BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig726

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614932.1|  PREDICTED: polyribonucleotide nucleotidyltra...    151   5e-73   Nicotiana tomentosiformis
ref|XP_009768206.1|  PREDICTED: polyribonucleotide nucleotidyltra...    150   2e-72   Nicotiana sylvestris
emb|CDP02087.1|  unnamed protein product                                153   2e-72   Coffea canephora [robusta coffee]
ref|XP_006338583.1|  PREDICTED: polyribonucleotide nucleotidyltra...    151   3e-72   Solanum tuberosum [potatoes]
ref|XP_010316293.1|  PREDICTED: polyribonucleotide nucleotidyltra...    152   5e-72   Solanum lycopersicum
ref|XP_007217697.1|  hypothetical protein PRUPE_ppa000918mg             151   2e-69   Prunus persica
ref|XP_008341437.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...    149   5e-69   
ref|XP_009377194.1|  PREDICTED: polyribonucleotide nucleotidyltra...    149   9e-69   
ref|XP_008230570.1|  PREDICTED: polyribonucleotide nucleotidyltra...    150   2e-68   Prunus mume [ume]
ref|XP_008443548.1|  PREDICTED: polyribonucleotide nucleotidyltra...    146   2e-67   Cucumis melo [Oriental melon]
ref|XP_006446552.1|  hypothetical protein CICLE_v10014159mg             147   1e-66   Citrus clementina [clementine]
gb|KDO55206.1|  hypothetical protein CISIN_1g002054mg                   147   1e-66   Citrus sinensis [apfelsine]
ref|XP_011047330.1|  PREDICTED: polyribonucleotide nucleotidyltra...    150   1e-66   Populus euphratica
ref|XP_006470281.1|  PREDICTED: polyribonucleotide nucleotidyltra...    146   1e-66   Citrus sinensis [apfelsine]
ref|XP_004141096.1|  PREDICTED: polyribonucleotide nucleotidyltra...    150   2e-66   Cucumis sativus [cucumbers]
ref|XP_002300042.2|  hypothetical protein POPTR_0001s35070g             151   2e-66   
ref|XP_012081186.1|  PREDICTED: polyribonucleotide nucleotidyltra...    150   8e-66   Jatropha curcas
ref|XP_010248545.1|  PREDICTED: polyribonucleotide nucleotidyltra...    142   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010660886.1|  PREDICTED: polyribonucleotide nucleotidyltra...    149   1e-65   Vitis vinifera
ref|XP_010248546.1|  PREDICTED: polyribonucleotide nucleotidyltra...    142   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_004304642.1|  PREDICTED: polyribonucleotide nucleotidyltra...    144   2e-65   Fragaria vesca subsp. vesca
ref|XP_002524669.1|  polyribonucleotide nucleotidyltransferase, p...    148   1e-64   Ricinus communis
ref|XP_010940149.1|  PREDICTED: polyribonucleotide nucleotidyltra...    143   8e-64   Elaeis guineensis
ref|XP_007151009.1|  hypothetical protein PHAVU_004G011100g             150   1e-62   Phaseolus vulgaris [French bean]
ref|XP_010550151.1|  PREDICTED: polyribonucleotide nucleotidyltra...    145   4e-62   Tarenaya hassleriana [spider flower]
ref|XP_007031537.1|  Polyribonucleotide nucleotidyltransferase, p...    153   5e-62   
ref|XP_002873678.1|  hypothetical protein ARALYDRAFT_488299             145   1e-61   
ref|XP_010420100.1|  PREDICTED: polyribonucleotide nucleotidyltra...    145   1e-61   Camelina sativa [gold-of-pleasure]
ref|NP_196962.1|  polyribonucleotide nucleotidyltransferase             144   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492266.1|  PREDICTED: polyribonucleotide nucleotidyltra...    144   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010453582.1|  PREDICTED: polyribonucleotide nucleotidyltra...    145   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006399970.1|  hypothetical protein EUTSA_v10012572mg             141   2e-61   Eutrema salsugineum [saltwater cress]
gb|KFK25698.1|  hypothetical protein AALP_AA8G147400                    142   4e-61   Arabis alpina [alpine rockcress]
ref|XP_006289585.1|  hypothetical protein CARUB_v10003135mg             145   5e-61   Capsella rubella
ref|XP_010108800.1|  Polyribonucleotide nucleotidyltransferase          135   5e-61   
ref|XP_011098446.1|  PREDICTED: polyribonucleotide nucleotidyltra...    143   3e-60   Sesamum indicum [beniseed]
gb|EYU44773.1|  hypothetical protein MIMGU_mgv1a001063mg                145   3e-59   Erythranthe guttata [common monkey flower]
gb|KJB33814.1|  hypothetical protein B456_006G032100                    151   5e-59   Gossypium raimondii
ref|XP_008796014.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...    142   5e-59   
gb|KJB33815.1|  hypothetical protein B456_006G032100                    151   5e-59   Gossypium raimondii
gb|KJB33816.1|  hypothetical protein B456_006G032100                    151   5e-59   Gossypium raimondii
ref|XP_009131416.1|  PREDICTED: polyribonucleotide nucleotidyltra...    134   2e-58   Brassica rapa
emb|CDX78584.1|  BnaA03g04960D                                          134   3e-58   
emb|CDX70572.1|  BnaC03g06560D                                          135   3e-58   
emb|CDX69573.1|  BnaA10g19220D                                          137   5e-58   
ref|XP_009121656.1|  PREDICTED: polyribonucleotide nucleotidyltra...    139   5e-58   Brassica rapa
emb|CDY09870.1|  BnaC09g42910D                                          138   3e-57   Brassica napus [oilseed rape]
ref|XP_010665719.1|  PREDICTED: polyribonucleotide nucleotidyltra...    142   8e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010033299.1|  PREDICTED: polyribonucleotide nucleotidyltra...    140   7e-54   Eucalyptus grandis [rose gum]
ref|XP_009375164.1|  PREDICTED: polyribonucleotide nucleotidyltra...    148   2e-53   Pyrus x bretschneideri [bai li]
emb|CBI34890.3|  unnamed protein product                                149   2e-53   Vitis vinifera
ref|XP_003554809.1|  PREDICTED: polyribonucleotide nucleotidyltra...    146   2e-53   Glycine max [soybeans]
ref|XP_009380405.1|  PREDICTED: polyribonucleotide nucleotidyltra...    148   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004489245.1|  PREDICTED: polyribonucleotide nucleotidyltra...    139   2e-49   Cicer arietinum [garbanzo]
gb|EEC73607.1|  hypothetical protein OsI_08089                          138   9e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_002454178.1|  hypothetical protein SORBIDRAFT_04g026110          139   2e-47   Sorghum bicolor [broomcorn]
ref|XP_008643478.1|  PREDICTED: uncharacterized protein LOC100279...    138   4e-47   
ref|XP_006648841.1|  PREDICTED: polyribonucleotide nucleotidyltra...    137   8e-47   Oryza brachyantha
sp|Q6KAI0.1|PNP2_ORYSJ  RecName: Full=Polyribonucleotide nucleoti...    132   5e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EPS73358.1|  hypothetical protein M569_01398                         136   7e-43   Genlisea aurea
gb|AES74396.2|  polyribonucleotide nucleotidyltransferase               134   1e-42   Medicago truncatula
ref|XP_006833262.2|  PREDICTED: polyribonucleotide nucleotidyltra...    134   6e-42   Amborella trichopoda
gb|ERM98540.1|  hypothetical protein AMTR_s00113p00140210               134   6e-42   Amborella trichopoda
ref|XP_007031538.1|  Polyribonucleotide nucleotidyltransferase, p...    153   1e-38   
gb|EEE57382.1|  hypothetical protein OsJ_07542                          138   3e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EMT15535.1|  Polyribonucleotide nucleotidyltransferase               139   7e-34   
ref|XP_001782634.1|  predicted protein                                  118   9e-34   
ref|XP_004953116.1|  PREDICTED: polyribonucleotide nucleotidyltra...    139   1e-33   
gb|EMS68952.1|  Polyribonucleotide nucleotidyltransferase               138   4e-33   Triticum urartu
ref|XP_010235710.1|  PREDICTED: polyribonucleotide nucleotidyltra...    137   4e-33   Brachypodium distachyon [annual false brome]
ref|XP_002965413.1|  hypothetical protein SELMODRAFT_84724              124   1e-28   
ref|XP_002976027.1|  hypothetical protein SELMODRAFT_104548             122   6e-28   
ref|XP_003618178.1|  Polyribonucleotide nucleotidyltransferase          122   7e-28   
ref|WP_022005994.1|  polyribonucleotide nucleotidyltransferase        99.4    3e-27   
ref|WP_004181131.1|  Polyribonucleotide nucleotidyltransferase          105   3e-27   Nitrosospira lacus
ref|WP_028462090.1|  polynucleotide phosphorylase/polyadenylase         107   3e-27   Nitrosomonas cryotolerans
gb|ADI16912.1|  polyribonucleotide nucleotidyltransferase (polynu...  99.0    5e-27   uncultured gamma proteobacterium HF0010_16J05
ref|WP_022186711.1|  polyribonucleotide nucleotidyltransferase        99.8    8e-27   
ref|WP_040728507.1|  polynucleotide phosphorylase/polyadenylase       97.4    1e-26   Thiomicrorhabdus sp. Kp2
ref|WP_029407474.1|  polynucleotide phosphorylase/polyadenylase       97.1    1e-26   Thiomicrorhabdus sp. Milos-T2
ref|WP_022196653.1|  polyribonucleotide nucleotidyltransferase        99.8    1e-26   
ref|WP_025287634.1|  polynucleotide phosphorylase/polyadenylase         102   2e-26   Granulibacter bethesdensis
ref|WP_011633051.1|  polyribonucleotide nucleotidyltransferase          102   2e-26   Granulibacter bethesdensis
ref|WP_041067289.1|  polynucleotide phosphorylase/polyadenylase       96.3    2e-26   Thiolapillus brandeum
ref|WP_036560419.1|  polynucleotide phosphorylase/polyadenylase       97.1    2e-26   Oligella
ref|WP_018026459.1|  polynucleotide phosphorylase/polyadenylase       97.1    2e-26   Oligella urethralis
gb|EEZ79604.1|  Polyribonucleotide nucleotidyltransferase             96.3    2e-26   uncultured SUP05 cluster bacterium
ref|WP_028486478.1|  polynucleotide phosphorylase/polyadenylase       98.2    2e-26   Thiomicrorhabdus chilensis
ref|WP_038136585.1|  polynucleotide phosphorylase/polyadenylase       98.6    4e-26   Hydrogenovibrio sp. Milos-T1
ref|WP_011381841.1|  polyribonucleotide nucleotidyltransferase          106   4e-26   Nitrosospira multiformis
ref|WP_004260595.1|  polynucleotide phosphorylase/polyadenylase       95.9    5e-26   Thauera sp. 63
sp|Q31GJ9.1|PNP_THICR  RecName: Full=Polyribonucleotide nucleotid...  99.0    6e-26   Hydrogenovibrio crunogenus XCL-2
gb|AIL12790.1|  polynucleotide phosphorylase/polyadenylase            99.0    6e-26   Candidatus Paracaedimonas acanthamoebae
ref|WP_006474939.1|  polyribonucleotide nucleotidyltransferase        97.1    6e-26   endosymbiont of Tevnia jerichonana
emb|CCA84441.1|  polyribonucleotide nucleotidyltransferase            95.1    7e-26   Ralstonia syzygii R24
ref|WP_043108091.1|  polynucleotide phosphorylase/polyadenylase         101   7e-26   endosymbiont of unidentified scaly snail isolate Monju
ref|WP_045653504.1|  polynucleotide phosphorylase/polyadenylase       98.6    7e-26   
ref|WP_003272823.1|  polynucleotide phosphorylase/polyadenylase       95.1    7e-26   Ralstonia solanacearum
ref|WP_042548930.1|  polynucleotide phosphorylase/polyadenylase       95.1    7e-26   Ralstonia solanacearum
ref|WP_014616649.1|  polynucleotide phosphorylase/polyadenylase       95.1    7e-26   Ralstonia solanacearum
ref|WP_003261921.1|  polynucleotide phosphorylase/polyadenylase       95.1    7e-26   Ralstonia solanacearum
emb|CBJ50723.1|  Polyribonucleotide nucleotidyltransferase            95.1    7e-26   Ralstonia solanacearum PSI07
ref|WP_015467428.1|  Polyribonucleotide nucleotidyltransferase        95.1    8e-26   Micavibrio aeruginosavorus
ref|WP_014102652.1|  polynucleotide phosphorylase                     95.1    8e-26   Micavibrio aeruginosavorus
ref|WP_014834137.1|  polynucleotide phosphorylase/polyadenylase       95.5    9e-26   Pseudomonas aeruginosa
ref|WP_020748132.1|  Polyribonucleotide nucleotidyltransferase        94.7    1e-25   Ralstonia solanacearum
ref|WP_018410895.1|  polynucleotide phosphorylase/polyadenylase       97.1    1e-25   
ref|WP_033947553.1|  polynucleotide phosphorylase/polyadenylase       95.5    1e-25   Pseudomonas aeruginosa
ref|WP_028499888.1|  polynucleotide phosphorylase/polyadenylase       98.2    1e-25   Microvirgula
ref|WP_038530324.1|  polynucleotide phosphorylase/polyadenylase       94.0    1e-25   Azospirillum brasilense
ref|WP_014238841.1|  polynucleotide phosphorylase                     94.0    1e-25   Azospirillum brasilense
ref|WP_035670107.1|  polynucleotide phosphorylase/polyadenylase       94.0    1e-25   Azospirillum
ref|WP_034619147.1|  polynucleotide phosphorylase/polyadenylase       97.4    1e-25   
ref|WP_024916751.1|  polyribonucleotide nucleotidyltransferase        95.1    1e-25   Pseudomonas aeruginosa
ref|WP_011001999.1|  polyribonucleotide nucleotidyltransferase        94.4    1e-25   Ralstonia
ref|WP_016727045.1|  polynucleotide phosphorylase/polyadenylase       94.4    1e-25   Ralstonia solanacearum
ref|WP_016722935.1|  polynucleotide phosphorylase/polyadenylase       94.4    1e-25   Ralstonia
ref|WP_011737843.1|  polyribonucleotide nucleotidyltransferase        94.4    1e-25   Candidatus Ruthia magnifica
ref|WP_029010755.1|  polynucleotide phosphorylase/polyadenylase       94.4    1e-25   Azospirillum halopraeferens
ref|WP_013835409.1|  polynucleotide phosphorylase/polyadenylase       97.1    1e-25   Thiomicrospira cyclica
ref|WP_045845301.1|  polynucleotide phosphorylase/polyadenylase       98.2    1e-25   Aquitalea
ref|WP_018605804.1|  polynucleotide phosphorylase/polyadenylase       97.8    1e-25   Uliginosibacterium gangwonense
ref|WP_039597857.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-25   Ralstonia sp. A12
ref|WP_045206183.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-25   Burkholderiaceae bacterium 26
ref|WP_024975286.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-25   Ralstonia
ref|WP_004332750.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-25   Thauera linaloolentis
ref|WP_033374647.1|  polynucleotide phosphorylase/polyadenylase         101   1e-25   
ref|WP_018402066.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-25   
ref|WP_024300413.1|  polynucleotide phosphorylase/polyadenylase       97.1    2e-25   
ref|WP_004630820.1|  polyribonucleotide nucleotidyltransferase        94.7    2e-25   Ralstonia pickettii
ref|WP_037027177.1|  polynucleotide phosphorylase/polyadenylase       94.7    2e-25   Ralstonia sp. UNC404CL21Col
ref|WP_024851033.1|  polynucleotide phosphorylase/polyadenylase       98.6    2e-25   Hydrogenovibrio kuenenii
ref|WP_022372624.1|  polyribonucleotide nucleotidyltransferase        94.7    2e-25   
ref|WP_036294238.1|  polynucleotide phosphorylase/polyadenylase         102   2e-25   Methylobacter whittenburyi
ref|WP_012762310.1|  polynucleotide phosphorylase/polyadenylase       94.7    2e-25   Ralstonia pickettii
ref|WP_029937973.1|  polynucleotide phosphorylase/polyadenylase       98.2    2e-25   Piscirickettsiaceae
ref|WP_009241068.1|  MULTISPECIES: polynucleotide phosphorylase/p...  94.4    2e-25   Ralstonia
gb|EFP65152.1|  polyribonucleotide nucleotidyltransferase             94.4    2e-25   Ralstonia pickettii
ref|WP_012436068.1|  MULTISPECIES: polyribonucleotide nucleotidyl...  94.4    2e-25   Ralstonia pickettii
ref|WP_013417766.1|  polynucleotide phosphorylase                     94.7    2e-25   Rhodomicrobium vannielii
ref|WP_037233498.1|  polynucleotide phosphorylase/polyadenylase       94.7    2e-25   Rhodomicrobium udaipurense
ref|WP_027467582.1|  polynucleotide phosphorylase/polyadenylase       99.8    2e-25   Deefgea rivuli
ref|WP_028681348.1|  MULTISPECIES: polynucleotide phosphorylase/p...  94.4    2e-25   Pseudomonas aeruginosa
ref|WP_036257881.1|  polynucleotide phosphorylase/polyadenylase       96.3    2e-25   Methylocapsa aurea
emb|CKI17185.1|  polynucleotide phosphorylase/polyadenylase           94.4    2e-25   Pseudomonas aeruginosa
ref|WP_034082159.1|  polynucleotide phosphorylase/polyadenylase       94.4    2e-25   Pseudomonas aeruginosa
ref|WP_033941628.1|  polyribonucleotide nucleotidyltransferase        94.4    2e-25   Pseudomonas aeruginosa
ref|WP_003100524.1|  polyribonucleotide nucleotidyltransferase        94.4    2e-25   Pseudomonas aeruginosa
ref|WP_024972481.1|  polynucleotide phosphorylase/polyadenylase       94.0    2e-25   Ralstonia pickettii
ref|WP_003095181.1|  MULTISPECIES: polyribonucleotide nucleotidyl...  94.4    2e-25   Pseudomonas
ref|WP_034039209.1|  polynucleotide phosphorylase/polyadenylase       94.4    2e-25   Pseudomonas aeruginosa
ref|WP_003148740.1|  polyribonucleotide nucleotidyltransferase        94.4    2e-25   Pseudomonas aeruginosa
gb|ADI16603.1|  polyribonucleotide nucleotidyltransferase (polynu...    101   3e-25   uncultured gamma proteobacterium HF0010_01E20
ref|WP_031640855.1|  polynucleotide phosphorylase/polyadenylase       94.4    3e-25   Pseudomonas aeruginosa
dbj|GAN59430.1|  polynucleotide phosphorylase/polyadenylase           97.1    3e-25   Acetobacter cibinongensis 4H-1
ref|WP_007419106.1|  polynucleotide phosphorylase/polyadenylase       97.1    3e-25   Idiomarina sp. A28L
dbj|GAN79291.1|  polynucleotide phosphorylase/polyadenylase           99.0    3e-25   Acidocella aminolytica 101 = DSM 11237
sp|B2ICY4.1|PNP_BEII9  RecName: Full=Polyribonucleotide nucleotid...  94.7    3e-25   Beijerinckia indica subsp. indica ATCC 9039
ref|WP_011311205.1|  polyribonucleotide nucleotidyltransferase        99.0    3e-25   Thiobacillus denitrificans
ref|WP_041778179.1|  polynucleotide phosphorylase/polyadenylase       94.7    3e-25   Beijerinckia indica
ref|WP_036183478.1|  polynucleotide phosphorylase/polyadenylase       93.2    3e-25   Marinobacterium sp. AK27
ref|WP_018913972.1|  polynucleotide phosphorylase/polyadenylase       92.8    3e-25   Thiomonas sp. FB-6
ref|WP_012697394.1|  polyribonucleotide nucleotidyltransferase        98.6    3e-25   Laribacter hongkongensis
gb|EGK73007.1|  Polyribonucleotide nucleotidyltransferase             95.9    3e-25   Methyloversatilis universalis FAM5
ref|WP_029143708.1|  polynucleotide phosphorylase/polyadenylase       95.9    3e-25   
ref|WP_015435870.1|  polynucleotide phosphorylase/polyadenylase       95.1    3e-25   Azoarcus sp. KH32C
ref|WP_019896234.1|  polynucleotide phosphorylase/polyadenylase       95.5    3e-25   Hydrogenovibrio halophilus
ref|WP_028310327.1|  polynucleotide phosphorylase/polyadenylase       93.2    3e-25   Derxia gummosa
ref|WP_006459029.1|  polynucleotide phosphorylase/polyadenylase       97.1    3e-25   Thiomicrospira aerophila
ref|WP_021194995.1|  polynucleotide phosphorylase/polyadenylase       95.1    3e-25   Ralstonia
emb|CBW75684.1|  Polyribonucleotide nucleotidyltransferase (EC 2....  94.4    4e-25   Paraburkholderia rhizoxinica HKI 454
gb|AET89543.1|  polynucleotide phosphorylase/polyadenylase            95.5    4e-25   Burkholderia sp. YI23
ref|WP_026861866.1|  polynucleotide phosphorylase/polyadenylase       94.7    4e-25   Idiomarina sediminum
dbj|GAN67206.1|  polynucleotide phosphorylase/polyadenylase           97.1    4e-25   Acetobacter orientalis 21F-2
ref|WP_002926546.1|  polynucleotide phosphorylase/polyadenylase       94.7    4e-25   Thauera sp. 28
ref|WP_034032426.1|  polynucleotide phosphorylase/polyadenylase       94.4    4e-25   
ref|WP_004322622.1|  MULTISPECIES: polynucleotide phosphorylase/p...  94.7    4e-25   Thauera
ref|WP_002936676.1|  polynucleotide phosphorylase/polyadenylase       94.7    4e-25   Thauera sp. 27
ref|WP_039611535.1|  polynucleotide phosphorylase/polyadenylase       99.0    4e-25   Pseudoalteromonas luteoviolacea
dbj|GAK34768.1|  polyribonucleotide nucleotidyltransferase            94.4    4e-25   alpha proteobacterium Q-1
ref|WP_011110817.1|  polyribonucleotide nucleotidyltransferase          104   4e-25   Nitrosomonas europaea
ref|WP_024006976.1|  polynucleotide phosphorylase/polyadenylase       95.9    4e-25   Advenella kashmirensis
ref|WP_028466285.1|  polynucleotide phosphorylase/polyadenylase       94.0    4e-25   Nisaea denitrificans
ref|WP_029908832.1|  polynucleotide phosphorylase/polyadenylase       98.6    4e-25   Hydrogenovibrio marinus
ref|WP_031799034.1|  polynucleotide phosphorylase/polyadenylase       94.4    4e-25   Pseudomonas aeruginosa
ref|WP_034732575.1|  polynucleotide phosphorylase/polyadenylase       94.7    4e-25   Idiomarina atlantica
ref|WP_019682251.1|  polynucleotide phosphorylase/polyadenylase       94.0    4e-25   Pseudomonas aeruginosa
ref|WP_041042005.1|  polynucleotide phosphorylase/polyadenylase       95.5    4e-25   Magnetospirillum magnetotacticum
ref|WP_031767157.1|  polynucleotide phosphorylase/polyadenylase       94.4    4e-25   
ref|WP_021248994.1|  polynucleotide phosphorylase/polyadenylase       95.5    5e-25   Thauera terpenica
ref|WP_011239110.1|  polyribonucleotide nucleotidyltransferase        95.5    5e-25   Aromatoleum aromaticum
ref|WP_023397668.1|  polyribonucleotide nucleotidyltransferase        99.0    5e-25   Pseudoalteromonas luteoviolacea
ref|WP_021995951.1|  polyribonucleotide nucleotidyltransferase        95.5    5e-25   
ref|WP_018989817.1|  polynucleotide phosphorylase/polyadenylase       95.9    5e-25   Azoarcus toluclasticus
ref|WP_005430395.1|  polynucleotide phosphorylase/polyadenylase       95.5    5e-25   Sutterella wadsworthensis
ref|WP_045787218.1|  polynucleotide phosphorylase/polyadenylase       94.7    5e-25   Ralstonia mannitolilytica
ref|WP_004999830.1|  polynucleotide phosphorylase/polyadenylase       99.4    5e-25   Nitrococcus mobilis
ref|WP_004382555.1|  polynucleotide phosphorylase/polyadenylase       94.4    5e-25   Thauera phenylacetica
ref|WP_008171541.1|  MULTISPECIES: polynucleotide phosphorylase/p...  89.4    5e-25   Marinobacter
ref|WP_026606468.1|  polynucleotide phosphorylase/polyadenylase       93.6    6e-25   Methylocapsa acidiphila
ref|WP_007421553.1|  MULTISPECIES: polynucleotide phosphorylase       95.9    6e-25   
sp|A5FVG2.1|PNP_ACICJ  RecName: Full=Polyribonucleotide nucleotid...  95.9    6e-25   Acidiphilium cryptum JF-5
ref|WP_011765834.1|  polyribonucleotide nucleotidyltransferase        97.4    6e-25   Azoarcus
ref|WP_011484169.1|  polyribonucleotide nucleotidyltransferase        94.7    6e-25   Polaromonas sp. JS666
ref|WP_043512933.1|  polynucleotide phosphorylase/polyadenylase       94.0    6e-25   Halomonas sp. BC04
ref|WP_033157375.1|  polynucleotide phosphorylase/polyadenylase       98.2    6e-25   Methylomonas
ref|WP_017432542.1|  polynucleotide phosphorylase/polyadenylase       95.5    6e-25   Burkholderia glumae
gb|EWH02122.1|  polynucleotide phosphorylase/polyadenylase            94.0    6e-25   Halomonas sp. BC04
ref|WP_031798811.1|  polynucleotide phosphorylase/polyadenylase       93.6    6e-25   
gb|ADP98827.1|  polynucleotide phosphorylase/polyadenylase            89.0    6e-25   Marinobacter adhaerens HP15
ref|WP_008542529.1|  polynucleotide phosphorylase/polyadenylase       97.1    7e-25   Sutterella parvirubra
gb|KEI73163.1|  polynucleotide phosphorylase/polyadenylase            91.7    7e-25   Endozoicomonas elysicola
gb|EDZ64685.1|  polyribonucleotide nucleotidyltransferase               104   7e-25   beta proteobacterium KB13
ref|WP_040872619.1|  polynucleotide phosphorylase/polyadenylase         104   7e-25   beta proteobacterium KB13
ref|WP_023950582.1|  polynucleotide phosphorylase/polyadenylase       98.2    7e-25   Pelistega indica
ref|WP_011386466.1|  polyribonucleotide nucleotidyltransferase        95.5    7e-25   Magnetospirillum magneticum
ref|WP_033402998.1|  polynucleotide phosphorylase/polyadenylase       91.3    7e-25   
ref|WP_042088160.1|  polynucleotide phosphorylase/polyadenylase       94.4    7e-25   alpha proteobacterium Q-1
ref|WP_012326153.1|  polyribonucleotide nucleotidyltransferase        98.6    7e-25   Shewanella
ref|WP_026199929.1|  polynucleotide phosphorylase/polyadenylase       95.9    8e-25   Acetobacter aceti
gb|EXI91453.1|  Polyribonucleotide nucleotidyltransferase             99.0    8e-25   Candidatus Accumulibacter sp. BA-94
ref|WP_004272030.1|  polynucleotide phosphorylase                     95.9    8e-25   Nitrospirillum amazonense
ref|WP_008616456.1|  polynucleotide phosphorylase/polyadenylase       95.5    8e-25   Magnetospirillum caucaseum
dbj|GAN75960.1|  polynucleotide phosphorylase/polyadenylase           99.4    8e-25   Acidisphaera rubrifaciens HS-AP3
ref|WP_004186494.1|  polyribonucleotide nucleotidyltransferase        94.7    8e-25   Burkholderia mallei
ref|WP_044564269.1|  polynucleotide phosphorylase/polyadenylase       94.7    9e-25   
ref|WP_042146075.1|  polynucleotide phosphorylase/polyadenylase       99.8    9e-25   Pseudoalteromonas
ref|WP_022955534.1|  polynucleotide phosphorylase/polyadenylase       98.2    9e-25   Perlucidibaca piscinae
ref|WP_007864483.1|  polynucleotide phosphorylase/polyadenylase       94.4    9e-25   Polaromonas
ref|WP_025371943.1|  polynucleotide phosphorylase/polyadenylase       95.5    9e-25   Advenella mimigardefordensis
ref|WP_025386564.1|  polynucleotide phosphorylase/polyadenylase       96.3    9e-25   Legionella
ref|WP_010625695.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   
ref|WP_013260951.1|  polynucleotide phosphorylase/polyadenylase         100   1e-24   gamma proteobacterium HdN1
ref|WP_035516321.1|  polynucleotide phosphorylase/polyadenylase       95.1    1e-24   Burkholderia sp. Ch1-1
ref|WP_046005484.1|  polynucleotide phosphorylase/polyadenylase       97.8    1e-24   Pseudoalteromonas rubra
ref|WP_045581303.1|  polynucleotide phosphorylase/polyadenylase       94.0    1e-24   Azospirillum thiophilum
gb|EIF32392.1|  polyribonucleotide nucleotidyltransferase             95.1    1e-24   Burkholderia sp. Ch1-1
ref|WP_008493131.1|  MULTISPECIES: polynucleotide phosphorylase       97.1    1e-24   Acidocella
ref|WP_041187840.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_038746153.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_038727056.1|  MULTISPECIES: polyribonucleotide nucleotidyl...  94.7    1e-24   Burkholderia pseudomallei
sp|B2T2E3.1|PNP_BURPP  RecName: Full=Polyribonucleotide nucleotid...  95.1    1e-24   Paraburkholderia phytofirmans PsJN
ref|WP_041758343.1|  polynucleotide phosphorylase/polyadenylase       95.1    1e-24   Paraburkholderia phytofirmans
ref|WP_038788407.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_037488558.1|  polynucleotide phosphorylase/polyadenylase       99.4    1e-24   
ref|WP_006025098.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia
ref|WP_015876543.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia glumae
ref|WP_038777114.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_044490053.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_038759645.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_004522416.1|  MULTISPECIES: polynucleotide phosphorylase/p...  94.7    1e-24   Burkholderia pseudomallei
ref|WP_004533637.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_010385051.1|  polynucleotide phosphorylase/polyadenylase       97.4    1e-24   Pseudoalteromonas rubra
gb|KKB68870.1|  polyribonucleotide nucleotidyltransferase             94.7    1e-24   Burkholderia pseudomallei MSHR1079
ref|WP_044356098.1|  polyribonucleotide nucleotidyltransferase        94.7    1e-24   
ref|WP_038756977.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_004526459.1|  MULTISPECIES: polyribonucleotide nucleotidyl...  94.7    1e-24   Burkholderia
ref|WP_038771652.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_011814531.1|  polyribonucleotide nucleotidyltransferase        98.6    1e-24   Halorhodospira halophila
ref|WP_029208897.1|  polynucleotide phosphorylase/polyadenylase       92.4    1e-24   
ref|WP_006156842.1|  polynucleotide phosphorylase/polyadenylase       94.4    1e-24   Cupriavidus basilensis
ref|WP_034998015.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Beijerinckia mobilis
ref|WP_043299822.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   
ref|WP_004538572.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia pseudomallei
ref|WP_040461223.1|  polynucleotide phosphorylase/polyadenylase       94.0    1e-24   Halomonas stevensii
ref|WP_033084355.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Colwellia psychrerythraea
ref|WP_039181354.1|  polynucleotide phosphorylase/polyadenylase       94.0    1e-24   Halomonas hydrothermalis
ref|WP_008489910.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Idiomarina xiamenensis
ref|WP_018266721.1|  polynucleotide phosphorylase                     95.1    1e-24   Methylosinus sp. LW4
ref|WP_022958513.1|  polynucleotide phosphorylase/polyadenylase       91.7    1e-24   Spongiibacter tropicus
ref|WP_010091187.1|  polynucleotide phosphorylase/polyadenylase       95.1    1e-24   Burkholderia ubonensis
gb|ETE24598.1|  polynucleotide phosphorylase/polyadenylase            89.0    1e-24   
ref|WP_042625604.1|  polynucleotide phosphorylase/polyadenylase       94.7    1e-24   Burkholderia plantarii
ref|WP_036296398.1|  polynucleotide phosphorylase/polyadenylase       95.1    1e-24   Methylosinus sp. PW1
gb|AIA74785.1|  polynucleotide phosphorylase/polyadenylase            94.0    1e-24   Halomonas campaniensis
ref|WP_042585919.1|  polynucleotide phosphorylase/polyadenylase       95.1    1e-24   Burkholderia
gb|ERJ34515.1|  Polyribonucleotide nucleotidyltransferase             95.1    1e-24   Burkholderia sp. AU4i
ref|WP_019027815.1|  polynucleotide phosphorylase/polyadenylase       93.2    1e-24   Colwellia piezophila
ref|WP_038480720.1|  polynucleotide phosphorylase/polyadenylase       94.0    1e-24   Halomonas
gb|EKD45241.1|  hypothetical protein ACD_70C00007G0002                  100   1e-24   
ref|WP_035868717.1|  polynucleotide phosphorylase/polyadenylase       94.4    1e-24   
ref|WP_009723733.1|  polynucleotide phosphorylase/polyadenylase       94.0    1e-24   
emb|CDS54381.1|  Polyribonucleotide nucleotidyltransferase            94.4    1e-24   
ref|WP_024878741.1|  MULTISPECIES: polynucleotide phosphorylase/p...  95.1    1e-24   
ref|WP_016474953.1|  polyribonucleotide nucleotidyltransferase        95.5    1e-24   
ref|WP_015767792.1|  polynucleotide phosphorylase/polyadenylase         100   1e-24   
ref|WP_026344328.1|  polynucleotide phosphorylase/polyadenylase       95.1    1e-24   
gb|AAF83052.1|AE003877_7  polynucleotide phosphorylase                89.0    1e-24   
ref|WP_019085202.1|  polynucleotide phosphorylase                     95.1    1e-24   
ref|WP_037445780.1|  polynucleotide phosphorylase/polyadenylase       93.6    1e-24   
sp|A5CWW8.1|PNP_VESOH  RecName: Full=Polyribonucleotide nucleotid...  90.1    1e-24   
ref|WP_005347480.1|  polynucleotide phosphorylase/polyadenylase       97.8    1e-24   
ref|WP_031403999.1|  polynucleotide phosphorylase/polyadenylase       90.1    1e-24   
ref|WP_029135017.1|  polynucleotide phosphorylase/polyadenylase       99.4    1e-24   
ref|WP_041191915.1|  polynucleotide phosphorylase/polyadenylase       90.1    1e-24   
ref|WP_026044557.1|  polynucleotide phosphorylase/polyadenylase       95.1    1e-24   
ref|WP_003614793.1|  polynucleotide phosphorylase                     94.4    1e-24   
ref|WP_045238152.1|  polynucleotide phosphorylase/polyadenylase       94.4    1e-24   
ref|WP_014751467.1|  polynucleotide phosphorylase/polyadenylase       95.5    1e-24   
ref|WP_028534923.1|  polynucleotide phosphorylase/polyadenylase       96.7    1e-24   
ref|WP_038709570.1|  polynucleotide phosphorylase/polyadenylase       95.1    1e-24   
ref|WP_044428459.1|  polynucleotide phosphorylase/polyadenylase       93.6    1e-24   
ref|WP_018877169.1|  MULTISPECIES: polynucleotide phosphorylase/p...  97.8    1e-24   
ref|WP_042700039.1|  polynucleotide phosphorylase/polyadenylase       93.6    2e-24   
ref|WP_043302055.1|  polynucleotide phosphorylase/polyadenylase       94.4    2e-24   
ref|WP_018867807.1|  MULTISPECIES: polynucleotide phosphorylase/p...  97.8    2e-24   
ref|WP_018934782.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_010509166.1|  polynucleotide phosphorylase                     95.1    2e-24   
ref|WP_008134625.1|  MULTISPECIES: polynucleotide phosphorylase/p...  95.5    2e-24   
ref|WP_025439776.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_007378500.1|  polyribonucleotide nucleotidyltransferase        95.5    2e-24   
ref|WP_011800821.1|  polyribonucleotide nucleotidyltransferase        94.7    2e-24   
ref|WP_019569072.1|  polynucleotide phosphorylase/polyadenylase       95.5    2e-24   
ref|WP_029934670.1|  polynucleotide phosphorylase/polyadenylase       93.2    2e-24   
dbj|GAA07660.1|  polyribonucleotide nucleotidyltransferase RNA bi...  97.4    2e-24   
ref|WP_031595449.1|  polynucleotide phosphorylase/polyadenylase       98.2    2e-24   
ref|WP_034773860.1|  polynucleotide phosphorylase/polyadenylase       94.7    2e-24   
ref|WP_009100926.1|  polynucleotide phosphorylase/polyadenylase       93.6    2e-24   
ref|WP_018946342.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_045479171.1|  polynucleotide phosphorylase/polyadenylase         100   2e-24   
dbj|BAP55478.1|  polynucleotide phosphorylase/polyadenylase           99.8    2e-24   
dbj|GAN67887.1|  polynucleotide phosphorylase/polyadenylase           95.1    2e-24   
ref|WP_005875552.1|  polynucleotide phosphorylase/polyadenylase       93.2    2e-24   
ref|WP_028491364.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_019021184.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_039736642.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_030074111.1|  polynucleotide phosphorylase/polyadenylase       93.6    2e-24   
ref|WP_043549309.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_018869941.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_019590683.1|  MULTISPECIES: polynucleotide phosphorylase/p...  95.1    2e-24   
ref|WP_036813644.1|  polynucleotide phosphorylase/polyadenylase       94.4    2e-24   
ref|WP_019589331.1|  MULTISPECIES: polynucleotide phosphorylase/p...  95.1    2e-24   
ref|WP_029524380.1|  polynucleotide phosphorylase/polyadenylase       94.4    2e-24   
gb|EAY68347.1|  Polyribonucleotide nucleotidyltransferase             94.4    2e-24   
ref|WP_028874740.1|  polynucleotide phosphorylase/polyadenylase       94.4    2e-24   
ref|WP_013106545.1|  Polyribonucleotide nucleotidyltransferase (P...  93.6    2e-24   
emb|CDW93084.1|  polynucleotide phosphorylase/polyadenylase           94.0    2e-24   
ref|WP_034926867.1|  MULTISPECIES: polynucleotide phosphorylase/p...  95.1    2e-24   
ref|WP_010514734.1|  polynucleotide phosphorylase                     95.1    2e-24   
ref|WP_035381302.1|  polynucleotide phosphorylase/polyadenylase       97.1    2e-24   
ref|WP_018979986.1|  polynucleotide phosphorylase                     98.6    2e-24   
ref|WP_029311466.1|  polynucleotide phosphorylase/polyadenylase       94.7    2e-24   
ref|WP_038500773.1|  polynucleotide phosphorylase/polyadenylase       98.2    2e-24   
dbj|GAN63632.1|  polynucleotide phosphorylase/polyadenylase           97.1    2e-24   
ref|WP_025731805.1|  polynucleotide phosphorylase/polyadenylase       94.4    2e-24   
ref|WP_011352703.1|  polyribonucleotide nucleotidyltransferase        95.1    2e-24   
ref|WP_043188858.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
gb|AFJ86405.1|  Polyribonucleotide nucleotidyltransferase             95.1    2e-24   
ref|WP_034184883.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_011885539.1|  MULTISPECIES: polyribonucleotide nucleotidyl...  95.1    2e-24   
ref|WP_019936391.1|  polynucleotide phosphorylase/polyadenylase       93.2    2e-24   
ref|WP_038456640.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_027784988.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
emb|CCD38988.1|  Polyribonucleotide nucleotidyltransferase            94.4    2e-24   
ref|WP_013123816.1|  polynucleotide phosphorylase/polyadenylase       93.6    2e-24   
ref|WP_034207970.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_034178497.1|  MULTISPECIES: polyribonucleotide nucleotidyl...  95.1    2e-24   
ref|WP_006484896.1|  polyribonucleotide nucleotidyltransferase        95.1    2e-24   
sp|Q142H7.1|PNP_BURXL  RecName: Full=Polyribonucleotide nucleotid...  95.1    2e-24   
ref|WP_042977387.1|  polynucleotide phosphorylase/polyadenylase       94.7    2e-24   
ref|WP_027786866.1|  polynucleotide phosphorylase/polyadenylase       94.7    2e-24   
ref|WP_029077186.1|  polynucleotide phosphorylase/polyadenylase       95.9    2e-24   
gb|AFT74511.1|  polynucleotide phosphorylase/polyadenylase            95.1    2e-24   
ref|WP_020407739.1|  polynucleotide phosphorylase/polyadenylase       92.4    2e-24   
ref|WP_038466727.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
gb|EHL95553.1|  polyribonucleotide nucleotidyltransferase             98.2    2e-24   
ref|WP_044844667.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_039370587.1|  polyribonucleotide nucleotidyltransferase        95.1    2e-24   
ref|WP_006756898.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_011545817.1|  polyribonucleotide nucleotidyltransferase        95.1    2e-24   
ref|WP_031401916.1|  MULTISPECIES: polynucleotide phosphorylase/p...  94.7    2e-24   
gb|ESS38327.1|  Polyribonucleotide nucleotidyltransferase             95.1    2e-24   
gb|AFS37287.1|  polynucleotide phosphorylase/polyadenylase            95.1    2e-24   
gb|KDV26498.1|  polynucleotide phosphorylase/polyadenylase            95.1    2e-24   
ref|WP_012328908.1|  polyribonucleotide nucleotidyltransferase        95.1    2e-24   
ref|WP_011657486.1|  polyribonucleotide nucleotidyltransferase        95.1    2e-24   
ref|WP_017374889.1|  polynucleotide phosphorylase/polyadenylase       96.3    2e-24   
ref|WP_019560378.1|  polynucleotide phosphorylase/polyadenylase       93.2    2e-24   
gb|AFT78308.1|  polynucleotide phosphorylase/polyadenylase            95.1    2e-24   
ref|WP_008250522.1|  polynucleotide phosphorylase/polyadenylase       90.5    2e-24   
ref|WP_042443290.1|  polynucleotide phosphorylase/polyadenylase       93.6    2e-24   
ref|WP_037429689.1|  polynucleotide phosphorylase/polyadenylase       99.4    2e-24   
ref|WP_006750454.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_010102511.1|  polynucleotide phosphorylase/polyadenylase       94.7    2e-24   
ref|WP_014896499.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
ref|WP_028133640.1|  polynucleotide phosphorylase/polyadenylase       94.0    2e-24   
ref|WP_039915283.1|  polynucleotide phosphorylase/polyadenylase       95.1    2e-24   
gb|KDE38719.1|  Polyribonucleotide nucleotidyltransferase             93.6    2e-24   
ref|WP_040127856.1|  polynucleotide phosphorylase/polyadenylase       94.4    2e-24   
gb|EGD02631.1|  polynucleotide phosphorylase/polyadenylase            94.4    2e-24   
dbj|BAI73501.1|  polyribonucleotide nucleotidyltransferase            93.6    2e-24   
ref|WP_028761446.1|  polynucleotide phosphorylase/polyadenylase       99.0    2e-24   
ref|WP_036549454.1|  polynucleotide phosphorylase/polyadenylase       93.6    2e-24   
ref|WP_043344729.1|  polynucleotide phosphorylase/polyadenylase       94.0    3e-24   
ref|WP_027546823.1|  polynucleotide phosphorylase/polyadenylase       94.0    3e-24   
ref|WP_006405567.1|  polynucleotide phosphorylase/polyadenylase       94.4    3e-24   
ref|WP_045989550.1|  polynucleotide phosphorylase/polyadenylase       94.7    3e-24   
ref|WP_039492205.1|  polynucleotide phosphorylase/polyadenylase       94.7    3e-24   
ref|WP_006082711.1|  polyribonucleotide nucleotidyltransferase        99.0    3e-24   
gb|KHD08943.1|  polynucleotide phosphorylase/polyadenylase            95.5    3e-24   
ref|WP_012589317.1|  polyribonucleotide nucleotidyltransferase        92.8    3e-24   
ref|WP_031336189.1|  polynucleotide phosphorylase/polyadenylase       89.0    3e-24   
gb|EGC09194.1|  polyribonucleotide nucleotidyltransferase             96.3    3e-24   
ref|WP_038747269.1|  polynucleotide phosphorylase/polyadenylase       94.7    3e-24   
ref|WP_012486121.1|  polyribonucleotide nucleotidyltransferase        95.1    3e-24   
ref|WP_035972042.1|  polynucleotide phosphorylase/polyadenylase       94.4    3e-24   
ref|WP_012089919.1|  polyribonucleotide nucleotidyltransferase        99.0    3e-24   
ref|WP_018041068.1|  hypothetical protein                             99.0    3e-24   
ref|WP_034190837.1|  polynucleotide phosphorylase/polyadenylase       94.7    3e-24   
ref|WP_031337508.1|  polyribonucleotide nucleotidyltransferase        89.0    3e-24   
ref|WP_008131784.1|  polynucleotide phosphorylase                     94.0    3e-24   
ref|WP_006410113.1|  polyribonucleotide nucleotidyltransferase        94.4    3e-24   
gb|EEE01560.1|  polyribonucleotide nucleotidyltransferase             94.4    3e-24   
ref|WP_010370826.1|  MULTISPECIES: polynucleotide phosphorylase/p...  94.7    3e-24   
ref|WP_043569483.1|  polynucleotide phosphorylase/polyadenylase       99.0    3e-24   
ref|WP_012587034.1|  polyribonucleotide nucleotidyltransferase        99.0    3e-24   
ref|WP_040144678.1|  polynucleotide phosphorylase/polyadenylase       95.1    3e-24   
ref|WP_011083601.1|  MULTISPECIES: polyribonucleotide nucleotidyl...  94.0    3e-24   
ref|WP_039718324.1|  polynucleotide phosphorylase/polyadenylase       99.0    3e-24   
ref|WP_034900527.1|  polynucleotide phosphorylase/polyadenylase       98.2    3e-24   
ref|WP_009892189.1|  polyribonucleotide nucleotidyltransferase        94.4    3e-24   
gb|EJZ35767.1|  polynucleotide phosphorylase/polyadenylase            93.6    3e-24   
gb|ABN62714.1|  Polyribonucleotide nucleotidyltransferase             99.0    3e-24   
ref|WP_028104325.1|  polynucleotide phosphorylase/polyadenylase       91.3    3e-24   
ref|WP_009908706.1|  polyribonucleotide nucleotidyltransferase        94.4    3e-24   
ref|WP_014147432.1|  polynucleotide phosphorylase/polyadenylase       97.4    3e-24   
ref|WP_043830512.1|  polynucleotide phosphorylase/polyadenylase       98.2    3e-24   
ref|WP_027021831.1|  polynucleotide phosphorylase/polyadenylase       98.6    3e-24   
ref|WP_014105876.1|  polynucleotide phosphorylase                     95.1    3e-24   
ref|WP_017840499.1|  polynucleotide phosphorylase/polyadenylase       97.1    3e-24   
ref|WP_028172517.1|  MULTISPECIES: polynucleotide phosphorylase/p...  94.0    3e-24   
gb|AEK62888.1|  Polyribonucleotide nucleotidyltransferase             91.3    3e-24   
ref|WP_044619054.1|  polynucleotide phosphorylase/polyadenylase       91.7    3e-24   
dbj|GAN44023.1|  polynucleotide phosphorylase/polyadenylase           92.0    3e-24   
ref|WP_040886428.1|  polynucleotide phosphorylase/polyadenylase       92.0    3e-24   
ref|WP_014249208.1|  polynucleotide phosphorylase                     93.6    3e-24   
ref|WP_025041332.1|  polynucleotide phosphorylase/polyadenylase         106   3e-24   
emb|CAM10001.1|  putative polyribonucleotide nucleotidyltransferase   97.8    3e-24   
ref|WP_011327690.1|  polyribonucleotide nucleotidyltransferase        95.5    3e-24   
ref|WP_007016554.1|  polynucleotide phosphorylase/polyadenylase       94.4    3e-24   
ref|WP_018319413.1|  polynucleotide phosphorylase                     94.0    3e-24   
ref|WP_013535495.1|  polynucleotide phosphorylase/polyadenylase       92.0    3e-24   
ref|WP_024338557.1|  polynucleotide phosphorylase/polyadenylase       93.6    3e-24   
ref|WP_042333864.1|  polynucleotide phosphorylase/polyadenylase       99.0    3e-24   
ref|WP_036859535.1|  polynucleotide phosphorylase/polyadenylase       92.0    3e-24   
ref|WP_015046833.1|  polynucleotide phosphorylase/polyadenylase       93.6    3e-24   
gb|EGG78264.1|  Polyribonucleotide nucleotidyltransferase             94.4    3e-24   
ref|WP_018875898.1|  MULTISPECIES: polynucleotide phosphorylase/p...  96.3    3e-24   
ref|WP_028176494.1|  polynucleotide phosphorylase/polyadenylase       93.6    3e-24   
ref|WP_035704285.1|  polynucleotide phosphorylase/polyadenylase       93.6    3e-24   
ref|WP_028997523.1|  polynucleotide phosphorylase/polyadenylase       94.0    4e-24   
gb|EWS54172.1|  Polyribonucleotide nucleotidyltransferase             93.6    4e-24   
ref|WP_018182279.1|  polynucleotide phosphorylase                     94.7    4e-24   
ref|WP_020911395.1|  Polyribonucleotide nucleotidyltransferase        97.1    4e-24   
emb|CQW67504.1|  polynucleotide phosphorylase/polyadenylase           95.9    4e-24   
ref|WP_012031354.1|  polyribonucleotide nucleotidyltransferase        94.4    4e-24   
ref|WP_041098334.1|  polynucleotide phosphorylase/polyadenylase       95.1    4e-24   
ref|WP_025860822.1|  polynucleotide phosphorylase/polyadenylase       96.3    4e-24   
ref|WP_028780655.1|  polynucleotide phosphorylase/polyadenylase       97.4    4e-24   
ref|WP_025009937.1|  MULTISPECIES: polynucleotide phosphorylase/p...  97.4    4e-24   
ref|WP_003617031.1|  polynucleotide phosphorylase                     95.1    4e-24   
ref|WP_007343844.1|  polynucleotide phosphorylase/polyadenylase       96.7    4e-24   
ref|WP_035566987.1|  polynucleotide phosphorylase/polyadenylase       95.5    4e-24   
gb|AEZ47008.1|  hypothetical protein STBHUCCB_33840                   95.9    4e-24   
ref|WP_038921684.1|  polynucleotide phosphorylase/polyadenylase       95.9    4e-24   
ref|WP_038900265.1|  polynucleotide phosphorylase/polyadenylase       95.9    4e-24   
ref|WP_027852956.1|  polynucleotide phosphorylase/polyadenylase       92.8    4e-24   
ref|WP_035671358.1|  polynucleotide phosphorylase/polyadenylase       93.6    4e-24   
emb|CBV44017.1|  polynucleotide phosphorylase/polyadenylase           92.0    4e-24   
ref|WP_022964557.1|  polynucleotide phosphorylase/polyadenylase       97.1    4e-24   
ref|WP_007229755.1|  polynucleotide phosphorylase/polyadenylase       90.1    4e-24   
ref|WP_041602240.1|  polynucleotide phosphorylase/polyadenylase       92.0    4e-24   
ref|WP_042046762.1|  polynucleotide phosphorylase/polyadenylase       97.4    4e-24   
ref|WP_035813387.1|  polynucleotide phosphorylase/polyadenylase       92.0    4e-24   
ref|WP_013316325.1|  polynucleotide phosphorylase/polyadenylase       95.9    4e-24   
ref|WP_024591623.1|  MULTISPECIES: polynucleotide phosphorylase/p...  95.5    4e-24   
ref|WP_007585511.1|  MULTISPECIES: polynucleotide phosphorylase/p...  95.5    4e-24   
ref|WP_039033644.1|  polynucleotide phosphorylase/polyadenylase       97.4    4e-24   
ref|WP_040452728.1|  polynucleotide phosphorylase/polyadenylase       89.7    4e-24   
ref|WP_026879138.1|  polynucleotide phosphorylase/polyadenylase       94.7    4e-24   
ref|WP_010989243.1|  polyribonucleotide nucleotidyltransferase        95.9    4e-24   
gb|EEE46221.1|  3' exoribonuclease family, domain 2                   89.7    4e-24   
ref|WP_022632132.1|  Polyribonucleotide nucleotidyltransferase        95.9    4e-24   
ref|WP_011071439.1|  polyribonucleotide nucleotidyltransferase        97.4    4e-24   
ref|WP_008165875.1|  polynucleotide phosphorylase/polyadenylase       95.5    4e-24   
ref|WP_044629478.1|  polynucleotide phosphorylase/polyadenylase       93.6    4e-24   
ref|WP_040292269.1|  polynucleotide phosphorylase/polyadenylase       98.6    4e-24   
ref|WP_043115670.1|  polynucleotide phosphorylase/polyadenylase       99.4    5e-24   
ref|WP_003624193.1|  polynucleotide phosphorylase                     95.1    5e-24   
gb|AJZ59981.1|  polyribonucleotide nucleotidyltransferase             95.5    5e-24   
ref|WP_016353041.1|  polynucleotide phosphorylase/polyadenylase       96.3    5e-24   
ref|WP_032113480.1|  polynucleotide phosphorylase/polyadenylase         100   5e-24   
gb|ERF84557.1|  polyribonucleotide nucleotidyltransferase             92.0    5e-24   
ref|WP_019088548.1|  polynucleotide phosphorylase                     95.1    5e-24   
ref|WP_006115377.1|  polynucleotide phosphorylase                     95.1    5e-24   
ref|WP_025496080.1|  polynucleotide phosphorylase/polyadenylase       95.5    5e-24   
ref|WP_024606291.1|  polynucleotide phosphorylase/polyadenylase       95.5    5e-24   
ref|WP_024593891.1|  polynucleotide phosphorylase/polyadenylase       95.5    5e-24   
ref|WP_042275099.1|  polynucleotide phosphorylase/polyadenylase       95.5    5e-24   
ref|WP_040183912.1|  polynucleotide phosphorylase/polyadenylase       93.6    5e-24   



