
            KQ F
Sbjct  120  KQWF  123



>ref|XP_006486181.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
Length=526

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H +L  MADKYGPIF ++LG +Q  +VSN +IAKECFTTNDK+ A+R K +A E++ 
Sbjct  64   EPAHRVLGDMADKYGPIFTMKLGVKQALMVSNWEIAKECFTTNDKAFASRPKTMAMELLE  123

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEH  559
            YN+++ + APYG YWRQ  K   +ELLS  R++ L+  REY V+ SI+R++++
Sbjct  124  YNFSVISFAPYGNYWRQSLKIATIELLSSHRLEKLKHVREYEVKASIQRLYKN  176



>gb|KDO40895.1| hypothetical protein CISIN_1g038677mg [Citrus sinensis]
Length=186

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MADKYGPIF I++G  +  VVSN ++AKEC TT+DK  A+R K LA+EI+GYN+++F  +
Sbjct  1    MADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAAEILGYNFSMFGFS  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PY  YWR+  K   LELLS  R++ L+  REY ++  +K +++ W +NK +    + VEM
Sbjct  61   PYDFYWRETHKIATLELLSNYRLEKLKHVREYELKTCLKELYQLWDNNK-STNKMLLVEM  119

Query  608  KQ  613
            K+
Sbjct  120  KR  121



>ref|XP_002519132.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF43343.1| cytochrome P450, putative [Ricinus communis]
Length=320

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 106/171 (62%), Gaps = 7/171 (4%)
 Frame = +2

Query  116  AIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQ  295
            AI +   N +N K  PEPSG+ P +GHLHLL    +  H  L +MAD+ GPIF IRLG  
Sbjct  25   AIKYANRNKKNIKNPPEPSGSWPFIGHLHLLSDSNQLLHRTLGSMADELGPIFSIRLGVH  84

Query  296  QTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLE  475
            Q  V+SN ++AKECFT NDK   TR ++LA +IMGY+  +F  APYG YWR +RK   +E
Sbjct  85   QAVVISNWELAKECFTINDKVFQTRPESLAVKIMGYDQVMFGFAPYGKYWRDVRKLATVE  144

Query  476  LLSGRRIDSLRPKREYHVRKSIKRMF--EHWSDNKDAATGAVTVEMKQTFD  622
            LLS RR++ L+     HVR    ++F  E + ++     G   +EMK+ F+
Sbjct  145  LLSNRRLELLK-----HVRDRETKLFFKELYQESVKNGGGNTVIEMKERFE  190



>ref|XP_008378984.1| PREDICTED: cytochrome P450 82A3-like, partial [Malus domestica]
Length=444

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 104/179 (58%), Gaps = 6/179 (3%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  HK       K++P  +     +     L     PPH  L AMA
Sbjct  16   TVIIVFYYLSRRWRAANHK------GKLSPPEAKGGWPIFGHLPLFGDSMPPHRTLGAMA  69

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG     V+S+S+I KEC+TT D S  +R K +  + + Y+Y +F   P 
Sbjct  70   DKYGPIFTIRLGVHPALVISSSEIVKECYTTKDVSSLSRPKMVVVDHVSYDYAMFGFGPS  129

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMK  610
            GPYWR+IRK V LELLS R+++ L+  R Y V   +K ++E W   K+++   V V++K
Sbjct  130  GPYWREIRKLVSLELLSVRKVELLKHIRAYEVTAFLKDLYELWRTKKESSKDGVVVDLK  188



>gb|AGN54072.1| cytochrome P450 monooxygenase [Artemisia annua]
Length=523

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 88/126 (70%), Gaps = 0/126 (0%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            P H IL +MA KYGPIF I+LG +Q  VV++  IAKE FTT+D  +++R K  A++I+GY
Sbjct  60   PLHKILGSMAVKYGPIFTIQLGVRQVLVVNSWDIAKEIFTTHDAIVSSRPKFTAAKILGY  119

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            +Y +F V+PYGPYWR++RK   LELLS RR++ L+  R   ++ SIK ++E W + +D  
Sbjct  120  DYAMFGVSPYGPYWREMRKITSLELLSARRLEQLKYVRVSELKNSIKNLYELWGERRDGQ  179

Query  584  TGAVTV  601
              A+ V
Sbjct  180  GKALVV  185



>ref|XP_004252778.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=527

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 115/186 (62%), Gaps = 10/186 (5%)
 Frame = +2

Query  65   LACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILA  244
            L   L+ L+F        I  K  N    K APEP+GA PI+GHL LL    +  +  L 
Sbjct  9    LIGVLIFLYF--------IFKKNKNCSTSKQAPEPAGAWPIIGHLPLLGGTDQLLYRTLG  60

Query  245  AMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAV  424
            AMAD YGP F +RLG ++ FVVS+ ++AKECFT NDK+LA+R   +A++ MGY Y +F  
Sbjct  61   AMADNYGPAFNLRLGTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGF  120

Query  425  APYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVE  604
            APY P+WR++RK  + ELLS RR+D+L+  +   V   I+ +++ W DN   +   + VE
Sbjct  121  APYSPFWREMRKIAMFELLSNRRLDTLKYVQVSEVDMGIQALYKLWVDNN--SDRPILVE  178

Query  605  MKQTFD  622
            +K+ F+
Sbjct  179  LKRWFE  184



>ref|XP_002284810.3| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=610

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  IMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQ  298
            +++   N +  K  PEPSG  P++GHLHLL A  K  H  L  MADKYGPIF +RLG ++
Sbjct  110  VLNAKGNKKRGKRPPEPSGRWPLIGHLHLLGAD-KLLHRTLGDMADKYGPIFCVRLGLKK  168

Query  299  TFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLEL  478
            T VVS+ ++AKEC+TT+DK  ATR ++LA +++GY++  F  APYGPYWR +RK  ++EL
Sbjct  169  TLVVSSWEVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVEL  228

