BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig707

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB80760.1|  hypothetical protein B456_013G114400                    404   2e-135   Gossypium raimondii
gb|KDO54954.1|  hypothetical protein CISIN_1g0202292mg                  392   3e-135   Citrus sinensis [apfelsine]
ref|XP_011077750.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    408   2e-134   Sesamum indicum [beniseed]
ref|XP_006443472.1|  hypothetical protein CICLE_v10018965mg             399   9e-134   
ref|XP_011094156.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    405   3e-133   Sesamum indicum [beniseed]
gb|KCW47762.1|  hypothetical protein EUGRSUZ_K015081                    390   4e-133   Eucalyptus grandis [rose gum]
gb|KJB44522.1|  hypothetical protein B456_007G257500                    397   4e-133   Gossypium raimondii
gb|AEO86798.1|  methionine synthase                                     404   1e-132   Camellia sinensis [black tea]
ref|XP_009629870.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    404   1e-132   Nicotiana tomentosiformis
ref|XP_004136654.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    404   1e-132   Cucumis sativus [cucumbers]
gb|ABI35986.1|  methionine synthase                                     404   2e-132   Phelipanche ramosa
gb|KJB26633.1|  hypothetical protein B456_004G251500                    395   2e-132   Gossypium raimondii
ref|XP_004291976.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    403   3e-132   Fragaria vesca subsp. vesca
gb|KJB80758.1|  hypothetical protein B456_013G114400                    403   3e-132   Gossypium raimondii
gb|KJB82416.1|  hypothetical protein B456_013G195000                    395   4e-132   Gossypium raimondii
gb|EYU18182.1|  hypothetical protein MIMGU_mgv1a001749mg                402   4e-132   Erythranthe guttata [common monkey flower]
gb|EYU38730.1|  hypothetical protein MIMGU_mgv1a001746mg                402   5e-132   Erythranthe guttata [common monkey flower]
ref|XP_006371191.1|  hypothetical protein POPTR_0019s05430g             398   8e-132   
ref|XP_006443470.1|  hypothetical protein CICLE_v10018965mg             396   8e-132   
gb|ABS01352.1|  methionine synthase                                     401   1e-131   Carica papaya [mamon]
ref|XP_009615630.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    401   1e-131   Nicotiana tomentosiformis
gb|AGT40326.1|  methionine synthase                                     401   1e-131   Nicotiana attenuata
ref|XP_008237251.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    401   2e-131   Prunus mume [ume]
ref|XP_009791486.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    400   2e-131   Nicotiana sylvestris
gb|KDO66097.1|  hypothetical protein CISIN_1g0165812mg                  382   2e-131   Citrus sinensis [apfelsine]
ref|XP_008443293.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    400   2e-131   Cucumis melo [Oriental melon]
ref|XP_009619432.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    400   2e-131   Nicotiana tomentosiformis
ref|XP_011008841.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    401   2e-131   Populus euphratica
ref|XP_011008839.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    401   2e-131   Populus euphratica
gb|KHG18658.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    400   3e-131   Gossypium arboreum [tree cotton]
ref|XP_009804811.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    400   3e-131   Nicotiana sylvestris
ref|XP_006384691.1|  hypothetical protein POPTR_0004s20220g             402   3e-131   
ref|XP_011467399.1|  PREDICTED: LOW QUALITY PROTEIN: 5-methyltetr...    400   3e-131   Fragaria vesca subsp. vesca
ref|XP_010247947.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    400   3e-131   Nelumbo nucifera [Indian lotus]
ref|XP_008386852.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    400   4e-131   
ref|XP_007015562.1|  Cobalamin-independent synthase family protei...    395   5e-131   
ref|XP_011005896.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    401   5e-131   Populus euphratica
ref|XP_006371184.1|  hypothetical protein POPTR_0019s05430g             399   5e-131   
ref|XP_009353101.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    399   8e-131   Pyrus x bretschneideri [bai li]
ref|XP_007030023.1|  Cobalamin-independent synthase family protei...    399   9e-131   
ref|XP_002325856.1|  hypothetical protein POPTR_0019s05430g             399   9e-131   
gb|KJB44523.1|  hypothetical protein B456_007G257500                    396   9e-131   Gossypium raimondii
ref|XP_008391707.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    398   2e-130   Malus domestica [apple tree]
ref|XP_009366484.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    398   2e-130   Pyrus x bretschneideri [bai li]
gb|KJB82419.1|  hypothetical protein B456_013G195000                    392   2e-130   Gossypium raimondii
ref|XP_006443469.1|  hypothetical protein CICLE_v10018965mg             397   3e-130   
ref|XP_002525709.1|  5-methyltetrahydropteroyltriglutamate--homoc...    397   3e-130   Ricinus communis
ref|NP_001235794.1|  methionine synthase                                397   3e-130   Glycine max [soybeans]
gb|KJB26632.1|  hypothetical protein B456_004G251500                    394   3e-130   Gossypium raimondii
ref|XP_007204266.1|  hypothetical protein PRUPE_ppa001783mg             397   3e-130   Prunus persica
gb|EPS68005.1|  methionine synthase                                     397   4e-130   Genlisea aurea
ref|XP_004960256.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    397   5e-130   
ref|XP_003542326.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    398   6e-130   Glycine max [soybeans]
gb|KJB44524.1|  hypothetical protein B456_007G257500                    396   9e-130   Gossypium raimondii
gb|KHG11135.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    396   9e-130   Gossypium arboreum [tree cotton]
gb|KHG11134.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    397   9e-130   Gossypium arboreum [tree cotton]
dbj|BAP47511.1|  methionine synthase                                    396   9e-130   Gentiana triflora
ref|XP_002515852.1|  5-methyltetrahydropteroyltriglutamate--homoc...    397   1e-129   Ricinus communis
gb|KHG18420.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    396   1e-129   Gossypium arboreum [tree cotton]
ref|XP_003522969.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    397   1e-129   Glycine max [soybeans]
ref|XP_009790020.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    396   1e-129   Nicotiana sylvestris
ref|XP_002276908.2|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    397   2e-129   Vitis vinifera
ref|XP_012070412.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    396   2e-129   Jatropha curcas
ref|XP_003554033.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    395   2e-129   
gb|KHN41415.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    397   2e-129   Glycine soja [wild soybean]
ref|XP_002319710.1|  hypothetical protein POPTR_0013s05850g             395   2e-129   
ref|NP_001275416.1|  methionine synthase                                395   2e-129   Solanum tuberosum [potatoes]
gb|KHG25606.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    395   2e-129   Gossypium arboreum [tree cotton]
dbj|BAN04645.1|  cobalamin-independent methionine synthase              395   2e-129   Senna obtusifolia
gb|KDO66311.1|  hypothetical protein CISIN_1g003819mg                   390   2e-129   Citrus sinensis [apfelsine]
tpg|DAA47596.1|  TPA: putative methionine synthase family protein       385   3e-129   
ref|XP_007015561.1|  Cobalamin-independent synthase family protei...    397   3e-129   
ref|XP_010031619.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    397   3e-129   Eucalyptus grandis [rose gum]
ref|XP_010036239.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    395   4e-129   
ref|XP_010521311.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    394   4e-129   Tarenaya hassleriana [spider flower]
gb|KJB26635.1|  hypothetical protein B456_004G251500                    395   4e-129   Gossypium raimondii
ref|XP_007149180.1|  hypothetical protein PHAVU_005G048200g             385   4e-129   Phaseolus vulgaris [French bean]
gb|KJB46053.1|  hypothetical protein B456_007G346100                    391   5e-129   Gossypium raimondii
ref|XP_011044091.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    396   5e-129   Populus euphratica
ref|XP_010031616.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    394   7e-129   
ref|XP_006470414.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    395   7e-129   Citrus sinensis [apfelsine]
ref|XP_010266670.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    394   8e-129   Nelumbo nucifera [Indian lotus]
ref|XP_008464953.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    394   9e-129   
ref|XP_008778953.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    394   9e-129   Phoenix dactylifera
ref|XP_003561625.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    394   1e-128   Brachypodium distachyon [annual false brome]
ref|XP_011034320.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    394   1e-128   Populus euphratica
gb|KJB82415.1|  hypothetical protein B456_013G195000                    394   1e-128   Gossypium raimondii
ref|XP_004960257.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    394   1e-128   Setaria italica
ref|XP_006826346.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    393   1e-128   Amborella trichopoda
dbj|BAP47510.1|  methionine synthase                                    393   2e-128   Gentiana triflora
ref|XP_009591564.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    395   2e-128   Nicotiana tomentosiformis
ref|XP_010528749.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    393   2e-128   Tarenaya hassleriana [spider flower]
gb|KJB82418.1|  hypothetical protein B456_013G195000                    394   2e-128   Gossypium raimondii
emb|CDP10525.1|  unnamed protein product                                394   2e-128   Coffea canephora [robusta coffee]
gb|KHG01449.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    393   2e-128   Gossypium arboreum [tree cotton]
ref|XP_004249374.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    393   3e-128   
ref|XP_002313635.2|  hypothetical protein POPTR_0009s15490g             394   3e-128   
gb|KHN20624.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    378   3e-128   Glycine soja [wild soybean]
ref|XP_007151496.1|  hypothetical protein PHAVU_004G051600g             392   4e-128   Phaseolus vulgaris [French bean]
ref|XP_012066300.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    394   4e-128   Jatropha curcas
ref|XP_010054791.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    392   4e-128   Eucalyptus grandis [rose gum]
ref|XP_004141126.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    392   4e-128   Cucumis sativus [cucumbers]
gb|KJB46054.1|  hypothetical protein B456_007G346100                    392   4e-128   Gossypium raimondii
sp|Q42699.1|METE_CATRO  RecName: Full=5-methyltetrahydropteroyltr...    392   5e-128   Catharanthus roseus [chatas]
ref|XP_010908721.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    392   5e-128   Elaeis guineensis
gb|KDP42919.1|  hypothetical protein JCGZ_23861                         392   7e-128   Jatropha curcas
gb|KDO66309.1|  hypothetical protein CISIN_1g003819mg                   391   8e-128   Citrus sinensis [apfelsine]
gb|KJB09182.1|  hypothetical protein B456_001G128200                    384   1e-127   Gossypium raimondii
ref|XP_010549696.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    390   1e-127   Tarenaya hassleriana [spider flower]
ref|XP_004502016.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    391   2e-127   Cicer arietinum [garbanzo]
gb|KDO66310.1|  hypothetical protein CISIN_1g003819mg                   391   2e-127   Citrus sinensis [apfelsine]
ref|XP_002276438.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    390   2e-127   
emb|CAN73135.1|  hypothetical protein VITISV_018473                     389   2e-127   Vitis vinifera
emb|CAN70498.1|  hypothetical protein VITISV_028551                     390   2e-127   Vitis vinifera
gb|ADO87039.1|  pollen allergen MetE                                    389   3e-127   Amaranthus retroflexus [common amaranth]
ref|XP_006446418.1|  hypothetical protein CICLE_v10014233mg             391   5e-127   
emb|CDY38470.1|  BnaA10g16880D                                          389   6e-127   Brassica napus [oilseed rape]
ref|XP_004228469.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    390   6e-127   Solanum lycopersicum
ref|XP_010097930.1|  5-methyltetrahydropteroyltriglutamate--homoc...    389   8e-127   Morus notabilis
ref|XP_010463840.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    389   9e-127   Camelina sativa [gold-of-pleasure]
ref|XP_006446419.1|  hypothetical protein CICLE_v10014233mg             391   9e-127   
ref|XP_006479149.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    389   9e-127   Citrus sinensis [apfelsine]
ref|XP_003551089.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    389   1e-126   Glycine max [soybeans]
ref|XP_006364490.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    389   1e-126   
ref|XP_010485733.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    388   1e-126   Camelina sativa [gold-of-pleasure]
gb|KJB09183.1|  hypothetical protein B456_001G128200                    384   1e-126   Gossypium raimondii
ref|XP_010553797.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    388   1e-126   Tarenaya hassleriana [spider flower]
gb|ABI95860.1|  methionine synthase                                     388   1e-126   Nicotiana suaveolens
sp|P93263.1|METE_MESCR  RecName: Full=5-methyltetrahydropteroyltr...    388   2e-126   Mesembryanthemum crystallinum
gb|KHN28122.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    388   2e-126   Glycine soja [wild soybean]
emb|CAE55863.1|  cobalamin-independent methionine synthase              388   2e-126   Arabidopsis thaliana [mouse-ear cress]
gb|AAL09712.1|  AT5g17920/MPI7_60                                       388   2e-126   Arabidopsis thaliana [mouse-ear cress]
gb|AAN31836.1|  putative 5-methyltetrahydropteroyltriglutamate--h...    388   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010677810.1|  PREDICTED: LOW QUALITY PROTEIN: 5-methyltetr...    389   2e-126   
ref|XP_009774960.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    389   2e-126   Nicotiana sylvestris
ref|NP_197294.1|  5-methyltetrahydropteroyltriglutamate--homocyst...    387   2e-126   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE07181.1|  methionine synthase                                    388   3e-126   Beta vulgaris [beet]
ref|XP_004489678.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    387   4e-126   
ref|XP_006443474.1|  hypothetical protein CICLE_v10018921mg             387   5e-126   
emb|CDY25477.1|  BnaC09g39920D                                          387   5e-126   Brassica napus [oilseed rape]
ref|XP_010932648.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    387   6e-126   Elaeis guineensis
ref|XP_006408262.1|  hypothetical protein EUTSA_v10020127mg             383   6e-126   
ref|XP_002871787.1|  cobalamin-independent methionine synthase          386   6e-126   Arabidopsis lyrata subsp. lyrata
ref|XP_009121037.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    386   7e-126   Brassica rapa
ref|XP_010524993.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    386   8e-126   Tarenaya hassleriana [spider flower]
emb|CAA89019.1|  cobalamine-independent methionine synthase             386   1e-125   Plectranthus scutellarioides
gb|ABG22097.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    381   1e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010514202.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    386   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_008662311.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    385   2e-125   
ref|XP_006400336.1|  hypothetical protein EUTSA_v10012750mg             385   3e-125   Eutrema salsugineum [saltwater cress]
ref|XP_010917850.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    386   3e-125   Elaeis guineensis
gb|AAL33589.1|  methionine synthase                                     385   3e-125   Zea mays [maize]
ref|NP_001067314.1|  Os12g0624000                                       384   4e-125   
ref|XP_009408488.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    384   4e-125   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA47593.1|  TPA: putative methionine synthase family protein       385   4e-125   
ref|XP_009398356.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    384   4e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008451024.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    386   4e-125   Cucumis melo [Oriental melon]
ref|XP_002882307.1|  hypothetical protein ARALYDRAFT_477628             384   5e-125   
ref|XP_004144074.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    385   6e-125   Cucumis sativus [cucumbers]
sp|Q42662.2|METE_PLESU  RecName: Full=5-methyltetrahydropteroyltr...    384   6e-125   Plectranthus scutellarioides
ref|XP_009398996.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    384   6e-125   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIE47233.1|  vitamin B-12-independent methionine synthase            384   7e-125   Pisum sativum [garden pea]
ref|XP_009398511.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    384   7e-125   
ref|XP_007161979.1|  hypothetical protein PHAVU_001G113800g             384   8e-125   Phaseolus vulgaris [French bean]
gb|KJB09184.1|  hypothetical protein B456_001G128200                    384   8e-125   Gossypium raimondii
emb|CDX70785.1|  BnaC03g08690D                                          383   1e-124   
ref|XP_006408261.1|  hypothetical protein EUTSA_v10020127mg             383   1e-124   
ref|XP_010558700.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    383   1e-124   Tarenaya hassleriana [spider flower]
ref|XP_003592244.1|  Methionine synthase                                383   1e-124   
emb|CDX74207.1|  BnaA03g28400D                                          383   2e-124   
gb|ABG22095.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    383   2e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009131623.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    382   2e-124   Brassica rapa
emb|CDX78767.1|  BnaA03g06790D                                          382   2e-124   
emb|CDX92051.1|  BnaC03g33530D                                          382   2e-124   
ref|XP_008778395.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    382   3e-124   Phoenix dactylifera
ref|XP_010541663.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    385   3e-124   Tarenaya hassleriana [spider flower]
ref|XP_006286451.1|  hypothetical protein CARUB_v10000282mg             382   3e-124   Capsella rubella
ref|NP_001067313.1|  Os12g0623900                                       382   3e-124   
emb|CDX85436.1|  BnaA02g03770D                                          382   3e-124   
ref|XP_009126216.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    382   4e-124   Brassica rapa
emb|CDY02674.1|  BnaC02g07610D                                          382   4e-124   
ref|XP_003601341.1|  Methionine synthase                                383   4e-124   Medicago truncatula
ref|NP_001266005.1|  5-methyltetrahydropteroyltriglutamate--homoc...    382   4e-124   Cicer arietinum [garbanzo]
gb|KEH25580.1|  cobalamin-independent methionine synthase               382   4e-124   Medicago truncatula
ref|XP_010685496.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    383   4e-124   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010909224.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    382   5e-124   
ref|XP_008807626.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    381   6e-124   
gb|AGV54391.1|  5-methyltetrahydropteroyltriglutamate homocystein...    381   7e-124   Phaseolus vulgaris [French bean]
ref|NP_187028.1|  methionine synthase 2                                 381   1e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAK64167.1|  putative methionine synthase                            381   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525709.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    380   1e-123   Glycine max [soybeans]
ref|XP_009134741.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    380   1e-123   Brassica rapa
ref|XP_008789650.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    380   2e-123   Phoenix dactylifera
ref|XP_010420526.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    380   2e-123   
ref|XP_006297040.1|  hypothetical protein CARUB_v10013032mg             380   2e-123   Capsella rubella
gb|EPS74353.1|  methionine synthase                                     382   2e-123   Genlisea aurea
ref|XP_003550102.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    380   2e-123   
ref|XP_006400670.1|  hypothetical protein EUTSA_v10012712mg             381   2e-123   Eutrema salsugineum [saltwater cress]
emb|CDY50662.1|  BnaC05g48040D                                          378   1e-122   Brassica napus [oilseed rape]
gb|ACO34814.1|  Sal k 3 pollen allergen                                 378   1e-122   Kali turgidum [common saltwort]
gb|EYU35999.1|  hypothetical protein MIMGU_mgv1a001741mg                378   1e-122   Erythranthe guttata [common monkey flower]
ref|XP_010909225.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    377   2e-122   Elaeis guineensis
emb|CAJ01713.1|  methionine synthase 1 enzyme                           377   2e-122   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003624677.1|  Methionine synthase                                379   2e-122   
ref|XP_006664220.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    377   3e-122   Oryza brachyantha
dbj|BAD34660.1|  methionine synthase                                    377   3e-122   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006286361.1|  hypothetical protein CARUB_v10000244mg             378   4e-122   Capsella rubella
ref|XP_008680958.1|  PREDICTED: LOC100286153 isoform X1                 377   4e-122   Zea mays [maize]
gb|KFK26314.1|  hypothetical protein AALP_AA8G231500                    378   6e-122   Arabis alpina [alpine rockcress]
gb|AES80897.2|  cobalamin-independent methionine synthase               373   7e-122   Medicago truncatula
ref|XP_010236330.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    363   1e-121   Brachypodium distachyon [annual false brome]
ref|XP_010492770.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    375   1e-121   Camelina sativa [gold-of-pleasure]
ref|XP_010493215.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    376   2e-121   Camelina sativa [gold-of-pleasure]
ref|XP_004982263.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    374   3e-121   
emb|CDX88830.1|  BnaA03g08190D                                          375   6e-121   
ref|NP_001152513.1|  LOC100286153                                       374   6e-121   Zea mays [maize]
ref|XP_010236990.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    373   7e-121   Brachypodium distachyon [annual false brome]
ref|XP_008359231.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    363   8e-121   
ref|XP_006650367.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    373   1e-120   
ref|XP_010420946.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    374   2e-120   Camelina sativa [gold-of-pleasure]
ref|XP_010454415.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    374   2e-120   Camelina sativa [gold-of-pleasure]
ref|XP_010454417.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    374   2e-120   Camelina sativa [gold-of-pleasure]
ref|XP_010454416.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    373   2e-120   Camelina sativa [gold-of-pleasure]
ref|XP_011622506.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    368   4e-120   
ref|NP_001288585.1|  LOC541714                                          371   5e-120   Zea mays [maize]
gb|EMS51950.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    371   6e-120   Triticum urartu
ref|XP_009131831.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    372   8e-120   Brassica rapa
gb|ABR17712.1|  unknown                                                 370   1e-119   Picea sitchensis
emb|CDX92419.1|  BnaA10g14580D                                          373   1e-119   
gb|AFW68110.1|  putative methionine synthase family protein             371   1e-119   
ref|XP_008385717.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    360   2e-119   
gb|ADE75603.1|  unknown                                                 369   2e-119   Picea sitchensis
pdb|1U1H|A  Chain A, A. Thaliana Cobalamine Independent Methionin...    369   2e-119   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ88127.1|  predicted protein                                      369   3e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAJ01714.1|  methionine synthase 2 enzyme                           369   3e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS50887.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    369   3e-119   Triticum urartu
gb|EMT31101.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    369   3e-119   
gb|ERN03804.1|  hypothetical protein AMTR_s00078p00112410               370   4e-119   Amborella trichopoda
emb|CDY16584.1|  BnaC09g36890D                                          373   5e-119   Brassica napus [oilseed rape]
ref|XP_010036242.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    368   7e-119   Eucalyptus grandis [rose gum]
ref|XP_009120746.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    369   8e-119   Brassica rapa
ref|XP_006842129.2|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    368   9e-119   
dbj|BAJ87953.1|  predicted protein                                      368   1e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009120742.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    369   1e-118   
ref|XP_011622504.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    368   1e-118   
ref|XP_011622505.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    368   1e-118   
emb|CAE55865.1|  cobalamin-independent methionine synthase              369   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008775707.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    369   2e-118   Phoenix dactylifera
dbj|BAJ89541.1|  predicted protein                                      367   2e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16134.1|  unknown                                                 367   3e-118   Picea sitchensis
ref|NP_197598.2|  methionine synthase 3                                 367   4e-118   Arabidopsis thaliana [mouse-ear cress]
gb|ABR18027.1|  unknown                                                 365   1e-117   Picea sitchensis
ref|XP_010933712.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    366   2e-117   Elaeis guineensis
emb|CDX70955.1|  BnaC03g10390D                                          363   2e-116   
ref|XP_002874026.1|  hypothetical protein ARALYDRAFT_489009             362   3e-116   
ref|XP_008230954.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    362   3e-116   Prunus mume [ume]
ref|XP_009346240.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    362   6e-116   Pyrus x bretschneideri [bai li]
ref|XP_010036240.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    359   3e-115   Eucalyptus grandis [rose gum]
ref|XP_007207630.1|  hypothetical protein PRUPE_ppa021650mg             359   3e-115   
gb|KCW47764.1|  hypothetical protein EUGRSUZ_K01513                     349   5e-115   Eucalyptus grandis [rose gum]
ref|XP_011090233.1|  PREDICTED: LOW QUALITY PROTEIN: 5-methyltetr...    359   8e-115   Sesamum indicum [beniseed]
ref|XP_010242374.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    358   1e-114   Nelumbo nucifera [Indian lotus]
ref|XP_010038792.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    341   7e-114   
gb|KCW44398.1|  hypothetical protein EUGRSUZ_L021162                    342   1e-113   Eucalyptus grandis [rose gum]
ref|XP_003624678.1|  Methionine synthase                                350   2e-113   
gb|AAL73979.1|AF466201_8  methionine synthase protein                   352   1e-112   Sorghum bicolor [broomcorn]
ref|XP_010036243.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    351   2e-112   Eucalyptus grandis [rose gum]
ref|XP_003624679.1|  Methionine synthase                                351   2e-112   
ref|XP_010041374.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    343   2e-111   
emb|CCC42221.1|  vitamin-b12 independent methionine synthase            348   2e-111   Pinus pinaster [cluster pine]
gb|KCW45141.1|  hypothetical protein EUGRSUZ_L01250                     342   8e-110   Eucalyptus grandis [rose gum]
ref|XP_001757366.1|  predicted protein                                  344   1e-109   
gb|KCW47769.1|  hypothetical protein EUGRSUZ_K015171                    320   1e-107   Eucalyptus grandis [rose gum]
ref|XP_001758527.1|  predicted protein                                  338   2e-107   
ref|XP_001784286.1|  predicted protein                                  338   2e-107   
gb|KCW45140.1|  hypothetical protein EUGRSUZ_L01249                     334   9e-106   Eucalyptus grandis [rose gum]
ref|XP_002969765.1|  hypothetical protein SELMODRAFT_171028             332   9e-105   Selaginella moellendorffii
ref|XP_002993286.1|  hypothetical protein SELMODRAFT_162950             332   9e-105   Selaginella moellendorffii
ref|XP_010038793.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    315   9e-104   
gb|KCW47766.1|  hypothetical protein EUGRSUZ_K01515                     311   4e-97    
gb|ABY60341.1|  At3g03780-like protein                                  263   1e-85    
gb|ABY60333.1|  At3g03780                                               263   2e-85    
gb|ABY60334.1|  At3g03780                                               261   8e-85    
gb|ABY60327.1|  At3g03780                                               260   2e-84    
ref|WP_043452738.1|  5-methyltetrahydropteroyltriglutamate--homoc...    256   4e-76    
ref|WP_025319249.1|  5-methyltetrahydropteroyltriglutamate--homoc...    256   4e-76    
gb|ABI61681.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    256   6e-76    
gb|AHJ69501.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    256   6e-76    
ref|WP_030980215.1|  hypothetical protein                               241   6e-74    
tpg|DAA47597.1|  TPA: putative methionine synthase family protein       231   1e-73    
gb|KIZ26964.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    237   3e-72    
ref|WP_030121850.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   8e-72    
ref|WP_030112459.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   1e-71    
ref|WP_030952777.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   1e-71    
ref|WP_025286299.1|  5-methyltetrahydropteroyltriglutamate--homoc...    243   2e-71    
gb|AHJ62603.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    243   3e-71    
gb|KIX70945.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    234   3e-71    
gb|AHJ66832.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    243   3e-71    
ref|WP_025320901.1|  5-methyltetrahydropteroyltriglutamate--homoc...    243   4e-71    
ref|WP_009949830.1|  5-methyltetrahydropteroyltriglutamate--homoc...    242   8e-71    
ref|WP_037934146.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   9e-71    
ref|WP_030999649.1|  5-methyltetrahydropteroyltriglutamate--homoc...    242   9e-71    
gb|EFL03975.1|  LOW QUALITY PROTEIN: 5-methyltetrahydropteroyltri...    235   1e-70    
ref|WP_011027494.1|  5-methyltetrahydropteroyltriglutamate--homoc...    241   2e-70    
ref|WP_027765038.1|  5-methyltetrahydropteroyltriglutamate--homoc...    241   2e-70    
ref|WP_030562869.1|  5-methyltetrahydropteroyltriglutamate--homoc...    241   2e-70    
ref|WP_031104352.1|  5-methyltetrahydropteroyltriglutamate--homoc...    240   3e-70    
ref|WP_028441028.1|  5-methyltetrahydropteroyltriglutamate--homoc...    240   3e-70    
ref|WP_030623621.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    240   4e-70    
ref|WP_037715526.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   7e-70    
ref|WP_046088725.1|  5-methyltetrahydropteroyltriglutamate--homoc...    239   1e-69    
ref|WP_037880195.1|  5-methyltetrahydropteroyltriglutamate--homoc...    238   1e-69    
ref|WP_041994231.1|  5-methyltetrahydropteroyltriglutamate--homoc...    238   2e-69    
ref|WP_030830316.1|  5-methyltetrahydropteroyltriglutamate--homoc...    238   3e-69    
ref|WP_030605039.1|  5-methyltetrahydropteroyltriglutamate--homoc...    237   4e-69    
ref|WP_034492788.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   8e-69    
ref|WP_018550962.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   8e-69    
ref|WP_030431666.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   8e-69    
gb|KFX72013.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    236   1e-68    
ref|WP_031054648.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   1e-68    
gb|AGP59875.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    236   1e-68    
ref|WP_027738047.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   1e-68    
ref|WP_030670507.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   1e-68    
ref|WP_028429673.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   2e-68    
ref|WP_019544425.1|  5-methyltetrahydropteroyltriglutamate--homoc...    236   2e-68    
ref|WP_014058985.1|  5-methyltetrahydropteroyltriglutamate--homoc...    235   2e-68    
ref|WP_014048850.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    235   2e-68    
ref|WP_043446221.1|  5-methyltetrahydropteroyltriglutamate--homoc...    235   2e-68    
ref|WP_030960165.1|  5-methyltetrahydropteroyltriglutamate--homoc...    235   3e-68    
ref|WP_030622139.1|  5-methyltetrahydropteroyltriglutamate--homoc...    235   3e-68    
ref|WP_030211308.1|  5-methyltetrahydropteroyltriglutamate--homoc...    235   3e-68    
ref|WP_044578942.1|  5-methyltetrahydropteroyltriglutamate--homoc...    235   3e-68    
ref|WP_040029084.1|  hypothetical protein                               235   3e-68    
ref|WP_002644197.1|  5-methyltetrahydropteroyltriglutamate--homoc...    235   3e-68    
ref|WP_030067371.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   4e-68    
ref|WP_030766874.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   4e-68    
ref|WP_030797749.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   5e-68    
ref|WP_030364082.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   5e-68    
ref|WP_017973577.1|  hypothetical protein                               234   5e-68    
ref|WP_039638756.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   6e-68    
ref|WP_015036761.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   6e-68    
ref|WP_030307263.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   7e-68    
ref|WP_030356566.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    234   7e-68    
ref|WP_030349384.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   7e-68    
ref|WP_045865304.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   8e-68    
ref|WP_030385439.1|  5-methyltetrahydropteroyltriglutamate--homoc...    234   1e-67    
ref|WP_043262800.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   1e-67    
ref|WP_016905608.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   1e-67    
ref|WP_030253868.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   1e-67    
gb|AJC60769.1|  5-methyltetrahydropteroyltriglutamate-- homocyste...    233   1e-67    
ref|WP_003951464.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   1e-67    
ref|WP_037643097.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   1e-67    
ref|WP_029581768.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   1e-67    
ref|WP_015506935.1|  5-methyltetrahydropteroyltriglutamate- homoc...    233   1e-67    
ref|WP_029184065.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   1e-67    
ref|WP_009192292.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   1e-67    
ref|WP_026282375.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   2e-67    
ref|WP_019521416.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    233   2e-67    
ref|WP_030410918.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   2e-67    
ref|WP_015655498.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   2e-67    
ref|WP_019982020.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   2e-67    
ref|WP_018548575.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   2e-67    
ref|WP_009946026.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   2e-67    
ref|WP_019631992.1|  hypothetical protein                               232   2e-67    
ref|WP_037961949.1|  5-methyltetrahydropteroyltriglutamate--homoc...    233   2e-67    
ref|WP_030887967.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   3e-67    
ref|WP_018539551.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   3e-67    
ref|WP_007023727.1|  5-methyltetrahydropteroyltriglutamate--homoc...    224   3e-67    
ref|WP_030881081.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   3e-67    
ref|WP_030331426.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   3e-67    
ref|WP_043679026.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   3e-67    
ref|WP_026066250.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_031177609.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_032772285.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_030339453.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    232   4e-67    
ref|WP_030084234.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_030736981.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_030293446.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_030724232.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    232   4e-67    
ref|WP_033238963.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_028798256.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_031058482.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_030702802.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    232   4e-67    
ref|WP_030278061.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    232   4e-67    
ref|WP_031058426.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_030698376.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   4e-67    
ref|WP_018534646.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   5e-67    
ref|WP_026048241.1|  5-methyltetrahydropteroyltriglutamate--homoc...    232   5e-67    
ref|WP_030625055.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   5e-67    
ref|WP_043246950.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   6e-67    
ref|WP_045507491.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   6e-67    
ref|WP_037842691.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   6e-67    
ref|WP_032775461.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   6e-67    
ref|WP_030420347.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   6e-67    
ref|WP_031221292.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   6e-67    
ref|WP_030948058.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   6e-67    
ref|WP_018523151.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    231   7e-67    
ref|WP_031150104.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   7e-67    
ref|WP_012378383.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   7e-67    
ref|WP_031063408.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   7e-67    
ref|WP_020127606.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   7e-67    
ref|WP_030783023.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   8e-67    
ref|WP_003965121.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   8e-67    
ref|WP_030020062.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   8e-67    
ref|WP_032767842.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   9e-67    
ref|WP_027762025.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   9e-67    
ref|WP_030105984.1|  5-methyltetrahydropteroyltriglutamate--homoc...    224   9e-67    
ref|WP_019358072.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   9e-67    
gb|EST37342.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    231   9e-67    
ref|WP_031143812.1|  5-methyltetrahydropteroyltriglutamate--homoc...    231   9e-67    
gb|ABG22093.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    230   1e-66    
gb|AAF81245.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    231   1e-66    
gb|EGG49057.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    226   1e-66    
ref|WP_030187911.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   1e-66    
ref|WP_043253810.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_009359908.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_018565339.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_026235168.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_006128671.1|  5-methyltetrahydropteroyltriglutamate-homocy...    230   2e-66    
ref|WP_037892233.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_010072662.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_010913785.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_030282363.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_034240533.1|  5-methyltetrahydropteroyltriglutamate--homoc...    222   2e-66    
ref|WP_030704191.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_032787200.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_031179487.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   2e-66    
ref|WP_032753913.1|  5-methyltetrahydropteroyltriglutamate--homoc...    230   3e-66    
ref|WP_004939117.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
ref|WP_029182681.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
ref|WP_030585464.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
ref|WP_031003223.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
ref|WP_028418297.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
ref|WP_030722759.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
ref|WP_040026583.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
ref|WP_033275432.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
ref|WP_018491438.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
ref|WP_033271877.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   3e-66    
gb|KIO32801.1|  hypothetical protein M407DRAFT_95971                    229   3e-66    
ref|WP_016333203.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   4e-66    
ref|WP_044372608.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   4e-66    
ref|WP_019061872.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   4e-66    
ref|WP_027033338.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   4e-66    
ref|WP_032794940.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   4e-66    
ref|WP_031084433.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   4e-66    
ref|WP_030319539.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   5e-66    
emb|CEL18357.1|  5-methyltetrahydropteroyltriglutamate--homocyste...    229   5e-66    
ref|WP_042189239.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   5e-66    
gb|EGJ73223.1|  putative 5-methyltetrahydropteroyltriglutamate--h...    230   5e-66    
ref|WP_031088626.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   6e-66    
ref|WP_030403495.1|  5-methyltetrahydropteroyltriglutamate--homoc...    229   6e-66    
ref|WP_045774974.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   7e-66    
ref|WP_016577914.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   7e-66    
ref|WP_026169514.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   7e-66    
ref|WP_018514786.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   7e-66    
ref|WP_038517536.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   7e-66    
emb|CAD31565.1|  PUTATIVE 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE--...    229   7e-66    
ref|WP_030814380.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   8e-66    
ref|WP_026164764.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   8e-66    
ref|WP_006602312.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   8e-66    
ref|WP_016432157.1|  5-methyltetrahydropteroyltriglutamate-homocy...    228   8e-66    
ref|WP_031126176.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   8e-66    
emb|CCV11472.1|  5-methyltetrahydropteroyltriglutamate-homocystei...    228   8e-66    
ref|WP_043576918.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   9e-66    
ref|WP_030124980.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    228   9e-66    
ref|WP_030638451.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   9e-66    
ref|WP_014152504.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    228   9e-66    
gb|EHM23802.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    228   9e-66    
ref|WP_030880510.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   9e-66    
ref|WP_036240889.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   1e-65    
ref|WP_030767820.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    228   1e-65    
ref|WP_027732197.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   1e-65    
gb|EST33017.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    228   1e-65    
ref|WP_019071130.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   1e-65    
ref|WP_010983486.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   1e-65    
ref|WP_030562685.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   1e-65    
ref|WP_010269001.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    228   2e-65    
ref|WP_019855266.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   2e-65    
gb|AJT63605.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    228   2e-65    
ref|WP_019863485.1|  5-methyltetrahydropteroyltriglutamate--homoc...    228   2e-65    
gb|AGJ59066.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    228   2e-65    
ref|WP_037344088.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   2e-65    
ref|WP_024520597.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   2e-65    
ref|WP_030872843.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   2e-65    
ref|WP_023421455.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   2e-65    
ref|WP_018653971.1|  hypothetical protein                               227   3e-65    
ref|WP_033947772.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   3e-65    
ref|WP_033279523.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   3e-65    
ref|WP_037829153.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   3e-65    
ref|WP_037928989.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   3e-65    
ref|WP_043973753.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   3e-65    
gb|AGK81152.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    227   3e-65    
ref|WP_030991322.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   3e-65    
ref|WP_020548783.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   3e-65    
ref|WP_028435821.1|  5-methyltetrahydropteroyltriglutamate--homoc...    227   3e-65    
ref|WP_024758346.1|  5-methyltetrahydropteroyltriglutamate--homoc...    226   4e-65    
ref|WP_030820718.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    226   4e-65    
ref|WP_026234673.1|  5-methyltetrahydropteroyltriglutamate--homoc...    226   4e-65    
ref|WP_023553314.1|  5-methyltetrahydropteroyltriglutamate--homoc...    226   5e-65    
ref|WP_030652607.1|  5-methyltetrahydropteroyltriglutamate--homoc...    226   5e-65    



