BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig701

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011077527.1|  PREDICTED: uncharacterized protein LOC105161516    156   1e-41   
gb|EYU26692.1|  hypothetical protein MIMGU_mgv1a004640mg                146   7e-38   Erythranthe guttata [common monkey flower]
ref|XP_009804815.1|  PREDICTED: uncharacterized protein LOC104249972    145   2e-37   Nicotiana sylvestris
ref|XP_009621638.1|  PREDICTED: uncharacterized protein LOC104113231    144   3e-37   Nicotiana tomentosiformis
emb|CDP06441.1|  unnamed protein product                                143   7e-37   Coffea canephora [robusta coffee]
gb|KJB77060.1|  hypothetical protein B456_012G118300                    133   8e-34   Gossypium raimondii
gb|KJB77059.1|  hypothetical protein B456_012G118300                    134   2e-33   Gossypium raimondii
ref|XP_006481101.1|  PREDICTED: uncharacterized protein LOC102626315    132   9e-33   Citrus sinensis [apfelsine]
ref|XP_006429475.1|  hypothetical protein CICLE_v10011480mg             132   9e-33   Citrus clementina [clementine]
ref|XP_010257054.1|  PREDICTED: uncharacterized protein LOC104597291    131   1e-32   Nelumbo nucifera [Indian lotus]
gb|KDO63237.1|  hypothetical protein CISIN_1g041094mg                   131   1e-32   Citrus sinensis [apfelsine]
ref|XP_006359553.1|  PREDICTED: uncharacterized protein LOC102601433    130   3e-32   Solanum tuberosum [potatoes]
ref|XP_007026599.1|  TRNA pseudouridine synthase B                      129   5e-32   Theobroma cacao [chocolate]
ref|XP_006287499.1|  hypothetical protein CARUB_v10000709mg             127   3e-31   Capsella rubella
ref|XP_010490537.1|  PREDICTED: uncharacterized protein LOC104768300    125   2e-30   Camelina sativa [gold-of-pleasure]
emb|CDY11192.1|  BnaA03g00280D                                          125   2e-30   Brassica napus [oilseed rape]
gb|AAP40502.1|  unknown protein                                         125   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568092.4|  uncharacterized protein                               125   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451971.1|  PREDICTED: uncharacterized protein LOC104734147    125   2e-30   Camelina sativa [gold-of-pleasure]
dbj|BAJ33920.1|  unnamed protein product                                124   3e-30   Eutrema halophilum
ref|XP_010423969.1|  PREDICTED: uncharacterized protein LOC104709006    125   3e-30   Camelina sativa [gold-of-pleasure]
emb|CAB82275.1|  hypothetical protein                                   125   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398603.1|  hypothetical protein EUTSA_v10013251mg             124   4e-30   Eutrema salsugineum [saltwater cress]
ref|XP_002873003.1|  hypothetical protein ARALYDRAFT_907991             124   7e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_009130641.1|  PREDICTED: uncharacterized protein LOC103855409    124   8e-30   Brassica rapa
ref|XP_004246347.1|  PREDICTED: uncharacterized protein LOC101255724    122   1e-29   Solanum lycopersicum
ref|XP_008442373.1|  PREDICTED: uncharacterized protein LOC103486261    122   2e-29   Cucumis melo [Oriental melon]
emb|CDX80763.1|  BnaC03g00170D                                          122   2e-29   
ref|XP_010676807.1|  PREDICTED: uncharacterized protein LOC104892542    120   9e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008243087.1|  PREDICTED: uncharacterized protein LOC103341349    119   2e-28   Prunus mume [ume]
gb|KJB17109.1|  hypothetical protein B456_002G265900                    117   2e-27   Gossypium raimondii
ref|XP_010543186.1|  PREDICTED: uncharacterized protein LOC104816184    116   3e-27   Tarenaya hassleriana [spider flower]
gb|KHG02124.1|  putative histone-lysine N-methyltransferase ATXR3...    116   4e-27   Gossypium arboreum [tree cotton]
ref|XP_006576506.1|  PREDICTED: uncharacterized protein LOC100781480    115   6e-27   
gb|AFK39343.1|  unknown                                                 114   9e-27   Lotus japonicus
ref|XP_002323019.1|  hypothetical protein POPTR_0016s13190g             111   2e-25   
ref|XP_012089787.1|  PREDICTED: protein TIC 56, chloroplastic           110   3e-25   Jatropha curcas
ref|XP_007134661.1|  hypothetical protein PHAVU_010G065700g             110   5e-25   Phaseolus vulgaris [French bean]
ref|XP_011466446.1|  PREDICTED: LOW QUALITY PROTEIN: protein TIC ...    110   8e-25   Fragaria vesca subsp. vesca
ref|XP_011046822.1|  PREDICTED: uncharacterized protein LOC105141339    109   1e-24   Populus euphratica
ref|XP_007205052.1|  hypothetical protein PRUPE_ppa004296mg             109   1e-24   Prunus persica
ref|XP_010036629.1|  PREDICTED: uncharacterized protein LOC104425569    108   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010093551.1|  hypothetical protein L484_013987                   108   2e-24   
gb|EPS63731.1|  hypothetical protein M569_11052                         105   8e-24   Genlisea aurea
ref|XP_002268305.1|  PREDICTED: uncharacterized protein LOC100257554    103   2e-22   Vitis vinifera
ref|XP_003516979.1|  PREDICTED: uncharacterized protein LOC100801...    103   2e-22   Glycine max [soybeans]
ref|XP_009337729.1|  PREDICTED: uncharacterized protein LOC103930159    102   4e-22   Pyrus x bretschneideri [bai li]
ref|XP_010922611.1|  PREDICTED: uncharacterized protein LOC105045882    102   4e-22   Elaeis guineensis
ref|XP_004137697.1|  PREDICTED: protein TIC 56, chloroplastic           102   4e-22   Cucumis sativus [cucumbers]
emb|CAN83946.1|  hypothetical protein VITISV_043666                     103   9e-22   Vitis vinifera
ref|XP_008388287.1|  PREDICTED: uncharacterized protein LOC103450691    100   2e-21   
ref|XP_008777698.1|  PREDICTED: uncharacterized protein LOC103697588  96.3    7e-20   Phoenix dactylifera
ref|XP_009382875.1|  PREDICTED: uncharacterized protein LOC103970706  91.7    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006853837.1|  PREDICTED: protein TIC 56, chloroplastic         87.0    1e-16   Amborella trichopoda
ref|XP_004506798.1|  PREDICTED: uncharacterized protein LOC101498099  82.0    6e-15   Cicer arietinum [garbanzo]
ref|XP_002526665.1|  conserved hypothetical protein                   80.1    3e-14   Ricinus communis
gb|KEH28844.1|  hypothetical protein MTR_4g014600                     71.2    2e-11   Medicago truncatula
ref|XP_003604569.1|  hypothetical protein MTR_4g014600                71.2    3e-11   Medicago truncatula