Query  479  LSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            LS R+++  +  ++  V+  IK ++  W+ NKD   G   VEMK+ F
Sbjct  229  LSNRQLEMHKHVQDSEVKILIKELYGQWASNKD---GPALVEMKERF  272



>ref|XP_011039260.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=528

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 117/195 (60%), Gaps = 5/195 (3%)
 Frame = +2

Query  38   NNIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliag  217
            ++++  +  L  TL+ L F    ++   + +P  G+ +  +  P          H+ + G
Sbjct  2    DSLLQFLLILFSTLLALLF---SVYFYGLKRPTTGKARSFSSAPQAGGAWPIIGHMHLFG  58

Query  218  gKP-PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEI  394
            GK   H IL AMADKYGP+F I+LG+ +  VV++ ++A++CFT +D++ ++R    AS++
Sbjct  59   GKQLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDCFTVHDRAFSSRPSIAASKL  118

Query  395  MGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNK  574
            +GY+  +F  APYGPYWR++RK   +ELLS  RID LR  R   V  +I+ + + W  +K
Sbjct  119  LGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIRASEVETAIRDLHKMWV-SK  177

Query  575  DAATGAVTVEMKQTF  619
             +A   VTV+MKQ F
Sbjct  178  GSAESGVTVDMKQWF  192



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 118/183 (64%), Gaps = 1/183 (1%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T  LL  L   +F   + K  N  ++K APEP+GA PI+GHLHLL    +  +  L AMA
Sbjct  3    TYFLLPLLGVVIFLYFLFKNKNSTSKKHAPEPAGAWPIIGHLHLLGGAEQLLYRTLGAMA  62

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            D YGP F IRLG+++ FVVS+ ++AKECFT NDK+LA+R   +A++ MGY Y +F  APY
Sbjct  63   DNYGPAFSIRLGSRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPY  122

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQ  613
              +WR++RK  + ELLS RR+D+L+  +   V   I+ +++ W +N ++    + VE+K 
Sbjct  123  STFWREMRKIAMYELLSNRRLDTLKHVQVSEVEMGIQELYKLWVNN-NSGYRPILVELKH  181

Query  614  TFD  622
             F+
Sbjct  182  WFE  184



>emb|CBI32510.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = +2

Query  119  IMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQ  298
            +++   N +  K  PEPSG  P++GHLHLL A  K  H  L  MADKYGPIF +RLG ++
Sbjct  95   VLNAKGNKKRGKRPPEPSGRWPLIGHLHLLGAD-KLLHRTLGDMADKYGPIFCVRLGLKK  153

Query  299  TFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLEL  478
            T VVS+ ++AKEC+TT+DK  ATR ++LA +++GY++  F  APYGPYWR +RK  ++EL
Sbjct  154  TLVVSSWEVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVEL  213

Query  479  LSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            LS R+++  +  ++  V+  IK ++  W+ NKD   G   VEMK+ F
Sbjct  214  LSNRQLEMHKHVQDSEVKILIKELYGQWASNKD---GPALVEMKERF  257



>ref|XP_009336429.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 109/181 (60%), Gaps = 7/181 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  HK       K++P  +     +     L  G  PPH+ L AMA
Sbjct  21   TVIIVFYYLSRRWRAANHK------GKLSPPEAKGGWPIIGHLPLFGGSTPPHITLGAMA  74

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG   + V+S+S+IAKEC+TT D S+ +R K +  + + Y+Y +F   P 
Sbjct  75   DKYGPIFTIRLGVHPSLVISSSEIAKECYTTQDLSILSRPKMVVLDHVSYDYAMFGFGPG  134

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNK-DAATGAVTVEMK  610
            GP+WR+IRK V LELLS R+++ L+  R   V   +K + E WS  K +++   V VE+K
Sbjct  135  GPFWREIRKLVTLELLSVRKVELLKHIRVSEVATFLKELHELWSAKKRESSKDGVIVELK  194

Query  611  Q  613
            Q
Sbjct  195  Q  195



>emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera]
Length=527

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L  MADKYGPIF +RLG ++T VVS+ ++AKEC+TT+DK  ATR ++LA +++GY++
Sbjct  63   HRTLGDMADKYGPIFCVRLGLKKTLVVSSWEVAKECYTTSDKVFATRPRSLAIKLIGYDH  122

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
              F  APYGPYWR +RK  ++ELLS R+++  +  ++  V+  IK ++  W+ NKD   G
Sbjct  123  GSFVFAPYGPYWRDVRKLAMVELLSNRQLEMHKHVQDSEVKILIKELYGQWASNKD---G  179

Query  590  AVTVEMKQTF  619
               VEMK+ F
Sbjct  180  PALVEMKERF  189



>gb|KCW67760.1| hypothetical protein EUGRSUZ_F01497 [Eucalyptus grandis]
Length=440

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  LA+MAD++GPIF IRLG  +  VVS S+IAKECFT ND +L+TR + LA +I+ 
Sbjct  58   KLPHKTLASMADQFGPIFTIRLGMFRALVVSGSEIAKECFTKNDIALSTRPQQLAPKILA  117

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDS-LRPKREYHVRKSIKRMFEHWSDNKD  577
            Y Y +F   PYGPYWR++RK V LELLS RR++S L P +      +I+ + E W ++KD
Sbjct  118  YGYAMFGYVPYGPYWREVRKMVTLELLSNRRVNSLLNPIQASEADVAIQELHELWIESKD  177



>ref|XP_009364774.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 109/181 (60%), Gaps = 7/181 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T++++F+  ++ + A  HK       K++P  +     +     L  G  PPH+ L AMA
Sbjct  21   TVIIVFYYLSRRWRAANHK------GKLSPPEAKGGWPIIGHLPLFGGSTPPHITLGAMA  74

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG   + V+S+S+IAKEC+TT D S+ +R K +  + + Y+Y +F   P 
Sbjct  75   DKYGPIFTIRLGVHPSLVISSSEIAKECYTTQDLSILSRPKMVVLDHVSYDYAMFGFGPG  134