>gb|KJB80760.1| hypothetical protein B456_013G114400 [Gossypium raimondii]
Length=538

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 202/206 (98%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLR+SIWKQM+GAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMSGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTT+MLGAVPPRYNWTGGEIG+DTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTSMLGAVPPRYNWTGGEIGYDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV+E+KEAKALGVDTVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKIIPIYKEVISELKAAGASWIQFD  206



>gb|KDO54954.1| hypothetical protein CISIN_1g0202292mg, partial [Citrus sinensis]
Length=222

 Score =   392 bits (1006),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAK LGV+TVPVL+GPVSYLLLSKPAKGV K+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVLIGPVSYLLLSKPAKGVAKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISELKAAGASWIQFD  206



>ref|XP_011077750.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Sesamum indicum]
Length=765

 Score =   408 bits (1049),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/206 (94%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAE+L+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEELEKVATDLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL+GPV+YLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLIGPVTYLLLSKPAKGVEKTFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEVV ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVVAELKAAGASWIQFD  206



>ref|XP_006443472.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 gb|ESR56712.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
Length=521

 Score =   399 bits (1025),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSQAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAK LGV+TVPVL+GPVSYLLLSKPAKGV K+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVLIGPVSYLLLSKPAKGVAKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISELKAAGASWIQFD  206



>ref|XP_011094156.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Sesamum indicum]
Length=765

 Score =   405 bits (1042),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAE+L+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEELEKVATDLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL+GPV+YLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVTYLLLSKPAKGVEKTFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQFD  206



>gb|KCW47762.1| hypothetical protein EUGRSUZ_K015081, partial [Eucalyptus grandis]
Length=319

 Score =   390 bits (1002),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVSADLRSSIWKQMSHAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKA+ EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAITEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKNFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+LPIYKEVV+ELKAAGASWIQFD
Sbjct  181  LGKVLPIYKEVVSELKAAGASWIQFD  206



>gb|KJB44522.1| hypothetical protein B456_007G257500 [Gossypium raimondii]
Length=511

 Score =   397 bits (1020),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+ LR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAAGLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV+FSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVRFSYASHKAVDEYKEAKALGVNTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISELKAAGASWIQFD  206



>gb|AEO86798.1| methionine synthase [Camellia sinensis]
Length=765

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMASAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY WTGGEIGFDTYFSMARGNA+VPAMEM KWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWTGGEIGFDTYFSMARGNASVPAMEMAKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP++KFSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPEIKFSYASHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEVV ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVVAELKAAGASWIQFD  206



>ref|XP_009629870.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana tomentosiformis]
 ref|XP_009629878.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana tomentosiformis]
Length=765

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQFD  206



>ref|XP_004136654.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Cucumis sativus]
 gb|KGN59474.1| Methionine synthase [Cucumis sativus]
Length=765