>ref|XP_009614932.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Nicotiana tomentosiformis]
Length=981

 Score =   151 bits (382),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MASV +K NPL+  +P+VLTW+RFGFRTICSGR+GFA ST  S +      +AG K+LE+
Sbjct  1    MASVRNKVNPLL--IPYVLTWRRFGFRTICSGRIGFAPSTSPSFADADTPPVAGKKVLET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS+KG  +  F
Sbjct  59   FAEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASSKGDAARDF  109


 Score =   150 bits (379),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GDA RDFLPLTVDYQEKQFAQG+IP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GF
Sbjct  101  SKGDAARDFLPLTVDYQEKQFAQGVIPTTYMRREGAPKERELLCGRLIDRPIRPLFPSGF  160

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSSDG
Sbjct  161  YHEVQVMASVLSSDG  175



>ref|XP_009768206.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Nicotiana sylvestris]
Length=981

 Score =   150 bits (379),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GDA RDFLPLTVDYQEKQFAQG+IP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GF
Sbjct  101  SKGDAARDFLPLTVDYQEKQFAQGVIPTTYMRREGAPKERELLCGRLIDRPIRPLFPSGF  160

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSSDG
Sbjct  161  YHEVQVMASVLSSDG  175


 Score =   149 bits (377),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MASV +K NPL+  +P+VLTW+RFGFRTICS R+GFA ST  S +      +AG KILE+
Sbjct  1    MASVRNKVNPLL--IPYVLTWRRFGFRTICSSRIGFAPSTSPSFADADTPPVAGKKILET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS+KG  +  F
Sbjct  59   FAEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASSKGDAARDF  109



>emb|CDP02087.1| unnamed protein product [Coffea canephora]
Length=972

 Score =   153 bits (386),  Expect(2) = 2e-72, Method: Composition-based stats.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 5/110 (5%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlssps-----sdsetHMAGT  311
            MASV+SKANPLISTLPH+LTW RF FRT+CSGRLGFA+ + SS S       SET +AGT
Sbjct  1    MASVSSKANPLISTLPHILTWPRFRFRTMCSGRLGFASYSSSSTSASVSPVTSETPVAGT  60

Query  312  KILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            K+LE+F EEFEIGSR ITLETGKIARFANG+VVLAM+ETKVLSTVASAKG
Sbjct  61   KVLETFKEEFEIGSRPITLETGKIARFANGAVVLAMEETKVLSTVASAKG  110


 Score =   147 bits (370),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GD VRDFLPLTV+YQEKQFAQG+IP+T+MRREGAPKERELLCGRLIDRPIRPLFP GFY
Sbjct  109  KGDGVRDFLPLTVEYQEKQFAQGVIPNTYMRREGAPKERELLCGRLIDRPIRPLFPPGFY  168

Query  637  HEVQVMASVLSSDG  678
            HEVQVMASVLSSDG
Sbjct  169  HEVQVMASVLSSDG  182



>ref|XP_006338583.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Solanum tuberosum]
Length=977

 Score =   151 bits (382),  Expect(2) = 3e-72, Method: Composition-based stats.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MASV +K NPL+  LP+VLTW+RFGFRTICSGRLGFA ST  S +      +AGTK+LE+
Sbjct  1    MASVRNKINPLLCNLPYVLTWRRFGFRTICSGRLGFAPSTSPSMADTDTP-VAGTKVLET  59

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            F EEFEIGSRKITLETGKIARFANGSV+LAM+ETKVLSTVAS+KG
Sbjct  60   FAEEFEIGSRKITLETGKIARFANGSVILAMEETKVLSTVASSKG  104


 Score =   147 bits (372),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 67/75 (89%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GDA+RDFLPLTVDYQEKQFAQ +IP+T+MRREGAPKERELLCGRLIDRPIRPLFP GF
Sbjct  102  SKGDAIRDFLPLTVDYQEKQFAQSVIPTTYMRREGAPKERELLCGRLIDRPIRPLFPPGF  161

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSSDG
Sbjct  162  YHEVQVMASVLSSDG  176



>ref|XP_010316293.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Solanum lycopersicum]
Length=983

 Score =   152 bits (385),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MASV +K NPL+  LP+VLTW+RFGFRTICSGRLGFA ST  S ++     +A TK+LE+
Sbjct  1    MASVRNKINPLLCNLPYVLTWRRFGFRTICSGRLGFAPSTSPSVANTDTP-VARTKVLET  59

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            FTEEFEIGSRKITLETGKIARFANGSV+LAM+ETKVLSTVAS+KG   S F
Sbjct  60   FTEEFEIGSRKITLETGKIARFANGSVILAMEETKVLSTVASSKGDAISDF  110


 Score =   145 bits (367),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDA+ DFLPLTVDYQEKQFAQ +IP+T+MRREGAPKERELLCGRLIDRPIRPLFP GFY
Sbjct  103  KGDAISDFLPLTVDYQEKQFAQSVIPTTYMRREGAPKERELLCGRLIDRPIRPLFPPGFY  162

Query  637  HEVQVMASVLSSDG  678
            HEVQVMASVLSSDG
Sbjct  163  HEVQVMASVLSSDG  176



>ref|XP_007217697.1| hypothetical protein PRUPE_ppa000918mg [Prunus persica]
 gb|EMJ18896.1| hypothetical protein PRUPE_ppa000918mg [Prunus persica]
Length=962

 Score =   151 bits (381),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TFMRREGAPKERELLCGR+IDRPIRPLFPAGFY
Sbjct  102  KGDAVRDFLPLTVDYQEKQFAQGVIPNTFMRREGAPKERELLCGRIIDRPIRPLFPAGFY  161

Query  637  HEVQVMASVLSSDG  678
            HEVQV ASVLSSDG
Sbjct  162  HEVQVTASVLSSDG  175


 Score =   139 bits (349),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MAS+ ++ANPL++ LPH LTW+  GFRTICSGR+GF++ +      +S   +AGTK+LE+
Sbjct  1    MASMANRANPLLNNLPHFLTWRALGFRTICSGRMGFSSQSQRQLDPESP--VAGTKVLET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            F EEFEIG R ITLE+GKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  59   FKEEFEIGDRLITLESGKIARFANGAVVLGMEETKVLSTVAAAKG  103



>ref|XP_008341437.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial [Malus domestica]
Length=945

 Score =   149 bits (377),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TFMRREGAPKERELLCGR+IDRPIRPLFPAGF+
Sbjct  102  KGDAVRDFLPLTVDYQEKQFAQGVIPNTFMRREGAPKERELLCGRIIDRPIRPLFPAGFF  161

Query  637  HEVQVMASVLSSDG  678
            HEVQV ASVLSSDG
Sbjct  162  HEVQVTASVLSSDG  175


 Score =   139 bits (350),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MAS+ ++ANPL++ LPH LTW+  GFRTICSGR+GF++ +   P  ++   +AGTK+LE+
Sbjct  1    MASMANRANPLLNNLPHFLTWRALGFRTICSGRMGFSSQSERQPDPETP--VAGTKVLET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            F EEFE+G R ITLETGKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  59   FREEFEVGDRLITLETGKIARFANGAVVLGMEETKVLSTVAAAKG  103



>ref|XP_009377194.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Pyrus x bretschneideri]
Length=944

 Score =   149 bits (375),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDAVRDFLPLTVDYQEKQFAQG IP+TFMRREGAPKERELLCGR+IDRPIRPLFPAGF+
Sbjct  102  KGDAVRDFLPLTVDYQEKQFAQGAIPNTFMRREGAPKERELLCGRIIDRPIRPLFPAGFF  161

Query  637  HEVQVMASVLSSDG  678
            HEVQV ASVLSSDG
Sbjct  162  HEVQVTASVLSSDG  175


 Score =   139 bits (350),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MAS+ ++ANPL++ LPH LTW+  GFRTICSGR+GF++ +   P   +   +AGTK+LE+
Sbjct  1    MASMANRANPLLNNLPHFLTWRALGFRTICSGRMGFSSQSERQPDPQTP--VAGTKVLET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            F EEFE+G R ITLETGKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  59   FREEFEVGDRLITLETGKIARFANGAVVLGMEETKVLSTVAAAKG  103