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNK-DAATGAVTVEMK  610
            GP+WR+IRK V LELLS R+++ L+  R   V   +K + E WS  K +++   V VE+K
Sbjct  135  GPFWREIRKLVTLELLSVRKVELLKHIRVSEVATFLKELHELWSAKKRESSKDGVIVELK  194

Query  611  Q  613
            Q
Sbjct  195  Q  195



>ref|XP_007223263.1| hypothetical protein PRUPE_ppa004464mg [Prunus persica]
 gb|EMJ24462.1| hypothetical protein PRUPE_ppa004464mg [Prunus persica]
Length=508

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+ LA++ DKYGPIF + +G     V+S  + AK+CFTTNDK +++R   L  + + YN
Sbjct  62   PHITLASLVDKYGPIFTVNIGIHSALVISTWEAAKDCFTTNDKVVSSRPATLGCKYLSYN  121

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
            + +F  +PYGPYWR++RK   LELLS RR++ LR  R   V  S+K+++  WS  K+  +
Sbjct  122  FAMFGFSPYGPYWREMRKLTSLELLSNRRLELLRNVRASEVEISLKQLYTLWSKRKE-GS  180

Query  587  GAVTVEMKQTF  619
            G + VEMKQ F
Sbjct  181  GELLVEMKQWF  191



>emb|CAN65890.1| hypothetical protein VITISV_018868 [Vitis vinifera]
Length=670

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 121/181 (67%), Gaps = 8/181 (4%)
 Frame = +2

Query  80   VLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADK  259
            +L   +C  L +A  +K N GR+    PEPSGA P++GHLHLL A  KP H    AMAD+
Sbjct  411  ILFAIICLWLVNAKGNK-NKGRS---PPEPSGAWPVMGHLHLLGAD-KPLHRTFGAMADE  465

Query  260  YGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGP  439
            YGPIF IRLG +   VVS+S++AKEC+TT DK+LATR ++LA ++MGY++ +FA   +GP
Sbjct  466  YGPIFSIRLGLRTALVVSSSEVAKECYTTKDKALATRPRSLAVKLMGYDHAMFAFERHGP  525

Query  440  YWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            YWR +R+  ++ELLS R+ + L+  R+  V+  I+ ++  W DN       V V+MK+ F
Sbjct  526  YWRDVRRLAMVELLSNRQHEMLKHVRDSEVKFFIQELYGQWVDN---GGSPVLVDMKKKF  582

Query  620  D  622
            +
Sbjct  583  E  583


 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALAS  388
            H  L  MADKYGPIF I LG ++  VVS  ++AKEC+TTNDK  A R+   +S
Sbjct  328  HQKLGDMADKYGPIFCIHLGFRKALVVSRWEVAKECYTTNDKREAMRSDTESS  380



>ref|XP_009336448.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 110/189 (58%), Gaps = 8/189 (4%)
 Frame = +2

Query  50   TIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPP  229
            +I + L    ++L++L  + + A  HK       K++P  +     +     L  G  PP
Sbjct  9    SITAGLFTVFIVLYYLSRR-WRAANHK------GKLSPPEAKGGWPIFGHLHLFGGSTPP  61

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H+ L AMADKYGPIF IRLG   + V+S+S+IAKEC+TT D S+ +R K +  + + YNY
Sbjct  62   HITLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECYTTKDLSVLSRPKMVVVDHVSYNY  121

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS-DNKDAAT  586
             +F   P GPYWR+IRK V LELLS R+++ L+  R   V   +K + E WS   K+ + 
Sbjct  122  AMFGFGPPGPYWREIRKIVTLELLSVRKVELLKHVRVSEVATFLKELHELWSTKKKEGSE  181

Query  587  GAVTVEMKQ  613
              + VE+KQ
Sbjct  182  DRMVVELKQ  190



>ref|XP_010028535.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 87/130 (67%), Gaps = 3/130 (2%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H ILA MAD+YGP F IRLG  +  VVSN ++AKECFT+ND+   TR ++L+ ++MGY++
Sbjct  62   HRILAVMADQYGPAFSIRLGILRVLVVSNWEVAKECFTSNDRVFPTRPRSLSIKLMGYDH  121

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +   APYGPYWR +RK  V+ELLS  R+DS +  R+      +K ++E W  N +    
Sbjct  122  AMLGFAPYGPYWRGMRKLAVVELLSNHRLDSFKHVRDAETNLFVKGLYEKWLSNGE---N  178

Query  590  AVTVEMKQTF  619
             VTVEM++ F
Sbjct  179  PVTVEMEKDF  188



>ref|XP_003528211.2| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=541

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 90/133 (68%), Gaps = 5/133 (4%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            KPPH+ L  MADKYGP+F +RLGA +T VVSN ++AK+CFT NDK+ A+R K+++ E++G
Sbjct  81   KPPHVTLGHMADKYGPVFTLRLGAHKTLVVSNWEMAKQCFTVNDKAFASRPKSVSFELLG  140

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YNY++    PYG YWR +RK + LELLS   ID L+      V+ ++K  +++   ++ A
Sbjct  141  YNYSMIGFIPYGSYWRHVRKIITLELLSTHCIDMLKHVMVAEVKAAVKETYKNLKGSEKA  200

Query  581  ATGAVTVEMKQTF  619
                 T EMK+ F
Sbjct  201  -----TTEMKRWF  208



>ref|XP_006428106.1| hypothetical protein CICLE_v10027086mg [Citrus clementina]
 gb|ESR41346.1| hypothetical protein CICLE_v10027086mg [Citrus clementina]
Length=408

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 90/130 (69%), Gaps = 8/130 (6%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MA+KYGPIF +++G  +  VVSNS+I KECFTTNDK+LA+R + +A EI+GYN+     +
Sbjct  1    MANKYGPIFTMKMGVNRALVVSNSEITKECFTTNDKALASRPRRMAMEILGYNFLATPSS  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR+ RK   +ELLS  R++ L+  RE  V  SIK +F+   D +++ATG V+VEM
Sbjct  61   PYGSYWRETRKIATVELLSNHRLEKLKHVRESEVTASIKGLFK---DCQNSATGKVSVEM  117