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 202/206 (98%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSCYDQVLDTTALLGAVPPRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGV+K+F LLSL
Sbjct  121  VPELGPEVKFSYASHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVDKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILP+YKEV+ +LKAAGASWIQFD
Sbjct  181  LDKILPVYKEVIADLKAAGASWIQFD  206



>gb|ABI35986.1| methionine synthase [Orobanche ramosa]
Length=765

 Score =   404 bits (1037),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DL+ASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLKASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFATYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEY EAKALGV+TVPVLVGPV+YLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVNEYNEAKALGVNTVPVLVGPVTYLLLSKPAKGVEKTFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQFD  206



>gb|KJB26633.1| hypothetical protein B456_004G251500 [Gossypium raimondii]
Length=511

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIW+QMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDNKSSAEDLQKVAADLRSSIWQQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGVDT+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELKAAGA WIQFD
Sbjct  181  LPKILPIYKEVIAELKAAGALWIQFD  206



>ref|XP_004291976.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Fragaria vesca subsp. vesca]
Length=765

 Score =   403 bits (1035),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRCSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSHYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVKEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV++ELKAAGASWIQFD
Sbjct  181  LGKIIPIYKEVISELKAAGASWIQFD  206



>gb|KJB80758.1| hypothetical protein B456_013G114400 [Gossypium raimondii]
 gb|KJB80759.1| hypothetical protein B456_013G114400 [Gossypium raimondii]
 gb|KJB80761.1| hypothetical protein B456_013G114400 [Gossypium raimondii]
Length=765

 Score =   403 bits (1035),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 202/206 (98%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLR+SIWKQM+GAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMSGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTT+MLGAVPPRYNWTGGEIG+DTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTSMLGAVPPRYNWTGGEIGYDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV+E+KEAKALGVDTVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKIIPIYKEVISELKAAGASWIQFD  206



>gb|KJB82416.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
Length=538

 Score =   395 bits (1016),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+++LKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISDLKAAGASWIQFD  206



>gb|EYU18182.1| hypothetical protein MIMGU_mgv1a001749mg [Erythranthe guttata]
Length=765

 Score =   402 bits (1034),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRSSIWKQMSDVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEYKEAKALG+DTVPVLVGPV+YLLLSKPAKGVEK+F ++SL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGIDTVPVLVGPVTYLLLSKPAKGVEKNFPIISL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGA+WIQFD
Sbjct  181  LDKILPIYKEVIAELKAAGATWIQFD  206



>gb|EYU38730.1| hypothetical protein MIMGU_mgv1a001746mg [Erythranthe guttata]
Length=765

 Score =   402 bits (1033),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVSADLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTA+LGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFAYYDQVLDTTALLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAVNEY EAKALG+DTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVTFSYASHKAVNEYNEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKTFNLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVIGELKAAGASWIQFD  206



>ref|XP_006371191.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48988.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
Length=655

 Score =   398 bits (1023),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELK AGASWIQFD
Sbjct  181  LGKILPIYKEVISELKEAGASWIQFD  206



>ref|XP_006443470.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 gb|ESR56710.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
Length=586

 Score =   396 bits (1017),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSQAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAK LGV+TVPVL+GPVSYLLLSKPAKGV K+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVLIGPVSYLLLSKPAKGVAKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISELKAAGASWIQFD  206



>gb|ABS01352.1| methionine synthase [Carica papaya]
Length=765

 Score =   401 bits (1030),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQM+ A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMSDARIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVTFSYASHKAVTEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L+KILP+YKEV++ELKAAGASWIQFD
Sbjct  181  LNKILPVYKEVISELKAAGASWIQFD  206



>ref|XP_009615630.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
 ref|XP_009615631.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
 ref|XP_009615632.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
Length=765

 Score =   401 bits (1030),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK LGV+TVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVNTVPVLIGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDK+LPIYKEV++ELKAAGASWIQFD
Sbjct  181  LDKVLPIYKEVISELKAAGASWIQFD  206



>gb|AGT40326.1| methionine synthase [Nicotiana attenuata]
Length=765

 Score =   401 bits (1030),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMAEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQ D
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQLD  206



>ref|XP_008237251.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Prunus mume]
Length=765

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALGVDT+PVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTIPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV++ELKAAGASWIQFD
Sbjct  181  LGKIIPIYKEVISELKAAGASWIQFD  206



>ref|XP_009791486.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana sylvestris]
 ref|XP_009791487.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana sylvestris]
Length=765

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNW GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPARYNWAGGEIAFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLIGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQFD  206



>gb|KDO66097.1| hypothetical protein CISIN_1g0165812mg, partial [Citrus sinensis]
Length=222

 Score =   382 bits (981),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPR+NW GGEIGFD YFSMARGNA+V AMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRFNWNGGEIGFDVYFSMARGNASVLAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAK  GV+TVPVL+GPVSYLLLSKPA GVEK+F +LSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGHGVETVPVLIGPVSYLLLSKPAWGVEKTFSVLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEVV+ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVVSELKAAGASWIQFD  206



>ref|XP_008443293.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Cucumis melo]
Length=765

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 203/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY+WTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYSWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGV+K+F LLSL
Sbjct  121  VPELGPEVKFSYASHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVDKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILP+YKEV+++LKAAGA+WIQFD
Sbjct  181  LDKILPVYKEVISDLKAAGATWIQFD  206



>ref|XP_009619432.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
 ref|XP_009619433.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
Length=765

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNW GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPARYNWAGGEIAFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLIGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQFD  206



>ref|XP_011008841.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X2 [Populus euphratica]
Length=779

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELK AGASWIQFD
Sbjct  181  LGKILPIYKEVISELKEAGASWIQFD  206



>ref|XP_011008839.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X1 [Populus euphratica]
 ref|XP_011008840.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X1 [Populus euphratica]
Length=779

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELK AGASWIQFD
Sbjct  181  LGKILPIYKEVISELKEAGASWIQFD  206



>gb|KHG18658.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=770

 Score =   400 bits (1029),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLR+SIWKQM+GAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMSGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTT+MLGAVPPRYNWTGGEIG DTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTSMLGAVPPRYNWTGGEIGDDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV+E+KEAKALGVDTVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKIIPIYKEVISELKAAGASWIQFD  206



>ref|XP_009804811.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
 ref|XP_009804812.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
 ref|XP_009804813.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
Length=765

 Score =   400 bits (1028),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK LGV+T PVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVNTAPVLIGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVISELKAAGASWIQFD  206



>ref|XP_006384691.1| hypothetical protein POPTR_0004s20220g [Populus trichocarpa]
 gb|ERP62488.1| hypothetical protein POPTR_0004s20220g [Populus trichocarpa]
Length=817

 Score =   402 bits (1032),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQM+ AGIK+IP
Sbjct  51   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMSDAGIKFIP  110

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  111  SNTFSCYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  170

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LL
Sbjct  171  YIVPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLL  230

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+Y+EV+ ELKAAGASWIQFD
Sbjct  231  SLIDKILPVYQEVLAELKAAGASWIQFD  258



>ref|XP_011467399.1| PREDICTED: LOW QUALITY PROTEIN: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Fragaria vesca subsp. 
vesca]
Length=765

 Score =   400 bits (1028),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR SIWKQM+ AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSNAEDLQKVSADLRCSIWKQMSDAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSHYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPD+KFSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDIKFSYASHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV++ELKAAGASWIQFD
Sbjct  181  LGKIIPIYKEVISELKAAGASWIQFD  206



>ref|XP_010247947.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nelumbo nucifera]
Length=765

 Score =   400 bits (1028),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLRASIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRASIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPDRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAVNEYKEAK LGV+TVPV++GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKELGVNTVPVIIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L+KILP+YKEVV ELKAAG+SWIQFD
Sbjct  181  LEKILPVYKEVVAELKAAGSSWIQFD  206



>ref|XP_008386852.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
 ref|XP_008386853.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
Length=765

 Score =   400 bits (1027),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEVV+ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVVSELKAAGASWIQFD  206



>ref|XP_007015562.1| Cobalamin-independent synthase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33181.1| Cobalamin-independent synthase family protein isoform 2 [Theobroma 
cacao]
Length=632

 Score =   395 bits (1016),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKVA+DLR+SIW+QM+ AGIKYIP
Sbjct  55   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWRQMSEAGIKYIP  114

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LD TAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  115  SNTFSYYDQMLDNTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  174

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKFSYASHKAV+EYKEAKALGVDTVPVL+GPVSYLLLSKPAKGVEKSF LL
Sbjct  175  YIVPELGPDVKFSYASHKAVDEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLL  234

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+ KILPIYKEVV ELKAAGA+WIQFD
Sbjct  235  SLIGKILPIYKEVVAELKAAGATWIQFD  262



>ref|XP_011005896.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Populus euphratica]
Length=814

 Score =   401 bits (1030),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQ+VA+DLR+SIWKQM+ AGIK+IP
Sbjct  48   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQRVAADLRSSIWKQMSDAGIKFIP  107

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  108  SNTFSCYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  167

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LL
Sbjct  168  YIVPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLL  227

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+Y+EV+ ELKAAGASWIQFD
Sbjct  228  SLIDKILPVYQEVLAELKAAGASWIQFD  255



>ref|XP_006371184.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48981.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
Length=738

 Score =   399 bits (1025),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELK AGASWIQFD
Sbjct  181  LGKILPIYKEVISELKEAGASWIQFD  206



>ref|XP_009353101.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
 ref|XP_009353102.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
Length=765

 Score =   399 bits (1025),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM  AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMTDAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEVV+ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVVSELKAAGASWIQFD  206



>ref|XP_007030023.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007030024.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10525.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10526.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
Length=765

 Score =   399 bits (1025),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTT+MLGAVPPRY+W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTSMLGAVPPRYSWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGVDTVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+P+YKEV++ELKAAGASWIQFD
Sbjct  181  LPKIIPVYKEVISELKAAGASWIQFD  206



>ref|XP_002325856.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371179.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
 ref|XP_006371180.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371181.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371182.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371183.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371185.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371186.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371187.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371188.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371189.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371190.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|EEF00238.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48976.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
 gb|ERP48977.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48978.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48979.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48980.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48982.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48983.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48984.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48985.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48986.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48987.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
Length=765

 Score =   399 bits (1025),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELK AGASWIQFD
Sbjct  181  LGKILPIYKEVISELKEAGASWIQFD  206



>gb|KJB44523.1| hypothetical protein B456_007G257500 [Gossypium raimondii]
Length=664

 Score =   396 bits (1017),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+ LR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAAGLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV+FSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVRFSYASHKAVDEYKEAKALGVNTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISELKAAGASWIQFD  206



>ref|XP_008391707.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Malus domestica]
 ref|XP_008391708.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Malus domestica]
Length=765

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM  AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMTDAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEVV+ELKAAGASWIQFD
Sbjct  181  LPKILPVYKEVVSELKAAGASWIQFD  206



>ref|XP_009366484.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
 ref|XP_009366485.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
Length=765

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEVV+ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVVSELKAAGASWIQFD  206



>gb|KJB82419.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
Length=578

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+++LKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISDLKAAGASWIQFD  206



>ref|XP_006443469.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 ref|XP_006443471.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 ref|XP_006479148.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Citrus sinensis]
 gb|ESR56709.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 gb|ESR56711.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
Length=765

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSQAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAK LGV+TVPVL+GPVSYLLLSKPAKGV K+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVLIGPVSYLLLSKPAKGVAKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISELKAAGASWIQFD  206



>ref|XP_002525709.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
 gb|EEF36692.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
Length=765

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLR SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAQDLEKVASDLRESIWKQMAAAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKA GVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVTEYKEAKAHGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV++ELKAAGASWIQFD
Sbjct  181  LGKILPVYKEVISELKAAGASWIQFD  206



>ref|NP_001235794.1| methionine synthase [Glycine max]
 gb|AAQ08403.1| methionine synthase [Glycine max]
Length=763

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+SDLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSSDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSHYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV F+YASHKAV+EYKEAKALGVDTVPVLVGPV+YLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFTYASHKAVDEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV+ +LKAAGASWIQFD
Sbjct  181  LPKVLAVYKEVIADLKAAGASWIQFD  206



>gb|KJB26632.1| hypothetical protein B456_004G251500 [Gossypium raimondii]
Length=651

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIW+QMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDNKSSAEDLQKVAADLRSSIWQQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGVDT+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELKAAGA WIQFD
Sbjct  181  LPKILPIYKEVIAELKAAGALWIQFD  206



>ref|XP_007204266.1| hypothetical protein PRUPE_ppa001783mg [Prunus persica]
 gb|EMJ05465.1| hypothetical protein PRUPE_ppa001783mg [Prunus persica]
Length=765

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK+SAEDLQKVA+DLR+SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTSAEDLQKVAADLRSSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YD VLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDHVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALGVDT+PVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTIPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV++ELKAAGASWIQFD
Sbjct  181  LGKIIPIYKEVISELKAAGASWIQFD  206



>gb|EPS68005.1| methionine synthase [Genlisea aurea]
Length=765

 Score =   397 bits (1021),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPR+GPKRELKFALESFWDGKSSAE+L+KVA D+R SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRVGPKRELKFALESFWDGKSSAEELEKVAKDIRTSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA LGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAFLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEYKEAKALG+DTVPVL+GPV+YLLLSKPAKGVE +F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEGNFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV++ELK+AGASWIQFD
Sbjct  181  LDKILPIYKEVISELKSAGASWIQFD  206



>ref|XP_004960256.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Setaria italica]
Length=774

 Score =   397 bits (1021),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            RKMASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIP
Sbjct  8    RKMASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIP  67

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH
Sbjct  68   SNTFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  127

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            FIVPELGP+ KF+Y+SHKAVNEYKEAKALGVDTVPVL GPVSYLLLSK AKGVEK F LL
Sbjct  128  FIVPELGPNTKFTYSSHKAVNEYKEAKALGVDTVPVLTGPVSYLLLSKAAKGVEKGFPLL  187

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SLL  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  188  SLLSGILPVYKEVIAELKAAGASWIQFD  215



>ref|XP_003542326.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Glycine max]
 gb|KHN46660.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=803

 Score =   398 bits (1022),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKVA+DLR++IWKQMA AGI
Sbjct  33   ATSSRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSAIWKQMADAGI  92

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            KYIPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  93   KYIPSNTFSLYDQVLDTTAMLGAVPSRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFD  152

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKS  617
            TNYH+IVPELGPDVKFSYASHKAV+E+KEAK LGV+TVPVLVGPVSYLLLSKPAKGVEKS
Sbjct  153  TNYHYIVPELGPDVKFSYASHKAVDEFKEAKVLGVNTVPVLVGPVSYLLLSKPAKGVEKS  212

Query  618  FQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            F LLSL+DKILP+Y+EVV ELKAAGA+WIQFD
Sbjct  213  FSLLSLIDKILPVYREVVAELKAAGATWIQFD  244



>gb|KJB44524.1| hypothetical protein B456_007G257500 [Gossypium raimondii]
 gb|KJB44525.1| hypothetical protein B456_007G257500 [Gossypium raimondii]
Length=765

 Score =   396 bits (1018),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+ LR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAAGLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV+FSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVRFSYASHKAVDEYKEAKALGVNTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISELKAAGASWIQFD  206



>gb|KHG11135.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =   396 bits (1018),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EY+EAKALGVDT+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYEEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVIAELKAAGASWIQFD  206



>gb|KHG11134.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=778

 Score =   397 bits (1019),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EY+EAKALGVDT+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYEEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVIAELKAAGASWIQFD  206



>dbj|BAP47511.1| methionine synthase [Gentiana triflora]
Length=765

 Score =   396 bits (1018),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA++LRASIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVATELRASIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT  MLGAVPPRYN+ GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTATMLGAVPPRYNYGGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAK LGVDTVPVLVGPVS+LL SKPAKGVEKSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKELGVDTVPVLVGPVSFLLQSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQFD  206



>ref|XP_002515852.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
 gb|EEF46521.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
Length=815

 Score =   397 bits (1021),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +3

Query  72   LASTP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGA  251
            L+ST  R MASHI GYPRMGPKRELKFALESFWDGKSSAEDLQKVA++LRASIWKQMA A
Sbjct  43   LSSTSFRAMASHIAGYPRMGPKRELKFALESFWDGKSSAEDLQKVAAELRASIWKQMADA  102

Query  252  GIKYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKW  431
            G K+IPSNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKW
Sbjct  103  GTKFIPSNTFSYYDQVLDTTAMLGAVPPRYGWDGGEIGFDVYFSMARGNASVPAMEMTKW  162

Query  432  FDTNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVE  611
            FDTNYH+IVPELGP+VKFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVE
Sbjct  163  FDTNYHYIVPELGPEVKFSYASHKAVDEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVE  222

Query  612  KSFQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            KSF LLSL+D+ILPIYKEV+ ELKAAGA WIQFD
Sbjct  223  KSFSLLSLIDRILPIYKEVIAELKAAGARWIQFD  256



>gb|KHG18420.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSS EDLQKVA+ LR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSGEDLQKVAAGLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV+FSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVRFSYASHKAVDEYKEAKALGVNTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISELKAAGASWIQFD  206



>ref|XP_003522969.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Glycine max]
Length=799

 Score =   397 bits (1019),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR++IWKQMA AGI
Sbjct  33   ATSSRAMASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVAADLRSAIWKQMADAGI  92

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            KYIPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGN++VPAMEMTKWFD
Sbjct  93   KYIPSNTFSYYDQVLDTTAMLGAVPSRYNWNGGEIGFDVYFSMARGNSSVPAMEMTKWFD  152

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKS  617
            TNYH+IVPELGPDVKFSYASHK V+EYKEAK LG++TVPVLVGPVSYLLLSKPAKGVEKS
Sbjct  153  TNYHYIVPELGPDVKFSYASHKVVDEYKEAKVLGINTVPVLVGPVSYLLLSKPAKGVEKS  212

Query  618  FQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            F LLSL+DKILP+Y+EVV ELKAAGA+WIQFD
Sbjct  213  FSLLSLIDKILPVYREVVAELKAAGATWIQFD  244



>ref|XP_009790020.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
 ref|XP_009790021.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
Length=765

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWT GEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTSGEIGFGTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQ D
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQLD  206



>ref|XP_002276908.2| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Vitis vinifera]
 emb|CBI24392.3| unnamed protein product [Vitis vinifera]
Length=804

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA++LRASIWKQMA AGIKYIP
Sbjct  38   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAAELRASIWKQMADAGIKYIP  97

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+V AMEMTKWFDTNYH
Sbjct  98   SNTFSYYDQVLDTTAMLGAVPERYGWNGGEIGFDAYFSMARGNASVTAMEMTKWFDTNYH  157

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            FIVPELGP+VKFSYASHKAVNE+KEAKALG++TVPV+VGPVSYLLLSKPAKG+EKSF LL
Sbjct  158  FIVPELGPNVKFSYASHKAVNEFKEAKALGIETVPVIVGPVSYLLLSKPAKGLEKSFSLL  217

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILPIYKEVVTELK AGA+WIQFD
Sbjct  218  SLIDKILPIYKEVVTELKKAGATWIQFD  245



>ref|XP_012070412.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Jatropha curcas]
 ref|XP_012070413.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Jatropha curcas]
 gb|KDP39669.1| hypothetical protein JCGZ_02689 [Jatropha curcas]
Length=765

 Score =   396 bits (1017),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVA +LR SIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAQDLEKVAFELRESIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAKALG+DTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV++ELK AGASWIQFD
Sbjct  181  LGKILPVYKEVISELKEAGASWIQFD  206



>ref|XP_003554033.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform 1 [Glycine max]
Length=763

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSFYDQLLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV F+YASHKAV+EYKEAKALGVDT+PVLVGPV+YLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFTYASHKAVDEYKEAKALGVDTIPVLVGPVTYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV+ +LKAAGASWIQFD
Sbjct  181  LPKVLAVYKEVIADLKAAGASWIQFD  206



>gb|KHN41415.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=799

 Score =   397 bits (1019),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR++IWKQMA AGI
Sbjct  33   ATSSRAMASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVAADLRSAIWKQMADAGI  92

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            KYIPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGN++VPAMEMTKWFD
Sbjct  93   KYIPSNTFSYYDQVLDTTAMLGAVPSRYNWNGGEIGFDVYFSMARGNSSVPAMEMTKWFD  152