>ref|XP_008230570.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Prunus mume]
Length=963

 Score =   150 bits (380),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TFMRREGAPKERELLCGR+IDRPIRPLFPAGFY
Sbjct  102  KGDAVRDFLPLTVDYQEKQFAQGVIPNTFMRREGAPKERELLCGRIIDRPIRPLFPAGFY  161

Query  637  HEVQVMASVLSSDG  678
            HEVQV ASVLSSDG
Sbjct  162  HEVQVTASVLSSDG  175


 Score =   136 bits (342),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 85/105 (81%), Gaps = 2/105 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MA + ++ANPL++ LPH LTW+  GFRTICSGR+GF++ +      +S   +AGTK+LE+
Sbjct  1    MAFMANRANPLLNNLPHFLTWRALGFRTICSGRMGFSSQSQRQLDPESP--VAGTKVLET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            F EEFEIG R ITLE+GKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  59   FKEEFEIGDRLITLESGKIARFANGAVVLGMEETKVLSTVAAAKG  103



>ref|XP_008443548.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Cucumis melo]
Length=1026

 Score =   146 bits (369),  Expect(2) = 2e-67, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +G AVRDFLPLTVDYQEKQFAQG+IP TF RREGAPKERELLCGR+IDRPIRPLFP GFY
Sbjct  104  KGGAVRDFLPLTVDYQEKQFAQGVIPGTFTRREGAPKERELLCGRIIDRPIRPLFPTGFY  163

Query  637  HEVQVMASVLSSDG  678
            HEVQVMASVLSSDG
Sbjct  164  HEVQVMASVLSSDG  177


 Score =   137 bits (344),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MAS+ SKANPL ST+PH LTW+  GFRTIC GR+GFA+ + S    D +T + GTK+LE+
Sbjct  1    MASMASKANPLFSTIPHFLTWRSHGFRTICCGRMGFASQSQSQQQLDPDTTLGGTKVLET  60

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            F E FEIGSR + LETGKIARFANG+ VL ++ETKVLSTVASAKG
Sbjct  61   FEEVFEIGSRLVKLETGKIARFANGAAVLGIEETKVLSTVASAKG  105



>ref|XP_006446552.1| hypothetical protein CICLE_v10014159mg [Citrus clementina]
 gb|ESR59792.1| hypothetical protein CICLE_v10014159mg [Citrus clementina]
Length=973

 Score =   147 bits (370),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GD+VRDFLPLTVDYQEKQFAQG+IP+T+MRREGAPKERELL GR+IDRPIRPLFPAGFY
Sbjct  102  KGDSVRDFLPLTVDYQEKQFAQGVIPNTYMRREGAPKERELLVGRIIDRPIRPLFPAGFY  161

Query  637  HEVQVMASVLSSDG  678
            HEVQVMASVLSSDG
Sbjct  162  HEVQVMASVLSSDG  175


 Score =   134 bits (337),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ +K +PL++ LP  LTW+  GFRTICSGRLGFA    + P+      +AGTK+LE+
Sbjct  1    MSSLATKTHPLLNNLPPFLTWRALGFRTICSGRLGFAPCEPAPPTPAPS--VAGTKVLET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            F EEFEIGSR ITLETGKIARFANG+VVL MDETKVLSTV S+KG
Sbjct  59   FKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKG  103



>gb|KDO55206.1| hypothetical protein CISIN_1g002054mg [Citrus sinensis]
Length=974

 Score =   147 bits (370),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 67/75 (89%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GD+VRDFLPLTVDYQEKQFAQG+IP+T+MRREGAPKERELL GR+IDRPIRPLFPAGF
Sbjct  101  SKGDSVRDFLPLTVDYQEKQFAQGVIPNTYMRREGAPKERELLVGRIIDRPIRPLFPAGF  160

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSSDG
Sbjct  161  YHEVQVMASVLSSDG  175


 Score =   134 bits (337),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ +K +PL++ LP  LTW+  GFRTICSGRLGFA    + P+      +AGTK+LE+
Sbjct  1    MSSLATKTHPLLNNLPPFLTWRALGFRTICSGRLGFAPCEPAPPTPAPS--VAGTKVLET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            F EEFEIGSR ITLETGKIARFANG+VVL MDETKVLSTV S+KG
Sbjct  59   FKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKG  103



>ref|XP_011047330.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Populus euphratica]
Length=965

 Score =   150 bits (380),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GD+VRDFLPLTVDYQEKQFAQG+IPST++RREGAPKERELLCGRLIDRPIRPLFPAGF
Sbjct  102  SKGDSVRDFLPLTVDYQEKQFAQGVIPSTYLRREGAPKERELLCGRLIDRPIRPLFPAGF  161

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMAS+LSSDG
Sbjct  162  YHEVQVMASILSSDG  176


 Score =   130 bits (326),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 71/109 (65%), Positives = 82/109 (75%), Gaps = 5/109 (5%)
 Frame = +3

Query  135  LKPIMASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTK  314
            +  IMA+  S++NPL+++LP  LTW+  GFRTICSGRLGFA S        S    AGTK
Sbjct  1    MPSIMAA--SRSNPLLNSLPRFLTWRSLGFRTICSGRLGFAPSDPDPEPPVST---AGTK  55

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
             LE+F EEFEIGSR IT ETGKIARFANGSVVL M+ETKVLSTV S+KG
Sbjct  56   FLETFREEFEIGSRLITFETGKIARFANGSVVLGMEETKVLSTVTSSKG  104



>ref|XP_006470281.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Citrus sinensis]
Length=974

 Score =   146 bits (369),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 67/75 (89%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GD+VRDFLPLTVDYQEKQFAQG+IP+T+MRREGAPKERELL GR+IDRPIRPLFPAGF
Sbjct  101  SKGDSVRDFLPLTVDYQEKQFAQGVIPNTYMRREGAPKERELLVGRIIDRPIRPLFPAGF  160

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSSDG
Sbjct  161  YHEVQVMASVLSSDG  175


 Score =   134 bits (336),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ +K +PL++ LP  LTW+  GFRTICSGRLGFA    + P+      +AGTK+LE+
Sbjct  1    MSSLATKTHPLLNNLPPFLTWRALGFRTICSGRLGFAPCEPAPPTPAPS--VAGTKVLET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            F EEFEIGSR ITLETGKIARFANG+VVL MDETKVLSTV S+KG
Sbjct  59   FKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKG  103



>ref|XP_004141096.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Cucumis sativus]
 gb|KGN59689.1| hypothetical protein Csa_3G838680 [Cucumis sativus]
Length=1032

 Score =   150 bits (379),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDA RDFLPLTVDYQEKQFAQG+IP TF RREGAPKERELLCGR+IDRPIRPLFPAGFY
Sbjct  102  KGDAARDFLPLTVDYQEKQFAQGVIPGTFTRREGAPKERELLCGRIIDRPIRPLFPAGFY  161

Query  637  HEVQVMASVLSSDG  678
            HEVQVMASVLSSDG
Sbjct  162  HEVQVMASVLSSDG  175


 Score =   130 bits (326),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MAS+ +KANPL ST+PH LTW+  GFRTIC GR+GF++ +      ++   +  TK+LE+
Sbjct  1    MASMATKANPLFSTIPHFLTWRSLGFRTICCGRMGFSSQSQQQVDPNTT--LGRTKVLET  58

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F E FEIGSR + LETGKIARFANG+ VL ++ETKVLSTVASAKG  +  F
Sbjct  59   FEEVFEIGSRLVKLETGKIARFANGAAVLGIEETKVLSTVASAKGDAARDF  109



>ref|XP_002300042.2| hypothetical protein POPTR_0001s35070g [Populus trichocarpa]
 gb|EEE84847.2| hypothetical protein POPTR_0001s35070g [Populus trichocarpa]
Length=961

 Score =   151 bits (381),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GD+VRDFLPLTVDYQEKQFAQG+IPST++RREGAPKERELLCGRLIDRPIRPLFPAGF
Sbjct  98   SKGDSVRDFLPLTVDYQEKQFAQGVIPSTYLRREGAPKERELLCGRLIDRPIRPLFPAGF  157

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSSDG
Sbjct  158  YHEVQVMASVLSSDG  172


 Score =   129 bits (323),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 68/100 (68%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = +3

Query  162  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  341
            S++NPL+++LP  LTW+  GFRTICSGRLGFA S        S    AGTK LE+F EEF
Sbjct  4    SRSNPLLNSLPRFLTWRSLGFRTICSGRLGFAPSDPDPEPPVST---AGTKFLETFREEF  60

Query  342  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            EIGSR IT ETGKIARFANGSVVL M+ETKVLSTV S+KG
Sbjct  61   EIGSRLITFETGKIARFANGSVVLGMEETKVLSTVTSSKG  100



>ref|XP_012081186.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Jatropha curcas]
 gb|KDP45314.1| hypothetical protein JCGZ_09563 [Jatropha curcas]
Length=938

 Score =   150 bits (380),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GD+VRDFLPLTVDYQEKQFAQG+IP TFMRREGAPKERELLCGR+IDRPIRPLFPAGFY
Sbjct  100  KGDSVRDFLPLTVDYQEKQFAQGVIPHTFMRREGAPKERELLCGRIIDRPIRPLFPAGFY  159

Query  637  HEVQVMASVLSSDG  678
            HEVQVMASVLSSDG
Sbjct  160  HEVQVMASVLSSDG  173


 Score =   127 bits (319),  Expect(2) = 8e-66, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 82/108 (76%), Gaps = 10/108 (9%)
 Frame = +3

Query  147  MASVTSK---ANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKI  317
            M+S+ S+   AN L S+LP+ LTW+  GFR ICSGRLGFA S    P       +AGTK+
Sbjct  1    MSSIASRGYRANSLRSSLPYFLTWRALGFRNICSGRLGFAPSDPDLP-------VAGTKV  53

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            LE+F EEFE+GSR ITLETGKIARFANG+VVL +DETKVLSTV +AKG
Sbjct  54   LETFKEEFEVGSRLITLETGKIARFANGAVVLGIDETKVLSTVTAAKG  101



>ref|XP_010248545.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=991

 Score =   142 bits (357),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GD V+DFLPLTV+YQEKQFAQGLIP TFMRREGAP+ERELLCGRLIDRPIRPLFPAGFY
Sbjct  100  KGDNVKDFLPLTVEYQEKQFAQGLIPHTFMRREGAPQERELLCGRLIDRPIRPLFPAGFY  159

Query  637  HEVQVMASVLSSDG  678
            ++VQVMASVL SDG
Sbjct  160  NDVQVMASVLCSDG  173


 Score =   135 bits (341),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 4/111 (4%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MA++ S++NPL++++P  LTW+RFGFR+ICSGRLGF +S+ +   + S    AGTK+LE+
Sbjct  1    MATLASRSNPLLTSIPAYLTWRRFGFRSICSGRLGFLSSSPTDAETPS----AGTKLLET  56

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFEIGS  IT ETGKIARFANG+VV+AMD+TKVLSTVAS+KG     F
Sbjct  57   FKEEFEIGSHLITFETGKIARFANGAVVMAMDKTKVLSTVASSKGDNVKDF  107



>ref|XP_010660886.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Vitis vinifera]
Length=997

 Score =   149 bits (377),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GDA RDFLPLTVDYQEK FAQG+IP+TFMRREGAP+ERELLCGRLIDRPIRPLFPAGF
Sbjct  100  SKGDAARDFLPLTVDYQEKHFAQGVIPTTFMRREGAPRERELLCGRLIDRPIRPLFPAGF  159

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSSDG
Sbjct  160  YHEVQVMASVLSSDG  174


 Score =   128 bits (321),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MA++ S+ NPL+++LP  LTW+   +RTICSG LGFA+S+ S         + G K+LE+
Sbjct  1    MAAMASRRNPLLTSLPLYLTWRSLRYRTICSGHLGFASSSPSISEQIP---VPGMKVLET  57

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFEIGSR IT ETGKIARFANG+VV++MDETKVLSTVAS+KG  +  F
Sbjct  58   FKEEFEIGSRSITFETGKIARFANGAVVMSMDETKVLSTVASSKGDAARDF  108



>ref|XP_010248546.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
isoform X2 [Nelumbo nucifera]
Length=971

 Score =   142 bits (357),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GD V+DFLPLTV+YQEKQFAQGLIP TFMRREGAP+ERELLCGRLIDRPIRPLFPAGFY
Sbjct  100  KGDNVKDFLPLTVEYQEKQFAQGLIPHTFMRREGAPQERELLCGRLIDRPIRPLFPAGFY  159

Query  637  HEVQVMASVLSSDG  678
            ++VQVMASVL SDG
Sbjct  160  NDVQVMASVLCSDG  173


 Score =   135 bits (340),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 4/111 (4%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MA++ S++NPL++++P  LTW+RFGFR+ICSGRLGF +S+ +   + S    AGTK+LE+
Sbjct  1    MATLASRSNPLLTSIPAYLTWRRFGFRSICSGRLGFLSSSPTDAETPS----AGTKLLET  56

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFEIGS  IT ETGKIARFANG+VV+AMD+TKVLSTVAS+KG     F
Sbjct  57   FKEEFEIGSHLITFETGKIARFANGAVVMAMDKTKVLSTVASSKGDNVKDF  107



>ref|XP_004304642.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=969

 Score =   144 bits (364),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDAV+DFLPLTVDYQEKQFAQG+IP+TFMRREGAPKERELLC R+IDRPIRPLFPAGF+
Sbjct  102  KGDAVKDFLPLTVDYQEKQFAQGVIPNTFMRREGAPKERELLCARIIDRPIRPLFPAGFF  161

Query  637  HEVQVMASVLSSDG  678
            HEVQV A+VLSSDG
Sbjct  162  HEVQVTANVLSSDG  175


 Score =   132 bits (332),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 3/99 (3%)
 Frame = +3

Query  165  KANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFE  344
            +ANPL+  LPH LTW+  GFRT+CSGR+GF++     P S +     GTK+LE+FTE+FE
Sbjct  8    RANPLLGRLPHFLTWRSLGFRTVCSGRMGFSSQPEPEPESHTR---PGTKLLETFTEQFE  64

Query  345  IGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            IGSR ITLETGKIARFANGSVVL MD+T+VLSTV SAKG
Sbjct  65   IGSRLITLETGKIARFANGSVVLGMDDTRVLSTVCSAKG  103



>ref|XP_002524669.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus 
communis]
 gb|EEF37688.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus 
communis]
Length=958

 Score =   148 bits (374),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GDAVRDFLPLTVDYQEKQFAQG+IP+TFMRREGAPKERELLCGRLIDRPIRPLF  GF
Sbjct  97   SKGDAVRDFLPLTVDYQEKQFAQGVIPNTFMRREGAPKERELLCGRLIDRPIRPLFAPGF  156

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSSDG
Sbjct  157  YHEVQVMASVLSSDG  171


 Score =   125 bits (314),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 7/104 (7%)
 Frame = +3

Query  150  ASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESF  329
            A   SKANPL+++LP  LT + F FRTICSGRLGFA S    P       +AGTK+LE+F
Sbjct  3    AIARSKANPLVNSLPRFLTRRSFNFRTICSGRLGFAPSYPDRP-------VAGTKVLETF  55

Query  330  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
             EEFEIGS+ I+LETG+IARFANG+VVL+MD+TKVLSTV S+KG
Sbjct  56   KEEFEIGSQVISLETGEIARFANGAVVLSMDQTKVLSTVTSSKG  99



>ref|XP_010940149.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Elaeis guineensis]
Length=989

 Score =   143 bits (361),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            RGD  RDFLPLTVDYQEKQ+AQG+IP+TFMRREGAPKERELLCGRLIDRPIRPLFP GFY
Sbjct  106  RGDGARDFLPLTVDYQEKQYAQGVIPTTFMRREGAPKERELLCGRLIDRPIRPLFPPGFY  165

Query  637  HEVQVMASVLSSDG  678
            H+VQVM +VLSSDG
Sbjct  166  HDVQVMVNVLSSDG  179


 Score =   127 bits (320),  Expect(2) = 8e-64, Method: Composition-based stats.
 Identities = 62/111 (56%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            +A++  +A PL+S++P  LTW+R GFR+ CSG LGF +    + S+ +   + G+KILE+
Sbjct  3    VAALRGRAYPLMSSVPSFLTWRRLGFRSFCSGHLGFLSQPPEAESTAAAGPVPGSKILET  62

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFEIGSR I++ETGK+ARFANGSVV+ MDET VLSTVASA+G  +  F
Sbjct  63   FREEFEIGSRTISIETGKVARFANGSVVITMDETNVLSTVASARGDGARDF  113



>ref|XP_007151009.1| hypothetical protein PHAVU_004G011100g [Phaseolus vulgaris]
 gb|ESW23003.1| hypothetical protein PHAVU_004G011100g [Phaseolus vulgaris]
Length=982

 Score =   150 bits (378),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDAVRDFLPLTVDYQEKQFAQG+IP++FMRREGAPKERELLCGR+IDRPIRPLFP GFY
Sbjct  90   KGDAVRDFLPLTVDYQEKQFAQGVIPTSFMRREGAPKERELLCGRIIDRPIRPLFPPGFY  149

Query  637  HEVQVMASVLSSDG  678
            HEVQVMASVLSSDG
Sbjct  150  HEVQVMASVLSSDG  163


 Score =   117 bits (294),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 72/99 (73%), Gaps = 10/99 (10%)
 Frame = +3

Query  165  KANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFE  344
            +A PL+ TLPH LTW+ F FR ICSGRLGF  +  ++           TK L++FTE+FE
Sbjct  3    RAKPLLRTLPHFLTWRAFRFRNICSGRLGFDGAGATTT----------TKHLDTFTEQFE  52

Query  345  IGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            IGSR ITLETGKIARFANG+VVL M+ T VLSTV SAKG
Sbjct  53   IGSRVITLETGKIARFANGAVVLTMENTNVLSTVTSAKG  91



>ref|XP_010550151.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010550152.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Tarenaya hassleriana]
Length=960

 Score =   145 bits (366),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D+ RDFLPLTVDYQEKQFAQG+IPS++MRREGAPKERELLCGRLIDRPIRPLFP+GFY
Sbjct  96   KTDSPRDFLPLTVDYQEKQFAQGVIPSSYMRREGAPKERELLCGRLIDRPIRPLFPSGFY  155

Query  637  HEVQVMASVLSSDG  678
            HEVQVMASVLSSDG
Sbjct  156  HEVQVMASVLSSDG  169


 Score =   120 bits (301),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 8/104 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+++ S+A    + LP++L W+  GFRT+CSGRLGFA S    P S      AGTK+L++
Sbjct  1    MSAIASRAT--ATALPNLLAWRALGFRTVCSGRLGFAPSNPEPPVS------AGTKVLDT  52

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F EEFEIGSR ITLETGKIARFANGSVVL MDETKVLST+  AK
Sbjct  53   FKEEFEIGSRVITLETGKIARFANGSVVLGMDETKVLSTITCAK  96



>ref|XP_007031537.1| Polyribonucleotide nucleotidyltransferase, putative isoform 1 
[Theobroma cacao]
 gb|EOY02463.1| Polyribonucleotide nucleotidyltransferase, putative isoform 1 
[Theobroma cacao]
Length=980

 Score =   153 bits (386),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TFMRREGAPKERELLCGRLIDRPIRPLFPAGFY
Sbjct  97   KGDAVRDFLPLTVDYQEKQFAQGVIPNTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  156

Query  637  HEVQVMASVLSSDG  678
            HE+QVMASVLSSDG
Sbjct  157  HEIQVMASVLSSDG  170


 Score =   112 bits (280),  Expect(2) = 5e-62, Method: Composition-based stats.
 Identities = 65/100 (65%), Positives = 73/100 (73%), Gaps = 11/100 (11%)
 Frame = +3

Query  162  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  341
            +KANPL       LTW+   FRTICSG LGFATS    P       +AGTK LESF EEF
Sbjct  10   AKANPL-------LTWRALRFRTICSGGLGFATSESDPPYPP----VAGTKFLESFKEEF  58

Query  342  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            EIGSR I+LETGKIARFANG+VVL M+ETKVLST+A+ KG
Sbjct  59   EIGSRVISLETGKIARFANGAVVLGMEETKVLSTIAAGKG  98



>ref|XP_002873678.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49937.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score =   145 bits (366),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D+ RDFLPLTVDYQEKQ+AQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFY
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFY  155

Query  637  HEVQVMASVLSSDG  678
            HEVQ+MASVLSSDG
Sbjct  156  HEVQIMASVLSSDG  169


 Score =   119 bits (298),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (76%), Gaps = 8/104 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ ++A    ++LP+ L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVNRARS--TSLPNFLAWRALGFRTICSGRLGFAPSNPDSPAS------AGTKILES  52

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96



>ref|XP_010420100.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Camelina sativa]
Length=996

 Score =   145 bits (366),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D+ RDFLPLTVDYQEKQ+AQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFY
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFY  155

Query  637  HEVQVMASVLSSDG  678
            HEVQ+MASVLSSDG
Sbjct  156  HEVQIMASVLSSDG  169


 Score =   119 bits (297),  Expect(2) = 1e-61, Method: Composition-based stats.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 8/104 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ ++A    S+LP++L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVNRARS--SSLPNLLAWRALGFRTICSGRLGFAPSDPDSPAS------AGTKILES  52

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96



>ref|NP_196962.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana]
 sp|Q9S7G6.1|PNP2_ARATH RecName: Full=Polyribonucleotide nucleotidyltransferase 2, mitochondrial; 
Short=AtmtPNPase; AltName: Full=Polynucleotide 
phosphorylase 2; Short=PNPase 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB43864.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 emb|CAB43865.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 emb|CAB87625.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 gb|AED92050.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana]
Length=991

 Score =   144 bits (364),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D+ RDFLPLTVDYQEKQ+AQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP GFY
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPTGFY  155

Query  637  HEVQVMASVLSSDG  678
            HEVQ+MASVLSSDG
Sbjct  156  HEVQIMASVLSSDG  169


 Score =   119 bits (299),  Expect(2) = 1e-61, Method: Composition-based stats.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 8/104 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ ++A+   ++LP+ L W+  GFRTICSGRLGFA S   SP S      AGTKILES
Sbjct  1    MSSIVNRASS--ASLPNFLAWRALGFRTICSGRLGFAPSVPDSPVS------AGTKILES  52

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F EEFE+GSR ++ ETGKIARFANGSVVL MDETKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDETKVLSTVTCAK  96



>ref|XP_010492266.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010492267.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=996

 Score =   144 bits (363),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D+ +DFLPLTVDYQEKQ+AQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFY
Sbjct  96   KTDSPKDFLPLTVDYQEKQYAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFY  155

Query  637  HEVQVMASVLSSDG  678
            HEVQ+MASVLSSDG
Sbjct  156  HEVQIMASVLSSDG  169


 Score =   119 bits (299),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 8/104 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ ++A    S+LP++L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVNRAKS--SSLPNLLAWRALGFRTICSGRLGFAPSDPDSPAS------AGTKILES  52

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96



>ref|XP_010453582.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Camelina sativa]
Length=993

 Score =   145 bits (367),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D+ RDFLPLTVDYQEKQ+AQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFY
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFY  155

Query  637  HEVQVMASVLSSDG  678
            HEVQ+MASVLSSDG
Sbjct  156  HEVQIMASVLSSDG  169


 Score =   118 bits (295),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 8/104 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ ++A    S+LP+ L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVNRAKS--SSLPNFLAWRALGFRTICSGRLGFAPSDPDSPAS------AGTKILES  52

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96



>ref|XP_006399970.1| hypothetical protein EUTSA_v10012572mg [Eutrema salsugineum]
 gb|ESQ41423.1| hypothetical protein EUTSA_v10012572mg [Eutrema salsugineum]
Length=984

 Score =   141 bits (356),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 69/69 (100%), Gaps = 0/69 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDFLPLTVDYQEKQ+AQGLIP+++MRREGAPKERELLCGRLIDRPIRPLFP+GFYHEVQ+
Sbjct  101  RDFLPLTVDYQEKQYAQGLIPNSYMRREGAPKERELLCGRLIDRPIRPLFPSGFYHEVQI  160

Query  652  MASVLSSDG  678
            MASVLSSDG
Sbjct  161  MASVLSSDG  169


 Score =   122 bits (305),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ S+A    ++LP+ L W+  GFRTICSGRLGFA S    P++      AGTKILES
Sbjct  1    MSSIVSRARS--TSLPNFLAWRALGFRTICSGRLGFAPSDPGLPAT------AGTKILES  52

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFE+GSR +TLETGKIARFANGSVVL MD+TKVLSTV  AK      F
Sbjct  53   FKEEFEVGSRVVTLETGKIARFANGSVVLGMDQTKVLSTVTCAKTNEPRDF  103



>gb|KFK25698.1| hypothetical protein AALP_AA8G147400 [Arabis alpina]
Length=998

 Score =   142 bits (358),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D  RDFLPLTVDYQEKQ+AQGLIP+++MRREGAPKERELLCGRLIDRPIRPLFP+GFY
Sbjct  96   KTDLPRDFLPLTVDYQEKQYAQGLIPNSYMRREGAPKERELLCGRLIDRPIRPLFPSGFY  155

Query  637  HEVQVMASVLSSDG  678
            HEVQ+MASVLSSDG
Sbjct  156  HEVQIMASVLSSDG  169


 Score =   120 bits (300),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 8/104 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ S+A    ++LP++L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVSRARS--TSLPNLLAWRALGFRTICSGRLGFAPSDPHSPAS------AGTKILES  52

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F EEFEIG R ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEIGGRVVSFETGKIARFANGSVVLGMDDTKVLSTVTCAK  96



>ref|XP_006289585.1| hypothetical protein CARUB_v10003135mg [Capsella rubella]
 gb|EOA22483.1| hypothetical protein CARUB_v10003135mg [Capsella rubella]
Length=944

 Score =   145 bits (367),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D+ RDFLPLTVDYQEKQ+AQGLIPST+MRREGAPKERELLCGRLIDRPIRPLFP+GFY
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPSTYMRREGAPKERELLCGRLIDRPIRPLFPSGFY  155

Query  637  HEVQVMASVLSSDG  678
            HEVQ+MASVLSSDG
Sbjct  156  HEVQIMASVLSSDG  169


 Score =   116 bits (290),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 8/104 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ ++A    ++LP+ L W+  GFRTICSGRLG A S   SP+S      AGTKILES
Sbjct  1    MSSIANRARS--TSLPNFLAWRALGFRTICSGRLGVAPSDPGSPAS------AGTKILES  52

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96



>ref|XP_010108800.1| Polyribonucleotide nucleotidyltransferase [Morus notabilis]
 gb|EXC20315.1| Polyribonucleotide nucleotidyltransferase [Morus notabilis]
Length=167

 Score =   135 bits (340),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M SV S+ANPL+ T+PH LTW+  GFRTICSGRLGFAT +    +    + +AGTK+LE+
Sbjct  1    MVSVASRANPLLRTVPHFLTWRGLGFRTICSGRLGFATLSEPLGTDAEPS-VAGTKVLET  59

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFE+G R ITLETGKIARFANG+VVL +DETKVLSTV SAK    + F
Sbjct  60   FREEFEVGLRIITLETGKIARFANGAVVLGIDETKVLSTVTSAKSNAVADF  110


 Score =   126 bits (317),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + +AV DFLPLTVDYQEKQFAQG+IP+T+MRREGAPKERELLCGRLIDRPIRPLFP GFY
Sbjct  103  KSNAVADFLPLTVDYQEKQFAQGVIPNTYMRREGAPKERELLCGRLIDRPIRPLFPKGFY  162

Query  637  HEVQV  651
            HEVQV
Sbjct  163  HEVQV  167



>ref|XP_011098446.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Sesamum indicum]
Length=901

 Score =   143 bits (360),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D  RDFLPLTV+YQEKQFAQG+IP+TFMRREGAPKERELLCGRLIDRPIRPLFP GFY
Sbjct  98   KSDGTRDFLPLTVEYQEKQFAQGMIPNTFMRREGAPKERELLCGRLIDRPIRPLFPPGFY  157

Query  637  HEVQVMASVLSSDG  678
            HEVQVM+SVLSSDG
Sbjct  158  HEVQVMSSVLSSDG  171


 Score =   116 bits (290),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MA V SKANPL+S +P    W+R   R I  G  G A +  SS +++SET +AGTK LE+
Sbjct  1    MAPVASKANPLLSKVP----WRRIILRRISGG--GIARAPSSSTATESETVIAGTKFLET  54

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F+EEFEIGSRKITLETGKIARFANG+VVLAM+ETKVLSTVASAK   +  F
Sbjct  55   FSEEFEIGSRKITLETGKIARFANGAVVLAMEETKVLSTVASAKSDGTRDF  105



>gb|EYU44773.1| hypothetical protein MIMGU_mgv1a001063mg [Erythranthe guttata]
Length=899

 Score =   145 bits (366),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D  RDFLPLTVDYQEKQFAQG+IP+TFMRREGAPKERELLCGR+IDRPIRPLFPAGFY
Sbjct  99   KSDGSRDFLPLTVDYQEKQFAQGVIPNTFMRREGAPKERELLCGRIIDRPIRPLFPAGFY  158

Query  637  HEVQVMASVLSSDG  678
            H+VQVMASVLSSDG
Sbjct  159  HDVQVMASVLSSDG  172


 Score =   110 bits (276),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 75/111 (68%), Gaps = 5/111 (5%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            MA V  KANP ++++     W+R   R+I  GRL F +   S         +AG K LE+
Sbjct  1    MAPVVGKANPFLASM----LWRRMKLRSIVGGRL-FHSPAQSPAGDPEAATIAGKKFLET  55

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            FTEEFEIGSRK++LETGKIARFANGSVVLAM+ETKVLSTV SAK   S  F
Sbjct  56   FTEEFEIGSRKMSLETGKIARFANGSVVLAMEETKVLSTVTSAKSDGSRDF  106



>gb|KJB33814.1| hypothetical protein B456_006G032100 [Gossypium raimondii]
Length=980

 Score =   151 bits (382),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDA RDFLPLTVDYQEKQFAQGLIP+TFMRREGAPKERELLCGRLIDRPIRPLFPAGFY
Sbjct  99   KGDADRDFLPLTVDYQEKQFAQGLIPNTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  158

Query  637  HEVQVMASVLSSDG  678
            HE+QVMASVLSSDG
Sbjct  159  HEIQVMASVLSSDG  172


 Score =   103 bits (258),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 11/106 (10%)
 Frame = +3

Query  162  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  341
            +KANPL       LT +   FR  C+GR G +TS    P       +AGTK LESF EEF
Sbjct  12   AKANPL-------LTRRALHFRNFCNGRFGLSTSESDPPDRP----VAGTKFLESFKEEF  60

Query  342  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            EIGSR I+LETGKIARFANG+VVL M+ETKVLSTVA+AKG     F
Sbjct  61   EIGSRVISLETGKIARFANGAVVLGMEETKVLSTVAAAKGDADRDF  106