Query  608  KQ-----TFD  622
            K      TFD
Sbjct  118  KHWLEGTTFD  127



>ref|XP_010106079.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07349.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 77/114 (68%), Gaps = 0/114 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ LA MADKYGPIF I++G  +  VVS+ ++AKEC TTNDK  A R KA A E M 
Sbjct  57   QPPHITLAHMADKYGPIFTIKMGVHRALVVSSWEMAKECLTTNDKIFANRPKAAAPEHMT  116

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHW  562
            YNY +F  +PYGPYWRQ+RK   LELLS  R++ L   R   V  +IK  +E W
Sbjct  117  YNYAMFGFSPYGPYWRQVRKIATLELLSNHRLEMLSHVRVSEVNTAIKEKYELW  170



>gb|KDP38426.1| hypothetical protein JCGZ_04351 [Jatropha curcas]
Length=514

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 117/193 (61%), Gaps = 9/193 (5%)
 Frame = +2

Query  44   IITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggK  223
            ++ ++  L  T +LLF  C  L      + +  R  + APE +G    +     L+AG +
Sbjct  1    MVLLLQYLGLTAILLF--CYYLL-----RRSQSRKARAAPE-AGDSWPIIGHLHLLAGRE  52

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
             PH +LAA+ADKYGPIF IR+G     VVS+ ++AKE FT ND ++++R K   ++++GY
Sbjct  53   LPHKVLAALADKYGPIFTIRIGIYPALVVSSWELAKELFTVNDPTVSSRPKLTGAKLLGY  112

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAA  583
            NY  F  +PYG YWR++RK   LELLS R+++ L+  R   V  SIK +++ W+ +KD  
Sbjct  113  NYANFGFSPYGEYWREMRKITALELLSNRKLELLKHIRASEVEGSIKDLYKFWTKDKDER  172

Query  584  TGAVTVEMKQTFD  622
               V VEMK+ F+
Sbjct  173  N-QVKVEMKRFFN  184



>gb|KDP38433.1| hypothetical protein JCGZ_04358 [Jatropha curcas]
Length=481

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MADKYGPIF I+ G  ++ VVS+ ++AKECFTTNDK+ A R   LA+E+MGYN  +F  +
Sbjct  1    MADKYGPIFSIKTGVHRSLVVSSWELAKECFTTNDKAFANRPNFLAAELMGYNSAMFGFS  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYG YWR IRK   +ELLS  R+ S R  RE  ++ ++  +++ W +N D     + V+M
Sbjct  61   PYGQYWRVIRKIATVELLSNHRLQSFRHVRESEIKAAMNGIYQLWEENIDYNKADMVVKM  120

Query  608  KQTF  619
            KQ F
Sbjct  121  KQWF  124



>sp|O49859.1|C82A4_SOYBN RecName: Full=Cytochrome P450 82A4; AltName: Full=Cytochrome 
P450 CP9 [Glycine max]
 emb|CAA71877.1| putative cytochrome P450 [Glycine max]
Length=525

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+A+K+GP+F I+LGA++  VVS+ ++A+ECFTTND +++ R K L +E+M 
Sbjct  60   KSPHKALGALAEKHGPLFTIKLGAKKALVVSDWEMARECFTTNDVAVSARPKLLVAELMC  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +  VAPYGPYWR++RK +V E+LS  R++ L+  R   V+ SI  +++ W   K+ 
Sbjct  120  YNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQLQDVRVSEVQNSIVELYDVWRSQKNE  179

Query  581  ATGAVTVEMKQTF  619
            +  A +VE+KQ F
Sbjct  180  SDYA-SVELKQWF  191



>ref|XP_010060879.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW67757.1| hypothetical protein EUGRSUZ_F01492 [Eucalyptus grandis]
Length=536

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  LAAMAD++GPIF +RLG+  T V+S+S+IAKECFT +D +L++R  +L+SEI+G
Sbjct  61   KLPHKTLAAMADEFGPIFTLRLGSFPTMVLSSSEIAKECFTKHDLALSSRWPSLSSEILG  120

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDS-LRPKREYHVRKSIKRMFEHWSDNKD  577
            Y+  +F +AP  PYWR++RK   LELLS RRI S L P        +IK +   WS+ KD
Sbjct  121  YDGALFGLAPCSPYWREVRKIATLELLSNRRIKSLLNPVLASATDLAIKELHGLWSEKKD  180

Query  578  AATGAVTVEMKQTF  619
              +G ++V++KQ F
Sbjct  181  -DSGHISVDLKQWF  193



>ref|XP_003517019.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=526

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+A+K+GP+F I+LGA++  VVS+ ++A+ECFTTND +++ R K L +E+M 
Sbjct  60   KSPHKALGALAEKHGPLFTIKLGAKKALVVSDWEMARECFTTNDVAVSARPKLLVAELMC  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +  VAPYGPYWR++RK +V E+LS  R++ L+  R   V+ SI  +++ W   K+ 
Sbjct  120  YNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQLQDVRVSEVQNSIVELYDVWRSQKNE  179

Query  581  ATGAVTVEMKQTF  619
            +  A +VE+KQ F
Sbjct  180  SDYA-SVELKQWF  191



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 120/192 (63%), Gaps = 10/192 (5%)
 Frame = +2

Query  56   ISTLACTLVLLFFLCNKLFHAIMHKPNN--GRNQ-KVAPEPSgalpilghlhlliaggKP  226
            ++ +  ++ LL FL    +HA + K  N  GRN  K AP P GA P++GHLHLL    + 
Sbjct  7    LTIVTISVSLLVFL----WHAFLGKKRNKGGRNNSKEAPVPVGAWPLIGHLHLLGGDDQL  62

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
             +  L  MAD+YGP F I LG ++ FVVS+ ++AKECFTTNDK+LA+R   +A++ MGYN
Sbjct  63   LYRTLGTMADQYGPAFNIWLGTRRAFVVSSWEVAKECFTTNDKALASRPTTVAAKHMGYN  122