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKS  617
            TNYH+IVPELGPDVKFSYASHK V+EYKEAK LG++TVPVLVGPVSYLLLSKPAKGVEKS
Sbjct  153  TNYHYIVPELGPDVKFSYASHKVVDEYKEAKVLGINTVPVLVGPVSYLLLSKPAKGVEKS  212

Query  618  FQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            F LLSL+DKILP+Y+EVV ELKAAGA+WIQFD
Sbjct  213  FSLLSLIDKILPVYREVVAELKAAGATWIQFD  244



>ref|XP_002319710.1| hypothetical protein POPTR_0013s05850g [Populus trichocarpa]
 ref|XP_006375907.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
 gb|EEE95633.1| hypothetical protein POPTR_0013s05850g [Populus trichocarpa]
 gb|ERP53704.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
Length=765

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMTDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALGVDT+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVTEYKEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELK AGASWIQFD
Sbjct  181  LGKILPIYKEVISELKEAGASWIQFD  206



>ref|NP_001275416.1| methionine synthase [Solanum tuberosum]
 gb|AAF74983.1|AF082893_1 methionine synthase [Solanum tuberosum]
Length=765

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEI F TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIEFGTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAVNEYKEAKA GVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKAQGVDTVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQ D
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQLD  206



>gb|KHG25606.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR++IWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSAIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK+LGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKSLGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISELKAAGASWIQFD  206



>dbj|BAN04645.1| cobalamin-independent methionine synthase [Senna obtusifolia]
Length=765

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIP N
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRASIWKQMSDAGIKYIPCN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV+E+KEAKALGV+TVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEAKALGVNTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEVV +LKAAGASWIQFD
Sbjct  181  LPKILPIYKEVVADLKAAGASWIQFD  206



>gb|KDO66311.1| hypothetical protein CISIN_1g003819mg [Citrus sinensis]
Length=595

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            +DKI+P+YKEVV ELKAAGA+WIQFD
Sbjct  181  IDKIIPVYKEVVAELKAAGATWIQFD  206



>tpg|DAA47596.1| TPA: putative methionine synthase family protein [Zea mays]
Length=458

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK F LLSL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKGFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGASWIQFD  206



>ref|XP_007015561.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33180.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
Length=821

 Score =   397 bits (1019),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKVA+DLR+SIW+QM+ AGIKYIP
Sbjct  55   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWRQMSEAGIKYIP  114

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LD TAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  115  SNTFSYYDQMLDNTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  174

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKFSYASHKAV+EYKEAKALGVDTVPVL+GPVSYLLLSKPAKGVEKSF LL
Sbjct  175  YIVPELGPDVKFSYASHKAVDEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLL  234

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+ KILPIYKEVV ELKAAGA+WIQFD
Sbjct  235  SLIGKILPIYKEVVAELKAAGATWIQFD  262



>ref|XP_010031619.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
 gb|KCW50983.1| hypothetical protein EUGRSUZ_J00612 [Eucalyptus grandis]
Length=827

 Score =   397 bits (1019),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  84   P*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKY  263
            P R MASHIVGYPRMGPKRELKFALESFWD KSSAE+LQKVA+DLRASIWKQMA AGIKY
Sbjct  59   PVRAMASHIVGYPRMGPKRELKFALESFWDRKSSAEELQKVAADLRASIWKQMASAGIKY  118

Query  264  IPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTN  443
            IPSNTFS YDQVLDTTAMLGAVPPRY W GGEI FDTYFSMARGNA+VPAMEMTKWFDTN
Sbjct  119  IPSNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDTYFSMARGNASVPAMEMTKWFDTN  178

Query  444  YHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQ  623
            YH+IVPELGPDVKFSYASHKAV+E+KEA+ALGVDTVPVLVGPVSYLLLSKPAKGVEKSF 
Sbjct  179  YHYIVPELGPDVKFSYASHKAVDEFKEARALGVDTVPVLVGPVSYLLLSKPAKGVEKSFS  238

Query  624  LLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            LLSL+ KI+PIYKEV+ ELKAAGA+WIQFD
Sbjct  239  LLSLIGKIVPIYKEVIAELKAAGATWIQFD  268



>ref|XP_010036239.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
Length=768

 Score =   395 bits (1014),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVSADLRSSIWKQMSHAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKA+ EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAITEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKNFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+LPIYKEVV+ELKAAGASWIQFD
Sbjct  181  LGKVLPIYKEVVSELKAAGASWIQFD  206



>ref|XP_010521311.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=727

 Score =   394 bits (1011),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQK A++LR+SIWKQMA A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKAAAELRSSIWKQMADADIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVTEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L+KILPIY+EV++ELK AGA+WIQFD
Sbjct  181  LNKILPIYQEVISELKGAGATWIQFD  206



>gb|KJB26635.1| hypothetical protein B456_004G251500 [Gossypium raimondii]
Length=765

 Score =   395 bits (1014),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIW+QMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDNKSSAEDLQKVAADLRSSIWQQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGVDT+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELKAAGA WIQFD
Sbjct  181  LPKILPIYKEVIAELKAAGALWIQFD  206



>ref|XP_007149180.1| hypothetical protein PHAVU_005G048200g [Phaseolus vulgaris]
 gb|ESW21174.1| hypothetical protein PHAVU_005G048200g [Phaseolus vulgaris]
Length=451

 Score =   385 bits (988),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R MASHIVGYPR+GPKRELKFALESFWDGKSSAE+LQKVA+DLR++I  QMA AG 
Sbjct  32   ATSSRAMASHIVGYPRIGPKRELKFALESFWDGKSSAEELQKVAADLRSAILMQMAEAGT  91

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            KYIPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  92   KYIPSNTFSYYDQVLDTTAMLGAVPARYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFD  151

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKS  617
            TNYH+IVPELGPDVKFSY+SHKAV EYKEAK LG++TVPVLVGP+SYLLLSKPAKGV+KS
Sbjct  152  TNYHYIVPELGPDVKFSYSSHKAVLEYKEAKVLGINTVPVLVGPISYLLLSKPAKGVDKS  211

Query  618  FQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            F LLSL+DKILP+Y+EVV ELKAAGA+WIQFD
Sbjct  212  FSLLSLIDKILPVYREVVVELKAAGATWIQFD  243



>gb|KJB46053.1| hypothetical protein B456_007G346100 [Gossypium raimondii]
Length=655

 Score =   391 bits (1005),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR++IWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSAIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIRFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK+LGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKSLGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVILELKAAGASWIQFD  206



>ref|XP_011044091.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Populus euphratica]
 ref|XP_011044098.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Populus euphratica]
Length=813

 Score =   396 bits (1017),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSSAEDLQ VA+DLR+SIWKQM+ AGIK+IP
Sbjct  47   RAMASHVVGYPRMGPKRELKFALESFWDGKSSAEDLQNVAADLRSSIWKQMSDAGIKFIP  106

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  107  SNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  166

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGP+V FSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LL
Sbjct  167  YIVPELGPEVNFSYASHKAVIEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLL  226

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILPIY+EVV ELKAAGA+WIQFD
Sbjct  227  SLIDKILPIYQEVVAELKAAGATWIQFD  254



>ref|XP_010031616.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010031617.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010031618.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Eucalyptus grandis]
 gb|KCW50984.1| hypothetical protein EUGRSUZ_J00613 [Eucalyptus grandis]
Length=765

 Score =   394 bits (1012),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAE+LQKVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDRKSSAEELQKVAADLRASIWKQMASAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDTYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV+E+KEA+ALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEARALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            + KI+PIYKEV+ ELKAAGA+WIQFD
Sbjct  181  IGKIVPIYKEVIAELKAAGATWIQFD  206



>ref|XP_006470414.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Citrus sinensis]
Length=811

 Score =   395 bits (1016),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = +3

Query  63   QCFLASTP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQM  242
            +C    T  R MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIWKQM
Sbjct  36   RCSFRRTRFRAMASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWKQM  95

Query  243  AGAGIKYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEM  422
            A AGIK+IPS+TFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEM
Sbjct  96   ADAGIKFIPSSTFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEM  155

Query  423  TKWFDTNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAK  602
            TKWFDTNYH+IVPELGPDV FSYASHKAV EYKEAKALG++TVPVLVGPVSYLLLSKPAK
Sbjct  156  TKWFDTNYHYIVPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAK  215

Query  603  GVEKSFQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            GVEKSF LLSL+DKI+P+YKEVV ELKAAGA+WIQFD
Sbjct  216  GVEKSFSLLSLIDKIIPVYKEVVAELKAAGATWIQFD  252



>ref|XP_010266670.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nelumbo nucifera]
Length=765

 Score =   394 bits (1012),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQM   GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMDSVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNW GGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYNWAGGEIGFGTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAVNEYKEAK LG+DTVPV+VGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKELGIDTVPVIVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L+KILP+YKEV  ELKAAGASWIQFD
Sbjct  181  LEKILPVYKEVAAELKAAGASWIQFD  206



>ref|XP_008464953.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis melo]
Length=765

 Score =   394 bits (1012),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP++KFSYASHKAV EYKEAKALGV+TVPVL+GPVSYLLLSKPAKGV+KSF LLSL
Sbjct  121  VPELGPEMKFSYASHKAVEEYKEAKALGVETVPVLIGPVSYLLLSKPAKGVDKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEVV++LKAAGASWIQFD
Sbjct  181  LDKILPIYKEVVSDLKAAGASWIQFD  206



>ref|XP_008778953.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Phoenix dactylifera]
Length=766

 Score =   394 bits (1012),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVATDLRRSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY WTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYGWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP  KFSYASHKAV+EYKEA ALGVDTVPVL+GPV+YLL+SKPAKGVEKSF LLSL
Sbjct  121  VPELGPSTKFSYASHKAVSEYKEANALGVDTVPVLIGPVTYLLMSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  +LPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LGNVLPIYKEVIAELKAAGASWIQFD  206



>ref|XP_003561625.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Brachypodium distachyon]
 ref|XP_010231869.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Brachypodium distachyon]
Length=766

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPETKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            +  ILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  VGSILPIYKEVIAELKAAGASWIQFD  206



>ref|XP_011034320.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Populus euphratica]
 ref|XP_011034321.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Populus euphratica]
Length=765

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFA ESFWDGKSSAEDLQKVA+DLR SIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFASESFWDGKSSAEDLQKVAADLRESIWKQMTDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALGVDT+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVAEYKEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV++ELK AGASWIQFD
Sbjct  181  LGKILPIYKEVISELKEAGASWIQFD  206



>gb|KJB82415.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
 gb|KJB82417.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
 gb|KJB82420.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
Length=765

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+++LKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISDLKAAGASWIQFD  206



>ref|XP_004960257.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Setaria italica]
Length=765

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KF+Y+SHKAVNEYKEAKALGVDTVPVL GPVSYLLLSK AKGVEK F LLSL
Sbjct  121  VPELGPNTKFTYSSHKAVNEYKEAKALGVDTVPVLTGPVSYLLLSKAAKGVEKGFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSGILPVYKEVIAELKAAGASWIQFD  206



>ref|XP_006826346.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Amborella trichopoda]
 gb|ERM93583.1| hypothetical protein AMTR_s00004p00117110 [Amborella trichopoda]
Length=765

 Score =   393 bits (1010),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS A DL+KVA DL+A+IWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSGAHDLEKVAKDLKAAIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNA++PAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDTYFSMARGNASLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAKALGV+TVPV+VGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVIVGPVSYLLLSKPAKGVEKSFNLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+P+YKEVVTELKAAGA+W+QFD
Sbjct  181  LGKIIPVYKEVVTELKAAGATWVQFD  206



>dbj|BAP47510.1| methionine synthase [Gentiana triflora]
Length=765

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA++LRASIWKQM+GAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVATELRASIWKQMSGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT  MLGAVPPRYN+ GGEIG D YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTVTMLGAVPPRYNFNGGEIGHDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSY+SHKAVNEYKEAK LG+DTVPVLVGPV++LLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPEVNFSYSSHKAVNEYKEAKELGIDTVPVLVGPVTFLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV++ELKAAGASWIQFD
Sbjct  181  LDKILPIYKEVISELKAAGASWIQFD  206



>ref|XP_009591564.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana tomentosiformis]
Length=829

 Score =   395 bits (1015),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGK+S+EDL+KVA+DLR+SIWKQMA AG+KYIP
Sbjct  63   RTMASHVVGYPRMGPKRELKFALESFWDGKNSSEDLEKVAADLRSSIWKQMAEAGVKYIP  122

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W G EIGFD YF MARGNA+VPAMEMTKWFDTNYH
Sbjct  123  SNTFSYYDQVLDTTAMLGAVPPRYSWNGSEIGFDVYFPMARGNASVPAMEMTKWFDTNYH  182

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKF YASHKAVNEYKEAK+LGVDTVPVLVGPVS+LLLSK AKGVEKSF LL
Sbjct  183  YIVPELGPDVKFCYASHKAVNEYKEAKSLGVDTVPVLVGPVSFLLLSKAAKGVEKSFPLL  242

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+TELKAAGASWIQFD
Sbjct  243  SLIDKILPVYKEVITELKAAGASWIQFD  270



>ref|XP_010528749.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010528750.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=762

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQK A++LR+SIWKQMA A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKAAAELRSSIWKQMADADIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVTEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L+KILPIY+EV++ELK AGA+WIQFD
Sbjct  181  LNKILPIYQEVISELKGAGATWIQFD  206



>gb|KJB82418.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
Length=793

 Score =   394 bits (1011),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+++LKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISDLKAAGASWIQFD  206



>emb|CDP10525.1| unnamed protein product [Coffea canephora]
Length=813

 Score =   394 bits (1012),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWD KSSAE+L+KVA+DLRASIWKQMA AGIKYIP
Sbjct  47   RIMASHIVGYPRMGPKRELKFALESFWDKKSSAEELEKVAADLRASIWKQMADAGIKYIP  106

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
             NTFS YDQVLDT A+LGAVPPRYNW+GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  107  GNTFSYYDQVLDTIALLGAVPPRYNWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYH  166

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGP ++L LSKPAKGVEK+F  L
Sbjct  167  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPFTFLSLSKPAKGVEKTFNKL  226

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SLLDKILPIYKEV+ +LKAAGASWIQFD
Sbjct  227  SLLDKILPIYKEVIADLKAAGASWIQFD  254



>gb|KHG01449.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =   393 bits (1009),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W+GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL+GPVSYLLLSKPAKGV+K+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVLIGPVSYLLLSKPAKGVDKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+++LKAAGASWIQFD
Sbjct  181  LPKILPIYKEVISDLKAAGASWIQFD  206



>ref|XP_004249374.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Solanum lycopersicum]
 ref|XP_010312196.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Solanum lycopersicum]
Length=765

 Score =   393 bits (1009),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQM   GIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMCDTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEI F TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIEFATYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAVNEYKEAKA GVDTVPVLVGPVSYLLLSKPAKGV+KSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKAQGVDTVPVLVGPVSYLLLSKPAKGVDKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQ D
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQLD  206



>ref|XP_002313635.2| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
 ref|XP_006379333.1| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
 gb|EEE87590.2| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
 gb|ERP57130.1| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
Length=813

 Score =   394 bits (1012),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSSAEDLQ VA++LR+SIWKQM+ AGIK+IP
Sbjct  47   RAMASHVVGYPRMGPKRELKFALESFWDGKSSAEDLQNVAAELRSSIWKQMSDAGIKFIP  106

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  107  SNTFSCYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  166

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGP+V FSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LL
Sbjct  167  YIVPELGPEVNFSYASHKAVIEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLL  226

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+Y+EVV ELKAAGA+WIQFD
Sbjct  227  SLIDKILPVYQEVVAELKAAGATWIQFD  254



>gb|KHN20624.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=325

 Score =   378 bits (970),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVA DLRASIWKQM  AGIKYIP+N
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVAFDLRASIWKQMIDAGIKYIPNN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W   EIGFDT+FSMARGNA+VP MEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNSEEIGFDTFFSMARGNASVPTMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL+GPVSYL+LSKPAKGV+KSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L IYKEVV +LK AGASWIQFD
Sbjct  181  LPKVLAIYKEVVADLKQAGASWIQFD  206



>ref|XP_007151496.1| hypothetical protein PHAVU_004G051600g [Phaseolus vulgaris]
 gb|ESW23490.1| hypothetical protein PHAVU_004G051600g [Phaseolus vulgaris]
Length=763

 Score =   392 bits (1007),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMTDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY WTGGEIGFDT+FSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPARYGWTGGEIGFDTFFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPD+ F+YASHKAVNEYKEAKALGVDTVPVLVGPV+YL+LSKPAKGV+KSF LLSL
Sbjct  121  VPELGPDMTFTYASHKAVNEYKEAKALGVDTVPVLVGPVTYLVLSKPAKGVDKSFCLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEVV +LKAAGA+WIQFD
Sbjct  181  LPKVLAVYKEVVADLKAAGATWIQFD  206



>ref|XP_012066300.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Jatropha curcas]
Length=816

 Score =   394 bits (1011),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKVA+DLR+SIWKQMA + IK+IP
Sbjct  50   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWKQMADSDIKFIP  109

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  110  SNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  169

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGP+VKFSYASHKAV+EYKEAKALG++TVPV+VGPVSYLLLSK AKGVEKSF LL
Sbjct  170  YIVPELGPEVKFSYASHKAVDEYKEAKALGIETVPVIVGPVSYLLLSKQAKGVEKSFSLL  229

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SLLDKILP+YKEVVTELK AGASWIQFD
Sbjct  230  SLLDKILPVYKEVVTELKEAGASWIQFD  257



>ref|XP_010054791.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Eucalyptus grandis]
 gb|KCW89900.1| hypothetical protein EUGRSUZ_A02126 [Eucalyptus grandis]
Length=765

 Score =   392 bits (1007),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQMA A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMADASIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWKGGEIGHDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGV+K+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVSEYKEAKALGVNTVPVLVGPVSYLLLSKPAKGVDKNFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV++ELKAAGASWIQFD
Sbjct  181  LGKILPVYKEVISELKAAGASWIQFD  206



>ref|XP_004141126.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
 gb|KGN59730.1| hypothetical protein Csa_3G842030 [Cucumis sativus]
Length=765

 Score =   392 bits (1007),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LD T  LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDATTTLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV EYKEAKALGV+TVPVL+GPVSYLLLSKPAKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVEEYKEAKALGVETVPVLIGPVSYLLLSKPAKGVDKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEVV++LKAAGASWIQFD
Sbjct  181  LDKILPIYKEVVSDLKAAGASWIQFD  206



>gb|KJB46054.1| hypothetical protein B456_007G346100 [Gossypium raimondii]
Length=765

 Score =   392 bits (1007),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR++IWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSAIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIRFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAK+LGVDTVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKSLGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVILELKAAGASWIQFD  206



>sp|Q42699.1|METE_CATRO RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase; AltName: Full=Cobalamin-independent 
methionine synthase isozyme; AltName: Full=Vitamin-B12-independent 
methionine synthase isozyme [Catharanthus roseus]
 emb|CAA58474.1| methionine synthase [Catharanthus roseus]
Length=765

 Score =   392 bits (1007),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT  MLGAVPPRYN+ GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTATMLGAVPPRYNFAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAK LGVDTVPVLVGPV++LLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKELGVDTVPVLVGPVTFLLLSKPAKGVEKTFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LDKILPVYKEVIGELKAAGASWIQFD  206



>ref|XP_010908721.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Elaeis guineensis]
Length=766

 Score =   392 bits (1006),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVATDLRCSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W G EIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSFYDQVLDTTAMLGAVPDRYRWNGVEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAV+EYKEAKALG+DTVPVL+GPV+YLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYASHKAVSEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILPIYKEV+ ELK AGASWIQFD
Sbjct  181  LGNILPIYKEVIAELKVAGASWIQFD  206



>gb|KDP42919.1| hypothetical protein JCGZ_23861 [Jatropha curcas]
Length=765

 Score =   392 bits (1006),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKVA+DLR+SIWKQMA + IK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWKQMADSDIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV+EYKEAKALG++TVPV+VGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVDEYKEAKALGIETVPVIVGPVSYLLLSKQAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILP+YKEVVTELK AGASWIQFD
Sbjct  181  LDKILPVYKEVVTELKEAGASWIQFD  206