>ref|XP_008796014.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial [Phoenix dactylifera]
Length=993

 Score =   142 bits (359),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            RGD  RDFLPLTVDYQEKQ+AQG+IP+TFMRREGAPKERELLCGR+IDRPIRPLFP GFY
Sbjct  112  RGDGARDFLPLTVDYQEKQYAQGVIPTTFMRREGAPKERELLCGRIIDRPIRPLFPPGFY  171

Query  637  HEVQVMASVLSSDG  678
            H+VQVM +VLSSDG
Sbjct  172  HDVQVMVNVLSSDG  185


 Score =   112 bits (281),  Expect(2) = 5e-59, Method: Composition-based stats.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 3/108 (3%)
 Frame = +3

Query  165  KANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFE  344
            +A PL++++P  LTW+R GFR+ CSGRLGF +      S      + G K+LE+F EEFE
Sbjct  12   RAYPLMASVPSFLTWRRLGFRSFCSGRLGFLSQPPEMESLAPAGPVPGLKVLETFREEFE  71

Query  345  IGSRKITLETGKIARFANGSVVLAMDET---KVLSTVASAKGRRSSRF  479
            IGSR I+LETGKIARFANGSVV+ MDET       TVAS +G  +  F
Sbjct  72   IGSRTISLETGKIARFANGSVVITMDETXXXXXXXTVASXRGDGARDF  119



>gb|KJB33815.1| hypothetical protein B456_006G032100 [Gossypium raimondii]
Length=958

 Score =   151 bits (382),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDA RDFLPLTVDYQEKQFAQGLIP+TFMRREGAPKERELLCGRLIDRPIRPLFPAGFY
Sbjct  99   KGDADRDFLPLTVDYQEKQFAQGLIPNTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  158

Query  637  HEVQVMASVLSSDG  678
            HE+QVMASVLSSDG
Sbjct  159  HEIQVMASVLSSDG  172


 Score =   103 bits (258),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 11/106 (10%)
 Frame = +3

Query  162  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  341
            +KANPL       LT +   FR  C+GR G +TS    P       +AGTK LESF EEF
Sbjct  12   AKANPL-------LTRRALHFRNFCNGRFGLSTSESDPPDRP----VAGTKFLESFKEEF  60

Query  342  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            EIGSR I+LETGKIARFANG+VVL M+ETKVLSTVA+AKG     F
Sbjct  61   EIGSRVISLETGKIARFANGAVVLGMEETKVLSTVAAAKGDADRDF  106



>gb|KJB33816.1| hypothetical protein B456_006G032100 [Gossypium raimondii]
Length=958

 Score =   151 bits (382),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDA RDFLPLTVDYQEKQFAQGLIP+TFMRREGAPKERELLCGRLIDRPIRPLFPAGFY
Sbjct  99   KGDADRDFLPLTVDYQEKQFAQGLIPNTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  158

Query  637  HEVQVMASVLSSDG  678
            HE+QVMASVLSSDG
Sbjct  159  HEIQVMASVLSSDG  172


 Score =   103 bits (258),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 11/106 (10%)
 Frame = +3

Query  162  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  341
            +KANPL       LT +   FR  C+GR G +TS    P       +AGTK LESF EEF
Sbjct  12   AKANPL-------LTRRALHFRNFCNGRFGLSTSESDPPDRP----VAGTKFLESFKEEF  60

Query  342  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            EIGSR I+LETGKIARFANG+VVL M+ETKVLSTVA+AKG     F
Sbjct  61   EIGSRVISLETGKIARFANGAVVLGMEETKVLSTVAAAKGDADRDF  106



>ref|XP_009131416.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Brassica rapa]
Length=963

 Score =   134 bits (338),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DFLPLTVDYQEK +AQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFYHEVQ+M
Sbjct  102  DFLPLTVDYQEKLYAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFYHEVQIM  161

Query  655  ASVLSSDG  678
            ASVLS DG
Sbjct  162  ASVLSLDG  169


 Score =   119 bits (297),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 73/99 (74%), Gaps = 6/99 (6%)
 Frame = +3

Query  183  STLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFEIGSRKI  362
            + LP++L W+  GFRTICSGRLG A S+  +P+       AGTKILESF EEFE+GS  I
Sbjct  11   TPLPNLLAWRALGFRTICSGRLGLAPSSPYTPAP------AGTKILESFKEEFEVGSGVI  64

Query  363  TLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            TLETGKIARFANGSVVL MDETKVLSTV  AK +    F
Sbjct  65   TLETGKIARFANGSVVLGMDETKVLSTVTCAKSKSPGDF  103



>emb|CDX78584.1| BnaA03g04960D [Brassica napus]
Length=964

 Score =   134 bits (338),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DFLPLTVDYQEK +AQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFYHEVQ+M
Sbjct  102  DFLPLTVDYQEKLYAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFYHEVQIM  161

Query  655  ASVLSSDG  678
            ASVLS DG
Sbjct  162  ASVLSLDG  169


 Score =   118 bits (296),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 73/99 (74%), Gaps = 6/99 (6%)
 Frame = +3

Query  183  STLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFEIGSRKI  362
            + LP++L W+  GFRTICSGRLG A S+  +P+       AGTKILESF EEFE+GS  I
Sbjct  11   TPLPNLLAWRALGFRTICSGRLGLAPSSPYTPAP------AGTKILESFKEEFEVGSGVI  64

Query  363  TLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            TLETGKIARFANGSVVL MDETKVLSTV  AK +    F
Sbjct  65   TLETGKIARFANGSVVLGMDETKVLSTVTCAKSKSPGDF  103



>emb|CDX70572.1| BnaC03g06560D [Brassica napus]
Length=963

 Score =   135 bits (339),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DFLPLTVDYQEK +AQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFYHEVQ+M
Sbjct  102  DFLPLTVDYQEKLYAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFYHEVQIM  161

Query  655  ASVLSSDG  678
            ASVLS DG
Sbjct  162  ASVLSLDG  169


 Score =   118 bits (295),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 72/99 (73%), Gaps = 6/99 (6%)
 Frame = +3

Query  183  STLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFEIGSRKI  362
            + LP++L W+  GFRTICSGRLG A S+  SP+       AGTKILESF EEFE+GS  I
Sbjct  11   TPLPNLLAWRALGFRTICSGRLGLAPSSPHSPAP------AGTKILESFKEEFEVGSGVI  64

Query  363  TLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            TLETGKIARFANGSVVL MDETKVLSTV  AK      F
Sbjct  65   TLETGKIARFANGSVVLGMDETKVLSTVTCAKSNSPGDF  103



>emb|CDX69573.1| BnaA10g19220D [Brassica napus]
Length=975

 Score =   137 bits (345),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DFLPLTVDYQEK FAQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFYHEV +M
Sbjct  101  DFLPLTVDYQEKMFAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFYHEVHIM  160

Query  655  ASVLSSDG  678
            A+VLSSDG
Sbjct  161  ANVLSSDG  168


 Score =   115 bits (287),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+ S+A    S+LP+ L W+  GFRTICSG LG A S+            AG KILES
Sbjct  1    MSSIVSRARS--SSLPNFLAWRALGFRTICSGGLGIAPSSSPPA-------SAGIKILES  51

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFE+GSR +TLETGKIARFANGSVVL MDETKVLSTV  AK +    F
Sbjct  52   FKEEFEVGSRVVTLETGKIARFANGSVVLGMDETKVLSTVTCAKSKSPGDF  102



>ref|XP_009121656.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Brassica rapa]
Length=975

 Score =   139 bits (350),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DFLPLTVDYQEK FAQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFYHEVQ+M
Sbjct  101  DFLPLTVDYQEKMFAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFYHEVQIM  160

Query  655  ASVLSSDG  678
            A+VLSSDG
Sbjct  161  ANVLSSDG  168


 Score =   113 bits (282),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 75/111 (68%), Gaps = 9/111 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+  +A    S+LP+ L W+  GFRTICSG LG A S+            AG KILES
Sbjct  1    MSSIVRRARS--SSLPNFLAWRALGFRTICSGGLGIAPSSSPPA-------SAGIKILES  51

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFE+GSR +TLETGKIARFANGSVVL MDETKVLSTV  AK +    F
Sbjct  52   FKEEFEVGSRVVTLETGKIARFANGSVVLGMDETKVLSTVTCAKSKSPGDF  102



>emb|CDY09870.1| BnaC09g42910D [Brassica napus]
Length=959

 Score =   138 bits (348),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DFLPLTVDYQEK FAQGLIP+T+MRREGAPKERELLCGRLIDRPIRPLFP+GFYHEVQ+M
Sbjct  101  DFLPLTVDYQEKMFAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPSGFYHEVQIM  160

Query  655  ASVLSSDG  678
            A+VLSSDG
Sbjct  161  ANVLSSDG  168


 Score =   111 bits (277),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 74/111 (67%), Gaps = 9/111 (8%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  326
            M+S+  +A    S+LP+ L W+  GFRTICSG LG A S+            AG KILES
Sbjct  1    MSSIVRRARS--SSLPNFLAWRALGFRTICSGGLGIAPSSSPPA-------SAGIKILES  51

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            F EEFE+GSR +TLETGKIARF NGSVVL MDETKVLSTV  AK +    F
Sbjct  52   FKEEFEVGSRVVTLETGKIARFTNGSVVLGMDETKVLSTVTCAKSKSPGDF  102



>ref|XP_010665719.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=957

 Score =   142 bits (357),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDFLPLTVDYQEKQ+AQG+IP+TFMRREGAPKERELLCGRLIDRPIRPLFP GFYHEVQV
Sbjct  101  RDFLPLTVDYQEKQYAQGVIPNTFMRREGAPKERELLCGRLIDRPIRPLFPPGFYHEVQV  160

Query  652  MASVLSSDG  678
            MASVLSSDG
Sbjct  161  MASVLSSDG  169


 Score = 99.8 bits (247),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 6/94 (6%)
 Frame = +3

Query  177  LISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFEIGSR  356
            L ++ P  +TW+RF FR+ CS R  F ++   SP +        TK+LESF EEFEIG+R
Sbjct  9    LQNSQPLFVTWRRFKFRSNCSSRRHFVSNPEPSPLTPE------TKLLESFKEEFEIGNR  62

Query  357  KITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
             I+ ETGK+ARFANG+VV+AMDETKVLSTVASAK
Sbjct  63   LISFETGKMARFANGAVVMAMDETKVLSTVASAK  96



>ref|XP_010033299.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Eucalyptus grandis]
 gb|KCW52909.1| hypothetical protein EUGRSUZ_J02224 [Eucalyptus grandis]
Length=946

 Score =   140 bits (352),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             RGDAV  FLPLTVDYQEKQ+AQGLIP T+ RREGAPKERELL GRLIDRPIRPLFPAGF
Sbjct  112  SRGDAVGSFLPLTVDYQEKQYAQGLIPKTYTRREGAPKERELLVGRLIDRPIRPLFPAGF  171

Query  634  YHEVQVMASVLSSDG  678
            +HEVQVMASVLSSDG
Sbjct  172  FHEVQVMASVLSSDG  186


 Score = 98.6 bits (244),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 74/117 (63%), Gaps = 17/117 (15%)
 Frame = +3

Query  147  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdset----------  296
            MAS+ ++A       P++L W+   FR    GRLG A+ + SS +               
Sbjct  3    MASIATRARK-----PNLLPWRSLSFRATRGGRLGLASFSSSSSTLSDPELEPPPPPPPS  57

Query  297  --HMAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
                AG K+LESFTEEFEIGSR ITLETGKIARFANG+VVL M++TKVLSTV S++G
Sbjct  58   PSPAAGAKVLESFTEEFEIGSRLITLETGKIARFANGAVVLGMEDTKVLSTVTSSRG  114



>ref|XP_009375164.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Pyrus x bretschneideri]
Length=157

 Score =   148 bits (373),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TFMRREGAPKERELLCGR+IDRPIRPLFPAGF+
Sbjct  69   KGDAVRDFLPLTVDYQEKQFAQGVIPNTFMRREGAPKERELLCGRIIDRPIRPLFPAGFF  128

Query  637  HEVQVMASVLSSDG  678
            HEVQV ASVLSSDG
Sbjct  129  HEVQVTASVLSSDG  142


 Score = 89.4 bits (220),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  300  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            +AGTK+LE+F EEFE+G R ITLETGKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  17   VAGTKVLETFREEFEVGDRLITLETGKIARFANGAVVLGMEETKVLSTVAAAKG  70



>emb|CBI34890.3| unnamed protein product [Vitis vinifera]
Length=905

 Score =   149 bits (377),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
             +GDA RDFLPLTVDYQEK FAQG+IP+TFMRREGAP+ERELLCGRLIDRPIRPLFPAGF
Sbjct  49   SKGDAARDFLPLTVDYQEKHFAQGVIPTTFMRREGAPRERELLCGRLIDRPIRPLFPAGF  108

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSSDG
Sbjct  109  YHEVQVMASVLSSDG  123


 Score = 87.0 bits (214),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  312  KILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            K+LE+F EEFEIGSR IT ETGKIARFANG+VV++MDETKVLSTVAS+KG  +  F
Sbjct  2    KVLETFKEEFEIGSRSITFETGKIARFANGAVVMSMDETKVLSTVASSKGDAARDF  57



>ref|XP_003554809.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Glycine max]
Length=959

 Score =   146 bits (368),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  460  GDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYH  639
             DAVRDFLPLTVDYQEKQFAQG+IP++FMRREGAP+ERELLCGR+IDRPIRPLFP GFYH
Sbjct  79   NDAVRDFLPLTVDYQEKQFAQGVIPTSFMRREGAPRERELLCGRIIDRPIRPLFPPGFYH  138

Query  640  EVQVMASVLSSDG  678
            EVQVMASVLSSDG
Sbjct  139  EVQVMASVLSSDG  151


 Score = 90.5 bits (223),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 63/108 (58%), Gaps = 23/108 (21%)
 Frame = +3

Query  165  KANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFE  344
            + N L+ TLPH LTW+ F FRT                        A TK LE+FTE+FE
Sbjct  3    RTNTLLRTLPHFLTWRAFRFRT-----------------------FATTKHLETFTEQFE  39

Query  345  IGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFSTP  488
            IGS  ITLETGKIARFAN +VVLAM+ T VLSTV ++K   + R   P
Sbjct  40   IGSSVITLETGKIARFANAAVVLAMENTNVLSTVTASKANDAVRDFLP  87



>ref|XP_009380405.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=1048

 Score =   148 bits (373),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            RGD  RDFLPLTVDYQEKQ+AQG+IP+TFMRREGAPKERELLCGRLIDRPIRPLFP+GFY
Sbjct  116  RGDGARDFLPLTVDYQEKQYAQGVIPTTFMRREGAPKERELLCGRLIDRPIRPLFPSGFY  175

Query  637  HEVQVMASVLSSDG  678
            HEVQVM SVLSSDG
Sbjct  176  HEVQVMVSVLSSDG  189


 Score = 79.3 bits (194),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 52/122 (43%), Positives = 74/122 (61%), Gaps = 8/122 (7%)
 Frame = +3

Query  135  LKPIMASVTSKANPLISTLPHVLTW------QRFGFRTICSGRLGFAtstlsspssdset  296
            L  + A++  +ANP I  +  +L++      +R G R +CS    F +     P S+   
Sbjct  3    LAAVAATLRRRANPRI-LMASLLSFHCRQRCRRLGVRFLCSDGHAFVSQPPRPPPSERAA  61

Query  297  HMAGT-KILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSS  473
                T K+L +F E+FE+GSR I++ETGKIARFANGSVV+ M +T VLSTVASA+G  + 
Sbjct  62   ESFHTRKVLGTFREDFEVGSRIISIETGKIARFANGSVVINMGDTNVLSTVASARGDGAR  121

Query  474  RF  479
             F
Sbjct  122  DF  123



>ref|XP_004489245.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Cicer arietinum]
Length=976

 Score =   139 bits (351),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 70/75 (93%), Gaps = 1/75 (1%)
 Frame = +1

Query  457  RGDAVR-DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +GD  + DFLPLTVDYQEKQFAQG+IPST+MRREGAPKERELLC R+IDRPIRPLFP GF
Sbjct  85   KGDTAKADFLPLTVDYQEKQFAQGMIPSTYMRREGAPKERELLCARIIDRPIRPLFPPGF  144

Query  634  YHEVQVMASVLSSDG  678
            YHEVQVMASVLSS+G
Sbjct  145  YHEVQVMASVLSSNG  159


 Score = 84.0 bits (206),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 62/98 (63%), Gaps = 21/98 (21%)
 Frame = +3

Query  168  ANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFEI  347
            A PL+ TL H L ++R    TI +   G A                 TK LE+F EEFEI
Sbjct  10   AKPLLRTLRHHLGFRR----TISTTDGGSA-----------------TKFLETFNEEFEI  48

Query  348  GSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            G+R ITLETGKIARFANG+VV +M++TKVLSTV SAKG
Sbjct  49   GNRIITLETGKIARFANGAVVFSMEDTKVLSTVTSAKG  86



>gb|EEC73607.1| hypothetical protein OsI_08089 [Oryza sativa Indica Group]
Length=1030

 Score =   138 bits (347),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  469  VRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQ  648
            VRDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGR+IDRPIRPLFP GFYHEVQ
Sbjct  109  VRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPPGFYHEVQ  168

Query  649  VMASVLSSDG  678
            +M +V+SSDG
Sbjct  169  IMVNVISSDG  178


 Score = 79.7 bits (195),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  306  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  485
            G K+LESF EEFEIG R I+ ETGK+ARFANGSVV++MD+T VLSTVA+AK     R   
Sbjct  54   GRKVLESFREEFEIGGRVISFETGKMARFANGSVVISMDDTHVLSTVAAAKSSEPVRDFL  113

Query  486  P  488
            P
Sbjct  114  P  114



>ref|XP_002454178.1| hypothetical protein SORBIDRAFT_04g026110 [Sorghum bicolor]
 gb|EES07154.1| hypothetical protein SORBIDRAFT_04g026110 [Sorghum bicolor]
Length=983

 Score =   139 bits (350),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  469  VRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQ  648
            VRDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGR+IDRPIRPLFP GFYHEVQ
Sbjct  116  VRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPPGFYHEVQ  175

Query  649  VMASVLSSDG  678
            +M +VLSSDG
Sbjct  176  IMVNVLSSDG  185


 Score = 77.8 bits (190),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  300  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            + G K+LESF EEFEIG R I  ETGK+ARFANGSVV++M++T VLSTVA+AK     R 
Sbjct  59   VPGRKVLESFREEFEIGGRSIAFETGKMARFANGSVVISMEDTHVLSTVAAAKSSEPVRD  118

Query  480  STP  488
              P
Sbjct  119  FLP  121



>ref|XP_008643478.1| PREDICTED: uncharacterized protein LOC100279772 isoform X1 [Zea 
mays]
 gb|AFW72337.1| hypothetical protein ZEAMMB73_632002 [Zea mays]
Length=980

 Score =   138 bits (347),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  469  VRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQ  648
            +RDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGR+IDRPIRPLFP GFYHEVQ
Sbjct  113  IRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPPGFYHEVQ  172

Query  649  VMASVLSSDG  678
            +M +VLSSDG
Sbjct  173  IMVNVLSSDG  182


 Score = 77.8 bits (190),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  300  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + G K+LESF EEFEIG R I  ETGK+ARFANGSVV++M++T VLSTVA+AK
Sbjct  56   VPGRKVLESFREEFEIGGRSIAFETGKMARFANGSVVISMEDTHVLSTVAAAK  108



>ref|XP_006648841.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like, 
partial [Oryza brachyantha]
Length=947

 Score =   137 bits (344),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  469  VRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQ  648
            VRDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGR+IDRPIRPLFP+GFYHEVQ
Sbjct  78   VRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPSGFYHEVQ  137

Query  649  VMASVLSSDG  678
            +  +V+SSDG
Sbjct  138  ITVNVISSDG  147


 Score = 77.8 bits (190),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  306  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  485
            G K+LESF +EFE+G R I+ ETGK+ARFANGSVV++MD+T VLSTVA+AK     R   
Sbjct  23   GRKVLESFRDEFEVGGRVISFETGKMARFANGSVVISMDDTHVLSTVAAAKSSEPVRDFL  82

Query  486  P  488
            P
Sbjct  83   P  83



>sp|Q6KAI0.1|PNP2_ORYSJ RecName: Full=Polyribonucleotide nucleotidyltransferase 2, mitochondrial; 
AltName: Full=Polynucleotide phosphorylase 2; Short=PNPase 
2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD21450.1| putative polyribonucleotide nucleotidyltransferase [Oryza sativa 
Japonica Group]
Length=982

 Score =   132 bits (332),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 6/76 (8%)
 Frame = +1

Query  469  VRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQ  648
            VRDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGR+IDRPIRPLFP GFYHEVQ
Sbjct  109  VRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPPGFYHEVQ  168

Query  649  V------MASVLSSDG  678
            V      M +V+SSDG
Sbjct  169  VMNATIIMVNVISSDG  184


 Score = 79.7 bits (195),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  306  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  485
            G K+LESF EEFEIG R I+ ETGK+ARFANGSVV++MD+T VLSTVA+AK     R   
Sbjct  54   GRKVLESFREEFEIGGRVISFETGKMARFANGSVVISMDDTHVLSTVAAAKSSEPVRDFL  113

Query  486  P  488
            P
Sbjct  114  P  114



>gb|EPS73358.1| hypothetical protein M569_01398 [Genlisea aurea]
Length=882

 Score =   136 bits (343),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            + D   DFLPLTVDY+EKQFAQG+IP TFMRREGAP+ERELLCGRLIDRPIRPLFPAGFY
Sbjct  99   KSDGAHDFLPLTVDYREKQFAQGVIPGTFMRREGAPRERELLCGRLIDRPIRPLFPAGFY  158

Query  637  HEVQVMASVLSSDG  678
            H+V++ ASVLSSDG
Sbjct  159  HDVEITASVLSSDG  172


 Score = 65.1 bits (157),  Expect(2) = 7e-43, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 70/105 (67%), Gaps = 2/105 (2%)
 Frame = +3

Query  171  NPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdset--HMAGTKILESFTEEFE  344
            +P+++ L   + W+R    TI  GR+  A S+L++ + D+ +    AG K  E+F+EEFE
Sbjct  2    SPVVNRLLSAIPWRRKKLHTIRRGRISRALSSLTAETLDANSDFRTAGNKFFETFSEEFE  61

Query  345  IGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            IG  KIT+ETGK+A FANG+V+ A++ETKVLST  SAK   +  F
Sbjct  62   IGESKITMETGKLAPFANGAVLFAVEETKVLSTAVSAKSDGAHDF  106



>gb|AES74396.2| polyribonucleotide nucleotidyltransferase [Medicago truncatula]
Length=973

 Score =   134 bits (338),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A  DFLPLTVDY+EKQF+ GLIPST+MRREGAPKERELLC R+IDRPIRPLFP GFYHEV
Sbjct  91   ARNDFLPLTVDYEEKQFSHGLIPSTYMRREGAPKERELLCARIIDRPIRPLFPPGFYHEV  150

Query  646  QVMASVLSSDG  678
            QV ASVLSSDG
Sbjct  151  QVTASVLSSDG  161


 Score = 66.2 bits (160),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  309  TKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            TK+LE+FTEEFE+G+R IT + GK  RF+NG+VVL M++ K+LS V +++
Sbjct  38   TKLLETFTEEFEVGNRLITFQNGKYGRFSNGAVVLTMEDNKILSAVNTSR  87



>ref|XP_006833262.2| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Amborella trichopoda]
Length=992

 Score =   134 bits (338),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  460  GDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYH  639
            GD  RDFLPLTVDY+EKQ+AQG IP+TFMRREGAPKERELLCGR+IDR IRPLFP GF H
Sbjct  103  GDGARDFLPLTVDYREKQYAQGKIPNTFMRREGAPKERELLCGRVIDRSIRPLFPKGFVH  162

Query  640  EVQVMASVLSSDG  678
            +VQVMA+VLSSDG
Sbjct  163  DVQVMANVLSSDG  175


 Score = 63.9 bits (154),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            ++EE E+GSR IT ETGK+ARFA G+VVL + +TKVLSTV SA+G  +  F
Sbjct  59   YSEEVEVGSRLITFETGKLARFAAGAVVLGIKDTKVLSTVVSAEGDGARDF  109



>gb|ERM98540.1| hypothetical protein AMTR_s00113p00140210, partial [Amborella 
trichopoda]
Length=958

 Score =   134 bits (337),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  460  GDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYH  639
            GD  RDFLPLTVDY+EKQ+AQG IP+TFMRREGAPKERELLCGR+IDR IRPLFP GF H
Sbjct  103  GDGARDFLPLTVDYREKQYAQGKIPNTFMRREGAPKERELLCGRVIDRSIRPLFPKGFVH  162

Query  640  EVQVMASVLSSDG  678
            +VQVMA+VLSSDG
Sbjct  163  DVQVMANVLSSDG  175


 Score = 63.9 bits (154),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  479
            ++EE E+GSR IT ETGK+ARFA G+VVL + +TKVLSTV SA+G  +  F
Sbjct  59   YSEEVEVGSRLITFETGKLARFAAGAVVLGIKDTKVLSTVVSAEGDGARDF  109



>ref|XP_007031538.1| Polyribonucleotide nucleotidyltransferase, putative isoform 2 
[Theobroma cacao]
 gb|EOY02464.1| Polyribonucleotide nucleotidyltransferase, putative isoform 2 
[Theobroma cacao]
Length=896

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +1

Query  457  RGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  636
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TFMRREGAPKERELLCGRLIDRPIRPLFPAGFY
Sbjct  14   KGDAVRDFLPLTVDYQEKQFAQGVIPNTFMRREGAPKERELLCGRLIDRPIRPLFPAGFY  73

Query  637  HEVQVMASVLSSDG  678
            HE+QVMASVLSSDG
Sbjct  74   HEIQVMASVLSSDG  87



>gb|EEE57382.1| hypothetical protein OsJ_07542 [Oryza sativa Japonica Group]
Length=941

 Score =   138 bits (347),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  469  VRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQ  648
            VRDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGR+IDRPIRPLFP GFYHEVQ
Sbjct  31   VRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPPGFYHEVQ  90

Query  649  VMASVLSSDG  678
            +M +V+SSDG
Sbjct  91   IMVNVISSDG  100


 Score = 44.7 bits (104),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  381  IARFANGSVVLAMDETKVLSTVASAKGRRSSRFSTP  488
            +ARFANGSVV++MD+T VLSTVA+AK     R   P
Sbjct  1    MARFANGSVVISMDDTHVLSTVAAAKSSEPVRDFLP  36



>gb|EMT15535.1| Polyribonucleotide nucleotidyltransferase [Aegilops tauschii]
Length=962

 Score =   139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +  D VRDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGRLIDRPIRPLFP GF
Sbjct  26   KSSDPVRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRLIDRPIRPLFPRGF  85

Query  634  YHEVQVMASVLSSDG  678
            YHEVQ+  +VLSSDG
Sbjct  86   YHEVQITVNVLSSDG  100



>ref|XP_001782634.1| predicted protein [Physcomitrella patens]
 gb|EDQ52537.1| predicted protein [Physcomitrella patens]
Length=817

 Score =   118 bits (296),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  463  DAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHE  642
            D  +DFLPL V+Y+EKQ+AQG IP+TFMRREGAPKERELLCGRLIDR +RPLFP GF+++
Sbjct  131  DGGKDFLPLQVEYREKQYAQGKIPATFMRREGAPKERELLCGRLIDRSVRPLFPKGFFYD  190

Query  643  VQVMASVLSSDG  678
             Q++A+VL SDG
Sbjct  191  SQIIANVLCSDG  202


 Score = 52.8 bits (125),  Expect(2) = 9e-34, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS  452
            F EE E+G+ K++ ETGK+ARFA+G+VV+ + ETKVL TV +
Sbjct  85   FQEEAEVGNMKMSFETGKLARFASGAVVVGVGETKVLVTVVA  126



>ref|XP_004953116.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Setaria italica]
Length=899

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +  + VRDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGR+IDRPIRPLFP GF
Sbjct  26   KSNEPVRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPPGF  85

Query  634  YHEVQVMASVLSSDG  678
            YHEVQ+M +VLSSDG
Sbjct  86   YHEVQIMVNVLSSDG  100



>gb|EMS68952.1| Polyribonucleotide nucleotidyltransferase [Triticum urartu]
Length=1374

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +  D VRDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGR+IDRPIRPLFP GF
Sbjct  495  KSSDPVRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPHGF  554

Query  634  YHEVQVMASVLSSDG  678
            YHEVQ+  +VLSSDG
Sbjct  555  YHEVQITVNVLSSDG  569


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  306  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  485
            G K+LESF EEFEIG R I  ETGK+ARFANGSVV++M+ET VLSTVA+AK     R   
Sbjct  445  GRKVLESFREEFEIGGRLIAFETGKMARFANGSVVISMEETNVLSTVAAAKSSDPVRDFL  504

Query  486  P  488
            P
Sbjct  505  P  505



>ref|XP_010235710.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Brachypodium distachyon]
Length=976

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +  D VRDFLPLTVDYQEKQ+AQG+IP+T+MRREGAPKERELLCGR+IDRPIRPLFP GF
Sbjct  100  KSSDPVRDFLPLTVDYQEKQYAQGVIPTTYMRREGAPKERELLCGRIIDRPIRPLFPRGF  159

Query  634  YHEVQVMASVLSSDG  678
            YHEVQ+  +V+SSDG
Sbjct  160  YHEVQITTNVISSDG  174


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  306  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  485
            G K+LESF EEFEIG R I  ETGKIARFANGSVV++MD+T VLSTVA++K     R   
Sbjct  50   GRKVLESFREEFEIGGRLIAFETGKIARFANGSVVISMDDTHVLSTVAASKSSDPVRDFL  109

Query  486  P  488
            P
Sbjct  110  P  110



>ref|XP_002965413.1| hypothetical protein SELMODRAFT_84724, partial [Selaginella moellendorffii]
 gb|EFJ32833.1| hypothetical protein SELMODRAFT_84724, partial [Selaginella moellendorffii]
Length=705

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +R DA RDF+PL V+Y+EK +AQG IP+TFMRREGAPKERELLCGR+IDR IRPLFP G+
Sbjct  47   ERLDAGRDFMPLQVEYREKSYAQGKIPNTFMRREGAPKERELLCGRVIDRSIRPLFPKGY  106

Query  634  YHEVQVMASVLSSDG  678
            Y E Q+MA+VLSSDG
Sbjct  107  YFETQIMANVLSSDG  121



>ref|XP_002976027.1| hypothetical protein SELMODRAFT_104548, partial [Selaginella 
moellendorffii]
 gb|EFJ22932.1| hypothetical protein SELMODRAFT_104548, partial [Selaginella 
moellendorffii]
Length=705

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +R DA RDF+PL V+Y+EK +AQG IP+TFMRREGAPKERELLCGR+IDR IRPLFP G+
Sbjct  47   ERLDAGRDFMPLQVEYREKSYAQGKIPNTFMRREGAPKERELLCGRVIDRSIRPLFPKGY  106