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
            Y +F  APY P+WR++RK   LELLS RR++ L+  R   +   IK ++  W  N+   +
Sbjct  123  YAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRVSELNTGIKELYNSWVQNR---S  179

Query  587  GAVTVEMKQTFD  622
              V VE+ +  +
Sbjct  180  QPVVVELNRWLE  191



>ref|XP_002268915.2| PREDICTED: cytochrome P450 82C2 [Vitis vinifera]
Length=744

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L AMADKYGP+F IRLG  +  V+S+S++A+ECFTT+D+  +TR    AS+I+GY++
Sbjct  279  HKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFTTHDRVFSTRPSVTASKILGYDF  338

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  APYG YWR++RK V +ELLS  R+D L+  R   V  SI+ ++E W   +    G
Sbjct  339  AMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRASEVGTSIRELYEMWVSER-GTDG  397

Query  590  AVTVEMKQTF  619
             V V+MK+ F
Sbjct  398  RVFVDMKRWF  407



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 117/189 (62%), Gaps = 6/189 (3%)
 Frame = +2

Query  56   ISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHL  235
            +S +A  L L+F  C KL      K N     + AP+P GA PILGHLHLL    +  + 
Sbjct  7    LSAIAVFLTLIF--CFKLLLG-KQKTNADDKTRTAPQPKGAWPILGHLHLLGGSDQLLYR  63

Query  236  ILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTI  415
             L AMAD+YGP F IRLG++  FVVS+ ++AKECFT NDK+LA+R   +A++ MGYNY +
Sbjct  64   TLGAMADEYGPAFTIRLGSRCAFVVSSWELAKECFTINDKALASRPTTVAAKHMGYNYAV  123

Query  416  FAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAV  595
            F  APY P+WR++RK   LELLS RR++ L+  R   V   I+ ++    DN    +  V
Sbjct  124  FGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRISEVDMGIRELYSLRHDN---GSIPV  180

Query  596  TVEMKQTFD  622
             VE+KQ  +
Sbjct  181  LVELKQWLE  189



>ref|XP_003546624.1| PREDICTED: cytochrome P450 82A2-like [Glycine max]
Length=521

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L  +ADKYGPIF I+LGA+   V+SN ++AKEC+TTND ++++    +++ ++ 
Sbjct  56   KTPHKTLGDLADKYGPIFSIKLGAKNAVVISNWEMAKECYTTNDIAVSSLPNLISANLLC  115

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN ++  VAPYGPYWRQ+RK ++ E LS  R++ L   R   V+ SI  +F  W  NK+ 
Sbjct  116  YNRSMILVAPYGPYWRQMRKILMSEFLSPSRVEQLHHVRVSEVQNSITDLFGAWRSNKNV  175

Query  581  ATGAVTVEMKQTF  619
             +G   VE+KQ F
Sbjct  176  ESGCALVELKQWF  188



>ref|XP_002510297.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52484.1| cytochrome P450, putative [Ricinus communis]
Length=526

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 117/191 (61%), Gaps = 9/191 (5%)
 Frame = +2

Query  59   STLACTLVLLFF----LCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKP  226
            S L  T + +FF    LC+        K + G N + APEP+GA PI+GHL +L    K 
Sbjct  3    SLLELTTIAVFFSFIILCSAWLRGT--KRSRGSNVREAPEPAGAWPIIGHLRVLGGADKL  60

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
             H  L  MADKYGP F IR+G+ + FV+++ ++AKEC TTNDK++A+R    A+E M YN
Sbjct  61   LHKTLGLMADKYGPAFNIRIGSHRAFVIASKELAKECLTTNDKAVASRPTTAATERMCYN  120

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
            + +F  APY  +WR++RK V+ ELLS RR++ ++  +   V   +++++  W+DN     
Sbjct  121  HAVFGFAPYSSHWREMRKIVMFELLSNRRLEMVKNVQASEVDIGLRKLYNLWADN---GC  177

Query  587  GAVTVEMKQTF  619
              V VE+KQ F
Sbjct  178  LPVLVELKQWF  188



>gb|AGC29951.1| CYP82D61 [Sinopodophyllum hexandrum]
Length=453

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 3/122 (2%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MADKYGP+F+I LG QQ  VV+NS+IAKECFTTND+    RT  +A +IM YNY +F  A
Sbjct  1    MADKYGPVFKIHLGVQQALVVNNSEIAKECFTTNDRFFLNRTSGVAVKIMSYNYVMFGFA  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEM  607
            PYGPYWR +RK ++L+LLS RR+ SL+      +  S K +++ W   K        V+M
Sbjct  61   PYGPYWRDMRKIIMLDLLSKRRLQSLKHVWHSEISISSKELYKLWETQK---IDFCLVDM  117

Query  608  KQ  613
            KQ
Sbjct  118  KQ  119



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 88/135 (65%), Gaps = 3/135 (2%)
 Frame = +2

Query  224  PPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGY  403
            PPH+ LAAMADKYGP+F IRLG   + V+S+S+IAKECFTTND  L +R K    + +GY
Sbjct  57   PPHIKLAAMADKYGPLFTIRLGVYPSLVISSSEIAKECFTTNDLVLNSRPKLAVVDHIGY  116

Query  404  NYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS---DNK  574
            N  +F  AP GP+WR++RK   LELLS RR++ LR  R   V   ++ +F+ WS     +
Sbjct  117  NCAMFGFAPSGPFWREMRKITTLELLSNRRLELLRHIRVSEVTTFLQELFKTWSTAEKRE  176

Query  575  DAATGAVTVEMKQTF  619
               +  V VE+KQ F
Sbjct  177  SNNSDGVLVELKQWF  191



>ref|XP_003611841.1| Cytochrome P450 82A3 [Medicago truncatula]
 gb|AES94799.1| cytochrome P450 family protein [Medicago truncatula]
Length=320