>gb|KDO66309.1| hypothetical protein CISIN_1g003819mg [Citrus sinensis]
Length=765

 Score =   391 bits (1005),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            +DKI+P+YKEVV ELKAAGA+WIQFD
Sbjct  181  IDKIIPVYKEVVAELKAAGATWIQFD  206



>gb|KJB09182.1| hypothetical protein B456_001G128200 [Gossypium raimondii]
Length=547

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M SHIVGYPR+GPKRELKFALESFW+GKSSAE+L++VA+DLR SIWKQMA  GIKYIP
Sbjct  35   RAMTSHIVGYPRIGPKRELKFALESFWEGKSSAEELKQVAADLRFSIWKQMAEVGIKYIP  94

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  95   SNTFSYYDHVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  154

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKFSYASHKAV EYKEAKALG+DTVPVL+GP+SYLLLSKPAKGV+KSF LL
Sbjct  155  YIVPELGPDVKFSYASHKAVEEYKEAKALGLDTVPVLIGPLSYLLLSKPAKGVDKSFSLL  214

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL++KI+PIYKEVV ELKAAGA+WIQFD
Sbjct  215  SLVEKIIPIYKEVVAELKAAGATWIQFD  242



>ref|XP_010549696.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Tarenaya hassleriana]
Length=765

 Score =   390 bits (1003),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV+EYKEAKALGV+TVPVL+GPVSYLLLSK AKGVEK+F LLSL
Sbjct  121  VPELGPEVKFSYASHKAVDEYKEAKALGVETVPVLIGPVSYLLLSKRAKGVEKTFNLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            +DKILPIYKEV++ELK AGA+WIQFD
Sbjct  181  IDKILPIYKEVISELKGAGATWIQFD  206



>ref|XP_004502016.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cicer arietinum]
Length=806

 Score =   391 bits (1005),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R M SHIVGYPR+GPKRELKFALESFWDGKSSA++L+KVA+DLR++IWKQMA AGI
Sbjct  36   ATSSRAMTSHIVGYPRVGPKRELKFALESFWDGKSSADELKKVAADLRSAIWKQMAEAGI  95

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            ++IPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  96   QHIPSNTFSYYDQVLDTTAMLGAVPDRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFD  155

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKS  617
            TNYHFIVPELGPDVKFSYASHKAV+EY EAKALGV+TVPVLVGPVSYLLLSKPAKGV+KS
Sbjct  156  TNYHFIVPELGPDVKFSYASHKAVDEYNEAKALGVNTVPVLVGPVSYLLLSKPAKGVDKS  215

Query  618  FQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            F LLSL+DKILP+YKEVVTELKAAGA+W+QFD
Sbjct  216  FSLLSLIDKILPVYKEVVTELKAAGATWVQFD  247



>gb|KDO66310.1| hypothetical protein CISIN_1g003819mg [Citrus sinensis]
Length=793

 Score =   391 bits (1004),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV EYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            +DKI+P+YKEVV ELKAAGA+WIQFD
Sbjct  181  IDKIIPVYKEVVAELKAAGATWIQFD  206



>ref|XP_002276438.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Vitis vinifera]
Length=765

 Score =   390 bits (1002),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLRASIWKQMA AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRASIWKQMADAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEI FD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV EY+EAKALGVDTVPV VGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVKEYQEAKALGVDTVPVFVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEVV ELKAAGAS IQFD
Sbjct  181  LDKILPIYKEVVAELKAAGASSIQFD  206



>emb|CAN73135.1| hypothetical protein VITISV_018473 [Vitis vinifera]
Length=734

 Score =   389 bits (1000),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLRASIWKQMA AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRASIWKQMADAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEI FD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV EY+EAKALGVDTVPV VGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVKEYQEAKALGVDTVPVFVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEVV ELKAAGAS IQFD
Sbjct  181  LDKILPIYKEVVAELKAAGASSIQFD  206



>emb|CAN70498.1| hypothetical protein VITISV_028551 [Vitis vinifera]
Length=765

 Score =   390 bits (1002),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA DLQKVA++LRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAXDLQKVATELRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYGWNGGEIGFDAYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNE+KEAK+LG++TVPV+VGPVSYLLLSKPAKG EKSF LLSL
Sbjct  121  VPELGPNVKFSYASHKAVNEFKEAKSLGIETVPVIVGPVSYLLLSKPAKGXEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            +DKILPIYKEVV+ELK  GA+WIQFD
Sbjct  181  IDKILPIYKEVVSELKEVGATWIQFD  206



>gb|ADO87039.1| pollen allergen MetE [Amaranthus retroflexus]
Length=757

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA  GIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KIL IYKEV++ELKAAGASWIQ D
Sbjct  181  LPKILVIYKEVISELKAAGASWIQLD  206



>ref|XP_006446418.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
 gb|ESR59658.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
Length=836

 Score =   391 bits (1005),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IP
Sbjct  70   RAMASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIP  129

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  130  SNTFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  189

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV FSYASHKAV EYKEAKALG++TVPVLVGPVSYLLLSKPAK VEKSF LL
Sbjct  190  YIVPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKAVEKSFSLL  249

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKI+P+YKEVV ELKAAGA+WIQFD
Sbjct  250  SLIDKIIPVYKEVVAELKAAGATWIQFD  277



>emb|CDY38470.1| BnaA10g16880D [Brassica napus]
Length=765

 Score =   389 bits (999),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLRA+IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRANIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPVYKEVITELKAAGATWIQLD  206



>ref|XP_004228469.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Solanum lycopersicum]
Length=817

 Score =   390 bits (1003),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKS++EDL+KVA+DLR SIWKQMA AGIKYIP
Sbjct  51   RTMASHVVGYPRMGPKRELKFALESFWDGKSNSEDLEKVAADLRLSIWKQMADAGIKYIP  110

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YF MARGNA+VPAMEMTKWFDTNYH
Sbjct  111  SNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFPMARGNASVPAMEMTKWFDTNYH  170

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKFSYASHKAV+EYKEAK+LG+DTVPVLVGPVS+LLLSK AKGVEKSF LL
Sbjct  171  YIVPELGPDVKFSYASHKAVSEYKEAKSLGIDTVPVLVGPVSFLLLSKAAKGVEKSFPLL  230

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL++KILP+YKEV+ ELKAAGASWIQFD
Sbjct  231  SLIEKILPVYKEVIAELKAAGASWIQFD  258



>ref|XP_010097930.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Morus notabilis]
 gb|EXB73286.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Morus notabilis]
Length=765

 Score =   389 bits (998),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPR+GPKRELKFALESFWDGKSSAEDLQKVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRVGPKRELKFALESFWDGKSSAEDLQKVAADLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL P++KFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELSPEIKFSYASHKAVEEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            +  ILP+YKEV+ ELKAAGA+W+QFD
Sbjct  181  IGSILPVYKEVLAELKAAGATWVQFD  206



>ref|XP_010463840.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Camelina sativa]
Length=765

 Score =   389 bits (998),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D +FSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LPKILPVYKEVIAELKAAGASWIQFD  206



>ref|XP_006446419.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
 gb|ESR59659.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
Length=864

 Score =   391 bits (1005),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IP
Sbjct  70   RAMASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIP  129

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  130  SNTFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  189

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV FSYASHKAV EYKEAKALG++TVPVLVGPVSYLLLSKPAK VEKSF LL
Sbjct  190  YIVPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKAVEKSFSLL  249

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKI+P+YKEVV ELKAAGA+WIQFD
Sbjct  250  SLIDKIIPVYKEVVAELKAAGATWIQFD  277



>ref|XP_006479149.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like isoform X1 [Citrus sinensis]
Length=795

 Score =   389 bits (1000),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +3

Query  93   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPS  272
            KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPS
Sbjct  3    KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPS  62

Query  273  NTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHF  452
            NTFS YDQVLDTTAMLGAVPPR+NW GGEIGFD YFSMARGNA+V AMEMTKWFDTNYHF
Sbjct  63   NTFSYYDQVLDTTAMLGAVPPRFNWNGGEIGFDVYFSMARGNASVLAMEMTKWFDTNYHF  122

Query  453  IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLS  632
            IVPELGPDVKFSYASHKAV EYKEAK  GV+TVPVL+GPVSYLLLSKPA GVEK+F +LS
Sbjct  123  IVPELGPDVKFSYASHKAVTEYKEAKGHGVETVPVLIGPVSYLLLSKPAWGVEKTFSVLS  182

Query  633  LLDKILPIYKEVVTELKAAGASWIQFD  713
            LL KILPIYKEVV+ELKAAGASWIQFD
Sbjct  183  LLPKILPIYKEVVSELKAAGASWIQFD  209



>ref|XP_003551089.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Glycine max]
 ref|XP_006601025.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Glycine max]
Length=765

 Score =   389 bits (998),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLRASIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVASDLRASIWKQMIDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W G EIGFDT+FSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGEEIGFDTFFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL+GPVSYL+LSKPAKGV+KSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L IYKEVV +LK AGASWIQFD
Sbjct  181  LPKVLAIYKEVVADLKQAGASWIQFD  206



>ref|XP_006364490.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Solanum tuberosum]
Length=765

 Score =   389 bits (998),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKS++EDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSNSEDLEKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YF MARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFPMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV+EYKEAK+LG+DTVPVLVGPVS+LLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVSEYKEAKSLGIDTVPVLVGPVSFLLLSKAAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            ++KILP+YKEV+ ELKAAGA+WIQFD
Sbjct  181  IEKILPVYKEVIAELKAAGANWIQFD  206



>ref|XP_010485733.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Camelina sativa]
 ref|XP_010485734.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Camelina sativa]
Length=765

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D +FSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LPKILPVYKEVIAELKAAGASWIQFD  206



>gb|KJB09183.1| hypothetical protein B456_001G128200 [Gossypium raimondii]
Length=629

 Score =   384 bits (987),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M SHIVGYPR+GPKRELKFALESFW+GKSSAE+L++VA+DLR SIWKQMA  GIKYIP
Sbjct  35   RAMTSHIVGYPRIGPKRELKFALESFWEGKSSAEELKQVAADLRFSIWKQMAEVGIKYIP  94

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  95   SNTFSYYDHVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  154

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKFSYASHKAV EYKEAKALG+DTVPVL+GP+SYLLLSKPAKGV+KSF LL
Sbjct  155  YIVPELGPDVKFSYASHKAVEEYKEAKALGLDTVPVLIGPLSYLLLSKPAKGVDKSFSLL  214

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL++KI+PIYKEVV ELKAAGA+WIQFD
Sbjct  215  SLVEKIIPIYKEVVAELKAAGATWIQFD  242



>ref|XP_010553797.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010553799.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=765

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWK+MA A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKRMADAEIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAV EYKEA ALGV+TVPVLVGPVSYLLLSKPAK VEKSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVTEYKEAMALGVETVPVLVGPVSYLLLSKPAKDVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L+KILP+YKEV++ELK AGA+WIQFD
Sbjct  181  LNKILPVYKEVISELKQAGATWIQFD  206



>gb|ABI95860.1| methionine synthase [Nicotiana suaveolens]
Length=765

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWT GEIGFDTYF MARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTRGEIGFDTYFFMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAV+EYKE K LGVDTVPVL GPVSYLLL KPAKGVEKSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVDEYKEGKGLGVDTVPVLFGPVSYLLLFKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQ D
Sbjct  181  LDKILPIYKEVIAELKAAGASWIQLD  206



>sp|P93263.1|METE_MESCR RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase; AltName: Full=Cobalamin-independent 
methionine synthase isozyme; AltName: Full=Vitamin-B12-independent 
methionine synthase isozyme [Mesembryanthemum crystallinum]
 gb|AAB41896.1| methionine synthase [Mesembryanthemum crystallinum]
Length=765

 Score =   388 bits (997),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY WTGGEI FD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAV EYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVLEYKEAKALGVDTVPVLVGPVSYLLLSKQAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEVV ELK AGASWIQFD
Sbjct  181  LPKILPIYKEVVAELKEAGASWIQFD  206



>gb|KHN28122.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=765

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLRASIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVASDLRASIWKQMIDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W G EIGFDT+FSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGEEIGFDTFFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL+GPVSYL+LSKPAKGV+KSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L IY+EVV +LK AGASWIQFD
Sbjct  181  LPKVLAIYREVVADLKQAGASWIQFD  206



>emb|CAE55863.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
Length=765

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF+LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPIYKEVITELKAAGATWIQLD  206



>gb|AAL09712.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
Length=765

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF+LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPIYKEVITELKAAGATWIQLD  206



>gb|AAN31836.1| putative 5-methyltetrahydropteroyltriglutamate--homocysteine 
S-methyltransferase [Arabidopsis thaliana]
Length=765

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF+LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPIYKEVITELKAAGATWIQLD  206



>ref|XP_010677810.1| PREDICTED: LOW QUALITY PROTEIN: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Beta vulgaris subsp. 
vulgaris]
Length=794

 Score =   389 bits (998),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            HIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV++DLR+SIWKQM+ AGIKYIPSNTF+
Sbjct  13   HIVGYPRMGPKRELKFALESFWDGKSSADDLKKVSADLRSSIWKQMSDAGIKYIPSNTFA  72

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVPPRY WTGGEI FD YFSMARGNATVPAMEMTKWFDTNYH+IVPE
Sbjct  73   YYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNATVPAMEMTKWFDTNYHYIVPE  132

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSLLDK  644
            LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSLL K
Sbjct  133  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFNLLSLLPK  192

Query  645  ILPIYKEVVTELKAAGASWIQFD  713
            IL IYKEVVTELKAAGAS IQFD
Sbjct  193  ILAIYKEVVTELKAAGASCIQFD  215



>ref|XP_009774960.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
Length=830

 Score =   389 bits (1000),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSS+EDL+KVA+DLR+SIWKQMA  GIKYIP
Sbjct  64   RTMASHVVGYPRMGPKRELKFALESFWDGKSSSEDLEKVAADLRSSIWKQMAEGGIKYIP  123

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YF MARGN +VPAMEMTKWFDTNYH
Sbjct  124  SNTFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFPMARGNDSVPAMEMTKWFDTNYH  183

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKF YA HKAVNEYKEAK+LGVDTVPVLVGPVS+LLLSK AKGVEKSF LL
Sbjct  184  YIVPELGPDVKFCYAYHKAVNEYKEAKSLGVDTVPVLVGPVSFLLLSKAAKGVEKSFPLL  243

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+ ELKAAGASWIQFD
Sbjct  244  SLIDKILPVYKEVIAELKAAGASWIQFD  271



>ref|NP_197294.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
 ref|NP_001078599.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
 sp|O50008.1|METE1_ARATH RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1; AltName: Full=Cobalamin-independent 
methionine synthase 1; Short=AtMS1; AltName: Full=Vitamin-B12-independent 
methionine synthase 1 [Arabidopsis thaliana]
 gb|AAK43899.1|AF370522_1 cobalamin-independent methionine synthase [Arabidopsis thaliana]
 gb|AAC50037.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
 dbj|BAB11226.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
 gb|AAK82464.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL06986.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL09740.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL47432.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL50108.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAM10291.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AED92486.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
 gb|AED92487.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
Length=765

 Score =   387 bits (995),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF+LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPIYKEVITELKAAGATWIQLD  206



>dbj|BAE07181.1| methionine synthase [Beta vulgaris]
Length=794

 Score =   388 bits (997),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            HIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV++DLR+SIWKQM+ AGIKYIPSNTF+
Sbjct  13   HIVGYPRMGPKRELKFALESFWDGKSSADDLKKVSADLRSSIWKQMSDAGIKYIPSNTFA  72

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVPPRY WTGGEI FD YFSMARGNATVPAMEMTKWFDTNYH+IVPE
Sbjct  73   YYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNATVPAMEMTKWFDTNYHYIVPE  132

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSLLDK  644
            LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSLL K
Sbjct  133  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFNLLSLLPK  192

Query  645  ILPIYKEVVTELKAAGASWIQFD  713
            IL IYKEVVTELKAAGAS IQFD
Sbjct  193  ILAIYKEVVTELKAAGASCIQFD  215



>ref|XP_004489678.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Cicer arietinum]
 ref|XP_004489679.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Cicer arietinum]
 ref|XP_004489680.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X3 [Cicer arietinum]
Length=765

 Score =   387 bits (994),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV++DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVSADLRASIWKQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY WTGGEIGFDTYFSM RGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFAYYDQVLDTTAMLGAVPTRYGWTGGEIGFDTYFSMGRGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV F+YASHKAVNEYKEAKALGVDTVPVLVGPV+YLLLSKPAKGV+ SF LL+L
Sbjct  121  VPELGPDVNFTYASHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVDPSFDLLTL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K++ +YKEVV++LKAAGASWIQFD
Sbjct  181  LPKVISVYKEVVSDLKAAGASWIQFD  206



>ref|XP_006443474.1| hypothetical protein CICLE_v10018921mg [Citrus clementina]
 gb|ESR56714.1| hypothetical protein CICLE_v10018921mg [Citrus clementina]
Length=792

 Score =   387 bits (995),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPR+NW GGEIGFD YFSMARGNA+V AMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRFNWNGGEIGFDVYFSMARGNASVLAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV EYKEAK  GV+TVPVL+GPVSYLLLSKPA GVEK+F +LSL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGHGVETVPVLIGPVSYLLLSKPAWGVEKTFSVLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEVV+ELKAAGASWIQFD
Sbjct  181  LPKILPIYKEVVSELKAAGASWIQFD  206



>emb|CDY25477.1| BnaC09g39920D [Brassica napus]
Length=765

 Score =   387 bits (993),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPVYKEVITELKAAGATWIQLD  206



>ref|XP_010932648.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Elaeis guineensis]
Length=766

 Score =   387 bits (993),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR SIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVAADLRFSIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W+G EIGFDTYFSMARGNA VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPQRYGWSGAEIGFDTYFSMARGNALVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL PD KF+YASHKAV+EYKEAKALG+DTVPVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121  VPELAPDTKFTYASHKAVSEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEKSFATLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  +LPIY+EV+ ELKAAGASWIQFD
Sbjct  181  LGNVLPIYQEVIMELKAAGASWIQFD  206



>ref|XP_006408262.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 ref|XP_006408263.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 ref|XP_006408264.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 gb|ESQ49715.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 gb|ESQ49716.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 gb|ESQ49717.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
Length=652

 Score =   383 bits (984),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELK AGA+WIQFD
Sbjct  181  LPKILPIYKEVIAELKGAGATWIQFD  206



>ref|XP_002871787.1| cobalamin-independent methionine synthase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48046.1| cobalamin-independent methionine synthase [Arabidopsis lyrata 
subsp. lyrata]
Length=765

 Score =   386 bits (992),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPIYKEVITELKAAGATWIQLD  206



>ref|XP_009121037.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Brassica rapa]
Length=765

 Score =   386 bits (992),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPVYKEVITELKAAGATWIQLD  206



>ref|XP_010524993.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=765

 Score =   386 bits (992),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMSDAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPSRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEK+F LLSL
Sbjct  121  VPELGPDVKFSYASHKAVDEYKEAKALGVETVPVLVGPVSYLLLSKRAKGVEKTFNLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            ++KILPIYKEV+TELK AGA+WIQFD
Sbjct  181  VEKILPIYKEVITELKGAGATWIQFD  206



>emb|CAA89019.1| cobalamine-independent methionine synthase [Solenostemon scutellarioides]
Length=784

 Score =   386 bits (992),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 194/207 (94%), Gaps = 1/207 (0%)
 Frame = +3

Query  93   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPS  272
            KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+K    L   + KQM+ AGIKYIPS
Sbjct  20   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKCQLILGIHL-KQMSDAGIKYIPS  78

Query  273  NTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHF  452
            NTFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHF
Sbjct  79   NTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHF  138

Query  453  IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLS  632
            IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYL+LSKPAKGVEK+F LLS
Sbjct  139  IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLILSKPAKGVEKTFPLLS  198

Query  633  LLDKILPIYKEVVTELKAAGASWIQFD  713
            LLDKILPIYKEV+ ELKAAGASWIQFD
Sbjct  199  LLDKILPIYKEVIAELKAAGASWIQFD  225



>gb|ABG22097.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=607

 Score =   381 bits (979),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT AMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSY+SHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGA+WIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGATWIQFD  206