Query  634  YHEVQVMASVLSSDG  678
            Y E Q+MA+VL SDG
Sbjct  107  YFETQIMANVLCSDG  121



>ref|XP_003618178.1| Polyribonucleotide nucleotidyltransferase [Medicago truncatula]
Length=1106

 Score =   122 bits (307),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  493  VDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVMASVLSS  672
            VDY+EKQF+ GLIPST+MRREGAPKERELLC R+IDRPIRPLFP GFYHEVQV ASVLSS
Sbjct  233  VDYEEKQFSHGLIPSTYMRREGAPKERELLCARIIDRPIRPLFPPGFYHEVQVTASVLSS  292

Query  673  DG  678
            DG
Sbjct  293  DG  294


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  309  TKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            TK+LE+FTEEFE+G+R IT + GK  RF+NG+VVL M++ K+LS V +++
Sbjct  38   TKLLETFTEEFEVGNRLITFQNGKYGRFSNGAVVLTMEDNKILSAVNTSR  87



>ref|WP_022005994.1| polyribonucleotide nucleotidyltransferase [Proteobacteria bacterium 
CAG:495]
 emb|CCZ30425.1| polyribonucleotide nucleotidyltransferase [Proteobacteria bacterium 
CAG:495]
Length=706

 Score = 99.4 bits (246),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +   A +DF PLTV+YQEK +A G +P  FM+REG P ERE+L  RLIDRPIRPLFP  F
Sbjct  50   KEAKADQDFFPLTVNYQEKYYATGKVPGGFMKREGKPSEREVLISRLIDRPIRPLFPDAF  109

Query  634  YHEVQVMASVLSSD  675
             +EVQV+ +VLS D
Sbjct  110  KNEVQVICTVLSHD  123


 Score = 50.1 bits (118),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +E E G RK+ LETGKIAR A G+VV+   ET+VL+TV +AK  ++ +
Sbjct  9    KEMEWGGRKLVLETGKIARQATGAVVVKYGETEVLATVCAAKEAKADQ  56



>ref|WP_004181131.1| Polyribonucleotide nucleotidyltransferase [Nitrosospira sp. APG3]
 emb|CCU64006.1| Polyribonucleotide nucleotidyltransferase [Nitrosospira sp. APG3]
Length=702

 Score =   105 bits (262),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDYQE+ +A G IP +F +REG P E+E+L  RLIDRPIRPLFP  FY+EVQ+
Sbjct  53   QDFFPLTVDYQERSYAAGRIPGSFFKREGRPSEKEILTSRLIDRPIRPLFPERFYNEVQI  112

Query  652  MASVLSSD  675
            +A+VLSSD
Sbjct  113  VATVLSSD  120


 Score = 43.5 bits (101),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            ++S  +    G  ++TLETG+IAR A+G+V++ MD+T VL T   AK  +  +
Sbjct  1    MKSIKKSITYGRHQLTLETGEIARQAHGAVMVTMDDTVVLVTAVGAKNAKQGQ  53



>ref|WP_028462090.1| polynucleotide phosphorylase/polyadenylase [Nitrosomonas cryotolerans]
Length=711

 Score =   107 bits (266),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDYQEK ++ G IP +F +REG P E+E+L  RLIDRPIRPLFP GFY+EVQV
Sbjct  53   QDFFPLTVDYQEKFYSAGRIPGSFFKREGRPSEKEILTSRLIDRPIRPLFPDGFYNEVQV  112

Query  652  MASVLSSD  675
            +A+V+SSD
Sbjct  113  VATVMSSD  120


 Score = 42.4 bits (98),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            ++S  +    G  ++TLETG+IAR A+G+V++ M +T VL TV  AK
Sbjct  1    MKSIKKSIAYGRHQLTLETGEIARQAHGAVMVTMGDTVVLVTVVGAK  47



>gb|ADI16912.1| polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) 
[uncultured gamma proteobacterium HF0010_16J05]
Length=718

 Score = 99.0 bits (245),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F RREG P E+E L  RLIDRPIRPLFP GF +EVQ+
Sbjct  70   QDFFPLTVNYQEKTYAAGKIPGGFFRREGRPSEKETLTSRLIDRPIRPLFPKGFMNEVQI  129

Query  652  MASVLSSD  675
            + +V+S+D
Sbjct  130  VCTVVSTD  137


 Score = 49.7 bits (117),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  306  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            G   L + T++F+ G +++T+ET KIA+ A GSVV+ + +T VL+TV  AK  R
Sbjct  14   GVYNLNAITKQFQFGDQQVTIETNKIAKQATGSVVVTIGDTVVLTTVVGAKSAR  67



>ref|WP_022186711.1| polyribonucleotide nucleotidyltransferase [Azospirillum sp. CAG:260]
 emb|CDB40264.1| polyribonucleotide nucleotidyltransferase [Azospirillum sp. CAG:260]
Length=706

 Score = 99.8 bits (247),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +   A +DF PLTV+YQEK +A G +P  FM+REG P ERE+L  RLIDRPIRPLFP  F
Sbjct  50   KEAKADQDFFPLTVNYQEKYYATGKVPGGFMKREGKPSEREVLLSRLIDRPIRPLFPDAF  109

Query  634  YHEVQVMASVLSSD  675
             +EVQV+ +VLS D
Sbjct  110  KNEVQVICTVLSHD  123


 Score = 48.5 bits (114),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +E E G RK+ LETGK+AR A G+VV+   ET+V++TV +AK  ++ +
Sbjct  9    KEMEWGGRKLVLETGKLARQAQGAVVVTYGETEVIATVCAAKEAKADQ  56



>ref|WP_040728507.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira sp. 
Kp2]
Length=696

 Score = 97.4 bits (241),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTV+YQEK +A G IP  F++REG P E+E L  RLIDRPIRPLFP GF +EV
Sbjct  51   AGQDFFPLTVNYQEKAYAAGKIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGFLNEV  110

Query  646  QVMASVLSSD  675
            Q++A+V++ D
Sbjct  111  QIIATVVALD  120


 Score = 50.1 bits (118),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +  FT+ F+ G  ++TLETG+IAR A+G+V++ M +T+VL T  +AK  ++ +
Sbjct  1    MAKFTKTFQYGQHQVTLETGEIARQADGAVMIGMGDTRVLVTAVAAKSAKAGQ  53



>ref|WP_029407474.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira sp. 
Milos-T2]
Length=697

 Score = 97.1 bits (240),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTV+YQEK +A G IP  F++REG P E+E L  RLIDRPIRPLFP GF +EV
Sbjct  51   AGQDFFPLTVNYQEKAYAAGRIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGFLNEV  110

Query  646  QVMASVLSSD  675
            Q++A+V++ D
Sbjct  111  QIIATVVALD  120


 Score = 50.4 bits (119),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +  FT+ F+ G+ ++TLETG+IAR A+G+V++ M ET++L T  +AK  ++ +
Sbjct  1    MAKFTKTFQYGNHQVTLETGEIARQADGAVMVGMGETRILVTAVAAKSAKAGQ  53



>ref|WP_022196653.1| polyribonucleotide nucleotidyltransferase [Azospirillum sp. CAG:239]
 emb|CDB53311.1| polyribonucleotide nucleotidyltransferase [Azospirillum sp. CAG:239]
Length=706

 Score = 99.8 bits (247),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTV+YQEK +A G +P  FM+REG P ERE+L  RLIDRPIRPLFP  F +EV
Sbjct  54   ADQDFFPLTVNYQEKYYATGKVPGGFMKREGKPSEREVLISRLIDRPIRPLFPDAFKNEV  113

Query  646  QVMASVLSSD  675
            QV+ +VLS D
Sbjct  114  QVICTVLSHD  123


 Score = 47.4 bits (111),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  336  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            E E G RK+ LETGK+AR A G+V++   ET+VL+TV +AK  ++ +
Sbjct  10   EMEWGGRKLVLETGKVARQAEGAVLVTYGETEVLATVCAAKEVKADQ  56



>ref|WP_025287634.1| polynucleotide phosphorylase/polyadenylase [Granulibacter bethesdensis]
 gb|AHJ64258.1| Polyribonucleotide nucleotidyltransferase [Granulibacter bethesdensis 
CGDNIH3]
Length=720

 Score =   102 bits (255),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTV+YQEK FA G IP  F +REG P E E L  RLIDRPIRPLFP GFY+EV
Sbjct  52   AGQDFFPLTVNYQEKAFAAGKIPGGFFKREGRPSEHETLVSRLIDRPIRPLFPEGFYNEV  111

Query  646  QVMASVLSSD  675
            QV+A+VLS D
Sbjct  112  QVIATVLSHD  121


 Score = 43.9 bits (102),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F +E ++G R + LETGKIAR A+G+V+  + +T VL T   AK  ++ +
Sbjct  5    FRKELDLGGRTLVLETGKIARQADGAVLARLGDTIVLCTAVGAKSAKAGQ  54



>ref|WP_011633051.1| polyribonucleotide nucleotidyltransferase [Granulibacter bethesdensis]
 sp|Q0BPK3.1|PNP_GRABC RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Granulibacter 
bethesdensis CGDNIH1]
 gb|ABI63249.1| polyribonucleotide nucleotidyltransferase [Granulibacter bethesdensis 
CGDNIH1]
 gb|AHJ66885.1| Polyribonucleotide nucleotidyltransferase [Granulibacter bethesdensis 
CGDNIH4]
 gb|AHJ69554.1| Polyribonucleotide nucleotidyltransferase [Granulibacter bethesdensis 
CGDNIH2]
Length=720

 Score =   102 bits (255),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTV+YQEK FA G IP  F +REG P E E L  RLIDRPIRPLFP GFY+EV
Sbjct  52   AGQDFFPLTVNYQEKAFAAGKIPGGFFKREGRPSEHETLVSRLIDRPIRPLFPEGFYNEV  111

Query  646  QVMASVLSSD  675
            QV+A+VLS D
Sbjct  112  QVIATVLSHD  121


 Score = 43.9 bits (102),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F +E ++G R + LETGKIAR A+G+V+  + +T VL T   AK  ++ +
Sbjct  5    FRKELDLGGRTLVLETGKIARQADGAVLARLGDTIVLCTAVGAKSAKAGQ  54



>ref|WP_041067289.1| polynucleotide phosphorylase/polyadenylase [Thiolapillus brandeum]
 dbj|BAO44454.1| polyribonucleotide nucleotidyltransferase [Thiolapillus brandeum]
Length=697

 Score = 96.3 bits (238),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PLTVDYQEK +A G IP  F RREG P E+E+L  RLIDRP+RPLFP G+ +E Q+
Sbjct  53   RDFFPLTVDYQEKTYAAGKIPGGFFRREGRPSEKEILVARLIDRPVRPLFPKGYTNETQI  112

Query  652  MASVLS  669
            + +V+S
Sbjct  113  ICTVMS  118


 Score = 50.4 bits (119),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + +  +EF+ G  K+TLETG++AR A+G+V++ MD+T VL TV  +K     R
Sbjct  1    MTAIKKEFQFGDHKVTLETGEVARQADGAVIVNMDDTVVLCTVVGSKHAMEGR  53



>ref|WP_036560419.1| polynucleotide phosphorylase/polyadenylase [Oligella urethralis]
 gb|KGF28127.1| polynucleotide phosphorylase/polyadenylase [Oligella urethralis 
DNF00040]
Length=715

 Score = 97.1 bits (240),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G+IP  F +RE  P E+E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKAYAAGMIPGGFFKREAKPSEKETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLSSD  675
            +  VLS D
Sbjct  114  IVHVLSVD  121


 Score = 49.7 bits (117),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +   FT+ F+ G   +TLETG+IAR A G+V+ +M +T VL+TV +AK
Sbjct  1    MFNKFTQSFQYGEHTVTLETGEIARQATGAVLASMGDTVVLATVVAAK  48



>ref|WP_018026459.1| polynucleotide phosphorylase/polyadenylase [Oligella urethralis]
Length=715

 Score = 97.1 bits (240),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G+IP  F +RE  P E+E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKAYAAGMIPGGFFKREAKPSEKETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLSSD  675
            +  VLS D
Sbjct  114  IVHVLSVD  121


 Score = 49.7 bits (117),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +   FT+ F+ G   +TLETG+IAR A G+V+ +M +T VL+TV +AK
Sbjct  1    MFNKFTQSFQYGEHTVTLETGEIARQATGAVLASMGDTVVLATVVAAK  48



>gb|EEZ79604.1| Polyribonucleotide nucleotidyltransferase [uncultured SUP05 cluster 
bacterium]
Length=697

 Score = 96.3 bits (238),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL+VDY EK +A G IP  F++RE  P E+E L  RLIDRPIRPLFPAGF +EVQV
Sbjct  55   QDFFPLSVDYIEKTYAAGKIPGGFLKREARPSEKETLTSRLIDRPIRPLFPAGFMNEVQV  114

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  115  LITVISAN  122


 Score = 50.4 bits (119),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  330  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            T+ F +G   ITLETG+IAR A+G+V+ +MD+T+VL TV  +K  R
Sbjct  7    TKSFAMGKHTITLETGRIARQAHGAVLASMDDTQVLVTVVGSKEMR  52



>ref|WP_028486478.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira chilensis]
Length=696

 Score = 98.2 bits (243),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F++REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLTVNYQEKAYAAGRIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGFLNEVQV  112

Query  652  MASVLSSD  675
            +A+V++ D
Sbjct  113  IATVVALD  120


 Score = 48.1 bits (113),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   ++ F+ G  ++TLETG+IAR A+G+V++ M +T+VL TV +AK  +  +
Sbjct  1    MAKISKSFQYGQHQVTLETGEIARQADGAVMIGMGDTRVLVTVVAAKSAKEGQ  53



>ref|WP_038136585.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira sp. 
Milos-T1]
Length=697

 Score = 98.6 bits (244),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV YQEK +A G IP  F++REG P E+E L  RLIDRPIRPLFP GF +EVQ+
Sbjct  53   QDFFPLTVQYQEKAYAAGKIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGFMNEVQI  112

Query  652  MASVLSSD  675
            +A+V+S D
Sbjct  113  IATVVSLD  120


 Score = 47.0 bits (110),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F+ G  ++TLETG+IAR A+G+V+++M +TK+L TV +AK  +  +
Sbjct  8    FQYGKHQVTLETGEIARQADGAVMVSMGDTKLLVTVVAAKSMKEGQ  53



>ref|WP_011381841.1| polyribonucleotide nucleotidyltransferase [Nitrosospira multiformis]
 sp|Q2Y5X9.1|PNP_NITMU RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Nitrosospira 
multiformis ATCC 25196]
 gb|ABB75842.1| 3' exoribonuclease [Nitrosospira multiformis ATCC 25196]
Length=701

 Score =   106 bits (264),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDYQE+ +A G IP +F +REG P E+E+L  RLIDRPIRPLFP  FY+EVQV
Sbjct  52   QDFFPLTVDYQERSYAAGRIPGSFFKREGRPSEKEILTSRLIDRPIRPLFPENFYNEVQV  111

Query  652  MASVLSSD  675
            +A+VLSSD
Sbjct  112  VATVLSSD  119


 Score = 39.3 bits (90),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  348  GSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            GS ++T ETG+IAR A+ +++++M +T VL TV  AK  +  +
Sbjct  10   GSHQLTFETGEIARQAHAAIMVSMGDTVVLVTVVGAKSAKQGQ  52



>ref|WP_004260595.1| polynucleotide phosphorylase/polyadenylase [Thauera sp. 63]
 gb|ENO77114.1| polynucleotide phosphorylase/polyadenylase [Thauera sp. 63]
Length=699

 Score = 95.9 bits (237),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E+L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGFFKREGRPSEKEILTSRLIDRPIRPLFPEGFMNEVQV  113

Query  652  MASVLS  669
            + +VLS
Sbjct  114  IVTVLS  119


 Score = 49.3 bits (116),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +L +  + F  G+  +TLETG++AR A G+V++ MDET VL+TV +AK  R  +
Sbjct  1    MLNAIKKTFAYGAHTVTLETGEVARQAGGAVIVNMDETVVLATVVAAKEARPGQ  54



>sp|Q31GJ9.1|PNP_THICR RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Thiomicrospira 
crunogena XCL-2]
 gb|ABB41724.1| Polyribonucleotide nucleotidyltransferase [Thiomicrospira crunogena 
XCL-2]
Length=694

 Score = 99.0 bits (245),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +   A +DF PLTV YQEK +A G IP  F++REG P E+E L  RLIDRPIRPLFP GF
Sbjct  47   KNAKAGQDFFPLTVQYQEKAYAAGRIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGF  106

Query  634  YHEVQVMASVLSSD  675
             +EVQV+A+V+S D
Sbjct  107  MNEVQVIATVVSLD  120


 Score = 46.2 bits (108),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +  F + F+ G  ++  ETG+IAR A+G+V++AM +T++L TV  AK  ++ +
Sbjct  1    MSKFIKSFQYGKHEVRFETGEIARQADGAVMVAMGDTQLLVTVVGAKNAKAGQ  53



>gb|AIL12790.1| polynucleotide phosphorylase/polyadenylase [Candidatus Caedibacter 
acanthamoebae]
Length=701

 Score = 99.0 bits (245),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  478  FLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVMA  657
            F PLTV YQEK FA G IP  F +REG P E+E+L  RLIDRPIRPLFP GFY+EVQ++ 
Sbjct  56   FFPLTVHYQEKAFAAGKIPGGFFKREGKPSEKEVLTSRLIDRPIRPLFPEGFYNEVQIIC  115

Query  658  SVLSSD  675
            ++LS D
Sbjct  116  TLLSHD  121


 Score = 45.8 bits (107),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +E + G R++ LETGKIAR A+G+VV    ET VL TV  AK
Sbjct  7    QELDWGGRQLVLETGKIARQADGAVVATYGETSVLCTVVGAK  48



>ref|WP_006474939.1| polyribonucleotide nucleotidyltransferase [endosymbiont of Tevnia 
jerichonana]
 gb|EGW54174.1| polyribonucleotide nucleotidyltransferase [endosymbiont of Tevnia 
jerichonana (vent Tica)]
Length=699

 Score = 97.1 bits (240),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PLTVDYQEK +A G IP  F RREG P E+E+L  RLIDRPIRPLFP G+  EVQV
Sbjct  52   RDFFPLTVDYQEKTYAAGKIPGGFFRREGRPSEKEILTSRLIDRPIRPLFPKGYNSEVQV  111

Query  652  MASVLS  669
            + +V S
Sbjct  112  ILTVKS  117


 Score = 47.8 bits (112),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  324  SFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASA  455
            +  +EF+ G  K++LETG+IAR A+G+V++ MD+T VL+TV  A
Sbjct  3    AIKKEFQWGEHKVSLETGEIARQADGAVLVNMDDTVVLATVVGA  46



>emb|CCA84441.1| polyribonucleotide nucleotidyltransferase [Ralstonia syzygii 
R24]
Length=722

 Score = 95.1 bits (235),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VVHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51



>ref|WP_043108091.1| polynucleotide phosphorylase/polyadenylase [endosymbiont of unidentified 
scaly snail isolate Monju]
Length=698

 Score =   101 bits (251),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PLTVDYQEK +A G+IP  F RREG P E+E+L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLTVDYQEKTYAAGIIPGGFFRREGRPSEKEILTARLIDRPIRPLFPKGFTNEVQV  112

Query  652  MASVLS  669
            + +V+S
Sbjct  113  ICTVMS  118


 Score = 43.5 bits (101),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +EF+ G  K+ LETG+IAR A+G+V++ M +T VL TV   K     R
Sbjct  6    KEFQYGDHKVVLETGEIARQADGAVMVNMGDTVVLCTVVYEKNASVER  53



>ref|WP_045653504.1| polynucleotide phosphorylase/polyadenylase [Gammaproteobacteria 
bacterium BRH_c0]
 gb|KJS04656.1| polynucleotide phosphorylase/polyadenylase [Gammaproteobacteria 
bacterium BRH_c0]
Length=709

 Score = 98.6 bits (244),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFPAG+ +EVQV+
Sbjct  54   DFFPLTVNYQEKAYAAGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPAGYKNEVQVI  113

Query  655  ASVLSSD  675
             +VLS+D
Sbjct  114  CTVLSAD  120


 Score = 46.2 bits (108),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +    + F+ G   +TLETG+IAR A G+V+  MD T VL TV  AK
Sbjct  1    MNPIIKSFQYGKHTVTLETGRIARQATGAVLCTMDNTSVLCTVVGAK  47



>ref|WP_003272823.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 emb|CBJ42618.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
CFBP2957]
 emb|CCF99005.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
K60-1]
Length=720

 Score = 95.1 bits (235),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VVHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48



>ref|WP_042548930.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
Length=726

 Score = 95.1 bits (235),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VVHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48



>ref|WP_014616649.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|AEG68667.1| polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
Po82]
 gb|EUJ15321.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum 
P673]
Length=724

 Score = 95.1 bits (235),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VVHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48



>ref|WP_003261921.1| polynucleotide phosphorylase/polyadenylase, partial [Ralstonia 
solanacearum]
 gb|EAP74167.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
UW551]
 gb|KEI32285.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|KFX29171.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|KFX79511.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|KFX84831.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|KFZ95149.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
Length=720

 Score = 95.1 bits (235),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VVHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48



>emb|CBJ50723.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
PSI07]
 emb|CCA81989.1| polyribonucleotide nucleotidyltransferase [blood disease bacterium 
R229]
Length=722

 Score = 95.1 bits (235),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VVHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51



>ref|WP_015467428.1| Polyribonucleotide nucleotidyltransferase [Micavibrio aeruginosavorus]
 gb|AGH97885.1| Polyribonucleotide nucleotidyltransferase [Micavibrio aeruginosavorus 
EPB]
Length=715

 Score = 95.1 bits (235),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL+V YQEK +A G IP  F +REG P E+E+L  RLIDRP+RPLFP GF +EVQV
Sbjct  54   QDFFPLSVHYQEKAYAAGKIPGGFFKREGRPSEKEVLVSRLIDRPVRPLFPEGFLNEVQV  113

Query  652  MASVLSSD  675
            +A+V++ D
Sbjct  114  IATVVAHD  121


 Score = 49.7 bits (117),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + +EFE+G +K+ LETGKIAR A+G+V+  M  T VL TV  A+  R  +
Sbjct  5    YRKEFELGGKKVVLETGKIARQADGAVMATMGGTTVLCTVVGARSLREGQ  54



>ref|WP_014102652.1| polynucleotide phosphorylase [Micavibrio aeruginosavorus]
 gb|AEP09429.1| S1 RNA binding domain protein [Micavibrio aeruginosavorus ARL-13]
Length=715

 Score = 95.1 bits (235),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL+V YQEK +A G IP  F +REG P E+E+L  RLIDRP+RPLFP GF +EVQV
Sbjct  54   QDFFPLSVHYQEKAYAAGKIPGGFFKREGRPSEKEVLVSRLIDRPVRPLFPEGFLNEVQV  113

Query  652  MASVLSSD  675
            +A+V++ D
Sbjct  114  IATVVAHD  121


 Score = 49.7 bits (117),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + +EFE+G +K+ LETGKIAR A+G+V+  M  T VL TV  A+  R  +
Sbjct  5    YRKEFELGGKKVVLETGKIARQADGAVMATMGGTTVLCTVVGARSLREGQ  54



>ref|WP_014834137.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|AFM67297.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
DK2]
Length=701

 Score = 95.5 bits (236),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.9 bits (115),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_020748132.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum]
 emb|CBJ37512.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
CMR15]
Length=717

 Score = 94.7 bits (234),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VIHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51



>ref|WP_018410895.1| polynucleotide phosphorylase/polyadenylase [Methyloversatilis 
sp. NVD]
Length=707

 Score = 97.1 bits (240),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYAEKFYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPDGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  IVQVLS  121


 Score = 47.4 bits (111),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +L +  +EF  G++K+ LETG+IAR ++G+V++ ++ET VL+TV + K  +
Sbjct  3    LLNAIRKEFMFGTQKVVLETGEIARQSSGAVIVNIEETVVLATVVAQKSAK  53



>ref|WP_033947553.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 95.5 bits (236),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_028499888.1| polynucleotide phosphorylase/polyadenylase [Microvirgula aerodenitrificans]
Length=703

 Score = 98.2 bits (243),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY E+ +A G IP  F +REG   E+E+L  RLIDRPIRPLFPAGFYH+VQ+
Sbjct  54   QDFFPLTVDYYERTYAAGKIPGGFFKREGKQSEKEILTCRLIDRPIRPLFPAGFYHDVQI  113

Query  652  MASVLS  669
            +A+V+S
Sbjct  114  VATVMS  119


 Score = 45.8 bits (107),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + + F++ F+ G   +TLETG+IAR A GSV++ MD+T VL  V   K
Sbjct  1    MFKKFSKTFQYGRHTVTLETGEIARQAQGSVLVTMDDTVVLVAVTVNK  48



>ref|WP_038530324.1| polynucleotide phosphorylase/polyadenylase [Azospirillum brasilense]
 gb|EZQ07399.1| polynucleotide phosphorylase/polyadenylase [Azospirillum brasilense]
 gb|AIB13166.1| polynucleotide phosphorylase/polyadenylase [Azospirillum brasilense]
Length=706

 Score = 94.0 bits (232),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  F +REG P E+E L  RLIDRPIRPLF  GF +E QV+
Sbjct  55   DFFPLTVNYQEKSFAAGKIPGGFFKREGRPTEKETLVSRLIDRPIRPLFADGFRNETQVI  114

Query  655  ASVLSSD  675
             +VLS D
Sbjct  115  CTVLSHD  121


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + + F +E E G RK+T ETGKIAR A+G+V++   ET VL TV  AK
Sbjct  1    MFKVFRKEIEWGGRKLTFETGKIARQADGAVLVTYGETTVLCTVVGAK  48



>ref|WP_014238841.1| polynucleotide phosphorylase [Azospirillum brasilense]
 emb|CCC96519.1| polynucleotide phosphorylase [Azospirillum brasilense Sp245]
Length=706

 Score = 94.0 bits (232),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  F +REG P E+E L  RLIDRPIRPLF  GF +E QV+
Sbjct  55   DFFPLTVNYQEKSFAAGKIPGGFFKREGRPTEKETLVSRLIDRPIRPLFADGFRNETQVI  114

Query  655  ASVLSSD  675
             +VLS D
Sbjct  115  CTVLSHD  121


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + + F +E E G RK+T ETGKIAR A+G+V++   ET VL TV  AK
Sbjct  1    MFKVFRKEIEWGGRKLTFETGKIARQADGAVLVTYGETTVLCTVVGAK  48



>ref|WP_035670107.1| polynucleotide phosphorylase/polyadenylase [Azospirillum brasilense]
Length=706

 Score = 94.0 bits (232),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  F +REG P E+E L  RLIDRPIRPLF  GF +E QV+
Sbjct  55   DFFPLTVNYQEKSFAAGKIPGGFFKREGRPTEKETLVSRLIDRPIRPLFADGFRNETQVI  114

Query  655  ASVLSSD  675
             +VLS D
Sbjct  115  CTVLSHD  121


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + + F +E E G RK+T ETGKIAR A+G+V++   ET VL TV  AK
Sbjct  1    MFKVFRKEIEWGGRKLTFETGKIARQADGAVLVTYGETTVLCTVVGAK  48



>ref|WP_034619147.1| polynucleotide phosphorylase/polyadenylase [Chitinibacter tainanensis]
Length=722

 Score = 97.4 bits (241),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTVDY E+ +A G IP  F +REG P E+E+L  RLIDRPIRPLFP GFY+++
Sbjct  58   AGQDFFPLTVDYFERTYAAGKIPGGFFKREGKPSEKEVLTSRLIDRPIRPLFPEGFYNDI  117

Query  646  QVMASVLS  669
            Q++A+V+S
Sbjct  118  QIVATVMS  125


 Score = 46.2 bits (108),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 20/59 (34%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +3

Query  300  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + G  +    ++ F  G   +T+ETG+IAR A G+V++ MD+T VL +V +A+  ++ +
Sbjct  2    LKGQNVFNKISKSFTFGKHNVTIETGEIARQATGAVMVNMDDTVVLVSVVAARDVKAGQ  60



>ref|WP_024916751.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa]
Length=701

 Score = 95.1 bits (235),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_011001999.1| polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum]
 sp|Q8XXP6.1|PNP_RALSO RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Ralstonia 
solanacearum GMI1000]
 emb|CAD15774.1| probable polyribonucleotide nucleotidyltransferase protein [Ralstonia 
solanacearum GMI1000]
Length=717

 Score = 94.4 bits (233),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VIHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51



>ref|WP_016727045.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
Length=717

 Score = 94.4 bits (233),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VIHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51



>ref|WP_016722935.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|AGH84535.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
FQY_4]
 gb|ESS49358.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum 
SD54]
Length=717

 Score = 94.4 bits (233),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VIHVLS  119


 Score = 49.7 bits (117),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51



>ref|WP_011737843.1| polyribonucleotide nucleotidyltransferase [Candidatus Ruthia 
magnifica]
 sp|A1AWB1.1|PNP_RUTMC RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Candidatus 
Ruthia magnifica str. Cm (Calyptogena magnifica)]
 gb|ABL02218.1| Polyribonucleotide nucleotidyltransferase [Candidatus Ruthia 
magnifica str. Cm (Calyptogena magnifica)]
Length=695

 Score = 94.4 bits (233),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL+VDY EK +A G IP  F++RE  P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLSVDYIEKTYAAGKIPGGFLKREARPSEKETLTSRLIDRPIRPLFPNGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  LITVISAN  120


 Score = 49.7 bits (117),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            T+ F +G   ITLETG+IAR A+G+V+++MD+T+VL TV  +K
Sbjct  5    TKSFVMGKHTITLETGRIARQAHGAVLVSMDDTQVLVTVVGSK  47



>ref|WP_029010755.1| polynucleotide phosphorylase/polyadenylase [Azospirillum halopraeferens]
Length=709

 Score = 94.4 bits (233),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  F +REG P E+E L  RLIDRPIRPLF  GF +E QV+
Sbjct  55   DFFPLTVNYQEKTFAAGKIPGGFFKREGRPTEKETLVSRLIDRPIRPLFAKGFRNETQVI  114

Query  655  ASVLSSD  675
             +VLS D
Sbjct  115  CTVLSHD  121


 Score = 49.7 bits (117),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F +E + G RK+TLETGKIAR A+G+V++   ET VL TV +AK
Sbjct  5    FRKEIDWGGRKLTLETGKIARQADGAVMVTYGETTVLCTVVAAK  48



>ref|WP_013835409.1| polynucleotide phosphorylase/polyadenylase [Thioalkalimicrobium 
cyclicum]
 gb|AEG31631.1| Polyribonucleotide nucleotidyltransferase [Thioalkalimicrobium 
cyclicum ALM1]
Length=694

 Score = 97.1 bits (240),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK FA G IP  F++REG P E E L  RLIDRPIRPLFP GF +EVQ+
Sbjct  53   QDFFPLTVNYQEKAFAAGKIPGGFLKREGRPSEYETLTSRLIDRPIRPLFPKGFMNEVQI  112