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 85/130 (65%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L  MADK+GPIF I+LG+ +  V+S+S++AKECFT +DK+ +TR    AS++MGYNY
Sbjct  63   HKTLGMMADKHGPIFTIKLGSYKVLVLSSSEMAKECFTLHDKTFSTRPLVAASKLMGYNY  122

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F   PYGPYWR+IRK   LELLS  R++ L+  R   +  ++  ++  WS  K     
Sbjct  123  AMFGFTPYGPYWREIRKLATLELLSNHRLELLKDTRVSEIEAAVSELYRLWS-IKGCPKE  181

Query  590  AVTVEMKQTF  619
             V V+MKQ F
Sbjct  182  GVLVDMKQWF  191



>ref|XP_007047112.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91269.1| Cytochrome P450 [Theobroma cacao]
Length=691

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 86/130 (66%), Gaps = 1/130 (1%)
 Frame = +2

Query  230  HLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNY  409
            H  L AMADKYGP+F IRLG+    V+++ ++A+ECFT +DK  +TR    AS+++GYNY
Sbjct  221  HKTLGAMADKYGPVFSIRLGSHSALVLNSWEMARECFTVHDKVFSTRPVLTASKVLGYNY  280

Query  410  TIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATG  589
             +F  APYG YWR+IR+   +ELLS  RID L+  R   V+ +++ +++ W       TG
Sbjct  281  AMFGFAPYGSYWREIRRIATIELLSSHRIDMLKHIRASEVKTAVRELYKSWLSKGGGETG  340

Query  590  AVTVEMKQTF  619
             V V+MKQ F
Sbjct  341  -VLVDMKQWF  349



>ref|XP_002281431.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 119/181 (66%), Gaps = 8/181 (4%)
 Frame = +2

Query  80   VLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADK  259
            +L   +C  L +A  +K N GR+    PEPSGA P++GHLHLL A  KP H    AMAD+
Sbjct  15   ILFAIICLWLVNAKGNK-NKGRS---PPEPSGAWPVMGHLHLLGAD-KPLHRTFGAMADE  69

Query  260  YGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGP  439
            YGPIF IRLG +   VVS+S++AKEC+TT DK+LA R ++LA ++MGY + +FA   +GP
Sbjct  70   YGPIFSIRLGLRTALVVSSSEVAKECYTTKDKALANRPRSLAVKLMGYEHAMFAFERHGP  129

Query  440  YWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            YWR +R+  ++ELLS R+ + L+  R+  V   I+ ++  W DN  +    V V+MK+ F
Sbjct  130  YWRDVRRLAMVELLSNRQHEMLKHVRDSEVTFFIQELYGQWVDNGGS---PVLVDMKKKF  186

Query  620  D  622
            +
Sbjct  187  E  187



>emb|CBI19610.3| unnamed protein product [Vitis vinifera]
Length=933

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+ L  MADKYGPIF IRLG  +  VVS+ ++AKECFTTND +++ R K +A E +GYN
Sbjct  504  PHVTLGTMADKYGPIFTIRLGVHRALVVSSREVAKECFTTNDSAVSGRPKLVAPEHLGYN  563

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKD  577
            Y +FA +PY  YWR++RK V  ELLS RR++ L+  R   V  SIK +++ W++ K+
Sbjct  564  YAMFAFSPYDAYWREVRKIVNTELLSNRRLELLKDVRASEVETSIKELYKLWAEKKN  620



>ref|XP_006342717.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=527

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 111/172 (65%), Gaps = 2/172 (1%)
 Frame = +2

Query  107  LFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIRL  286
            +F   + K  N    K  PEP+GA PI+GHLHLL    +  +  L AMAD YGP F +RL
Sbjct  15   IFLYFIFKNKNYSTSKQVPEPAGAWPIIGHLHLLGGTEQLLYRTLGAMADNYGPAFNLRL  74

Query  287  GAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKTV  466
            G ++ FVVS+ ++AKECFT NDK+LA+R   +A++ MGY Y +F  APY P+WR++RK  
Sbjct  75   GTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSPFWREMRKIA  134

Query  467  VLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTFD  622
            + ELLS RR+D+L+  +   V   I+ +++ W DN   +   + VE+K+ F+
Sbjct  135  MFELLSNRRLDALKYVQVSEVDIGIQELYKLWVDNN--SDRPILVELKRWFE  184



>gb|KHN44000.1| Cytochrome P450 82A4 [Glycine soja]
Length=523

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            K PH  L A+A+K+GP+F I+LG ++  VVS+ ++A+ECFTTND +++ R K L +E+M 
Sbjct  60   KSPHKALGALAEKHGPLFTIKLGVKKALVVSDWEMARECFTTNDVAVSARPKLLVAELMC  119

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN  +  VAPYGPYWR++RK +V E+LS  R++ L+  R   V+ SI  +++ W   K+ 
Sbjct  120  YNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQLQDVRVSEVQNSIVELYDVWRSQKNE  179

Query  581  ATGAVTVEMKQTF  619
            +  A +VE+KQ F
Sbjct  180  SDYA-SVELKQWF  191



>ref|XP_007225086.1| hypothetical protein PRUPE_ppa017464mg, partial [Prunus persica]
 gb|EMJ26285.1| hypothetical protein PRUPE_ppa017464mg, partial [Prunus persica]
Length=519

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +P H+ L  +ADKYGPIF I+ G ++  VVS+S++AKEC  T+DK  ++R +++ SEI+G
Sbjct  43   EPLHMALGKLADKYGPIFTIKYGVERAVVVSSSEMAKECLKTHDKVFSSRVQSVVSEILG  102

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDN-KD  577
            YNY  FA + YG Y+ +I+K V+ EL S  RI+ L+  RE  V  SI+ ++E W+ N K 
Sbjct  103  YNYAFFAFSTYGRYFHEIKKKVMHELFSNHRIEMLKHVRESEVSTSIREIYEQWTKNKKS  162