>ref|XP_010514202.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Camelina sativa]
Length=765

 Score =   386 bits (991),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D +FSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+ ELKAAGA+WIQFD
Sbjct  181  LPKILPVYKEVIAELKAAGATWIQFD  206



>ref|XP_008662311.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Zea mays]
 gb|ACN28399.1| unknown [Zea mays]
 tpg|DAA47594.1| TPA: putative methionine synthase family protein isoform 1 [Zea 
mays]
 tpg|DAA47595.1| TPA: putative methionine synthase family protein isoform 2 [Zea 
mays]
Length=766

 Score =   385 bits (989),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK F LLSL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKGFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGASWIQFD  206



>ref|XP_006400336.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
 ref|XP_006400337.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
 gb|ESQ41789.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
 gb|ESQ41790.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
Length=765

 Score =   385 bits (988),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPVYKEVITELKAAGATWIQLD  206



>ref|XP_010917850.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Elaeis guineensis]
Length=803

 Score =   386 bits (991),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            RKMASH+VGYPRMGPKRELKFALESFWDGKSSA DLQKV+ DLR SIWKQM+ AG+KYIP
Sbjct  36   RKMASHVVGYPRMGPKRELKFALESFWDGKSSAADLQKVSQDLRCSIWKQMSDAGVKYIP  95

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLD TAMLGAVP RY W+GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  96   SNTFSYYDQVLDATAMLGAVPQRYGWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYH  155

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPEL PD KF+YASHKAV+EYKEAKALG+DTVPVL+GPV+YLLLSKPAKGVEK+F LL
Sbjct  156  YIVPELAPDTKFTYASHKAVSEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEKAFPLL  215

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SLL  +LP+YKEV+ ELKAAGASW+QFD
Sbjct  216  SLLGNVLPVYKEVIAELKAAGASWVQFD  243



>gb|AAL33589.1| methionine synthase [Zea mays]
Length=766

 Score =   385 bits (988),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK F LLSL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKGFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGASWIQFD  206



>ref|NP_001067314.1| Os12g0624000 [Oryza sativa Japonica Group]
 sp|Q2QLY4.1|METE2_ORYSJ RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2; AltName: Full=Cobalamin-independent 
methionine synthase 2 [Oryza sativa Japonica Group]
 gb|ABA99428.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABA99429.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30333.1| Os12g0624000 [Oryza sativa Japonica Group]
 dbj|BAG90565.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69709.1| hypothetical protein OsI_39180 [Oryza sativa Indica Group]
 gb|EEE53643.1| hypothetical protein OsJ_36927 [Oryza sativa Japonica Group]
 gb|AFI71268.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 
[Oryza sativa Japonica Group]
Length=766

 Score =   384 bits (987),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSY+SHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGA+WIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGATWIQFD  206



>ref|XP_009408488.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Musa acuminata subsp. malaccensis]
Length=766

 Score =   384 bits (987),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSA+DLQKVA+DLR SIWKQMAGAGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSADDLQKVATDLRHSIWKQMAGAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYN+TGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYNFTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP  KFSY+SHK V+EYKEAK+LG++TVPVL+GPV+YLLLSKPAKGVEKSF  L+L
Sbjct  121  VPELGPTTKFSYSSHKPVSEYKEAKSLGIETVPVLIGPVTYLLLSKPAKGVEKSFSPLTL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILPIYKEV+TELKAAGASWIQFD
Sbjct  181  LGDILPIYKEVITELKAAGASWIQFD  206



>tpg|DAA47593.1| TPA: putative methionine synthase family protein [Zea mays]
Length=781

 Score =   385 bits (988),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEK F LLSL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKGFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGASWIQFD  206



>ref|XP_009398356.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Musa acuminata subsp. malaccensis]
Length=766

 Score =   384 bits (987),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+A+DLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTADDLQKVATDLRHSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYN+TGGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYNFTGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSY+SHK V+EYKEAKALG++TVPVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121  VPELGPNTKFSYSSHKPVSEYKEAKALGIETVPVLIGPVTYLLLSKPAKGVEKSFSPLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LGSILPIYKEVIAELKAAGASWIQFD  206



>ref|XP_008451024.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Cucumis melo]
Length=829

 Score =   386 bits (991),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            ST  R MASHIVGYPR+GPKRELKFALESFWDGKSSA+DLQKVA+DLR+SIWKQMA AGI
Sbjct  59   STVVRAMASHIVGYPRIGPKRELKFALESFWDGKSSADDLQKVAADLRSSIWKQMADAGI  118

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            K+IPSNTFS YDQVLDT  MLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  119  KFIPSNTFSYYDQVLDTATMLGAVPSRYGWNGGEIGFDIYFSMARGNASVPAMEMTKWFD  178

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKS  617
            TNYH+IVPEL P+ KF+YASHKAVNE+KEAKALGV+TVPVLVGPVS+LLLSKPAKGVEKS
Sbjct  179  TNYHYIVPELSPEDKFTYASHKAVNEFKEAKALGVETVPVLVGPVSFLLLSKPAKGVEKS  238

Query  618  FQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            F LLSL+DKILP+YKEVV+ELKAAGA+WIQFD
Sbjct  239  FSLLSLIDKILPVYKEVVSELKAAGATWIQFD  270



>ref|XP_002882307.1| hypothetical protein ARALYDRAFT_477628 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58566.1| hypothetical protein ARALYDRAFT_477628 [Arabidopsis lyrata subsp. 
lyrata]
Length=765

 Score =   384 bits (987),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+ ELKAAGASWIQ D
Sbjct  181  LPKILPVYKEVIAELKAAGASWIQLD  206



>ref|XP_004144074.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Cucumis sativus]
 gb|KGN66367.1| hypothetical protein Csa_1G599580 [Cucumis sativus]
Length=827

 Score =   385 bits (990),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            ST  R MASHIVGYPR+GPKRELKFALESFWDGKSSA+DLQKVA+DLR+SIWKQMA AGI
Sbjct  57   STVVRAMASHIVGYPRIGPKRELKFALESFWDGKSSADDLQKVAADLRSSIWKQMAEAGI  116

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            K+IPSNTFS YDQVLDT  MLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  117  KFIPSNTFSYYDQVLDTATMLGAVPSRYGWNGGEIGFDIYFSMARGNASVPAMEMTKWFD  176

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKS  617
            TNYH+IVPEL P+ KF+YASHKAVNE+KEAKALGV+TVPVLVGPVS+LLLSKPAKGVEKS
Sbjct  177  TNYHYIVPELSPEDKFTYASHKAVNEFKEAKALGVETVPVLVGPVSFLLLSKPAKGVEKS  236

Query  618  FQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            F LLSL+DKILP+YKEVV+ELKAAGA+WIQFD
Sbjct  237  FSLLSLIDKILPVYKEVVSELKAAGATWIQFD  268



>sp|Q42662.2|METE_PLESU RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase; AltName: Full=Cobalamin-independent 
methionine synthase isozyme; AltName: Full=Vitamin-B12-independent 
methionine synthase isozyme [Solenostemon scutellarioides]
Length=764

 Score =   384 bits (986),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 193/206 (94%), Gaps = 1/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+K    L   + KQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKCQLILGIHL-KQMSDAGIKYIPSN  59

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  60   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  119

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYL+LSKPAKGVEK+F LLSL
Sbjct  120  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLILSKPAKGVEKTFPLLSL  179

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIYKEV+ ELKAAGASWIQFD
Sbjct  180  LDKILPIYKEVIAELKAAGASWIQFD  205



>ref|XP_009398996.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Musa acuminata subsp. malaccensis]
Length=766

 Score =   384 bits (986),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVATDLRCSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYN+TG EIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYNYTGAEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KF+Y+SHKA++EYKEAKALG++TVPVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121  VPELGPNTKFTYSSHKALSEYKEAKALGIETVPVLIGPVTYLLLSKPAKGVEKSFSPLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILPIYKEV  ELKAAGASWIQFD
Sbjct  181  LGNILPIYKEVTAELKAAGASWIQFD  206



>gb|AIE47233.1| vitamin B-12-independent methionine synthase [Pisum sativum]
Length=763

 Score =   384 bits (985),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV F Y+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121  VPELGPDVNFVYSSHKAVEEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L IYKEV+ +LKAAGA +IQFD
Sbjct  181  LPKVLAIYKEVIADLKAAGAQFIQFD  206



>ref|XP_009398511.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Musa acuminata subsp. malaccensis]
Length=766

 Score =   384 bits (985),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRE+KFALESFWDGKSSA+DLQKVA+DLR SIWKQM   GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKREIKFALESFWDGKSSADDLQKVATDLRCSIWKQMTDVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TAMLGAVP RYN+TGGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATAMLGAVPERYNYTGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSY+SHKAV+EYKEAKALG++T+PVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121  VPELGPNTKFSYSSHKAVSEYKEAKALGIETIPVLIGPVTYLLLSKPAKGVEKSFAPLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L+ ILPIYKEV+ ELKAAGASWIQFD
Sbjct  181  LESILPIYKEVIAELKAAGASWIQFD  206



>ref|XP_007161979.1| hypothetical protein PHAVU_001G113800g [Phaseolus vulgaris]
 gb|ESW33973.1| hypothetical protein PHAVU_001G113800g [Phaseolus vulgaris]
Length=763

 Score =   384 bits (985),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AE LQ VA+ LRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEALQLVAAGLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV F+YASHKAV EYKEAKALGV+T+PVLVGPV+YLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFTYASHKAVEEYKEAKALGVETIPVLVGPVTYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV+ +LKAAGASWIQFD
Sbjct  181  LPKVLAVYKEVIADLKAAGASWIQFD  206



>gb|KJB09184.1| hypothetical protein B456_001G128200 [Gossypium raimondii]
Length=801

 Score =   384 bits (987),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M SHIVGYPR+GPKRELKFALESFW+GKSSAE+L++VA+DLR SIWKQMA  GIKYIP
Sbjct  35   RAMTSHIVGYPRIGPKRELKFALESFWEGKSSAEELKQVAADLRFSIWKQMAEVGIKYIP  94

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  95   SNTFSYYDHVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  154

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKFSYASHKAV EYKEAKALG+DTVPVL+GP+SYLLLSKPAKGV+KSF LL
Sbjct  155  YIVPELGPDVKFSYASHKAVEEYKEAKALGLDTVPVLIGPLSYLLLSKPAKGVDKSFSLL  214

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL++KI+PIYKEVV ELKAAGA+WIQFD
Sbjct  215  SLVEKIIPIYKEVVAELKAAGATWIQFD  242



>emb|CDX70785.1| BnaC03g08690D [Brassica napus]
Length=765

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK  KGVEKSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAVKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPVYKEVITELKAAGATWIQID  206



>ref|XP_006408261.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 dbj|BAJ33898.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49714.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
Length=765

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELK AGA+WIQFD
Sbjct  181  LPKILPIYKEVIAELKGAGATWIQFD  206



>ref|XP_010558700.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010558701.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010558702.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=765

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMSDAGIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSY+SHKAV+EYKEAKALGV+TVPVL+GPVSYLLLSK AKGVEK+F LLSL
Sbjct  121  VPELGPEVTFSYSSHKAVDEYKEAKALGVETVPVLIGPVSYLLLSKRAKGVEKTFNLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELK AGA+WIQFD
Sbjct  181  LGKILPIYKEVIGELKGAGATWIQFD  206



>ref|XP_003592244.1| Methionine synthase [Medicago truncatula]
Length=765

 Score =   383 bits (983),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            HIVGYPRMGPKRELKFALESFWDGKSSAE+L++VA++LR++IWKQMA AGI++IPSNTFS
Sbjct  52   HIVGYPRMGPKRELKFALESFWDGKSSAEELKQVAANLRSAIWKQMADAGIQHIPSNTFS  111

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFIVPE
Sbjct  112  YYDQVLDTTAMLGAVPDRYKWNGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFIVPE  171

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSLLDK  644
            LGPDVKFSYASHKAV+EY EAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL+DK
Sbjct  172  LGPDVKFSYASHKAVDEYNEAKALGVNTVPVLVGPVSYLLLSKPAKGVEKSFSLLSLIDK  231

Query  645  ILPIYKEVVTELKAAGASWIQFD  713
            ILP+YKEVVTELK AGA+WIQFD
Sbjct  232  ILPVYKEVVTELKTAGATWIQFD  254



>emb|CDX74207.1| BnaA03g28400D [Brassica napus]
Length=765

 Score =   383 bits (983),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK++AEDL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELK AGA+WIQFD
Sbjct  181  LPKILPIYKEVIAELKGAGATWIQFD  206



>gb|ABG22095.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22096.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=766

 Score =   383 bits (983),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT AMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSY+SHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGA+WIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGATWIQFD  206



>ref|XP_009131623.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Brassica rapa]
Length=765

 Score =   382 bits (982),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPVYKEVITELKAAGATWIQLD  206



>emb|CDX78767.1| BnaA03g06790D [Brassica napus]
Length=765

 Score =   382 bits (982),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKILPVYKEVITELKAAGATWIQLD  206



>emb|CDX92051.1| BnaC03g33530D [Brassica napus]
Length=765

 Score =   382 bits (982),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK++AEDL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELK AGA+WIQFD
Sbjct  181  LPKILPIYKEVIAELKGAGATWIQFD  206



>ref|XP_008778395.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
 ref|XP_008778396.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
Length=766

 Score =   382 bits (982),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR SIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAQDLQKVAADLRCSIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT+AMLGAVP RY W G EIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTSAMLGAVPDRYGWNGEEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAV EYK+AKALG+DTVPV++GPV+YLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYASHKAVAEYKDAKALGIDTVPVIIGPVTYLLLSKHAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  +L IYKEV+ ELKAAGA+WIQFD
Sbjct  181  LGNVLSIYKEVIAELKAAGATWIQFD  206



>ref|XP_010541663.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Tarenaya hassleriana]
Length=859

 Score =   385 bits (988),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGKSSA++LQKVA+DLRASIWKQMA AGIKYIP
Sbjct  93   RTMSSHIVGYPRIGPKRELKFALESFWDGKSSADELQKVAADLRASIWKQMAEAGIKYIP  152

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W GGE+GFD YFSMARGNA+ PAMEMTKWFDTNYH
Sbjct  153  SNTFSYYDQVLDTTAMLGAVPPRYDWEGGEVGFDIYFSMARGNASAPAMEMTKWFDTNYH  212

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKFSYASHKAV+E+ EAKALG+DT+PVL+GPV+YLLLSKPAKGVEKSF LL
Sbjct  213  YIVPELGPDVKFSYASHKAVSEFMEAKALGIDTIPVLLGPVTYLLLSKPAKGVEKSFSLL  272

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL++KILP+Y+EV+ +LK+AGA WIQFD
Sbjct  273  SLINKILPVYQEVLAKLKSAGARWIQFD  300



>ref|XP_006286451.1| hypothetical protein CARUB_v10000282mg [Capsella rubella]
 gb|EOA19349.1| hypothetical protein CARUB_v10000282mg [Capsella rubella]
Length=765

 Score =   382 bits (981),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV++ELKAAGA+WIQ D
Sbjct  181  LPKILPVYKEVISELKAAGATWIQLD  206



>ref|NP_001067313.1| Os12g0623900 [Oryza sativa Japonica Group]
 sp|Q2QLY5.1|METE1_ORYSJ RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1; AltName: Full=Cobalamin-independent 
methionine synthase 1 [Oryza sativa Japonica Group]
 gb|ABA99427.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22094.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30332.1| Os12g0623900 [Oryza sativa Japonica Group]
 gb|EAY83957.1| hypothetical protein OsI_39179 [Oryza sativa Indica Group]
 gb|EAZ21274.1| hypothetical protein OsJ_36926 [Oryza sativa Japonica Group]
 gb|AFI71269.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 
[Oryza sativa Japonica Group]
Length=766

 Score =   382 bits (981),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT AMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSY+SHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGA+WIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGATWIQFD  206



>emb|CDX85436.1| BnaA02g03770D [Brassica napus]
Length=765

 Score =   382 bits (981),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKVLAVYKEVITELKAAGATWIQLD  206



>ref|XP_009126216.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Brassica rapa]
Length=765

 Score =   382 bits (981),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKVLAVYKEVITELKAAGATWIQLD  206



>emb|CDY02674.1| BnaC02g07610D [Brassica napus]
Length=765

 Score =   382 bits (981),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V FSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV+TELKAAGA+WIQ D
Sbjct  181  LPKVLAVYKEVITELKAAGATWIQLD  206



>ref|XP_003601341.1| Methionine synthase [Medicago truncatula]
 gb|AES71592.1| cobalamin-independent methionine synthase [Medicago truncatula]
Length=813

 Score =   383 bits (984),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            HIVGYPRMGPKRELKFALESFWDGKSSAE+L++VA++LR++IWKQMA AGI++IPSNTFS
Sbjct  52   HIVGYPRMGPKRELKFALESFWDGKSSAEELKQVAANLRSAIWKQMADAGIQHIPSNTFS  111

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFIVPE
Sbjct  112  YYDQVLDTTAMLGAVPDRYKWNGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFIVPE  171

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSLLDK  644
            LGPDVKFSYASHKAV+EY EAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL+DK
Sbjct  172  LGPDVKFSYASHKAVDEYNEAKALGVNTVPVLVGPVSYLLLSKPAKGVEKSFSLLSLIDK  231

Query  645  ILPIYKEVVTELKAAGASWIQFD  713
            ILP+YKEVVTELK AGA+WIQFD
Sbjct  232  ILPVYKEVVTELKTAGATWIQFD  254



>ref|NP_001266005.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase-like 
[Cicer arietinum]
 gb|ACL14488.1| methionine synthase [Cicer arietinum]
Length=763

 Score =   382 bits (980),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            M SHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MGSHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY WTGGE+GFDTYFSMARGNAT+PAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWTGGEVGFDTYFSMARGNATIPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV F+YASHKAV EYKEAKALGVDTVPVL+GPVSYLLLSKPAKGV+KSF LLSL
Sbjct  121  VPELGPDVNFTYASHKAVEEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVDKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV+ +LKAAGA +IQFD
Sbjct  181  LPKVLAVYKEVIADLKAAGALFIQFD  206



>gb|KEH25580.1| cobalamin-independent methionine synthase [Medicago truncatula]
Length=765

 Score =   382 bits (980),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLEKVAADLRASIWKQMSSAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVL+TTAM+GAVPPRY WTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLNTTAMVGAVPPRYGWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDVKF+YASHKAVNEYKEAKALGVDT+PVLVGPVSYLLLSK A GV+ SF LL+L
Sbjct  121  VPELGPDVKFTYASHKAVNEYKEAKALGVDTIPVLVGPVSYLLLSKLANGVDPSFDLLTL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K++ +YKEVV +LKAAGASWIQFD
Sbjct  181  LPKVIAVYKEVVADLKAAGASWIQFD  206



>ref|XP_010685496.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Beta vulgaris subsp. vulgaris]
Length=817

 Score =   383 bits (984),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGK +AE+LQ VA  LR SIWKQM+ AGIKYIP
Sbjct  51   RTMASHIVGYPRMGPKRELKFALESFWDGKINAEELQNVAHSLRTSIWKQMSDAGIKYIP  110

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIG D YFSMARGNA VPAMEMTKWFDTNYH
Sbjct  111  SNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIGNDVYFSMARGNADVPAMEMTKWFDTNYH  170

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPD+KF+YASHKAV+EYKEAKALGV+TVPV+VGPVSYLL SKPAKG+EKSF LL
Sbjct  171  YIVPELGPDMKFTYASHKAVDEYKEAKALGVETVPVIVGPVSYLLSSKPAKGIEKSFPLL  230

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SLLDKILP+YKEV++ELKAAGASWIQFD
Sbjct  231  SLLDKILPVYKEVISELKAAGASWIQFD  258



>ref|XP_010909224.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like isoform X1 [Elaeis guineensis]
Length=770

 Score =   382 bits (980),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            RKMASHIVGYPRMGPKRELKFALESFWDGK+SA+DLQKVA+DLR SIWKQMA AGIKYIP
Sbjct  3    RKMASHIVGYPRMGPKRELKFALESFWDGKTSAQDLQKVAADLRCSIWKQMADAGIKYIP  62