Query  652  MASVLSSD  675
            +A+VL+ D
Sbjct  113  IATVLALD  120


 Score = 46.6 bits (109),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F+ G  ++TLETG+IAR A+G+V++ M +T+VL TV  AK
Sbjct  8    FQYGQHQVTLETGEIARQADGAVIVGMGDTRVLVTVVGAK  47



>ref|WP_045845301.1| polynucleotide phosphorylase/polyadenylase [Aquitalea magnusonii]
 gb|KJV33618.1| polynucleotide phosphorylase/polyadenylase [Aquitalea magnusonii]
Length=715

 Score = 98.2 bits (243),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY E+ +A G IP  F +REG   E+E+L  RLIDRPIRPLFP GFYH+VQ+
Sbjct  54   QDFFPLTVDYLERTYAAGKIPGGFFKREGKQSEKEVLTSRLIDRPIRPLFPEGFYHDVQI  113

Query  652  MASVLS  669
            +A+VLS
Sbjct  114  VATVLS  119


 Score = 45.8 bits (107),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
             T+ F+ G++ +TLETG++AR A+GSV++++DET VL  V   K
Sbjct  5    ITKTFQYGNQTVTLETGEVARQASGSVIVSVDETVVLVAVVGGK  48



>ref|WP_018605804.1| polynucleotide phosphorylase/polyadenylase [Uliginosibacterium 
gangwonense]
Length=700

 Score = 97.8 bits (242),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYMEKFYAAGRIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPDGFYNEVQV  113

Query  652  MASVLSSD  675
            +A+VLS +
Sbjct  114  VATVLSQN  121


 Score = 46.2 bits (108),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  324  SFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +  + F+ G   +T ETG++AR A+G+V++ MD+T VL+TV  AK
Sbjct  4    AIKKSFQYGQHTVTFETGEVARQAHGAVIVTMDDTVVLATVVGAK  48



>ref|WP_039597857.1| polynucleotide phosphorylase/polyadenylase [Ralstonia sp. A12]
 gb|KHK56360.1| polynucleotide phosphorylase/polyadenylase [Ralstonia sp. A12]
Length=724

 Score = 94.7 bits (234),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 49.3 bits (116),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKIVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50



>ref|WP_045206183.1| polynucleotide phosphorylase/polyadenylase [Burkholderiaceae 
bacterium 26]
 gb|KJJ95118.1| polynucleotide phosphorylase/polyadenylase [Burkholderiaceae 
bacterium 26]
Length=722

 Score = 94.7 bits (234),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VIHVLS  119


 Score = 49.3 bits (116),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48



>ref|WP_024975286.1| polynucleotide phosphorylase/polyadenylase [Ralstonia pickettii]
Length=722

 Score = 94.7 bits (234),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VIHVLS  119


 Score = 49.3 bits (116),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48



>ref|WP_004332750.1| polynucleotide phosphorylase/polyadenylase [Thauera linaloolentis]
 gb|ENO90502.1| polynucleotide phosphorylase/polyadenylase [Thauera linaloolentis 
47Lol = DSM 12138]
Length=699

 Score = 94.7 bits (234),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E+L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGFFKREGRPTEKEILTSRLIDRPIRPLFPEGFMNEVQV  113

Query  652  MASVLS  669
            + +VLS
Sbjct  114  IVTVLS  119


 Score = 48.9 bits (115),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +L +  + F  G+  +TLETG++AR A G+V++ MDET VL+TV  AK  R  +
Sbjct  1    MLNAIKKTFAYGAHTVTLETGEVARQAGGAVIVNMDETVVLATVVGAKEARPGQ  54



>ref|WP_033374647.1| polynucleotide phosphorylase/polyadenylase [Leeia oryzae]
Length=714

 Score =   101 bits (251),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDYQE+ +A G IP  F +REG P E+E+L  RLIDRP+RPLFP GF++E+Q+
Sbjct  57   QDFFPLTVDYQERTYAAGKIPGGFFKREGRPSEKEILVSRLIDRPLRPLFPEGFFNEIQI  116

Query  652  MASVLSSD  675
            +A+V+S D
Sbjct  117  VATVMSVD  124


 Score = 42.7 bits (99),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASA  455
            L S  + F+ G   +TLETG+IAR A G+V+ +M +T VL +V +A
Sbjct  5    LSSVKKSFQYGQHTVTLETGEIARQATGAVMASMGDTVVLVSVVAA  50



>ref|WP_018402066.1| polynucleotide phosphorylase/polyadenylase [gamma proteobacterium 
SCGC AB-629-P17]
Length=697

 Score = 94.7 bits (234),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PL+VDY EK +A G IP  F++REG P E+E L  RLIDRPIRPLFP G+ +EV
Sbjct  53   AGQDFFPLSVDYIEKTYAAGKIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPNGYMNEV  112

Query  646  QVMASVLSSD  675
            QVM  V+S++
Sbjct  113  QVMIQVISAN  122


 Score = 48.9 bits (115),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + F +G+ +IT ETG+IAR A+G+V+ +MD+T+VL +V  AK  R+ +
Sbjct  8    KSFTLGNSQITFETGRIARQAHGAVLASMDDTQVLVSVVGAKEARAGQ  55



>ref|WP_024300413.1| polynucleotide phosphorylase/polyadenylase [Methyloversatilis 
sp. FAM1]
Length=704

 Score = 97.1 bits (240),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GFY+EV
Sbjct  52   AGQDFFPLTVDYAEKFYAAGRIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPEGFYNEV  111

Query  646  QVMASVLS  669
            QV+  VLS
Sbjct  112  QVIVQVLS  119


 Score = 46.6 bits (109),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +L +  +EF  G++K+ LETG+IAR ++G+V++ ++ET VL+TV + K  ++ +
Sbjct  1    MLNATRKEFMFGTQKVVLETGEIARQSSGAVIVNVEETVVLATVVAQKSAKAGQ  54



>ref|WP_004630820.1| polyribonucleotide nucleotidyltransferase [Ralstonia pickettii]
 gb|ENZ77415.1| polyribonucleotide nucleotidyltransferase [Ralstonia pickettii 
OR214]
Length=724

 Score = 94.7 bits (234),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 48.9 bits (115),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50



>ref|WP_037027177.1| polynucleotide phosphorylase/polyadenylase [Ralstonia sp. UNC404CL21Col]
Length=724

 Score = 94.7 bits (234),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 48.9 bits (115),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50



>ref|WP_024851033.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira kuenenii]
Length=697

 Score = 98.6 bits (244),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV YQEK +A G IP  F++REG P E+E L  RLIDRPIRPLFP GF +EVQ+
Sbjct  53   QDFFPLTVQYQEKAYAAGKIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGFMNEVQI  112

Query  652  MASVLSSD  675
            +A+V+S D
Sbjct  113  IATVVSLD  120


 Score = 45.1 bits (105),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +  + + F+ G  ++T ETG+IAR A+G+V+++M +T++L TV  AK  +  +
Sbjct  1    MAKYIKTFQYGKHQVTFETGEIARQADGAVMVSMGDTQLLVTVVGAKSAKEGQ  53



>ref|WP_022372624.1| polyribonucleotide nucleotidyltransferase [Sutterella sp. CAG:397]
 emb|CDD72014.1| polyribonucleotide nucleotidyltransferase [Sutterella sp. CAG:397]
Length=710

 Score = 94.7 bits (234),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G  P  F +REG P E+E L  RLIDRPIRPLFP GF++EVQV
Sbjct  56   QDFFPLTVDYIEKTYAAGKFPGGFFKREGRPSEKETLTSRLIDRPIRPLFPDGFFNEVQV  115

Query  652  MASVLSSD  675
            +  VLS D
Sbjct  116  IIHVLSVD  123


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +    T+ F+ G   +TL TG+IAR A G+VV AMD+T VL+TV + K
Sbjct  3    MFNKVTKSFQFGDHNVTLTTGEIARQATGAVVCAMDDTVVLATVVAKK  50



>ref|WP_036294238.1| polynucleotide phosphorylase/polyadenylase [Methylobacter whittenburyi]
Length=698

 Score =   102 bits (255),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDFLPLTV+YQE+ +A G IP  F RREG P E+E L  RLIDRPIRPLFP GF HEVQ+
Sbjct  53   RDFLPLTVNYQERTYAAGRIPGGFFRREGRPSEKETLTSRLIDRPIRPLFPDGFTHEVQI  112

Query  652  MASVLSSD  675
            +A+VLS D
Sbjct  113  IATVLSLD  120


 Score = 40.8 bits (94),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS  452
            F  G+ ++TLETG IAR A G+V+ +M +T VL TV +
Sbjct  8    FSFGAHQVTLETGAIARQATGAVICSMGDTVVLVTVVA  45



>ref|WP_012762310.1| polynucleotide phosphorylase/polyadenylase [Ralstonia pickettii]
 gb|ACS63177.1| Polyribonucleotide nucleotidyltransferase [Ralstonia pickettii 
12D]
Length=724

 Score = 94.7 bits (234),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 48.9 bits (115),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50



>ref|WP_029937973.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira sp. 
MA2-6]
Length=694

 Score = 98.2 bits (243),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV YQEK +A G IP  F++REG P E+E L  RLIDRPIRPLFP GF +EVQ+
Sbjct  53   QDFFPLTVQYQEKTYAAGKIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGFMNEVQI  112

Query  652  MASVLSSD  675
            +A+V+S D
Sbjct  113  IATVVSLD  120


 Score = 45.4 bits (106),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +  + + F+ G  ++ LETG+IAR A+G+V++AM +T+VL T   AK  +
Sbjct  1    MAKYVKSFQYGKHQVRLETGEIARQADGAVMVAMGDTQVLVTAVGAKSAK  50



>ref|WP_009241068.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Ralstonia]
 gb|EGY63161.1| polyribonucleotide nucleotidyltransferase [Ralstonia sp. 5_2_56FAA]
 gb|KFL20761.1| polyribonucleotide nucleotidyltransferase [Ralstonia pickettii]
Length=724

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 48.9 bits (115),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50



>gb|EFP65152.1| polyribonucleotide nucleotidyltransferase [Ralstonia sp. 5_7_47FAA]
Length=722

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VIHVLS  119


 Score = 48.9 bits (115),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48



>ref|WP_012436068.1| MULTISPECIES: polyribonucleotide nucleotidyltransferase [Ralstonia]
 sp|B2U7R6.1|PNP_RALPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Ralstonia 
pickettii 12J]
 gb|ACD27353.1| Polyribonucleotide nucleotidyltransferase [Ralstonia pickettii 
12J]
Length=724

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 48.9 bits (115),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50



>ref|WP_013417766.1| polynucleotide phosphorylase [Rhodomicrobium vannielii]
 gb|ADP69359.1| polyribonucleotide nucleotidyltransferase [Rhodomicrobium vannielii 
ATCC 17100]
Length=709

 Score = 94.7 bits (234),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  460  GDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYH  639
             D  +DF PLTV+YQEK +A G IP  + +REG P ERE L  RLIDRPIRPLF  GF +
Sbjct  50   ADPSKDFFPLTVNYQEKAYAAGKIPGGYFKREGRPTERETLVSRLIDRPIRPLFAHGFKN  109

Query  640  EVQVMASVLSSD  675
            E QV+ +VLS D
Sbjct  110  ETQVIVTVLSHD  121


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + + F EE E G RK+TLETG+IAR A+G+V+    ET VL+TV   +    S+
Sbjct  1    MFDIFREEVEWGGRKLTLETGRIARQADGAVLAHYGETSVLATVVGERDADPSK  54



>ref|WP_037233498.1| polynucleotide phosphorylase/polyadenylase [Rhodomicrobium udaipurense]
 gb|KAI95996.1| polynucleotide phosphorylase/polyadenylase [Rhodomicrobium udaipurense 
JA643]
Length=709

 Score = 94.7 bits (234),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  460  GDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYH  639
             D  +DF PLTV+YQEK +A G IP  + +REG P ERE L  RLIDRPIRPLF  GF +
Sbjct  50   ADPSKDFFPLTVNYQEKAYAAGKIPGGYFKREGRPTERETLVSRLIDRPIRPLFAHGFKN  109

Query  640  EVQVMASVLSSD  675
            E QV+ +VLS D
Sbjct  110  ETQVIVTVLSHD  121


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + + F EE E G RK+TLETG+IAR A+G+V+    ET VL+TV   +    S+
Sbjct  1    MFDIFREEVEWGGRKLTLETGRIARQADGAVLAHYGETSVLATVVGERDADPSK  54



>ref|WP_027467582.1| polynucleotide phosphorylase/polyadenylase [Deefgea rivuli]
Length=717

 Score = 99.8 bits (247),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDYQE+ +A G IP  F +REG P E+E+L  RLIDRPIRPLFP GF++++Q+
Sbjct  54   QDFFPLTVDYQERTYAAGKIPGGFFKREGKPSEKEVLTSRLIDRPIRPLFPEGFFNDIQI  113

Query  652  MASVLS  669
            +A+V+S
Sbjct  114  IATVMS  119


 Score = 43.1 bits (100),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +   FT+ F  G   +T+ETG+IAR A G+V++ +D T VL TV +A+
Sbjct  1    MFNKFTKSFAFGKNTVTIETGEIARQATGAVMVDVDGTSVLVTVVAAR  48



>ref|WP_028681348.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Pseudomonas]
Length=701

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.9 bits (115),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_036257881.1| polynucleotide phosphorylase/polyadenylase [Methylocapsa aurea]
Length=714

 Score = 96.3 bits (238),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  + +REG P E+E L  RLIDRPIRPLFP G+ +E Q++
Sbjct  55   DFFPLTVNYQEKAFAAGRIPGGYFKREGRPSEKETLVSRLIDRPIRPLFPEGYRNETQIV  114

Query  655  ASVLSSD  675
            A+VLS D
Sbjct  115  ATVLSHD  121


 Score = 46.6 bits (109),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + E   EE +   RK+ LETGKIAR A+G+V+    ET VL+TV SAK
Sbjct  1    MFEIHREELDWAGRKLVLETGKIARQADGAVLATYGETTVLATVVSAK  48



>emb|CKI17185.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_034082159.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_033941628.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa]
Length=701

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_003100524.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa]
 gb|EME91692.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PA21_ST175]
 gb|ERF06702.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
HB13]
Length=701

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_024972481.1| polynucleotide phosphorylase/polyadenylase [Ralstonia pickettii]
Length=724

 Score = 94.0 bits (232),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 48.9 bits (115),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50



>ref|WP_003095181.1| MULTISPECIES: polyribonucleotide nucleotidyltransferase [Pseudomonas]
 ref|NP_253428.1| polynucleotide phosphorylase [Pseudomonas aeruginosa PAO1]
 sp|Q9HV59.1|PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Pseudomonas 
aeruginosa PAO1]
 sp|Q02FT2.1|PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Pseudomonas 
aeruginosa UCBPP-PA14]
 sp|B7V1F2.1|PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Pseudomonas 
aeruginosa LESB58]
 gb|AAG08126.1|AE004888_1 polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1]
 gb|ABJ14123.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
UCBPP-PA14]
 gb|EAZ55965.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C3719]
 gb|EAZ61799.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
2192]
 emb|CAW29879.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
LESB58]
 gb|EFQ40756.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
39016]
 dbj|GAA20803.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
NCMG1179]
 gb|AEO77328.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
M18]
 dbj|BAK87682.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
NCGM2.S1]
 gb|EHF14215.1| polyribonucleotide nucleotidyltransferase [Pseudomonas sp. 2_1_26]
 gb|EHS36028.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
MPAO1/P1]
 gb|EHS40796.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
MPAO1/P2]
 gb|EIE48328.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PADK2_CF510]
 gb|EJY59064.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
CIG1]
 gb|EJZ71572.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PAO579]
 gb|EKA30073.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
ATCC 14886]
 gb|EKA33488.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
ATCC 700888]
 gb|EKA39187.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
ATCC 25324]
 gb|EKA40096.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
CI27]
 gb|EKA50621.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
E2]
 emb|CCQ88992.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
18A]
 gb|EMZ50294.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
str. Stone 130]
 gb|EMZ51865.1| polyribonucleotide nucleotidyltransferase [Pseudomonas sp. P179]
 gb|AGI83902.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
B136-33]
 gb|ENH90945.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PA45]
 gb|EOQ81770.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA02]
 gb|EOT07061.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA14]
 gb|EOT09503.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MSH-10]
 gb|EOT09713.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAK]
 gb|AGO42227.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
RP73]
 gb|EQL42574.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA03]
 gb|EQM88982.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
WC55]
 gb|AGV64180.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
c7447m]
 gb|AGV58493.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO581]
 gb|ERU31442.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF614]
 gb|ERU39062.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF77]
 gb|ERU46375.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C52]
 gb|ERU54459.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C51]
 gb|ERU55398.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C48]
 gb|ERU58609.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C41]
 gb|ERU64866.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C40]
 gb|ERU72070.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C23]
 gb|ERU75265.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C20]
 gb|ERU87073.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M9A.1]
 gb|ERU91363.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M8A.2]
 gb|ERU98631.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M8A.1]
 gb|ERV06739.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL18]
 gb|ERV08531.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL19]
 gb|ERV09040.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL17]
 gb|ERV27243.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL14]
 gb|ERV28001.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL16]
 gb|ERV31234.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL15]
 gb|ERV38408.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL10]
 gb|ERV39447.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL11]
 gb|ERV53760.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL08]
 gb|ERV58779.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL09]
 gb|ERV66183.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL04]
 gb|ERV66634.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL07]
 gb|ERV80402.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA027]
 gb|ERV83758.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA028]
 gb|ERV91036.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA026]
 gb|ERV98861.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA025]
 gb|ERW00150.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA024]
 gb|ERW11621.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA022]
 gb|ERW14083.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA021]
 gb|ERW15012.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA023]
 gb|ERW32986.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA019]
 gb|ERW41904.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA020]
 gb|ERW43098.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA014]
 gb|ERW48800.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA017]
 gb|ERW49890.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA018]
 gb|ERW59523.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA013]
 gb|ERW60595.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA012]
 gb|ERW71056.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA011]
 gb|ERW76626.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA006]
 gb|ERW79449.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA005]
 gb|ERW91325.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA004]
 gb|ERW97457.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA003]
 gb|ERW98972.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA002]
 gb|ERX03304.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA001]
 gb|ERX18382.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
X13273]
 gb|ERX26827.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
S35004]
 gb|ERX32285.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
19660]
 gb|ERX32786.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
U2504]
 gb|ERX33884.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
6077]
 gb|ERX43635.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
UDL]
 gb|ERX48789.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF18]
 gb|ERX54514.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
X24509]
 gb|ERX62521.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MSH3]
 gb|ERX73038.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
E2]
 gb|ERX75977.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
62]
 gb|ERX82881.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M8A.4]
 gb|ERX91064.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL25]
 gb|ERY01615.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL24]
 gb|ERY09807.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL22]
 gb|ERY10402.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL23]
 gb|ERY14196.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL21]
 gb|ERY23142.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL20]
 gb|ERY23736.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL13]
 gb|ERY38132.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL12]
 gb|ERY42412.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL05]
 gb|ERY50895.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL06]
 gb|ERY60140.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL03]
 gb|ERY60656.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL02]
 gb|ERY62991.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL01]
 gb|ERY71858.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA016]
 gb|ERY77530.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA015]
 gb|ERY88184.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA010]
 gb|ERY92053.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA009]
 gb|ERY94247.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA008]
 gb|ERZ05655.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
JJ692]
 gb|ERZ06349.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA007]
 gb|ERZ13534.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
S54485]
 gb|ERZ19498.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF5]
 gb|ERZ23304.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF27]
 gb|ERZ36520.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MSH10]
 gb|ERZ37838.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF127]
 gb|ERZ45785.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M8A.3]
 gb|AGY66880.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1-VE2]
 gb|AGY70428.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1-VE13]
 gb|ESQ63079.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
HB15]
 gb|ESR68394.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA05]
 gb|ESR94781.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
DHS01]
 gb|AHA18587.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA1]
 gb|AHA24386.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA1R]
 emb|CDH79806.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MH27]
 gb|ESZ79825.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
DHS29]
 gb|AHB58428.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
MTB-1]
 gb|ETD52048.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA07]
 gb|ETD52525.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA08]
 gb|ETD73753.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA06]
 gb|AHC67763.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LES431]
 gb|AHC79500.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
SCV20265]
 emb|CDH73492.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MH38]
 gb|ETU72025.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PS50]
 gb|ETU74364.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
Z61]
 gb|ETU83638.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA048]
 gb|ETU88825.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PS42]
 gb|ETU93488.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA047]
 gb|ETV00051.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA046]
 gb|ETV07357.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA045]
 gb|ETV13464.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA044]
 gb|ETV24829.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA043]
 gb|ETV33103.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA041]
 gb|ETV33929.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA040]
 gb|ETV49055.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA038]
 gb|ETV52173.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA039]
 gb|ETV59750.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA037]
 emb|CDI93299.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PA38182]
 gb|AHH48864.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
YL84]
 gb|EVT87895.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA09]
 gb|EWH24220.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
SG17M]
 gb|AHK85993.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESlike5]
 gb|AHK91873.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESlike7]
 gb|AHK97868.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LES400]
 gb|AHL03834.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESB65]
 gb|AHL09757.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESlike1]
 gb|AHL15713.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESlike4]
 gb|EYU02836.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA99]
 gb|EYU08485.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA103]
 gb|AHW73465.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PA96]
 gb|EZN44347.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH036]
 gb|EZN49649.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH033]
 gb|EZN55103.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH035]
 gb|EZN63251.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH032]
 gb|EZN68828.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH031]
 gb|EZN78309.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH030]
 gb|EZN79756.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH029]
 gb|EZN87490.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3580]
 gb|EZN88999.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3581]
 gb|EZO04855.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3577]
 gb|EZO05085.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3579]
 gb|EZO08528.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3578]
 gb|EZO17346.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3576]
 gb|EZO27910.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3575]
 gb|EZO29600.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3574]
 gb|EZO35508.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1-GFP]
 gb|EZO43719.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH060]
 gb|EZO44489.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PS75]
 gb|EZO56497.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3573]
 gb|EZO60691.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH058]
 gb|EZO65482.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH059]
 gb|EZO72397.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH057]
 gb|EZO79660.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH056]
 gb|EZO80798.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH055]
 gb|EZO92640.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH053]
 gb|EZO97093.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH054]
 gb|EZO98102.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH052]
 gb|EZP04257.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH051]
 gb|EZP18103.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH050]
 gb|EZP21720.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH049]
 gb|KAJ11316.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
ID4365]
 gb|KAJ14816.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
IGB83]
 gb|KAJ25029.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
148]
 gb|KAJ89738.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PAK]
 gb|KDR46919.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KEA11653.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
C1913C]
 gb|KEA19979.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
C2159M]
 gb|KEA27468.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
C2773C]
 gb|KEA29512.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
C0324C]
 gb|KEF94357.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KEI27501.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|AID75943.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PAO1H2O]
 gb|AID82649.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA04]
 gb|KFB20408.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PGPR2]
 dbj|BAP24535.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KFL12162.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa]
 dbj|BAP53309.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KGB87523.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KGD90895.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas sp. YS-1p]
 emb|CDM54303.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
WS394]
 gb|KHE34141.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KHE64538.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KHE64642.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 emb|CEI79666.1| Polyribonucleotide nucleotidyltransferase (EC 2.7 .7.8) (Polynucleotide 
phosphorylase) [Pseudomonas aeruginosa]
 emb|CEI11795.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa]
 gb|AJD60430.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 emb|CDM48177.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
WS136]
 gb|AJF53324.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 dbj|BAQ42516.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KJC15754.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KJC21935.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KJJ22941.1| polyribonucleotide nucleotidyltransferase [Pseudomonas sp. HMSC05H02]
Length=701

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_034039209.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_003148740.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa]
 sp|A6VCJ6.1|PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Pseudomonas 
aeruginosa PA7]
 gb|ABR85627.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA7]
 gb|KFF33142.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA01]
Length=701

 Score = 94.4 bits (233),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>gb|ADI16603.1| polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) 
[uncultured gamma proteobacterium HF0010_01E20]
Length=701

 Score =   101 bits (251),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F RREG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLTVNYQEKTYAAGKIPGGFFRREGRPSEKETLTSRLIDRPIRPLFPKGFMNEVQV  112

Query  652  MASVLSSD  675
            + +VLS+D
Sbjct  113  VCTVLSAD  120


 Score = 41.6 bits (96),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +EF+ G   + +ET K+A+ A+GSV++ +  T VL+TV  AK  R
Sbjct  6    KEFQYGDETVVMETNKVAKQASGSVIVTIGSTVVLTTVVGAKNPR  50



>ref|WP_031640855.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|ETV23171.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA042]
Length=701

 Score = 94.4 bits (233),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.5 bits (114),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>dbj|GAN59430.1| polynucleotide phosphorylase/polyadenylase [Acetobacter cibinongensis 
4H-1]
Length=719

 Score = 97.1 bits (240),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTV+YQEK +A G IP  F +REG P E E L  RLIDRPIRPLFP GF +EV
Sbjct  55   AGQDFFPLTVNYQEKAYAAGKIPGGFFKREGRPSENETLVSRLIDRPIRPLFPEGFRNEV  114

Query  646  QVMASVLSSD  675
            QV+A+VL+ D
Sbjct  115  QVIATVLTHD  124


 Score = 45.8 bits (107),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F +E E G R + LETGKIAR A+G+VV+   ET VL T   AK  ++ +
Sbjct  8    FRKEIEWGGRPLVLETGKIARQADGAVVVTYGETVVLCTAVGAKSVKAGQ  57



>ref|WP_007419106.1| polynucleotide phosphorylase/polyadenylase [Idiomarina sp. A28L]
 gb|EGN76375.1| polyribonucleotide nucleotidyltransferase [Idiomarina sp. A28L]
Length=702

 Score = 97.1 bits (240),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQE+ +A G IP  F +REG P E E L  RLIDRPIRPLFP GFY+EVQV+
Sbjct  54   DFFPLTVNYQERTYAAGKIPGGFFKREGRPSENETLTCRLIDRPIRPLFPDGFYNEVQVI  113

Query  655  ASVLS  669
            A+V+S
Sbjct  114  ATVIS  118


 Score = 45.4 bits (106),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRS  470
            +    ++F+ G   +TLETG IAR A G+V+ +MD+T VL TV   K  R+
Sbjct  1    MNPIIKQFQYGQHTVTLETGAIARQATGAVMASMDDTTVLVTVVGKKEARA  51



>dbj|GAN79291.1| polynucleotide phosphorylase/polyadenylase [Acidocella aminolytica 
101 = DSM 11237]
Length=717

 Score = 99.0 bits (245),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F +REG P ERE L  RLIDRPIRPLFP GF +EVQV
Sbjct  55   QDFFPLTVNYQEKFYAAGRIPGGFFKREGRPTERETLVSRLIDRPIRPLFPEGFRNEVQV  114

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  115  IVTVLSHD  122


 Score = 43.9 bits (102),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F +E E G + + LETGK+AR A+G+VV +  +T VL+TV  AK
Sbjct  6    FRKEMEWGGKTLILETGKVARQADGAVVASYGDTVVLATVVGAK  49



>sp|B2ICY4.1|PNP_BEII9 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Beijerinckia 
indica subsp. indica ATCC 9039]
 gb|ACB96752.1| Polyribonucleotide nucleotidyltransferase [Beijerinckia indica 
subsp. indica ATCC 9039]
Length=715

 Score = 94.7 bits (234),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  + +REG P ERE L  RLIDRPIRPLFP G+ +E QV+
Sbjct  57   DFFPLTVNYQEKAFAAGRIPGGYFKREGRPSERETLVSRLIDRPIRPLFPEGYRNETQVI  116

Query  655  ASVLSSD  675
             +VL+ D
Sbjct  117  VTVLAHD  123


 Score = 48.1 bits (113),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + E   EE E   RK+ LETGKIAR A+G++     ET VL+TV SAK
Sbjct  3    MFEIHREEIEWAGRKLVLETGKIARQADGAIFATYGETTVLATVVSAK  50



>ref|WP_011311205.1| polyribonucleotide nucleotidyltransferase [Thiobacillus denitrificans]
 sp|Q3SKX5.1|PNP_THIDA RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Thiobacillus 
denitrificans ATCC 25259]
 gb|AAZ96646.1| polyribonucleotide nucleotidyltransferase protein [Thiobacillus 
denitrificans ATCC 25259]
Length=706

 Score = 99.0 bits (245),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDYQEK +A G IP  F++RE  P E E L  RLIDRPIRPLFP GF++EVQ+
Sbjct  53   QDFFPLTVDYQEKTYAAGRIPGGFLKRESRPSEGETLISRLIDRPIRPLFPEGFFNEVQI  112

Query  652  MASVLSSD  675
            +A+V+SS+
Sbjct  113  IATVMSSN  120


 Score = 43.5 bits (101),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS  452
            F  G  ++TLETG+IAR A+G+VV+ MD+T VL TV +
Sbjct  8    FTYGRHQVTLETGEIARQASGAVVVNMDDTMVLVTVVA  45



>ref|WP_041778179.1| polynucleotide phosphorylase/polyadenylase [Beijerinckia indica]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  + +REG P ERE L  RLIDRPIRPLFP G+ +E QV+
Sbjct  55   DFFPLTVNYQEKAFAAGRIPGGYFKREGRPSERETLVSRLIDRPIRPLFPEGYRNETQVI  114

Query  655  ASVLSSD  675
             +VL+ D
Sbjct  115  VTVLAHD  121


 Score = 48.1 bits (113),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + E   EE E   RK+ LETGKIAR A+G++     ET VL+TV SAK
Sbjct  1    MFEIHREEIEWAGRKLVLETGKIARQADGAIFATYGETTVLATVVSAK  48



>ref|WP_036183478.1| polynucleotide phosphorylase/polyadenylase [Marinobacterium sp. 
AK27]
 gb|KEA64909.1| Polyribonucleotide nucleotidyltransferase [Marinobacterium sp. 
AK27]
Length=701

 Score = 93.2 bits (230),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL+V YQEK +A G IP  F +RE  P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLSVHYQEKYYAVGRIPGGFFKREARPSEKETLTSRLIDRPIRPLFPKGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S+D
Sbjct  113  VCTVMSAD  120


 Score = 49.7 bits (117),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +++ T+ F+ G   +TLETGK+AR A G+V+++MD  +VL TV  AK  +  +
Sbjct  1    MQAITKTFQYGKHSVTLETGKVARQATGAVMVSMDGVQVLCTVVGAKDTKEGQ  53



>ref|WP_018913972.1| polynucleotide phosphorylase/polyadenylase [Thiomonas sp. FB-6]
Length=705

 Score = 92.8 bits (229),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG   E E L  RLIDRPIRPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRLSEHETLTSRLIDRPIRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +A VLS
Sbjct  114  VAQVLS  119