Query  578  AATGAVTVEMKQTF  619
              +  V VEMK+ F
Sbjct  163  GGSNEVVVEMKEWF  176



>gb|KDP38436.1| hypothetical protein JCGZ_04361 [Jatropha curcas]
Length=503

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 115/175 (66%), Gaps = 6/175 (3%)
 Frame = +2

Query  107  LFHAIMHKPNNGRNQKV----APEPSgalpilghlhlliaggKPPHLILAAMADKYGPIF  274
            L +++  K    R+ K+     PEP+G LP++GHLHLL    +PPH+ L  MA+K GPI+
Sbjct  22   LIYSLFTKSKKARDNKIRLPLPPEPTGRLPVIGHLHLLGGS-QPPHITLEKMAEKIGPIY  80

Query  275  RIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQI  454
             I+LG  +  +VS+ ++ KECFTTNDK+ A R KAL  ++M Y+Y +F  +PYG YWR++
Sbjct  81   SIKLGVHRALIVSSWEMVKECFTTNDKAFAYRPKALFLDVMSYDYAMFGASPYGDYWREM  140

Query  455  RKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTF  619
            RK   LELLS RR++ L+  RE  V+++ + +++ W  NK+ +   + VEM + F
Sbjct  141  RKIATLELLSVRRLELLKHVRETEVKEATEGLYQGWLKNKN-SNNKLEVEMIKWF  194



>ref|XP_012071746.1| PREDICTED: cytochrome P450 82C4-like [Jatropha curcas]
 gb|KDP38431.1| hypothetical protein JCGZ_04356 [Jatropha curcas]
Length=504

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  MA+K GPI+ I+LG  +  +VS+ ++ KECFTTNDK+ A R KAL  ++M 
Sbjct  63   QPPHITLEKMAEKIGPIYSIKLGVHRALIVSSWEMVKECFTTNDKAFAYRPKALFLDVMS  122

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            Y+Y +F  +PYG YWR++RK   LELLS RR++ L+  RE  V+++ + +++ W  NK+ 
Sbjct  123  YDYAMFGASPYGDYWREMRKIATLELLSVRRLELLKHVRETEVKEATEGLYQGWLKNKN-  181

Query  581  ATGAVTVEMKQTF  619
            +   + VEM + F
Sbjct  182  SNNKLEVEMIKWF  194



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 2/157 (1%)
 Frame = +2

Query  107  LFHAIMHKPNNGRNQKV--APEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRI  280
            +F+A++ +    ++ K   APEP GA PI+GHLHLL  G +  +  L AMADKYGP F I
Sbjct  19   VFYAMLGRKKIIKSSKSRDAPEPGGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNI  78

Query  281  RLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRK  460
            RLG+++ FVVS+ ++AKECFT NDK+LATR   +A++ MGYNY +F  APY P+WR++RK
Sbjct  79   RLGSRRAFVVSSWEVAKECFTINDKALATRPTTVAAKHMGYNYAVFGFAPYSPFWREMRK  138

Query  461  TVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDN  571
               LELLS RR++ L+  R   V   I+ ++  W  N
Sbjct  139  IATLELLSNRRLEILKHVRTSEVDMGIRELYGLWVKN  175



>gb|AFK38862.1| unknown [Lotus japonicus]
Length=534

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 89/134 (66%), Gaps = 3/134 (2%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            +PPH+ L  +ADKYGPIF +RLG  +T VVSN ++AKECFT NDK+ ATR K LA+EI+ 
Sbjct  62   QPPHITLGNIADKYGPIFTLRLGVHRTLVVSNWEMAKECFTVNDKAFATRPKTLANEIVA  121

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
             N+  F   PYG YWR ++K   +E+LS +R + L+   E  V+ ++K  ++ W   K++
Sbjct  122  KNF--FGFVPYGSYWRDVKKIATVEVLSAKRTEMLKHVMESEVKAAMKDSYDSWEKMKES  179

Query  581  ATGAVTV-EMKQTF  619
             T  V V EM++ F
Sbjct  180  GTEKVVVTEMEKWF  193



>ref|XP_004147804.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis sativus]
 gb|KGN59913.1| hypothetical protein Csa_3G852620 [Cucumis sativus]
Length=526

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 121/200 (61%), Gaps = 11/200 (6%)
 Frame = +2

Query  23   LSPPCNNIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlh  202
            +  P + +  +I  LA  + LLF         IM + +    +++ PEP GA P++GHLH
Sbjct  1    MEQPSHAVAGVIFALAFIIYLLF---------IMSRRSVAHPKRLPPEPDGAWPVIGHLH  51

Query  203  lliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKAL  382
            LL A  +P H+ LA MAD YGPIF  R G ++  +VSN +IAKECFTTND+  A+R K L
Sbjct  52   LLNAS-EPIHITLAKMADVYGPIFTFRFGTKRALIVSNWEIAKECFTTNDRIFASRPKQL  110

Query  383  ASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFE-H  559
            AS+++ Y+Y + A +PY P+WR +RK  +L L + +RI+ L   R   V   +K +++ +
Sbjct  111  ASKLLAYDYAMMAFSPYNPHWRYVRKLAMLGLFTNQRIEQLEHVRVVEVHSWMKELYDLY  170

Query  560  WSDNKDAATGAVTVEMKQTF  619
            W  N +  +  V VEMK+ F
Sbjct  171  WLKNNNNKSEKVVVEMKKWF  190



>ref|XP_009336944.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 106/181 (59%), Gaps = 7/181 (4%)
 Frame = +2

Query  74   TLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMA  253
            T+ ++F+  ++ + A  HK       K++P  +     +     L  G  PPH+IL AMA
Sbjct  16   TVFIVFYYLSRRWRAANHK------GKLSPPEAKGGWPIFGHLHLFGGSTPPHIILGAMA  69

Query  254  DKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPY  433
            DKYGPIF IRLG   + V+S+S+ AKEC+TT D S+ +R K    + + YNY +F   P 
Sbjct  70   DKYGPIFTIRLGFHPSLVISSSESAKECYTTKDLSVLSRPKMAVVDHVSYNYAMFGFGPP  129