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVP RY W G EIGFDTYFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  63   SNTFSYYDQVLDTTAMLGAVPDRYGWNGEEIGFDTYFSMARGNASVPAMEMTKWFDTNYH  122

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            FIVPELGP+ KFSYASHKAV EY EAKALG+DTVPVL+GPV+YLLLSK AKGV+K+F LL
Sbjct  123  FIVPELGPNTKFSYASHKAVAEYNEAKALGIDTVPVLIGPVTYLLLSKHAKGVKKTFSLL  182

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SLL  ++ +YKEV+ ELKAAGASWIQFD
Sbjct  183  SLLGNVISVYKEVIAELKAAGASWIQFD  210



>ref|XP_008807626.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Phoenix dactylifera]
Length=766

 Score =   381 bits (979),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPR+GPKRELKFALESFWDGKSSA++LQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRIGPKRELKFALESFWDGKSSADNLQKVAADLRRSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVP RY W+GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSCYDQMLDTTAMLGAVPQRYGWSGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL PD KF+YASHKAV+EYKEAKALG+DTVPVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121  VPELAPDSKFTYASHKAVSEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEKSFATLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  +LP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LGNVLPVYKEVIAELKAAGASWIQFD  206



>gb|AGV54391.1| 5-methyltetrahydropteroyltriglutamate homocysteine methyltransferase 
like isoform 1 [Phaseolus vulgaris]
Length=763

 Score =   381 bits (979),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AE LQ VA+ LRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEALQLVAAGLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV F+YASHKAV EYKEAKALGV+T+PVLVGPV+YLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPDVNFTYASHKAVEEYKEAKALGVETIPVLVGPVTYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV+ +LKAAGASWIQFD
Sbjct  181  LPKVLAVYKEVIADLKAAGASWIQFD  206



>ref|NP_187028.1| methionine synthase 2 [Arabidopsis thaliana]
 ref|NP_850507.1| methionine synthase 2 [Arabidopsis thaliana]
 ref|NP_001118564.1| methionine synthase 2 [Arabidopsis thaliana]
 sp|Q9SRV5.1|METE2_ARATH RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2; AltName: Full=Cobalamin-independent 
methionine synthase 2; Short=AtMS2 [Arabidopsis thaliana]
 gb|AAF00639.1|AC009540_16 putative methionine synthase [Arabidopsis thaliana]
 gb|AAM61126.1| putative methionine synthase [Arabidopsis thaliana]
 gb|AAN12930.1| putative methionine synthase [Arabidopsis thaliana]
 emb|CAE55864.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
 gb|AEE73989.1| methionine synthase 2 [Arabidopsis thaliana]
 gb|AEE73990.1| methionine synthase 2 [Arabidopsis thaliana]
 gb|AEE73991.1| methionine synthase 2 [Arabidopsis thaliana]
Length=765

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVP RY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+ ELKAAGASWIQ D
Sbjct  181  LPKILPVYKEVIAELKAAGASWIQLD  206



>gb|AAK64167.1| putative methionine synthase [Arabidopsis thaliana]
Length=765

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVP RY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+ ELKAAGASWIQ D
Sbjct  181  LPKILPVYKEVIAELKAAGASWIQLD  206



>ref|XP_003525709.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Glycine max]
 ref|XP_006579821.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Glycine max]
 gb|KHN36957.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=765

 Score =   380 bits (977),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFW+GKSSA+DLQKVA+DLRASIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWEGKSSADDLQKVAADLRASIWKQMTDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY    GEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGLNNGEIEFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV F+YASHKAVNEYKEAKALGVDTVPVL+GPVSYL+LSKPAKGV+KSF LLSL
Sbjct  121  VPELGPDVNFTYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L IYKEVV +LK AGASW+QFD
Sbjct  181  LPKVLAIYKEVVADLKEAGASWVQFD  206



>ref|XP_009134741.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Brassica rapa]
Length=765

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+A+DL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTADDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALG +TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGAETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIYKEV+ ELK AGA+WIQFD
Sbjct  181  LPKILPIYKEVIEELKGAGATWIQFD  206



>ref|XP_008789650.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
Length=766

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKR+LKFALESFWDGKSSA+DLQKVA DLR SIWKQM+ AG+KYIPSN
Sbjct  1    MASHVVGYPRMGPKRQLKFALESFWDGKSSADDLQKVAQDLRCSIWKQMSDAGVKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W+GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPQRYGWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL P  KF+YASHKAV+EYKEAKALG+DT+PVL+GPV+YLLLSKPAKGVEK+F  LSL
Sbjct  121  VPELSPVSKFTYASHKAVSEYKEAKALGIDTIPVLIGPVTYLLLSKPAKGVEKAFSTLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  +LP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LGNVLPVYKEVIAELKAAGASWIQFD  206



>ref|XP_010420526.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Camelina sativa]
Length=765

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA++LQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADNLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D +FSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V F+YASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVNFTYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV++ELKAAGA+WIQ D
Sbjct  181  LPKILPVYKEVISELKAAGATWIQLD  206



>ref|XP_006297040.1| hypothetical protein CARUB_v10013032mg [Capsella rubella]
 gb|EOA29938.1| hypothetical protein CARUB_v10013032mg [Capsella rubella]
Length=765

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK+SA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTSADDLQKVSADLRSDIWKQMSSAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YD VLDTTAM+GAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDHVLDTTAMIGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+ ELKAAGASWIQ D
Sbjct  181  LPKILPVYKEVIAELKAAGASWIQLD  206



>gb|EPS74353.1| methionine synthase [Genlisea aurea]
Length=829

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 197/204 (97%), Gaps = 1/204 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            H+VGYPR+GPKRELKFALESFWDGKS+AE+L+KVA+DLRASIWKQM+ AGIKYIPSNTFS
Sbjct  60   HVVGYPRIGPKRELKFALESFWDGKSTAEELEKVAADLRASIWKQMSDAGIKYIPSNTFS  119

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVPPRY WTGGEIGF TYFSMARGNA+ PAMEMTKWFDTNYHFIVPE
Sbjct  120  FYDQVLDTTAMLGAVPPRYGWTGGEIGFGTYFSMARGNASAPAMEMTKWFDTNYHFIVPE  179

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSLLDK  644
            LGPDVKFSYASHKAV+EY+EAKALGV+TVPVL+GPV+YLLLSKPAKGVEK+F LLSLLDK
Sbjct  180  LGPDVKFSYASHKAVDEYQEAKALGVETVPVLIGPVTYLLLSKPAKGVEKNFSLLSLLDK  239

Query  645  ILPIYKEVVTELKAAG-ASWIQFD  713
            ILP+Y+EV++ELK+AG ASWIQFD
Sbjct  240  ILPVYREVISELKSAGAASWIQFD  263



>ref|XP_003550102.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Glycine max]
Length=765

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVA DLRASIWKQM  AGIKYIP+N
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVAFDLRASIWKQMIDAGIKYIPNN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W   EIGFDT+FSMARGNA+VP MEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNSEEIGFDTFFSMARGNASVPTMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL+GPVSYL+LSKPAKGV+KSF LLSL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L IY+EVV +LK AGASWIQFD
Sbjct  181  LPKVLAIYREVVADLKQAGASWIQFD  206



>ref|XP_006400670.1| hypothetical protein EUTSA_v10012712mg [Eutrema salsugineum]
 gb|ESQ42123.1| hypothetical protein EUTSA_v10012712mg [Eutrema salsugineum]
Length=812

 Score =   381 bits (978),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AE+LQ VA++LR SIWK MA AGIKYIP
Sbjct  47   RAMSSHIVGYPRIGPKRELKFALESFWDGKTGAEELQNVAANLRNSIWKHMADAGIKYIP  106

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  107  SNTFSYYDQMLDTTAMLGAVPPRYGWESGEIGFDIYFSMARGNASVPAMEMTKWFDTNYH  166

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKFSYASHKAV+E+KEAKALG+DTVPVL+GP++YLLLSKPAKGVEKSF LL
Sbjct  167  YIVPELGPDVKFSYASHKAVDEFKEAKALGIDTVPVLIGPITYLLLSKPAKGVEKSFSLL  226

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+ +LK+AGA WIQFD
Sbjct  227  SLIDKILPVYKEVLADLKSAGARWIQFD  254



>emb|CDY50662.1| BnaC05g48040D [Brassica napus]
Length=753

 Score =   378 bits (970),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSDIWKQMSSAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VK SY+SHKAVNEYKE KALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLS+
Sbjct  121  VPELGPEVKLSYSSHKAVNEYKETKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSV  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+LPIYKEV+ ELK AGA+WIQFD
Sbjct  181  LPKVLPIYKEVIAELKGAGATWIQFD  206



>gb|ACO34814.1| Sal k 3 pollen allergen [Salsola kali]
Length=757

 Score =   378 bits (970),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY + GGEIGFD YFSMARGNA++PAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPARYGFNGGEIGFDLYFSMARGNASLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+VKF+Y+SHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELGPEVKFAYSSHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILP+YKEV+ ELKAAGAS IQFD
Sbjct  181  LPKILPVYKEVIAELKAAGASTIQFD  206



>gb|EYU35999.1| hypothetical protein MIMGU_mgv1a001741mg [Erythranthe guttata]
Length=766

 Score =   378 bits (970),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPR+GPKRELKFALESFWDGKS+AE+L KVASDLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHVVGYPRIGPKRELKFALESFWDGKSNAEELHKVASDLRVSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W+GG+IGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYGWSGGDIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELG + +FSYAS KAV EYKEA+ALG+DTVPVLVGPVSYLLLSKPAKGV KSF LLSL
Sbjct  121  VPELGLETEFSYASRKAVQEYKEARALGIDTVPVLVGPVSYLLLSKPAKGVGKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LDKILPIY EVV ELKAAGASWIQFD
Sbjct  181  LDKILPIYMEVVAELKAAGASWIQFD  206



>ref|XP_010909225.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like isoform X2 [Elaeis guineensis]
Length=766

 Score =   377 bits (969),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK+SA+DLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTSAQDLQKVAADLRCSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W G EIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYGWNGEEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAV EY EAKALG+DTVPVL+GPV+YLLLSK AKGV+K+F LLSL
Sbjct  121  VPELGPNTKFSYASHKAVAEYNEAKALGIDTVPVLIGPVTYLLLSKHAKGVKKTFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ++ +YKEV+ ELKAAGASWIQFD
Sbjct  181  LGNVISVYKEVIAELKAAGASWIQFD  206



>emb|CAJ01713.1| methionine synthase 1 enzyme [Hordeum vulgare subsp. vulgare]
Length=765

 Score =   377 bits (969),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY+WTGGEI   TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFAYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPD KFSY+SHKA+NEYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF  LSL
Sbjct  121  VPELGPDTKFSYSSHKAINEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSPLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGASWIQFD  206



>ref|XP_003624677.1| Methionine synthase [Medicago truncatula]
 gb|AES80895.1| cobalamin-independent methionine synthase [Medicago truncatula]
Length=803

 Score =   379 bits (972),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  81   TP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIK  260
            TP  KMASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KV++DLRASIWKQM+  GIK
Sbjct  36   TPQEKMASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVSADLRASIWKQMSDVGIK  95

Query  261  YIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDT  440
            YIPSNTF+ YD VLDTTA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDT
Sbjct  96   YIPSNTFTYYDHVLDTTATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDT  155

Query  441  NYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSF  620
            NYHFIVPELGP+V F Y+SHKAV EYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF
Sbjct  156  NYHFIVPELGPEVNFVYSSHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSF  215

Query  621  QLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
             LLSLL K+L +YKEV+ +LKAAGA +IQFD
Sbjct  216  DLLSLLPKVLAVYKEVIADLKAAGAQFIQFD  246



>ref|XP_006664220.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Oryza brachyantha]
Length=766

 Score =   377 bits (968),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSY+SHKAVNEYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  +LP+YKEV+ ELKAAGA+WIQFD
Sbjct  181  LSSVLPVYKEVIAELKAAGATWIQFD  206



>dbj|BAD34660.1| methionine synthase [Hordeum vulgare subsp. vulgare]
Length=765

 Score =   377 bits (968),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY+WTGGEI   TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFAYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPD KFSY+SHKA+NEYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF  LSL
Sbjct  121  VPELGPDTKFSYSSHKAINEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSPLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGASWIQFD  206



>ref|XP_006286361.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
 ref|XP_006286362.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
 gb|EOA19259.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
 gb|EOA19260.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
Length=814

 Score =   378 bits (971),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  49   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  108

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  109  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  168

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DTVPVL+GP++YLLLSKPAKGVEKSF LL
Sbjct  169  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLL  228

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILPIYKEV+T+LK+AGA WIQFD
Sbjct  229  SLIDKILPIYKEVLTDLKSAGARWIQFD  256



>ref|XP_008680958.1| PREDICTED: LOC100286153 isoform X1 [Zea mays]
Length=793

 Score =   377 bits (969),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            RKMASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLR+SIWKQM+ AGIKYIP
Sbjct  27   RKMASHIVGYPRMGPKRELKFALESFWDGKSSADDLEKVASDLRSSIWKQMSEAGIKYIP  86

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYH
Sbjct  87   SNTFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYH  146

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            FIVPELGP  KF+YASHKAV+EYKEAKALG+DTVPVLVGPVSYLLLSKPAKGVEKSF LL
Sbjct  147  FIVPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLL  206

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SLL  ILPIYKEVV+ELKAAGASWIQFD
Sbjct  207  SLLGSILPIYKEVVSELKAAGASWIQFD  234



>gb|KFK26314.1| hypothetical protein AALP_AA8G231500 [Arabis alpina]
Length=837

 Score =   378 bits (971),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S E+LQ VA++LR SIWK M+ AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVEELQNVAANLRKSIWKHMSDAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNATVPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDNYFSMARGNATVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDVKFSYASHKAV E+KEAKALG+DTVPVL+GP++YLLLSKPAKGVEKSF LL
Sbjct  166  YIVPELGPDVKFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLL  225

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+ +LK+AGA WIQFD
Sbjct  226  SLIDKILPVYKEVLDDLKSAGARWIQFD  253



>gb|AES80897.2| cobalamin-independent methionine synthase [Medicago truncatula]
Length=650

 Score =   373 bits (957),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KV++DLRASIWKQM+  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVSADLRASIWKQMSDVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YD VLDTTA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFTYYDHVLDTTATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V F Y+SHKAV EYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVNFVYSSHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV+ +LKAAGA +IQFD
Sbjct  181  LPKVLAVYKEVIADLKAAGAQFIQFD  206



>ref|XP_010236330.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Brachypodium distachyon]
Length=388

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYP MG KRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIP N
Sbjct  1    MASHIVGYPCMGAKRELKFALESFWDGKSSAEDLKKVATDLRASIWKQMASAGIKYIPGN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEI   TYF MARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFLMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSY+SHKA+NEYKEAKALG+DTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYSSHKAINEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSSILPVYKEVIVELKAAGASWIQFD  206



>ref|XP_010492770.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Camelina sativa]
Length=765

 Score =   375 bits (964),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+V F+YASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121  VPELGPEVNFTYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L K+L +YKEV++ELKAAGA+WIQ D
Sbjct  181  LPKVLAVYKEVISELKAAGATWIQLD  206



>ref|XP_010493215.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like [Camelina sativa]
Length=811

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DTVPVL+GP++YLLLSKPAKGVEKSF LL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLL  225

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+ +LK+AGA WIQFD
Sbjct  226  SLIDKILPVYKEVLADLKSAGARWIQFD  253



>ref|XP_004982263.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Setaria italica]
Length=765

 Score =   374 bits (961),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP  KFSYASHKAV+EYKEAKALG+DTVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPSTKFSYASHKAVSEYKEAKALGIDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILPIYKEVV ELKAAGASWIQFD
Sbjct  181  LGSILPIYKEVVAELKAAGASWIQFD  206



>emb|CDX88830.1| BnaA03g08190D [Brassica napus]
Length=815

 Score =   375 bits (963),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK++A+DLQ VA++LR SIWK MA AGIKYIP
Sbjct  50   RAMSSHIVGYPRIGPKRELKFALESFWDGKTAADDLQTVAANLRNSIWKHMADAGIKYIP  109

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVPPRY W  GEIGFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  110  SNTFSYYDQMLDTTAMLGAVPPRYGWKSGEIGFDVYFSMARGNESVPAMEMTKWFDTNYH  169

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV+FSYASHKAV+E+KEAKALG+DTVPVL+GP++YLLLSKPAKGV+KSF LL
Sbjct  170  YIVPELGPDVEFSYASHKAVDEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVDKSFCLL  229

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILPIYKEV  +LK+AGA WIQFD
Sbjct  230  SLIDKILPIYKEVFDDLKSAGARWIQFD  257



>ref|NP_001152513.1| LOC100286153 [Zea mays]
 gb|ACG47988.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Zea mays]
 tpg|DAA50626.1| TPA: putative methionine synthase family protein isoform 1 [Zea 
mays]
 tpg|DAA50627.1| TPA: putative methionine synthase family protein isoform 2 [Zea 
mays]
 tpg|DAA50628.1| TPA: putative methionine synthase family protein isoform 3 [Zea 
mays]
Length=765

 Score =   374 bits (959),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLEKVASDLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP  KF+YASHKAV+EYKEAKALG+DTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILPIYKEVV+ELKAAGASWIQFD
Sbjct  181  LGSILPIYKEVVSELKAAGASWIQFD  206



>ref|XP_010236990.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Brachypodium distachyon]
Length=765

 Score =   373 bits (958),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMATTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEI   TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSY+SHKA+NEYKEAKALG+DTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPNTKFSYSSHKAINEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGASWIQFD  206



>ref|XP_008359231.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
Length=439

 Score =   363 bits (932),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R +ASHIVG PRMGPKRELKF+LESFWDGKSSAE+LQK A+ LR+SIWKQ+A AGI
Sbjct  51   TTSTRAVASHIVGLPRMGPKRELKFSLESFWDGKSSAEELQKAAAGLRSSIWKQLADAGI  110

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            +YIPSNTFS YDQ+LDTTAMLGAVPPRY W   EIGF+TYFSMARGNA VPAMEMTKWFD
Sbjct  111  QYIPSNTFSYYDQMLDTTAMLGAVPPRYGWKHSEIGFETYFSMARGNANVPAMEMTKWFD  170

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKS  617
            TNYH+IVPELGP ++FSYASHKAV+E+KEAKALGVDT+PVL+GPVSYLLLSKPA+G+E+S
Sbjct  171  TNYHYIVPELGPHIRFSYASHKAVDEFKEAKALGVDTIPVLIGPVSYLLLSKPARGIEQS  230

Query  618  FQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            F  LSLL  ILP+YKEV+ EL+AAGA+W+QFD
Sbjct  231  FSPLSLLRYILPVYKEVMAELRAAGATWVQFD  262



>ref|XP_006650367.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Oryza brachyantha]
Length=766

 Score =   373 bits (957),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP+ KFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGV+KSF LLSL
Sbjct  121  VPELGPNTKFSYASHKAVSEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVDKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEVV ELKAAG+SWIQFD
Sbjct  181  LSSILPVYKEVVAELKAAGSSWIQFD  206



>ref|XP_010420946.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like [Camelina sativa]
Length=811

 Score =   374 bits (960),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+ PAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASAPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DTVPVL+GP++YLLLSKPAKGVEKSF LL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLL  225

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+ +LK+AGA WIQFD
Sbjct  226  SLIDKILPVYKEVLADLKSAGARWIQFD  253



>ref|XP_010454415.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic isoform X1 [Camelina sativa]
Length=813

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DT PVL+GP++YLLLSKPAKGVEKSF LL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTFPVLIGPMTYLLLSKPAKGVEKSFCLL  225

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+ +LK+AGA WIQFD
Sbjct  226  SLIDKILPVYKEVLADLKSAGARWIQFD  253



>ref|XP_010454417.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic isoform X3 [Camelina sativa]
Length=811

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DT PVL+GP++YLLLSKPAKGVEKSF LL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTFPVLIGPMTYLLLSKPAKGVEKSFCLL  225

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+ +LK+AGA WIQFD
Sbjct  226  SLIDKILPVYKEVLADLKSAGARWIQFD  253



>ref|XP_010454416.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic isoform X2 [Camelina sativa]
Length=812