 Score = 49.7 bits (117),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +    T+ F+ GS  +TLETG+IAR A G+V+L MD+T VL++V +AK  +
Sbjct  1    MFNKVTKSFQWGSHTVTLETGEIARQAGGAVLLNMDDTVVLASVVAAKSAK  51



>ref|WP_012697394.1| polyribonucleotide nucleotidyltransferase [Laribacter hongkongensis]
 sp|C1D8W8.1|PNP_LARHH RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Laribacter 
hongkongensis HLHK9]
 gb|ACO74908.1| Pnp [Laribacter hongkongensis HLHK9]
Length=701

 Score = 98.6 bits (244),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY E+ +A G IP  F +REG   E+E+L  RLIDRPIRPLFPAGFYH+VQV
Sbjct  54   QDFFPLTVDYYERTYAAGKIPGGFFKREGKQSEKEILTCRLIDRPIRPLFPAGFYHDVQV  113

Query  652  MASVLS  669
            +A+V+S
Sbjct  114  VATVMS  119


 Score = 43.9 bits (102),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +   F++ F+ G   + LETG+IAR A+GSV+++MD+T VL  V   K
Sbjct  1    MFNKFSKTFQYGRHTVKLETGEIARQASGSVLVSMDDTVVLVAVTVNK  48



>gb|EGK73007.1| Polyribonucleotide nucleotidyltransferase [Methyloversatilis 
universalis FAM5]
Length=705

 Score = 95.9 bits (237),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GFY+EV
Sbjct  52   AGQDFFPLTVDYAEKFYAAGRIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPEGFYNEV  111

Query  646  QVMASVLS  669
            QV+  VLS
Sbjct  112  QVIVQVLS  119


 Score = 46.6 bits (109),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +L +  +EF  G++K+ LETG+IAR ++G+V++ ++ET VL+TV + K  ++ +
Sbjct  1    MLNATRKEFMFGAQKVVLETGEIARQSSGAVIVNVEETVVLATVVAQKSAKAGQ  54



>ref|WP_029143708.1| polynucleotide phosphorylase/polyadenylase [Methyloversatilis 
universalis]
Length=704

 Score = 95.9 bits (237),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GFY+EV
Sbjct  52   AGQDFFPLTVDYAEKFYAAGRIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPEGFYNEV  111

Query  646  QVMASVLS  669
            QV+  VLS
Sbjct  112  QVIVQVLS  119


 Score = 46.6 bits (109),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +L +  +EF  G++K+ LETG+IAR ++G+V++ ++ET VL+TV + K  ++ +
Sbjct  1    MLNATRKEFMFGTQKVVLETGEIARQSSGAVIVNVEETVVLATVVAQKSAKAGQ  54



>ref|WP_015435870.1| polynucleotide phosphorylase/polyadenylase [Azoarcus sp. KH32C]
 dbj|BAL24565.1| polynucleotide phosphorylase/polyadenylase [Azoarcus sp. KH32C]
Length=700

 Score = 95.1 bits (235),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +   A +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF
Sbjct  48   KEAKAGQDFFPLTVDYVEKFYAAGRIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPDGF  107

Query  634  YHEVQVMASVLS  669
            Y+EVQ++ +VLS
Sbjct  108  YNEVQIIVTVLS  119


 Score = 47.4 bits (111),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F  G+  +TLETG+IAR A G+V++ MD+T VL+TV +AK
Sbjct  9    FAYGAHTVTLETGEIARQAGGAVIVNMDDTVVLATVVAAK  48



>ref|WP_019896234.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira halophila]
Length=695

 Score = 95.5 bits (236),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PL V YQEK +A G IP  F++REG P E+E L  RLIDRPIRPLFP GF +EV
Sbjct  51   AGQDFFPLMVQYQEKSYAAGRIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGFMNEV  110

Query  646  QVMASVLSSD  675
            QV+A+V+S D
Sbjct  111  QVIATVVSLD  120


 Score = 47.0 bits (110),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +   T+ FE G   + LETG+IAR A+G+V++AM +T++L TV +AK
Sbjct  1    MSKITKTFEYGQHTVRLETGEIARQADGAVMVAMGDTQLLVTVVAAK  47



>ref|WP_028310327.1| polynucleotide phosphorylase/polyadenylase [Derxia gummosa]
Length=705

 Score = 93.2 bits (230),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRP+RPLFP GFY++VQV
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGFFKREGKPSEKETLTSRLIDRPLRPLFPDGFYNDVQV  113

Query  652  MASVLSSD  675
            +  VLS +
Sbjct  114  VIHVLSVN  121


 Score = 49.3 bits (116),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +    T+EF+ G  K+ LETG+IAR A+G+VV+ +++T VL+TV +AK
Sbjct  1    MFNKVTKEFQYGQHKVVLETGEIARQASGAVVVNIEDTVVLATVVAAK  48



>ref|WP_006459029.1| polynucleotide phosphorylase/polyadenylase [Thioalkalimicrobium 
aerophilum]
 gb|AHF01167.1| polynucleotide phosphorylase/polyadenylase [Thioalkalimicrobium 
aerophilum AL3]
Length=694

 Score = 97.1 bits (240),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK FA G IP  F++REG P E E L  RLIDRPIRPLFP GF +EVQ+
Sbjct  53   QDFFPLTVNYQEKAFAAGKIPGGFLKREGRPSEYETLTSRLIDRPIRPLFPKGFMNEVQI  112

Query  652  MASVLSSD  675
            +A+VL+ D
Sbjct  113  IATVLALD  120


 Score = 45.4 bits (106),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F+ G  ++T ETG+IAR A+G+V++ M +T+VL TV  AK
Sbjct  8    FQYGQHQVTFETGEIARQADGAVIVGMGDTRVLVTVVGAK  47



>ref|WP_021194995.1| polynucleotide phosphorylase/polyadenylase [Ralstonia sp. AU12-08]
 gb|EPX97416.1| polynucleotide phosphorylase/polyadenylase [Ralstonia sp. AU12-08]
Length=724

 Score = 95.1 bits (235),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VVHVLS  121


 Score = 47.4 bits (111),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ +ETG+IAR A+G+V+L M++T VL+TV  AK
Sbjct  3    MFNKIVKEFQWGGHKVRMETGEIARQASGAVLLDMEDTVVLATVVGAK  50



>emb|CBW75684.1| Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8) / Polynucleotide 
adenylyltransferase (EC 2.7.7.19) [Burkholderia rhizoxinica 
HKI 454]
Length=768

 Score = 94.4 bits (233),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  100  QDFFPLTVDYIEKTYAAGKIPGGFFRREGRPSEGETLISRLIDRPLRPLFPEGFYNEVQV  159

Query  652  MASVLS  669
            +  VLS
Sbjct  160  VIHVLS  165


 Score = 48.1 bits (113),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  300  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + G K+     +EF+ G   + LETG+IAR A+G+V++ +++T VL+TV +AK
Sbjct  42   LEGVKMFNKIVKEFKWGQHNVRLETGEIARQASGAVIVDVEDTVVLATVVAAK  94



>gb|AET89543.1| polynucleotide phosphorylase/polyadenylase [Burkholderia sp. 
YI23]
Length=717

 Score = 95.5 bits (236),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  59   QDFFPLTVDYLEKTYAAGKIPGGFFRREGRPSEGETLISRLIDRPLRPLFPEGFYNEVQV  118

Query  652  MASVLS  669
            +  VLS
Sbjct  119  VIHVLS  124


 Score = 47.0 bits (110),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  300  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            M G  +     +EF+ G   + LETG+IAR A+G+V++ +++T VL+TV  AK
Sbjct  1    MKGVTMFNKIVKEFKWGQHNVRLETGEIARQASGAVIVDIEDTVVLATVVGAK  53



>ref|WP_026861866.1| polynucleotide phosphorylase/polyadenylase [Idiomarina sediminum]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQE+ +A G IP  F +REG P E E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLTVNYQERTYAAGKIPGGFFKREGRPSENETLTSRLIDRPIRPLFPEGFKNEVQV  112

Query  652  MASVLS  669
            +A+V+S
Sbjct  113  IATVVS  118


 Score = 47.8 bits (112),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +   T++FE G   +TLETG +AR A+G+V+ +MD+T VL TV + K
Sbjct  1    MNPITKQFEYGRHTVTLETGAMARQASGAVLASMDDTAVLVTVVAKK  47



>dbj|GAN67206.1| polynucleotide phosphorylase/polyadenylase [Acetobacter orientalis 
21F-2]
Length=719

 Score = 97.1 bits (240),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTV+YQEK +A G IP  F +REG P E E L  RLIDRPIRPLFP GF +EV
Sbjct  55   AGQDFFPLTVNYQEKAYAAGKIPGGFFKREGRPSEHETLVSRLIDRPIRPLFPEGFRNEV  114

Query  646  QVMASVLSSD  675
            QV+A+VL+ D
Sbjct  115  QVIATVLTHD  124


 Score = 45.1 bits (105),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + +E E G R + LETGKIAR A+G+VV+   ET VL T   AK  ++ +
Sbjct  8    YRKEIEWGGRPLVLETGKIARQADGAVVVTYGETVVLCTAVGAKNVKAGQ  57



>ref|WP_002926546.1| polynucleotide phosphorylase/polyadenylase [Thauera sp. 28]
 gb|ENO93529.1| polynucleotide phosphorylase/polyadenylase [Thauera sp. 28]
Length=699

 Score = 94.7 bits (234),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E+L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGFFKREGRPSEKEILTSRLIDRPIRPLFPDGFMNEVQV  113

Query  652  MASVLS  669
            + +VLS
Sbjct  114  IVTVLS  119


 Score = 47.8 bits (112),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F  G+  +TLETG++AR A G+V++ MDET VL+TV  AK  R  +
Sbjct  9    FAYGAHTVTLETGEVARQAGGAVIVNMDETVVLATVVGAKEARPGQ  54



>ref|WP_034032426.1| polynucleotide phosphorylase/polyadenylase, partial [Pseudomonas 
aeruginosa]
Length=359

 Score = 94.4 bits (233),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.1 bits (113),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_004322622.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Thauera]
 gb|ACK54451.1| Polyribonucleotide nucleotidyltransferase [Thauera sp. MZ1T]
 gb|ENO83427.1| polynucleotide phosphorylase/polyadenylase [Thauera aminoaromatica 
S2]
 gb|KIN89395.1| polyribonucleotide nucleotidyltransferase [Thauera sp. SWB20]
Length=699

 Score = 94.7 bits (234),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E+L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGFFKREGRPSEKEILTSRLIDRPIRPLFPDGFMNEVQV  113

Query  652  MASVLS  669
            + +VLS
Sbjct  114  IVTVLS  119


 Score = 47.8 bits (112),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F  G+  +TLETG++AR A G+V++ MDET VL+TV  AK  R  +
Sbjct  9    FAYGAHTVTLETGEVARQAGGAVIVNMDETVVLATVVGAKEARPGQ  54



>ref|WP_002936676.1| polynucleotide phosphorylase/polyadenylase [Thauera sp. 27]
 gb|ENO82443.1| polynucleotide phosphorylase/polyadenylase [Thauera sp. 27]
Length=699

 Score = 94.7 bits (234),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E+L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGFFKREGRPSEKEILTSRLIDRPIRPLFPDGFMNEVQV  113

Query  652  MASVLS  669
            + +VLS
Sbjct  114  IVTVLS  119


 Score = 47.8 bits (112),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F  G+  +TLETG++AR A G+V++ MDET VL+TV  AK  R  +
Sbjct  9    FAYGAHTVTLETGEVARQAGGAVIVNMDETVVLATVVGAKEARPGQ  54



>ref|WP_039611535.1| polynucleotide phosphorylase/polyadenylase [Pseudoalteromonas 
luteoviolacea]
 gb|KID54634.1| polynucleotide phosphorylase/polyadenylase [Pseudoalteromonas 
luteoviolacea]
Length=709

 Score = 99.0 bits (245),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F++REG P + E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLTVNYQEKMYAAGRIPGGFLKREGRPSDSETLTARLIDRPIRPLFPDGFVNEVQV  112

Query  652  MASVLSSD  675
            +A+V+SSD
Sbjct  113  IATVVSSD  120


 Score = 43.1 bits (100),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSS  473
            +++  +EF++G   +TLETG IAR A+G+V+ ++ +T VL TV    G+R +
Sbjct  1    MQAIIKEFQLGQHTVTLETGAIARQADGAVLASIGDTSVLVTVV---GKREA  49



>dbj|GAK34768.1| polyribonucleotide nucleotidyltransferase [alpha proteobacterium 
Q-1]
Length=719

 Score = 94.4 bits (233),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PLTV+YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFPA F ++ QV
Sbjct  67   RDFFPLTVNYQEKTYAAGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPAEFRNDTQV  126

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  127  ICTVLSHD  134


 Score = 47.8 bits (112),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  312  KILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            ++ E + +  E G R +TLETG+IAR A+G+VV    ET VL TV +A+     R
Sbjct  13   RMFEIYRKTIEWGGRSLTLETGRIARQADGAVVATYGETSVLCTVVAARKAEPGR  67



>ref|WP_011110817.1| polyribonucleotide nucleotidyltransferase [Nitrosomonas europaea]
 sp|Q82XT0.1|PNP_NITEU RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Nitrosomonas 
europaea ATCC 19718]
 emb|CAD84083.1| pnp; polyribonucleotide nucleotidyltransferase protein [Nitrosomonas 
europaea ATCC 19718]
Length=708

 Score =   104 bits (259),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDYQEK ++ G IP +F +REG P E+E L  RLIDRPIRPLFP GFY+EVQV
Sbjct  53   QDFFPLTVDYQEKFYSAGRIPGSFFKREGRPSEKETLTSRLIDRPIRPLFPDGFYNEVQV  112

Query  652  MASVLSSD  675
            +A VLSSD
Sbjct  113  VAMVLSSD  120


 Score = 37.7 bits (86),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  348  GSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            G   +T+ETG+IA+ A+G+V+++MD+T VL T    K
Sbjct  11   GRHTLTIETGEIAKQAHGAVIVSMDDTVVLVTAVGDK  47



>ref|WP_024006976.1| polynucleotide phosphorylase/polyadenylase [Advenella kashmirensis]
 gb|ETF00709.1| polynucleotide phosphorylase/polyadenylase [Advenella kashmirensis 
W13003]
Length=721

 Score = 95.9 bits (237),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F +REG P E+E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYVEKTYSAGRIPGGFFKREGKPSEKETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLSSD  675
            +  VLS D
Sbjct  114  IVHVLSVD  121


 Score = 46.2 bits (108),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +    T+ F+ G + + LETG+IAR A+G+VV++M ++ VL+TV +AK  +
Sbjct  1    MFNKVTKSFQYGDQTVVLETGEIARQASGAVVVSMGDSVVLATVVAAKNAK  51



>ref|WP_028466285.1| polynucleotide phosphorylase/polyadenylase [Nisaea denitrificans]
Length=703

 Score = 94.0 bits (232),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  F +REG P E+E+L  RLIDRPIRPLF  GF +E QV+
Sbjct  55   DFFPLTVNYQEKTFAAGKIPGGFFKREGRPTEKEVLTSRLIDRPIRPLFVKGFKNETQVV  114

Query  655  ASVLSSD  675
             +VLS D
Sbjct  115  CTVLSHD  121


 Score = 48.1 bits (113),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + + + +E + G RK+TLETGKIAR A+G+V+  M ET VL T   A+
Sbjct  1    MFQIYKQEIDWGGRKLTLETGKIARQADGAVMATMGETTVLCTAVYAR  48



>ref|WP_029908832.1| polynucleotide phosphorylase/polyadenylase [Hydrogenovibrio marinus]
 gb|KDN95077.1| polynucleotide phosphorylase/polyadenylase [Hydrogenovibrio marinus]
Length=697

 Score = 98.6 bits (244),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV YQEK +A G IP  F++REG P E+E L  RLIDRPIRPLFP GF +EVQ+
Sbjct  53   QDFFPLTVQYQEKAYAAGKIPGGFLKREGRPSEKETLTSRLIDRPIRPLFPKGFMNEVQI  112

Query  652  MASVLSSD  675
            +A+V+S D
Sbjct  113  IATVVSLD  120


 Score = 43.5 bits (101),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F+ G  ++T ETG+IAR A+G+V+++M +T++L TV  AK  +  +
Sbjct  8    FQYGKHQVTFETGEIARQADGAVMVSMGDTQLLVTVVGAKSAKEGQ  53



>ref|WP_031799034.1| polynucleotide phosphorylase/polyadenylase, partial [Pseudomonas 
aeruginosa]
 gb|KAJ27447.1| polynucleotide phosphorylase/polyadenylase, partial [Pseudomonas 
aeruginosa M10]
Length=653

 Score = 94.4 bits (233),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 47.8 bits (112),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_034732575.1| polynucleotide phosphorylase/polyadenylase [Idiomarina sp. MCCC 
1A10513]
 gb|KFZ28684.1| polynucleotide phosphorylase/polyadenylase [Idiomarina sp. MCCC 
1A10513]
Length=712

 Score = 94.7 bits (234),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQE+ +A G IP  F +REG P E E L  RLIDRPIRPLFP GF +EVQ+
Sbjct  53   QDFFPLTVNYQERTYAAGKIPGGFFKREGRPSENETLTSRLIDRPIRPLFPEGFKNEVQI  112

Query  652  MASVLS  669
            +A+V+S
Sbjct  113  IATVVS  118


 Score = 47.4 bits (111),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +   T++FE G   +TLETG +AR A G+V+ +MD+T VL TV + K
Sbjct  1    MNPITKQFEYGRHTVTLETGAMARQATGAVLASMDDTTVLVTVVAKK  47



>ref|WP_019682251.1| polynucleotide phosphorylase/polyadenylase, partial [Pseudomonas 
aeruginosa]
Length=554

 Score = 94.0 bits (232),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 48.1 bits (113),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_041042005.1| polynucleotide phosphorylase/polyadenylase [Magnetospirillum 
magnetotacticum]
 gb|KIL97541.1| Polyribonucleotide nucleotidyltransferase [Magnetospirillum magnetotacticum 
MS-1]
Length=720

 Score = 95.5 bits (236),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  F +REG P E+E L  RLIDRPIRPLF  GF +EVQV+
Sbjct  57   DFFPLTVNYQEKAFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFADGFRNEVQVV  116

Query  655  ASVLSSD  675
             +VLS D
Sbjct  117  CTVLSHD  123


 Score = 46.2 bits (108),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +E   G RK+ LETGKIAR A+G+V++   ET VL TV  AK ++
Sbjct  9    KEITWGGRKLVLETGKIARQADGAVLVTYGETSVLCTVVGAKSQK  53



>ref|WP_031767157.1| polynucleotide phosphorylase/polyadenylase, partial [Pseudomonas 
aeruginosa]
Length=382

 Score = 94.4 bits (233),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 47.8 bits (112),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>ref|WP_021248994.1| polynucleotide phosphorylase/polyadenylase [Thauera terpenica]
 gb|EPZ16153.1| polynucleotide phosphorylase/polyadenylase [Thauera terpenica 
58Eu]
Length=699

 Score = 95.5 bits (236),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E+L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGFFKREGRPSEKEILTSRLIDRPIRPLFPEGFMNEVQV  113

Query  652  MASVLS  669
            + +VLS
Sbjct  114  IVTVLS  119


 Score = 46.6 bits (109),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F  G+  +TLETG+IAR A G+V++ M+ET VL+TV +AK  R  +
Sbjct  9    FTYGAHSVTLETGEIARQAGGAVIVNMEETVVLATVVAAKEARPGQ  54



>ref|WP_011239110.1| polyribonucleotide nucleotidyltransferase [Aromatoleum aromaticum]
 sp|Q5NZR7.1|PNP_AROAE RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Aromatoleum 
aromaticum EbN1]
 emb|CAI09447.1| polyribonucleotide nucleotidyltransferase protein [Aromatoleum 
aromaticum EbN1]
Length=699

 Score = 95.5 bits (236),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            +   A +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF
Sbjct  48   KEAKAGQDFFPLTVDYVEKFYAAGRIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPEGF  107

Query  634  YHEVQVMASVLS  669
            Y+EVQV+ +VLS
Sbjct  108  YNEVQVIITVLS  119


 Score = 46.6 bits (109),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  324  SFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +  + F  G+  +TLETG+IAR A G+V++ MD+T VL+TV +AK  ++ +
Sbjct  4    AIKKTFAYGAHTVTLETGEIARQAGGAVIVNMDDTIVLATVVAAKEAKAGQ  54



>ref|WP_023397668.1| polyribonucleotide nucleotidyltransferase [Pseudoalteromonas 
luteoviolacea]
 gb|ESP94942.1| polyribonucleotide nucleotidyltransferase [Pseudoalteromonas 
luteoviolacea 2ta16]
Length=709

 Score = 99.0 bits (245),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F++REG P + E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLTVNYQEKMYAAGRIPGGFLKREGRPSDSETLTARLIDRPIRPLFPDGFVNEVQV  112

Query  652  MASVLSSD  675
            +A+V+SSD
Sbjct  113  IATVVSSD  120


 Score = 43.1 bits (100),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSS  473
            +++  +EF++G   +TLETG IAR A+G+V+ ++ +T VL TV    G+R +
Sbjct  1    MQAIIKEFQLGQHTVTLETGAIARQADGAVLASIGDTSVLVTVV---GKREA  49



>ref|WP_021995951.1| polyribonucleotide nucleotidyltransferase [Sutterella wadsworthensis 
CAG:135]
 emb|CCZ19007.1| polyribonucleotide nucleotidyltransferase [Sutterella wadsworthensis 
CAG:135]
Length=707

 Score = 95.5 bits (236),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF++EVQV
Sbjct  56   QDFFPLTVDYIEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPDGFFNEVQV  115

Query  652  MASVLSSD  675
            +  VLS+D
Sbjct  116  IIHVLSAD  123


 Score = 46.6 bits (109),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            T+ F  G   +TLETG+IAR A G+V+  MD+T VL+TV   K
Sbjct  8    TQSFRFGDHDVTLETGEIARQATGAVICRMDDTVVLATVVCKK  50



>ref|WP_018989817.1| polynucleotide phosphorylase/polyadenylase [Azoarcus toluclasticus]
Length=699

 Score = 95.9 bits (237),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GFY+EVQ+
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPDGFYNEVQI  113

Query  652  MASVLS  669
            + +VLS
Sbjct  114  IITVLS  119


 Score = 46.2 bits (108),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  324  SFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +  + F  G+  +T+ETG+IAR A G+V++ MD+T VL+TV +AK
Sbjct  4    AIKKTFAYGAHTVTIETGEIARQAGGAVIVNMDDTMVLATVVAAK  48



>ref|WP_005430395.1| polynucleotide phosphorylase/polyadenylase [Sutterella wadsworthensis]
 gb|EFW01867.1| polyribonucleotide nucleotidyltransferase [Sutterella wadsworthensis 
3_1_45B]
Length=707

 Score = 95.5 bits (236),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF++EVQV
Sbjct  56   QDFFPLTVDYIEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPDGFFNEVQV  115

Query  652  MASVLSSD  675
            +  VLS+D
Sbjct  116  IIHVLSAD  123


 Score = 46.6 bits (109),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            T+ F  G   +TLETG+IAR A G+V+  MD+T VL+TV   K
Sbjct  8    TQSFRFGDHDVTLETGEIARQATGAVICRMDDTVVLATVVCKK  50



>ref|WP_045787218.1| polynucleotide phosphorylase/polyadenylase [Ralstonia mannitolilytica]
 gb|AJW45688.1| polynucleotide phosphorylase/polyadenylase [Ralstonia mannitolilytica]
Length=724

 Score = 94.7 bits (234),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VVHVLS  121


 Score = 47.0 bits (110),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ +ETG+IAR A+G+V+L M++T VL+TV  AK  +
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMEDTVVLATVVGAKNAK  53



>ref|WP_004999830.1| polynucleotide phosphorylase/polyadenylase [Nitrococcus mobilis]
 gb|EAR20858.1| Polyribonucleotide nucleotidyltransferase [Nitrococcus mobilis 
Nb-231]
Length=700

 Score = 99.4 bits (246),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDFLPLTV+YQE+ +A G IP  F +REG P E+E L  RLIDRP+RPLFPAGF +EVQ+
Sbjct  53   RDFLPLTVNYQERTYAAGKIPGGFFKREGRPSEKETLVSRLIDRPVRPLFPAGFTNEVQI  112

Query  652  MASVLSSD  675
            +A+V+S +
Sbjct  113  VATVISMN  120


 Score = 42.4 bits (98),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFSTP  488
            F+ G   +TLETG+IAR A+G+V++ M +T VL TV   K +   R   P
Sbjct  8    FQYGDHTVTLETGRIARQASGAVMVNMSDTVVLVTVVGKKDQGEPRDFLP  57



>ref|WP_004382555.1| polynucleotide phosphorylase/polyadenylase [Thauera phenylacetica]
 gb|ENO94964.1| polynucleotide phosphorylase/polyadenylase [Thauera phenylacetica 
B4P]
Length=699

 Score = 94.4 bits (233),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E+L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGFFKREGRPSEKEILTSRLIDRPIRPLFPDGFMNEVQV  113

Query  652  MASVLS  669
            + +VLS
Sbjct  114  IITVLS  119


 Score = 47.8 bits (112),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            F  G+  +TLETG++AR A G+V++ MDET VL+TV  AK  R  +
Sbjct  9    FAYGAHTVTLETGEVARQAGGAVIVNMDETVVLATVVGAKEARPGQ  54



>ref|WP_008171541.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Marinobacter]
 gb|EHJ05379.1| polynucleotide phosphorylase/polyadenylase [Marinobacter manganoxydans 
MnI7-9]
Length=706

 Score = 89.4 bits (220),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +1

Query  478  FLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVMA  657
            F PLTV+Y EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV+ 
Sbjct  57   FFPLTVNYFEKTYAVGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPNGFMNEVQVIT  116

Query  658  SVLSS  672
            +V+SS
Sbjct  117  TVMSS  121


 Score = 52.4 bits (124),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            L+ F + FE+G + +TLETG+IAR A GSV++ +D+  VL TV  AK
Sbjct  3    LKPFKKSFELGGKTVTLETGRIARQATGSVLVTVDDISVLGTVVGAK  49



>ref|WP_026606468.1| polynucleotide phosphorylase/polyadenylase [Methylocapsa acidiphila]
Length=714

 Score = 93.6 bits (231),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK FA G IP  + +REG P E+E L  RLIDRPIRPLFP G+ ++ QV
Sbjct  54   QDFFPLTVNYQEKAFAAGRIPGGYFKREGRPSEKETLVSRLIDRPIRPLFPEGYRNDTQV  113

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  114  VVTVLSHD  121


 Score = 48.1 bits (113),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + E   EE +   RK+ LETGKIAR A+G+VV    ET VL+TV SAK
Sbjct  1    MFEIHREEIDWAGRKLVLETGKIARQADGAVVATYGETTVLATVVSAK  48



>ref|WP_007421553.1| MULTISPECIES: polynucleotide phosphorylase [Acidiphilium]
 gb|EGO96771.1| Polyribonucleotide nucleotidyltransferase [Acidiphilium sp. PM]
 gb|KDM67436.1| polyribonucleotide nucleotidyltransferase Pnp [Acidiphilium sp. 
JA12-A1]
 dbj|GAN73013.1| polynucleotide phosphorylase/polyadenylase [Acidiphilium multivorum 
AIU301]
Length=716

 Score = 95.9 bits (237),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F +REG P ERE L  RLIDRPIRPLFP GF +EVQV
Sbjct  55   QDFFPLTVNYQEKFYAAGRIPGGFFKREGRPTERETLTSRLIDRPIRPLFPHGFRNEVQV  114

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  115  IVNVLSHD  122


 Score = 45.8 bits (107),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F +E + G RK+ LETGK+AR A+G+VV +  +T VL+TV  A+
Sbjct  6    FRKELDWGGRKLILETGKVARQADGAVVASYGDTVVLATVVGAR  49



>sp|A5FVG2.1|PNP_ACICJ RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Acidiphilium 
cryptum JF-5]
 gb|ABQ29594.1| Polyribonucleotide nucleotidyltransferase [Acidiphilium cryptum 
JF-5]
 dbj|BAJ79806.1| polyribonucleotide nucleotidyltransferase [Acidiphilium multivorum 
AIU301]
Length=717

 Score = 95.9 bits (237),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F +REG P ERE L  RLIDRPIRPLFP GF +EVQV
Sbjct  56   QDFFPLTVNYQEKFYAAGRIPGGFFKREGRPTERETLTSRLIDRPIRPLFPHGFRNEVQV  115

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  116  IVNVLSHD  123


 Score = 45.8 bits (107),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F +E + G RK+ LETGK+AR A+G+VV +  +T VL+TV  A+
Sbjct  7    FRKELDWGGRKLILETGKVARQADGAVVASYGDTVVLATVVGAR  50



>ref|WP_011765834.1| polyribonucleotide nucleotidyltransferase [Azoarcus sp. BH72]
 sp|A1K7B5.1|PNP_AZOSB RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Azoarcus 
sp. BH72]
 emb|CAL94720.1| polyribonucleotide nucleotidyltransferase [Azoarcus sp. BH72]
Length=699

 Score = 97.4 bits (241),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            + +VLS
Sbjct  114  IVTVLS  119


 Score = 44.3 bits (103),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  324  SFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +  + F  G+  +TLETG++AR A G+V++ +D+T VL+TV +AK
Sbjct  4    AIKKTFTYGAHTVTLETGEVARQAGGAVIVNVDDTVVLATVVAAK  48



>ref|WP_011484169.1| polyribonucleotide nucleotidyltransferase [Polaromonas sp. JS666]
 sp|Q127W8.1|PNP_POLSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Polaromonas 
sp. JS666]
 gb|ABE45174.1| Polyribonucleotide nucleotidyltransferase [Polaromonas sp. JS666]
Length=707

 Score = 94.7 bits (234),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP +F +REG P E E L  RLIDRPIRPLFP GF++EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGRIPGSFFKREGRPSEFETLTSRLIDRPIRPLFPEGFFNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 47.0 bits (110),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS  452
            I    T+ F+ G  K+T+ETG++AR A+G+VV+ MD T VL+TV +
Sbjct  3    IFNKVTKSFQWGQHKVTMETGEVARQASGAVVVDMDGTVVLATVVA  48



>ref|WP_043512933.1| polynucleotide phosphorylase/polyadenylase [Halomonas sp. BC04]
Length=715

 Score = 94.0 bits (232),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  58   QDFFPLAVFYQEKTYAVGKIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPKGFMNEVQV  117

Query  652  MASVLSSD  675
            + +VLS+D
Sbjct  118  ICTVLSTD  125


 Score = 47.4 bits (111),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F+ G   +TLETG+IAR ANG+V++ MD+T VL TV + K
Sbjct  13   FQYGRSTVTLETGRIARQANGAVMVTMDDTVVLCTVVAKK  52



>ref|WP_033157375.1| polynucleotide phosphorylase/polyadenylase [Methylomonas sp. 
LW13]
Length=692