Query  434  GPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWS-DNKDAATGAVTVEMK  610
            GPYWR+IRK V LELLS R+++ L+  R   V   +K + E WS   K+ +   + VE+K
Sbjct  130  GPYWREIRKIVTLELLSVRKVELLKHIRVSEVATFLKELHELWSTKKKEGSEDRMVVELK  189

Query  611  Q  613
            Q
Sbjct  190  Q  190



>ref|NP_001240972.1| cytochrome P450 82A3 [Glycine max]
 sp|O49858.1|C82A3_SOYBN RecName: Full=Cytochrome P450 82A3; AltName: Full=Cytochrome 
P450 CP6 [Glycine max]
 emb|CAA71876.1| putative cytochrome P450 [Glycine max]
 gb|KHN13273.1| Cytochrome P450 82A3 [Glycine soja]
Length=527

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +2

Query  221  KPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMG  400
            + PH +L A+ADKYGP+F I+LG +   V+SN +++KE FTTND ++++R K +A E+M 
Sbjct  58   QTPHKVLGALADKYGPLFTIKLGMKPALVLSNWEMSKELFTTNDLAVSSRPKLVAVEVMS  117

Query  401  YNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDA  580
            YN     +APYGPYWR++RK V  E LS RRI+     R   VR SIK +F+ WS+    
Sbjct  118  YNQAFVGLAPYGPYWRELRKIVTFEFLSNRRIEQRNHIRVSEVRTSIKELFDIWSNGNKN  177

Query  581  ATGAVTVEMKQ  613
             +    V++KQ
Sbjct  178  ESRYTLVDIKQ  188



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (66%), Gaps = 4/173 (2%)
 Frame = +2

Query  104  KLFHAIMHKPNNGRNQKVAPEPSgalpilghlhlliaggKPPHLILAAMADKYGPIFRIR  283
            K FH    K +N R  + APEP+GA PI+GHLHLL  G +  +  L AMADK+GP F IR
Sbjct  15   KTFHD-GRKSSNVRKTQKAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIR  73

Query  284  LGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVAPYGPYWRQIRKT  463
            LG++  FVVS+ ++ KECFT NDK+LA+R K  A++ MGY+Y +F  APY P+WR++RK 
Sbjct  74   LGSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKI  133

Query  464  VVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVEMKQTFD  622
              LELLS RR+++L+  R   V   ++ ++  W+ N    +  V VE+K+  +
Sbjct  134  ATLELLSNRRLEALKHVRISEVDMGLRDLYGLWAKND---SRPVLVELKKWLE  183



>ref|XP_010026987.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=454

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +2

Query  248  MADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYNYTIFAVA  427
            MAD+ GPIF +R+G  Q  VVS S++ KECFT ND +L+TR + +A +I+GY+Y +F  A
Sbjct  1    MADQCGPIFTVRVGTFQALVVSGSEMVKECFTKNDIALSTRPRHVAQKILGYSYAMFPFA  60

Query  428  PYGPYWRQIRKTVVLELLSGRRIDS-LRPKREYHVRKSIKRMFEHWSDNKDAATGAVTVE  604
            PYGPYWR++RK V LELLS RR+ S L P +      +I+ + E W +NKD  +G V V+
Sbjct  61   PYGPYWREVRKMVTLELLSSRRVKSFLNPIQASEADVAIQELHELWIENKD-DSGHVIVD  119

Query  605  MKQTF  619
            +KQ F
Sbjct  120  LKQWF  124



>ref|XP_008220885.1| PREDICTED: cytochrome P450 82A3-like [Prunus mume]
Length=1017

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 120/210 (57%), Gaps = 25/210 (12%)
 Frame = +2

Query  11   TMDFLSPPCNNIITIISTLACTLVLLFFLCNKLFHAIMHKPNNGRNQKVAPEPSgalpil  190
            +MD+  P  N+I   + T+   +++ ++   +            R  K+AP  +     +
Sbjct  492  SMDYSLPYVNSITAFLFTI---IIVSYYFSRRW-----------RPAKLAPTEAKGAWPI  537

Query  191  ghlhlliaggKPPHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATR  370
                 L+ G  PPH+ LAAMADKYGP+F IRLG   + V+S+S+IAKECFTTND + ++R
Sbjct  538  FGHLPLLGGSTPPHIKLAAMADKYGPLFTIRLGVYPSLVISSSEIAKECFTTNDLASSSR  597

Query  371  TKALASEIMGYNYTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRM  550
             K +  E +GYN+ +F  AP GP+WR++RK   L+LLS RR++ LR  R   V   ++ +
Sbjct  598  PKLVVVEHVGYNHAMFGFAPSGPFWREMRKITTLKLLSNRRLELLRHIRVSEVTTFLQEL  657

Query  551  FEHW-------SDNKDAATGAVTVEMKQTF  619
            ++ W       S+N+D     V VE+KQ F
Sbjct  658  YKTWSTAEKRESNNRD----GVLVELKQWF  683


 Score =   127 bits (320),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = +2

Query  227  PHLILAAMADKYGPIFRIRLGAQQTFVVSNSKIAKECFTTNDKSLATRTKALASEIMGYN  406
            PH+ LA++ DKYGP F I +G     V+S  ++AK+CFTTND  +++R   L ++ +GYN
Sbjct  73   PHIALASLVDKYGPAFTINIGIHSALVISTWEVAKDCFTTNDMVVSSRPATLGAKHLGYN  132

Query  407  YTIFAVAPYGPYWRQIRKTVVLELLSGRRIDSLRPKREYHVRKSIKRMFEHWSDNKDAAT  586
            + +F  +PYGPYWR++RK   LELLS RR++ L+  R   V  S+K ++  W   K+ ++
Sbjct  133  FAMFGFSPYGPYWREMRKLTSLELLSNRRLELLKKVRVSEVEMSLKELYTLWIKRKE-SS  191

Query  587  GAVTVEMKQTF  619
            G   VEMK+ F
Sbjct  192  GERLVEMKRWF  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1977341620752