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DT PVL+GP++YLLLSKPAKGVEKSF LL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTFPVLIGPMTYLLLSKPAKGVEKSFCLL  225

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+ +LK+AGA WIQFD
Sbjct  226  SLIDKILPVYKEVLADLKSAGARWIQFD  253



>ref|XP_011622506.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X4 [Amborella trichopoda]
Length=638

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPR+GPKRELKFALESFWDG+SSAEDLQKVA +LR S+WKQM+  GIKYIP N
Sbjct  1    MASHVVGYPRIGPKRELKFALESFWDGRSSAEDLQKVAKELRHSMWKQMSDVGIKYIPCN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNAT+PAMEMTKWFDTNYH++
Sbjct  61   TFSYYDHVLDTTAMLGAVPPRYGWMGGEIGFDVYFSMARGNATLPAMEMTKWFDTNYHYL  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPD+KFSY+SHKAV+EYKEAK LG +TVPVLVGPVSYLLLSKP K V++ F LLSL
Sbjct  121  VPELGPDIKFSYSSHKAVSEYKEAKELGFETVPVLVGPVSYLLLSKPTKSVDRPFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV+ ELKAAGA W+QFD
Sbjct  181  LGKIIPIYKEVLAELKAAGAKWVQFD  206



>ref|NP_001288585.1| LOC541714 [Zea mays]
 ref|XP_008644635.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Zea mays]
 gb|ACL54117.1| unknown [Zea mays]
 gb|AFW68108.1| putative methionine synthase family protein isoform 1 [Zea mays]
 gb|AFW68109.1| putative methionine synthase family protein isoform 2 [Zea mays]
Length=765

 Score =   371 bits (953),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP  KF+YASHKAV+EYKEAKALG+DTVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121  VPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILPIYKEVV ELKAAGASWIQ D
Sbjct  181  LGSILPIYKEVVAELKAAGASWIQLD  206



>gb|EMS51950.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Triticum urartu]
 gb|EMT07372.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Aegilops tauschii]
Length=765

 Score =   371 bits (952),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEI   TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL P  KFSY+SHKA+NEYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF  LSL
Sbjct  121  VPELAPSTKFSYSSHKAINEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSPLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L  ILP+YKEV+ ELKAAGASWIQFD
Sbjct  181  LSSILPVYKEVIAELKAAGASWIQFD  206



>ref|XP_009131831.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic [Brassica rapa]
Length=815

 Score =   372 bits (955),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK++A DLQ VA++LR SIWK MA AGIKYIP
Sbjct  50   RAMSSHIVGYPRIGPKRELKFALESFWDGKTAANDLQTVAANLRNSIWKHMADAGIKYIP  109

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GEIGFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  110  SNTFSYYDQMLDTTAMLGAVPSRYGWKSGEIGFDVYFSMARGNDSVPAMEMTKWFDTNYH  169

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV+FSYASHKAV+E+KEAKALG+DTVPVL+GP++YLLLSKPAKGV+KSF LL
Sbjct  170  YIVPELGPDVEFSYASHKAVDEFKEAKALGIDTVPVLIGPITYLLLSKPAKGVDKSFCLL  229

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILPIYKEV  +LK+AGA WIQFD
Sbjct  230  SLIDKILPIYKEVFDDLKSAGARWIQFD  257



>gb|ABR17712.1| unknown [Picea sitchensis]
Length=766

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA DL+ VA  LRASIWKQM  AG+K IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAADLEAVAKGLRASIWKQMVAAGVKLIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY++ GGEIGFDTYFSMARGNAT+PAMEMTKWFDTNYH+I
Sbjct  61   TFSFYDQVLDTTAMLGAVPPRYSFAGGEIGFDTYFSMARGNATLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP++KF+Y+SHKAV EYKEAK LG+DTVPV+VGPVSYLLLSKPAKGV K+F LLSL
Sbjct  121  VPELGPEIKFAYSSHKAVAEYKEAKELGIDTVPVIVGPVSYLLLSKPAKGVAKTFNLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LD ILPIYK+VV+EL+AAGA+++QFD
Sbjct  181  LDAILPIYKQVVSELEAAGATFVQFD  206



>emb|CDX92419.1| BnaA10g14580D [Brassica napus]
Length=876

 Score =   373 bits (957),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ VA+DLR SIWK MAG GIKYIP
Sbjct  111  RPMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGIKYIP  170

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GE+GFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  171  SNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFDTNYH  230

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGP VKFSYASHKAV E+KEAKALG+DTVPVL+GP++YLLLSKPAK V+KSF LL
Sbjct  231  YIVPELGPSVKFSYASHKAVEEFKEAKALGIDTVPVLIGPMTYLLLSKPAKDVDKSFCLL  290

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+T+LK+AGA WIQFD
Sbjct  291  SLIDKILPVYKEVLTDLKSAGARWIQFD  318



>gb|AFW68110.1| putative methionine synthase family protein [Zea mays]
Length=812

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  93   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPS  272
            +MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIKYIPS
Sbjct  47   RMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPS  106

Query  273  NTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHF  452
            NTFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHF
Sbjct  107  NTFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHF  166

Query  453  IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLS  632
            IVPELGP  KF+YASHKAV+EYKEAKALG+DTVPVLVGPVSYLLLSKPAKGVEKSF LLS
Sbjct  167  IVPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLS  226

Query  633  LLDKILPIYKEVVTELKAAGASWIQFD  713
            LL  ILPIYKEVV ELKAAGASWIQ D
Sbjct  227  LLGSILPIYKEVVAELKAAGASWIQLD  253



>ref|XP_008385717.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
Length=466

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R +ASHIVG PR GPKRELKF+LESFWDGKSSAE+LQK A+ LR+SIWKQ+A AGI
Sbjct  35   TTSTRAVASHIVGLPRXGPKRELKFSLESFWDGKSSAEELQKAAAGLRSSIWKQLADAGI  94

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            +YIPSNTFS YDQ+LDTTAMLGAVPPRY W   EIGF+TYFSMARGNA VPAMEMTKWFD
Sbjct  95   QYIPSNTFSYYDQMLDTTAMLGAVPPRYGWKHSEIGFETYFSMARGNANVPAMEMTKWFD  154

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKS  617
            TNYH+IVPELGP ++FSYASHKAV+E+KEAKALGVDT+PVL+GPVSYLLLSKPA+G+E+S
Sbjct  155  TNYHYIVPELGPHIRFSYASHKAVDEFKEAKALGVDTIPVLIGPVSYLLLSKPARGIEQS  214

Query  618  FQLLSLLDKILPIYKEVVTELKAAGASWIQFD  713
            F  LSLL  ILP+YKEV+ EL+AAGA+W+QFD
Sbjct  215  FSPLSLLRYILPVYKEVMAELRAAGATWVQFD  246



>gb|ADE75603.1| unknown [Picea sitchensis]
Length=766

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA DL+ VA  LRASIWKQM  AG+K IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAADLEAVAKGLRASIWKQMVAAGVKLIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY++ GGEIGFDTYFSMARGNAT+PAMEMTKWFDTNYH+I
Sbjct  61   TFSFYDQVLDTTAMLGAVPPRYSFVGGEIGFDTYFSMARGNATLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP++KF+Y+SHKAV EYKEAK LG+DTVPV+VGPVSYLLLSKPAKGV K+F LLSL
Sbjct  121  VPELGPEIKFAYSSHKAVAEYKEAKELGIDTVPVIVGPVSYLLLSKPAKGVAKTFNLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LD ILPIYK+VV+EL+AAGA+++QFD
Sbjct  181  LDAILPIYKQVVSELEAAGATFVQFD  206



>pdb|1U1H|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
 pdb|1U1J|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
 pdb|1U1U|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
 pdb|1U22|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
Length=765

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = +3

Query  99   ASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNT  278
            ASHIVGYPR GPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQ + AG K+IPSNT
Sbjct  2    ASHIVGYPRXGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQXSAAGTKFIPSNT  61

Query  279  FSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIV  458
            F++YDQVLDTTA LGAVPPRY +TGGEIG D YFS ARGNA+VPA E TKWFDTNYH+IV
Sbjct  62   FAHYDQVLDTTAXLGAVPPRYGYTGGEIGLDVYFSXARGNASVPAXEXTKWFDTNYHYIV  121

Query  459  PELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSLL  638
            PELGP+V FSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSK AKGV+KSF+LLSLL
Sbjct  122  PELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSLL  181

Query  639  DKILPIYKEVVTELKAAGASWIQFD  713
             KILPIYKEV+TELKAAGA+WIQ D
Sbjct  182  PKILPIYKEVITELKAAGATWIQLD  206



>dbj|BAJ88127.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =   369 bits (948),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LD ILPIYKEVV ELKAAGASWIQFD
Sbjct  181  LDSILPIYKEVVAELKAAGASWIQFD  206



>emb|CAJ01714.1| methionine synthase 2 enzyme [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96070.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =   369 bits (948),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LD ILPIYKEVV ELKAAGASWIQFD
Sbjct  181  LDSILPIYKEVVAELKAAGASWIQFD  206



>gb|EMS50887.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Triticum urartu]
Length=740

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LD ILPIYKEVV ELKAAGASWIQFD
Sbjct  181  LDSILPIYKEVVAELKAAGASWIQFD  206



>gb|EMT31101.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Aegilops tauschii]
Length=766

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFS+ARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSIARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LD ILPIYKEVVTELKAAGASWIQFD
Sbjct  181  LDSILPIYKEVVTELKAAGASWIQFD  206



>gb|ERN03804.1| hypothetical protein AMTR_s00078p00112410 [Amborella trichopoda]
Length=804

 Score =   370 bits (949),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPR+GPKRELKFALESFWDG+SSAEDLQKVA +LR S+WKQM+  GIKYIP
Sbjct  37   RSMASHVVGYPRIGPKRELKFALESFWDGRSSAEDLQKVAKELRHSMWKQMSDVGIKYIP  96

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
             NTFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNAT+PAMEMTKWFDTNYH
Sbjct  97   CNTFSYYDHVLDTTAMLGAVPPRYGWMGGEIGFDVYFSMARGNATLPAMEMTKWFDTNYH  156

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            ++VPELGPD+KFSY+SHKAV+EYKEAK LG +TVPVLVGPVSYLLLSKP K V++ F LL
Sbjct  157  YLVPELGPDIKFSYSSHKAVSEYKEAKELGFETVPVLVGPVSYLLLSKPTKSVDRPFSLL  216

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SLL KI+PIYKEV+ ELKAAGA W+QFD
Sbjct  217  SLLGKIIPIYKEVLAELKAAGAKWVQFD  244



>emb|CDY16584.1| BnaC09g36890D [Brassica napus]
Length=945

 Score =   373 bits (958),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ VA+DLR SIWK MAG GIKYIP
Sbjct  180  RAMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGIKYIP  239

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GE+GFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  240  SNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFDTNYH  299

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGP VKFSYASHKAV E+KEAKALG+DTVPVL+GP++YLLLSKPAK V+KSF LL
Sbjct  300  YIVPELGPSVKFSYASHKAVEEFKEAKALGIDTVPVLIGPMTYLLLSKPAKDVDKSFCLL  359

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+T+LK+AGA WIQFD
Sbjct  360  SLIDKILPVYKEVLTDLKSAGARWIQFD  387



>ref|XP_010036242.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
Length=767

 Score =   368 bits (945),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGP+RELKFALESFWDGKSS EDLQKVA+DLR+S WKQMA AGIKY+PSN
Sbjct  1    MASHVVGYPRMGPQRELKFALESFWDGKSSTEDLQKVAADLRSSTWKQMADAGIKYVPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YD VLDTTAMLGAVP RY W GGEIG D YF MARGNA+VPAMEM KWFD++YH+I
Sbjct  61   TFSYYDHVLDTTAMLGAVPTRYGWEGGEIGLDVYFLMARGNASVPAMEMAKWFDSSYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL PDV+FSYAS KAVNEYKE K LGVDTVPVL+GPVSYLLLSKPAKGVEKSF  LSL
Sbjct  121  VPELAPDVEFSYASAKAVNEYKEVKKLGVDTVPVLLGPVSYLLLSKPAKGVEKSFSPLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KILPIY+EVV+ELKAAGASWIQFD
Sbjct  181  LHKILPIYREVVSELKAAGASWIQFD  206



>ref|XP_009120746.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X2 [Brassica 
rapa]
Length=808

 Score =   369 bits (948),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ VA+DLR SIWK MAG G KYIP
Sbjct  43   RPMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGNKYIP  102

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GE+GFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  103  SNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFDTNYH  162

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGP VKFSYASHKAV E+KEAKALG+DTVPVL+GP++YLLLSKPAK V+KSF LL
Sbjct  163  YIVPELGPHVKFSYASHKAVEEFKEAKALGIDTVPVLIGPMTYLLLSKPAKDVDKSFCLL  222

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+T+LK+AGA WIQFD
Sbjct  223  SLIDKILPVYKEVLTDLKSAGARWIQFD  250



>ref|XP_006842129.2| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase isoform X3 [Amborella trichopoda]
Length=766

 Score =   368 bits (945),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPR+GPKRELKFALESFWDG+SSAEDLQKVA +LR S+WKQM+  GIKYIP N
Sbjct  1    MASHVVGYPRIGPKRELKFALESFWDGRSSAEDLQKVAKELRHSMWKQMSDVGIKYIPCN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNAT+PAMEMTKWFDTNYH++
Sbjct  61   TFSYYDHVLDTTAMLGAVPPRYGWMGGEIGFDVYFSMARGNATLPAMEMTKWFDTNYHYL  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPD+KFSY+SHKAV+EYKEAK LG +TVPVLVGPVSYLLLSKP K V++ F LLSL
Sbjct  121  VPELGPDIKFSYSSHKAVSEYKEAKELGFETVPVLVGPVSYLLLSKPTKSVDRPFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV+ ELKAAGA W+QFD
Sbjct  181  LGKIIPIYKEVLAELKAAGAKWVQFD  206



>dbj|BAJ87953.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =   368 bits (944),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL P  KFSYASH+AV+EYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELSPATKFSYASHEAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LD ILPIYKEVV ELKAAGASWIQFD
Sbjct  181  LDSILPIYKEVVAELKAAGASWIQFD  206



>ref|XP_009120742.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
 ref|XP_009120743.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
 ref|XP_009120744.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
 ref|XP_009120745.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
Length=833

 Score =   369 bits (948),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ VA+DLR SIWK MAG G KYIP
Sbjct  68   RPMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGNKYIP  127

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GE+GFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  128  SNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFDTNYH  187

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGP VKFSYASHKAV E+KEAKALG+DTVPVL+GP++YLLLSKPAK V+KSF LL
Sbjct  188  YIVPELGPHVKFSYASHKAVEEFKEAKALGIDTVPVLIGPMTYLLLSKPAKDVDKSFCLL  247

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+T+LK+AGA WIQFD
Sbjct  248  SLIDKILPVYKEVLTDLKSAGARWIQFD  275



>ref|XP_011622504.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase isoform X1 [Amborella trichopoda]
Length=772

 Score =   368 bits (944),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPR+GPKRELKFALESFWDG+SSAEDLQKVA +LR S+WKQM+  GIKYIP N
Sbjct  1    MASHVVGYPRIGPKRELKFALESFWDGRSSAEDLQKVAKELRHSMWKQMSDVGIKYIPCN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNAT+PAMEMTKWFDTNYH++
Sbjct  61   TFSYYDHVLDTTAMLGAVPPRYGWMGGEIGFDVYFSMARGNATLPAMEMTKWFDTNYHYL  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPD+KFSY+SHKAV+EYKEAK LG +TVPVLVGPVSYLLLSKP K V++ F LLSL
Sbjct  121  VPELGPDIKFSYSSHKAVSEYKEAKELGFETVPVLVGPVSYLLLSKPTKSVDRPFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV+ ELKAAGA W+QFD
Sbjct  181  LGKIIPIYKEVLAELKAAGAKWVQFD  206



>ref|XP_011622505.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase isoform X2 [Amborella trichopoda]
Length=773

 Score =   368 bits (944),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPR+GPKRELKFALESFWDG+SSAEDLQKVA +LR S+WKQM+  GIKYIP N
Sbjct  1    MASHVVGYPRIGPKRELKFALESFWDGRSSAEDLQKVAKELRHSMWKQMSDVGIKYIPCN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNAT+PAMEMTKWFDTNYH++
Sbjct  61   TFSYYDHVLDTTAMLGAVPPRYGWMGGEIGFDVYFSMARGNATLPAMEMTKWFDTNYHYL  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGPD+KFSY+SHKAV+EYKEAK LG +TVPVLVGPVSYLLLSKP K V++ F LLSL
Sbjct  121  VPELGPDIKFSYSSHKAVSEYKEAKELGFETVPVLVGPVSYLLLSKPTKSVDRPFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            L KI+PIYKEV+ ELKAAGA W+QFD
Sbjct  181  LGKIIPIYKEVLAELKAAGAKWVQFD  206



>emb|CAE55865.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
Length=812

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGKS+ +DLQ VA++LR SIWK MA AGIKYIP
Sbjct  47   RAMSSHIVGYPRIGPKRELKFALESFWDGKSNVDDLQNVAANLRKSIWKHMAHAGIKYIP  106

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GEIGFD YFSMARGNA+  AMEMTKWFDTNYH
Sbjct  107  SNTFSYYDQMLDTTAMLGAVPSRYGWESGEIGFDVYFSMARGNASAHAMEMTKWFDTNYH  166

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPDV FSYASHKAV E+KEAKALG+DTVPVL+GP++YLLLSKPAKGVEKSF LL
Sbjct  167  YIVPELGPDVNFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLL  226

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SL+DKILP+YKEV+ +LK+AGA WIQFD
Sbjct  227  SLIDKILPVYKEVLADLKSAGARWIQFD  254



>ref|XP_008775707.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
Length=819

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R +ASHIVGYPR+GPKRELKFALESFWDG+SSAEDL+KVA DLR SIWKQMA AG K+IP
Sbjct  52   RAVASHIVGYPRIGPKRELKFALESFWDGRSSAEDLEKVAKDLRMSIWKQMADAGTKFIP  111

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YD +LDTT MLGAVP RY WTGGEIGFD YFSMARG+AT+PAMEMTKWFDTNYH
Sbjct  112  SNTFSYYDHILDTTVMLGAVPHRYGWTGGEIGFDVYFSMARGDATLPAMEMTKWFDTNYH  171

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLL  629
            +IVPELGPD+KFS ASHKAVNEYKEAK LG++T+PVLVGPVSYLLLSK A+G+EK F LL
Sbjct  172  YIVPELGPDLKFSCASHKAVNEYKEAKELGIETIPVLVGPVSYLLLSKLAEGIEKPFSLL  231

Query  630  SLLDKILPIYKEVVTELKAAGASWIQFD  713
            SLL KI+P+YKEVV+ELKAAGA+W+Q D
Sbjct  232  SLLQKIIPVYKEVVSELKAAGATWVQLD  259



>dbj|BAJ89541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNA VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNAAVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LD ILPIYKEVV ELKAAGASWIQFD
Sbjct  181  LDSILPIYKEVVAELKAAGASWIQFD  206



>gb|ABR16134.1| unknown [Picea sitchensis]
Length=766

 Score =   367 bits (941),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPR+ PKRELKFALESFWDGKSSA +LQ VA DLR + WKQMA AG+ YIPSN
Sbjct  1    MASHVVGYPRIAPKRELKFALESFWDGKSSAAELQNVAKDLRVATWKQMADAGLTYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAM+GAVPPRY WTGGEIGFDTYFSMARGNA +PAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMVGAVPPRYGWTGGEIGFDTYFSMARGNAKLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFQLLSL  635
            VPELGP++KF Y+SHKAV+EYKEAK +G++TVPV++GPVSYLLLSKPAKGV K+F LLSL
Sbjct  121  VPELGPEIKFKYSSHKAVDEYKEAKKIGIETVPVIIGPVSYLLLSKPAKGVPKTFDLLSL  180

Query  636  LDKILPIYKEVVTELKAAGASWIQFD  713
            LD ILP+YKEV+ ELK AGA+WIQFD
Sbjct  181  LDAILPVYKEVLGELKQAGATWIQFD  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1281324548632