 Score = 98.2 bits (243),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTVDYQEK FA G IP  F +REG P E E L  RLIDRPIRPLFP GF +EVQ++
Sbjct  53   DFFPLTVDYQEKAFAAGKIPGGFFKREGRPSENETLISRLIDRPIRPLFPEGFTNEVQII  112

Query  655  ASVLS  669
            A+VLS
Sbjct  113  ATVLS  117


 Score = 43.5 bits (101),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +    ++F+ G R +TLETG+IAR ANG+V++ ++ T +L TV   K
Sbjct  1    MNPIRKQFQYGDRLVTLETGEIARQANGAVIIDVEGTTLLVTVVGKK  47



>ref|WP_017432542.1| polynucleotide phosphorylase/polyadenylase [Burkholderia glumae]
 gb|AJY66827.1| polyribonucleotide nucleotidyltransferase [Burkholderia glumae 
LMG 2196 = ATCC 33617]
Length=709

 Score = 95.5 bits (236),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F+RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFLRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.8 bits (107),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDVEDTVVLATVVGAKNAK  53



>gb|EWH02122.1| polynucleotide phosphorylase/polyadenylase [Halomonas sp. BC04]
Length=710

 Score = 94.0 bits (232),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLAVFYQEKTYAVGKIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPKGFMNEVQV  112

Query  652  MASVLSSD  675
            + +VLS+D
Sbjct  113  ICTVLSTD  120


 Score = 47.4 bits (111),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F+ G   +TLETG+IAR ANG+V++ MD+T VL TV + K
Sbjct  8    FQYGRSTVTLETGRIARQANGAVMVTMDDTVVLCTVVAKK  47



>ref|WP_031798811.1| polynucleotide phosphorylase/polyadenylase, partial [Pseudomonas 
aeruginosa]
Length=411

 Score = 93.6 bits (231),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQV  112

Query  652  MASVLSSD  675
            + +V+S++
Sbjct  113  VCTVVSTN  120


 Score = 47.8 bits (112),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53



>gb|ADP98827.1| polynucleotide phosphorylase/polyadenylase [Marinobacter adhaerens 
HP15]
Length=727

 Score = 89.0 bits (219),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +1

Query  478  FLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVMA  657
            F PLTV+Y EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV+ 
Sbjct  78   FFPLTVNYFEKTYAVGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPNGFMNEVQVIT  137

Query  658  SVLSS  672
            +V+SS
Sbjct  138  TVMSS  142


 Score = 52.4 bits (124),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            L+ F + FE+G + +TLETG+IAR A GSV++ +D+  VL TV  AK
Sbjct  24   LKPFKKSFELGGKTVTLETGRIARQATGSVLVTVDDISVLGTVVGAK  70



>ref|WP_008542529.1| polynucleotide phosphorylase/polyadenylase [Sutterella parvirubra]
 gb|EHY31109.1| polyribonucleotide nucleotidyltransferase [Sutterella parvirubra 
YIT 11816]
Length=707

 Score = 97.1 bits (240),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF++EVQV
Sbjct  56   QDFFPLTVDYIEKTYAAGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPDGFFNEVQV  115

Query  652  MASVLSSD  675
            +  VLS+D
Sbjct  116  IIHVLSAD  123


 Score = 44.3 bits (103),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F  G+  +TLETG+IAR A GS +  MD+T VL+TV + K
Sbjct  11   FRFGNHDVTLETGEIARQATGSCICRMDDTVVLATVVAKK  50



>gb|KEI73163.1| polynucleotide phosphorylase/polyadenylase [Endozoicomonas elysicola]
Length=710

 Score = 91.7 bits (226),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL+V YQEK +A G IP  F++REG   E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  57   QDFFPLSVHYQEKVYAAGKIPGGFLKREGKASEKETLTSRLIDRPIRPLFPKGFMNEVQV  116

Query  652  MASVLSSD  675
            + +V+S D
Sbjct  117  IITVMSVD  124


 Score = 50.1 bits (118),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  321  ESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            ++F + F+ G + +TLETG++AR A+G+V+ +M E +VL+TV  AK  R
Sbjct  6    KAFAKSFQFGDQTVTLETGRVARQASGAVLASMGELQVLATVVGAKSAR  54



>gb|EDZ64685.1| polyribonucleotide nucleotidyltransferase [beta proteobacterium 
KB13]
Length=710

 Score =   104 bits (259),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDYQEK +A G IP  F +REG P E E+L  RLIDRP+RPLFP GFY++VQ+
Sbjct  58   QDFFPLTVDYQEKTYAAGKIPGGFFKREGRPSENEILVCRLIDRPLRPLFPKGFYNDVQI  117

Query  652  MASVLSSD  675
            +A+VLSSD
Sbjct  118  VATVLSSD  125


 Score = 37.0 bits (84),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTV  446
            +    ++  ++G+ ++ LETG++AR A+G+V+++  ET VL TV
Sbjct  5    MFNKVSKSMKLGAHELKLETGEVARQADGAVMVSYGETVVLVTV  48



>ref|WP_040872619.1| polynucleotide phosphorylase/polyadenylase [beta proteobacterium 
KB13]
Length=706

 Score =   104 bits (259),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDYQEK +A G IP  F +REG P E E+L  RLIDRP+RPLFP GFY++VQ+
Sbjct  54   QDFFPLTVDYQEKTYAAGKIPGGFFKREGRPSENEILVCRLIDRPLRPLFPKGFYNDVQI  113

Query  652  MASVLSSD  675
            +A+VLSSD
Sbjct  114  VATVLSSD  121


 Score = 37.0 bits (84),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTV  446
            +    ++  ++G+ ++ LETG++AR A+G+V+++  ET VL TV
Sbjct  1    MFNKVSKSMKLGAHELKLETGEVARQADGAVMVSYGETVVLVTV  44



>ref|WP_023950582.1| polynucleotide phosphorylase/polyadenylase [Pelistega sp. HM-7]
 gb|ETD72212.1| polynucleotide phosphorylase/polyadenylase [Pelistega sp. HM-7]
Length=726

 Score = 98.2 bits (243),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRP+RPLFP GFY+EV
Sbjct  52   AGQDFFPLTVDYVEKTYAAGRIPGGFFKREGKPSEKETLTSRLIDRPLRPLFPEGFYNEV  111

Query  646  QVMASVLSSD  675
            QV+  VLS D
Sbjct  112  QVIVHVLSVD  121


 Score = 43.5 bits (101),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  330  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            T+ F+ G+  +  ETG+IAR A+G+VV +M +T VL+TV +AK
Sbjct  6    TKSFQYGAHTVVFETGEIARQASGAVVASMGDTVVLATVVAAK  48



>ref|WP_011386466.1| polyribonucleotide nucleotidyltransferase [Magnetospirillum magneticum]
 sp|Q2VZQ4.1|PNP_MAGSA RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Magnetospirillum 
magneticum AMB-1]
 dbj|BAE52921.1| Polyribonucleotide nucleotidyltransferase [Magnetospirillum magneticum 
AMB-1]
Length=720

 Score = 95.5 bits (236),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  F +REG P E+E L  RLIDRPIRPLF  GF +EVQV+
Sbjct  57   DFFPLTVNYQEKAFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFADGFRNEVQVV  116

Query  655  ASVLSSD  675
             +VLS D
Sbjct  117  CTVLSHD  123


 Score = 45.8 bits (107),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +E   G RK+ LETGK+AR A+G+V++   ET VL TV  AK ++
Sbjct  9    KEITWGGRKLVLETGKVARQADGAVMVTYGETSVLCTVVGAKSQK  53



>ref|WP_033402998.1| polynucleotide phosphorylase/polyadenylase [Endozoicomonas elysicola]
Length=708

 Score = 91.3 bits (225),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL+V YQEK +A G IP  F++REG   E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  55   QDFFPLSVHYQEKVYAAGKIPGGFLKREGKASEKETLTSRLIDRPIRPLFPKGFMNEVQV  114

Query  652  MASVLSSD  675
            + +V+S D
Sbjct  115  IITVMSVD  122


 Score = 50.1 bits (118),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  321  ESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            ++F + F+ G + +TLETG++AR A+G+V+ +M E +VL+TV  AK  R
Sbjct  4    KAFAKSFQFGDQTVTLETGRVARQASGAVLASMGELQVLATVVGAKSAR  52



>ref|WP_042088160.1| polynucleotide phosphorylase/polyadenylase [alpha proteobacterium 
Q-1]
Length=706

 Score = 94.4 bits (233),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            RDF PLTV+YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFPA F ++ QV
Sbjct  54   RDFFPLTVNYQEKTYAAGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPAEFRNDTQV  113

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  114  ICTVLSHD  121


 Score = 47.0 bits (110),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + E + +  E G R +TLETG+IAR A+G+VV    ET VL TV +A+     R
Sbjct  1    MFEIYRKTIEWGGRSLTLETGRIARQADGAVVATYGETSVLCTVVAARKAEPGR  54



>ref|WP_012326153.1| polyribonucleotide nucleotidyltransferase [Shewanella woodyi]
 sp|B1KRQ5.1|PNP_SHEWM RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Shewanella 
woodyi ATCC 51908]
 gb|ACA87820.1| Polyribonucleotide nucleotidyltransferase [Shewanella woodyi 
ATCC 51908]
Length=702

 Score = 98.6 bits (244),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  463  DAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHE  642
            D  RDF PLTV+YQEK +A G IP  F +REG P E E L  RLIDRPIRPLFP GF +E
Sbjct  50   DVGRDFFPLTVNYQEKTYAAGKIPGGFFKREGRPSENETLIARLIDRPIRPLFPNGFKNE  109

Query  643  VQVMASVLSSD  675
            VQV+ +V+S D
Sbjct  110  VQVIITVVSVD  120


 Score = 42.7 bits (99),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +    + FE G   +TLETG IAR AN +V+ +M +T VL TV   K     R
Sbjct  1    MNPIVKSFEYGQHTVTLETGVIARQANAAVLASMGDTTVLVTVVGKKAEDVGR  53



>ref|WP_026199929.1| polynucleotide phosphorylase/polyadenylase [Acetobacter aceti]
 dbj|GAN55927.1| polynucleotide phosphorylase/polyadenylase [Acetobacter aceti 
NBRC 14818]
Length=715

 Score = 95.9 bits (237),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F +REG P E E L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVNYQEKAYAAGKIPGGFFKREGRPSEAETLNSRLIDRPIRPLFPEGFRNEVQV  113

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  114  ITTVLSHD  121


 Score = 45.4 bits (106),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F +E E G R + LETGKIAR A+G+VV+   ET VL T   AK
Sbjct  5    FRKEIEWGGRPLILETGKIARQADGAVVVTYGETVVLCTAVGAK  48



>gb|EXI91453.1| Polyribonucleotide nucleotidyltransferase [Candidatus Accumulibacter 
sp. BA-94]
Length=714

 Score = 99.0 bits (245),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F +REG P E+E L  RLIDRP+RPLFP GFYHEVQV
Sbjct  54   QDFFPLTVDYIEKTYAAGRIPGGFFKREGRPSEKETLTSRLIDRPLRPLFPEGFYHEVQV  113

Query  652  MASVLSSD  675
            +A V+S D
Sbjct  114  VAMVMSLD  121


 Score = 42.4 bits (98),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            + F  G+++++LETG+IAR A G+V+++M ET VL TV    G R++R
Sbjct  7    KSFAYGAQQVSLETGEIARQAGGAVLVSMGETVVLVTVV---GNRTAR  51



>ref|WP_004272030.1| polynucleotide phosphorylase [Nitrospirillum amazonense]
 gb|EGY02070.1| polynucleotide phosphorylase/polyadenylase [Nitrospirillum amazonense 
Y2]
Length=709

 Score = 95.9 bits (237),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK FA G IP  F +REG P E+E+L  RLIDRPIRPLF  GF +EVQV
Sbjct  54   QDFFPLTVNYQEKAFAAGKIPGGFFKREGRPTEKEVLTSRLIDRPIRPLFVDGFRNEVQV  113

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  114  VCTVLSHD  121


 Score = 45.1 bits (105),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            + + F +E E G RK+ LETGK+AR A+G+V+    +T VL T   AK
Sbjct  1    MFKVFRKEMEWGGRKLVLETGKVARQADGAVIATYGDTVVLCTAVGAK  48



>ref|WP_008616456.1| polynucleotide phosphorylase/polyadenylase [Magnetospirillum 
sp. SO-1]
 gb|EME70346.1| polynucleotide phosphorylase/polyadenylase [Magnetospirillum 
sp. SO-1]
Length=720

 Score = 95.5 bits (236),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  F +REG P E+E L  RLIDRPIRPLF  GF +EVQV+
Sbjct  57   DFFPLTVNYQEKAFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFADGFRNEVQVV  116

Query  655  ASVLSSD  675
             +VLS D
Sbjct  117  CTVLSHD  123


 Score = 45.4 bits (106),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +  +  +E   G RK+ LETGK+AR A+G+V++   ET VL TV  AK ++
Sbjct  3    MFNAHRKEITWGGRKLVLETGKVARQADGAVMVTYGETTVLCTVVGAKSQK  53



>dbj|GAN75960.1| polynucleotide phosphorylase/polyadenylase [Acidisphaera rubrifaciens 
HS-AP3]
Length=727

 Score = 99.4 bits (246),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK FA G IP  F +REG P E E+L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVNYQEKAFAAGKIPGGFFKREGRPSENEVLVSRLIDRPIRPLFPEGFRNEVQV  113

Query  652  MASVLSSD  675
            +A+VLS D
Sbjct  114  IATVLSHD  121


 Score = 42.0 bits (97),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F +E E G R + LETGK+AR A+G+V++   +T VL T   AK
Sbjct  5    FRKELEWGGRTLVLETGKMARQADGAVLVRYGDTIVLCTAVGAK  48



>ref|WP_004186494.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 ref|YP_103438.1| polynucleotide phosphorylase [Burkholderia mallei ATCC 23344]
 sp|Q62IN1.1|PNP_BURMA RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Burkholderia 
mallei ATCC 23344]
 sp|A3MI97.1|PNP_BURM7 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Burkholderia 
mallei NCTC 10247]
 sp|A2S463.1|PNP_BURM9 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Burkholderia 
mallei NCTC 10229]
 sp|A1V2L2.1|PNP_BURMS RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Burkholderia 
mallei SAVP1]
 gb|AAU49845.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
ATCC 23344]
 gb|ABM52380.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
SAVP1]
 gb|ABN02282.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
NCTC 10229]
 gb|ABO05379.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
NCTC 10247]
 gb|EDK53438.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
FMH]
 gb|EDK58405.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
JHU]
 gb|EDK87011.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
2002721280]
 gb|EDP86732.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
ATCC 10399]
 gb|EEP86731.1| polyribonucleotide nucleotidyltransferase (Polynucleotidephosphorylase) 
(PNPase) [Burkholderia mallei GB8 horse 4]
 gb|EES45892.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
PRL-20]
 gb|AIO52168.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AIO57443.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AIO62415.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AIO82466.1| polynucleotide phosphorylase/polyadenylase [Burkholderia mallei]
 gb|AIP76440.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|KGC54486.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AIS30188.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei 
NCTC 10247]
 gb|KIY06787.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AJX02380.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AJX44266.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AJX50086.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AJX53619.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AJX65392.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
 gb|AJY33271.1| polyribonucleotide nucleotidyltransferase [Burkholderia mallei]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 46.6 bits (109),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G +K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQQKVRLETGEIARQASGAVIVDIEDTVVLATVVGAKSAK  53



>ref|WP_044564269.1| polynucleotide phosphorylase/polyadenylase, partial [Azospirillum 
sp. B4]
Length=358

 Score = 94.7 bits (234),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK FA G IP  F +REG P E+E+L  RLIDRPIRPLF  GF +EVQV
Sbjct  54   QDFFPLTVNYQEKAFAAGKIPGGFFKREGRPTEKEVLTSRLIDRPIRPLFVDGFRNEVQV  113

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  114  VCTVLSHD  121


 Score = 46.6 bits (109),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F +E E G RK+TLETGK+AR A+G+V+    +T VL T   AK
Sbjct  5    FRKEMEWGGRKLTLETGKVARQADGAVIATYGDTVVLCTAVGAK  48



>ref|WP_042146075.1| polynucleotide phosphorylase/polyadenylase [Pseudoalteromonas 
sp. '520P1 No. 412']
Length=707

 Score = 99.8 bits (247),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  466  AVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEV  645
            A +DF PLTV+YQE+ +A G IP  F++REG P + E L  RLIDRPIRPLFPAGF +EV
Sbjct  51   AGQDFFPLTVNYQERMYAAGRIPGGFLKREGRPNDGETLIARLIDRPIRPLFPAGFMNEV  110

Query  646  QVMASVLSSD  675
            QV+A+V+SS+
Sbjct  111  QVIATVMSSN  120


 Score = 41.2 bits (95),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +++  ++F++G  ++TLETG IAR A G+V+ ++ +T VL TV   K  ++ +
Sbjct  1    MQAIIKKFQLGQHEVTLETGAIARQACGAVLASIGDTSVLVTVVGKKDVKAGQ  53



>ref|WP_022955534.1| polynucleotide phosphorylase/polyadenylase [Perlucidibaca piscinae]
Length=695

 Score = 98.2 bits (243),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  + +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  54   QDFFPLTVNYQEKTYAAGRIPGGYFKREGRPSEKETLTSRLIDRPIRPLFPEGFLNEVQV  113

Query  652  MASVLSSD  675
             A+V+S+D
Sbjct  114  TATVISTD  121


 Score = 42.7 bits (99),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +EF+ G++ ++LETG+IAR A+G+VV+ M   +VL  V  AK  +
Sbjct  7    KEFQFGNQTVSLETGRIARQASGAVVVTMGGLQVLVAVVGAKSAK  51



>ref|WP_007864483.1| polynucleotide phosphorylase/polyadenylase [Polaromonas sp. CF318]
 gb|EJL87616.1| polyribonucleotide nucleotidyltransferase [Polaromonas sp. CF318]
Length=705

 Score = 94.4 bits (233),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP +F +REG P E E L  RLIDRPIRPLFP GF++EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGRIPGSFFKREGRPSEFETLTSRLIDRPIRPLFPEGFFNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 46.6 bits (109),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS  452
            I    T+ F+ G  K+T+ETG+IAR ++G+VV+ MD T VL+TV +
Sbjct  3    IFNKVTKSFQWGQHKVTMETGEIARQSSGAVVVDMDGTVVLATVVA  48



>ref|WP_025371943.1| polynucleotide phosphorylase/polyadenylase [Advenella mimigardefordensis]
 gb|AHG63315.1| polyribonucleotide nucleotidyltransferase [Advenella mimigardefordensis 
DPN7]
Length=720

 Score = 95.5 bits (236),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F +REG P E+E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYVEKTYSAGRIPGGFFKREGKPTEKETLTSRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLSSD  675
            +  VLS D
Sbjct  114  IVHVLSVD  121


 Score = 45.4 bits (106),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +    T+ F+ G + + LETG+IAR A+G+VV +M ++ VL+TV +AK  +
Sbjct  1    MFNKVTKSFQYGDQTVVLETGEIARQASGAVVASMGDSVVLATVVAAKNAK  51



>ref|WP_025386564.1| polynucleotide phosphorylase/polyadenylase [Legionella oakridgensis]
 gb|AHE68237.1| polyribonucleotide nucleotidyltransferase [Legionella oakridgensis 
ATCC 33761 = DSM 21215]
 gb|ETO92320.1| polyribonucleotide nucleotidyltransferase [Legionella oakridgensis 
RV-2-2007]
Length=721

 Score = 96.3 bits (238),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            + G    +F PLTV+YQEK +A G IP  F +REG P E E L  RLIDRP+RPLFP GF
Sbjct  47   KEGAEKNNFFPLTVNYQEKTYAAGKIPGGFTKREGRPSEHETLISRLIDRPLRPLFPDGF  106

Query  634  YHEVQVMASVLS  669
            Y+EVQ++A+VLS
Sbjct  107  YNEVQIIATVLS  118


 Score = 44.7 bits (104),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +   T+E + G  K+ LETG+IAR A+G+V ++M+ T+VL TV   K
Sbjct  1    MTKITKEIQFGEHKLVLETGEIARQADGAVFVSMNGTQVLVTVVGNK  47



>ref|WP_010625695.1| polynucleotide phosphorylase/polyadenylase [Halomonas sp. KM-1]
Length=710

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PL+V YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLSVHYQEKTYAVGKIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPKGFMNEVQV  112

Query  652  MASVLSSD  675
            + +VLS+D
Sbjct  113  ICTVLSTD  120


 Score = 46.2 bits (108),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F+ G   +TLETG+IAR A G+V++ MDET VL TV + K
Sbjct  8    FQYGRSTVTLETGRIARQATGAVMVTMDETVVLCTVVARK  47



>ref|WP_013260951.1| polynucleotide phosphorylase/polyadenylase [gamma proteobacterium 
HdN1]
 emb|CBL44452.1| Polyribonucleotide nucleotidyltransferase [gamma proteobacterium 
HdN1]
Length=701

 Score =   100 bits (249),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  454  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGF  633
            ++ D  +DF PLTV+YQEK +A G IP  + +REG P E+E L  RLIDRP+RPLFP GF
Sbjct  48   KKADPSKDFFPLTVNYQEKTYASGRIPGGYFKREGKPSEKETLTSRLIDRPLRPLFPEGF  107

Query  634  YHEVQVMASVLSSD  675
             +EVQ++A+VLS+D
Sbjct  108  RNEVQIIATVLSTD  121


 Score = 40.4 bits (93),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  476
            +EF  G +  TLETGKIAR A G+V+++  +  VL TV   K    S+
Sbjct  7    KEFRFGDQTYTLETGKIARQATGAVLVSTAQVAVLVTVVGKKKADPSK  54



>ref|WP_035516321.1| polynucleotide phosphorylase/polyadenylase [Burkholderia sp. 
Ch1-1]
Length=714

 Score = 95.1 bits (235),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYLEKTYAAGKIPGGFFRREGRPSEGETLISRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VIHVLS  119


 Score = 45.4 bits (106),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDVEDTVVLATVVGAK  48



>ref|WP_046005484.1| polynucleotide phosphorylase/polyadenylase [Pseudoalteromonas 
rubra]
 gb|KJZ08116.1| polynucleotide phosphorylase/polyadenylase [Pseudoalteromonas 
rubra]
Length=704

 Score = 97.8 bits (242),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F++REG P + E L  RLIDRPIRPLFP GF +EVQV
Sbjct  53   QDFFPLTVNYQEKMYAAGRIPGGFLKREGRPSDNETLIARLIDRPIRPLFPDGFVNEVQV  112

Query  652  MASVLSSD  675
            +A+V+SS+
Sbjct  113  IATVVSSN  120


 Score = 43.1 bits (100),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  318  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSS  473
            +++  +EF++G   +TLETG IAR A+G+V+ ++ +T VL TV    G+R +
Sbjct  1    MQAIIKEFQLGQHTVTLETGAIARQADGAVLASIGDTSVLVTVV---GKREA  49



>ref|WP_045581303.1| polynucleotide phosphorylase/polyadenylase [Azospirillum thiophilum]
 gb|KJR65994.1| polynucleotide phosphorylase/polyadenylase [Azospirillum thiophilum]
Length=703

 Score = 94.0 bits (232),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  475  DFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQVM  654
            DF PLTV+YQEK FA G IP  F +REG P E+E L  RLIDRPIRPLF  GF +E QV+
Sbjct  55   DFFPLTVNYQEKAFAAGKIPGGFFKREGRPTEKETLVSRLIDRPIRPLFADGFRNETQVV  114

Query  655  ASVLSSD  675
             +VLS D
Sbjct  115  CTVLSHD  121


 Score = 47.0 bits (110),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  333  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  461
            +E E G RK+ LETGKIAR ANG+V++   +T VL T  +AK 
Sbjct  7    KEIEWGGRKLVLETGKIARQANGAVLVTYGDTTVLCTAVAAKA  49



>gb|EIF32392.1| polyribonucleotide nucleotidyltransferase [Burkholderia sp. Ch1-1]
Length=716

 Score = 95.1 bits (235),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFRREGRPSEGETLISRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.4 bits (106),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK
Sbjct  3    MFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDVEDTVVLATVVGAK  50



>ref|WP_008493131.1| MULTISPECIES: polynucleotide phosphorylase [Acidocella]
 gb|EKN00424.1| polynucleotide phosphorylase/polyadenylase [Acidocella sp. MX-AZ02]
Length=716

 Score = 97.1 bits (240),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTV+YQEK +A G IP  F +REG P E+E L  RLIDRPIRPLFP GF +EVQV
Sbjct  55   QDFFPLTVNYQEKFYAAGRIPGGFFKREGRPTEKETLVSRLIDRPIRPLFPEGFRNEVQV  114

Query  652  MASVLSSD  675
            + +VLS D
Sbjct  115  VVNVLSHD  122


 Score = 43.9 bits (102),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  327  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F +E E G + + LETGK+AR A+G+VV +  +T VL+TV  AK
Sbjct  6    FRKEMEWGGKTLILETGKVARQADGAVVASYGDTVVLATVVGAK  49



>ref|WP_041187840.1| polynucleotide phosphorylase/polyadenylase [Burkholderia pseudomallei]
 gb|KGW36894.1| polyribonucleotide nucleotidyltransferase [Burkholderia pseudomallei 
MSHR3016]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.8 bits (107),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDIEDTVVLATVVGAKSAK  53



>ref|WP_038746153.1| polynucleotide phosphorylase/polyadenylase [Burkholderia pseudomallei]
 gb|KGC51021.1| polyribonucleotide nucleotidyltransferase [Burkholderia pseudomallei]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.8 bits (107),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDIEDTVVLATVVGAKSAK  53



>ref|WP_038727056.1| MULTISPECIES: polyribonucleotide nucleotidyltransferase [pseudomallei 
group]
 gb|KGX21857.1| polyribonucleotide nucleotidyltransferase [Burkholderia sp. MSHR4009]
 gb|KGX25908.1| polyribonucleotide nucleotidyltransferase [Burkholderia sp. MSHR4018]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 46.2 bits (108),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDIEDTVVLTTVVGAKSAK  53



>sp|B2T2E3.1|PNP_BURPP RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Burkholderia 
phytofirmans PsJN]
 gb|ACD15754.1| Polyribonucleotide nucleotidyltransferase [Burkholderia phytofirmans 
PsJN]
Length=718

 Score = 95.1 bits (235),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGFFRREGRPSEGETLISRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.4 bits (106),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK
Sbjct  3    MFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDVEDTVVLATVVGAK  50



>ref|WP_041758343.1| polynucleotide phosphorylase/polyadenylase [Burkholderia phytofirmans]
Length=716

 Score = 95.1 bits (235),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK +A G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  54   QDFFPLTVDYLEKTYAAGKIPGGFFRREGRPSEGETLISRLIDRPLRPLFPEGFYNEVQV  113

Query  652  MASVLS  669
            +  VLS
Sbjct  114  VIHVLS  119


 Score = 45.4 bits (106),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDVEDTVVLATVVGAK  48



>ref|WP_038788407.1| polynucleotide phosphorylase/polyadenylase [Burkholderia pseudomallei]
 gb|KGU97657.1| polyribonucleotide nucleotidyltransferase [Burkholderia pseudomallei 
MSHR4372]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.8 bits (107),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDIEDTVVLATVVGAKSAK  53



>ref|WP_037488558.1| polynucleotide phosphorylase/polyadenylase [Snodgrassella alvi]
 gb|KES10398.1| Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) 
[Snodgrassella alvi SCGC AB-598-O02]
Length=706

 Score = 99.4 bits (246),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY E+ +A G IP  F +REG   E+E+L  RLIDRPIRPLFP GFYH++Q+
Sbjct  54   QDFFPLTVDYLERTYAAGKIPGGFFKREGKQSEKEILTSRLIDRPIRPLFPEGFYHDIQI  113

Query  652  MASVLSSD  675
            +A V+SSD
Sbjct  114  VAMVVSSD  121


 Score = 41.6 bits (96),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  339  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  458
            F+ G++ +TLETG+IAR A G+V ++M +T VL  V +AK
Sbjct  9    FQYGNQTVTLETGEIARQAAGAVKISMGDTVVLVAVTTAK  48



>ref|WP_006025098.1| polynucleotide phosphorylase/polyadenylase [Burkholderia thailandensis]
 gb|EIP90492.1| polynucleotide phosphorylase/polyadenylase [Burkholderia thailandensis 
MSMB43]
 gb|AGK49506.1| polyribonucleotide nucleotidyltransferase [Burkholderia thailandensis 
MSMB121]
 gb|AJY41365.1| polyribonucleotide nucleotidyltransferase [Burkholderia sp. 2002721687]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 46.2 bits (108),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+VV+ +++T VL+TV  AK  +
Sbjct  3    LFNKVVKEFQWGQHKVRLETGEIARQASGAVVVDIEDTVVLATVVGAKSAK  53



>ref|WP_015876543.1| polynucleotide phosphorylase/polyadenylase [Burkholderia glumae]
 gb|ACR29674.1| Polyribonucleotide nucleotidyltransferase [Burkholderia glumae 
BGR1]
 gb|KHJ64130.1| polynucleotide phosphorylase/polyadenylase [Burkholderia glumae]
Length=709

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.8 bits (107),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDVEDTVVLATVVGAKNAK  53



>ref|WP_038777114.1| polynucleotide phosphorylase/polyadenylase [Burkholderia pseudomallei]
 gb|KGS85497.1| polyribonucleotide nucleotidyltransferase [Burkholderia pseudomallei 
MSHR7334]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.8 bits (107),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDIEDTVVLATVVGAKSAK  53



>ref|WP_044490053.1| polynucleotide phosphorylase/polyadenylase [Burkholderia pseudomallei]
 gb|AIV62023.1| polyribonucleotide nucleotidyltransferase [Burkholderia pseudomallei 
K42]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.8 bits (107),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDIEDTVVLATVVGAKSAK  53



>ref|WP_038759645.1| polynucleotide phosphorylase/polyadenylase [Burkholderia pseudomallei]
 gb|KGC81539.1| polyribonucleotide nucleotidyltransferase [Burkholderia pseudomallei]
 gb|AIV52512.1| polyribonucleotide nucleotidyltransferase [Burkholderia pseudomallei 
MSHR1153]
 gb|KGV05493.1| polyribonucleotide nucleotidyltransferase [Burkholderia pseudomallei 
TSV 43]
 gb|KGV34903.1| polyribonucleotide nucleotidyltransferase [Burkholderia pseudomallei 
TSV 31]
Length=713

 Score = 94.7 bits (234),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  472  RDFLPLTVDYQEKQFAQGLIPSTFMRREGAPKERELLCGRLIDRPIRPLFPAGFYHEVQV  651
            +DF PLTVDY EK ++ G IP  F RREG P E E L  RLIDRP+RPLFP GFY+EVQV
Sbjct  56   QDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQV  115

Query  652  MASVLS  669
            +  VLS
Sbjct  116  VIHVLS  121


 Score = 45.8 bits (107),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  315  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  467
            +     +EF+ G  K+ LETG+IAR A+G+V++ +++T VL+TV  AK  +
Sbjct  3    LFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDIEDTVVLATVVGAKSAK  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1147404787994