>ref|XP_011077527.1| PREDICTED: uncharacterized protein LOC105161516 [Sesamum indicum]
Length=508

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 120/153 (78%), Gaps = 4/153 (3%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkkek  251
            MAS+NFNPF+DNWF   P  + F  +H    S+  FKP +KN  FA+I+ PFSRKPK + 
Sbjct  1    MASINFNPFNDNWFGNRPK-LPFRPIH-LLSSI--FKPHSKNSSFASITNPFSRKPKTDP  56

Query  252  ppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSE  431
               PG YR+MLDQFYWECE LPD+RHTP+VE+IL ED I E KENPTQEEIEENE+W++E
Sbjct  57   DETPGKYRQMLDQFYWECENLPDYRHTPEVERILQEDPIAEKKENPTQEEIEENEKWWAE  116

Query  432  FKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            F+ SPVVQFLARAEEIADK+NE  LR+NS PY+
Sbjct  117  FRSSPVVQFLARAEEIADKLNEIELRQNSVPYR  149



>gb|EYU26692.1| hypothetical protein MIMGU_mgv1a004640mg [Erythranthe guttata]
Length=517

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 116/156 (74%), Gaps = 4/156 (3%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPN---PIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpk  242
            MAS+NFNPF+DNWF  PP     I+   ++      NP  P ++ P FA+IS PFS+KP 
Sbjct  1    MASINFNPFNDNWFRNPPKLPFQIQIQSINLLSSFFNP-APSSQTPNFASISNPFSKKPN  59

Query  243  kekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
             +    PG YR+MLDQFYWECE LPD+RH P+VE+IL ED I E KENPTQEEIEENE+W
Sbjct  60   SDPDKKPGKYRQMLDQFYWECENLPDYRHAPEVERILQEDPIAEKKENPTQEEIEENEQW  119

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            +++F+ +PVVQFL RAEEIADK+NE  L+ENS PY+
Sbjct  120  WADFRSNPVVQFLTRAEEIADKLNEIELQENSVPYR  155



>ref|XP_009804815.1| PREDICTED: uncharacterized protein LOC104249972 [Nicotiana sylvestris]
Length=510

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 3/153 (2%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkkek  251
            M S+NFNPF++NWF+KP  P + +++ T F   N  KPQ  +PPFAAIS PFSRK KK  
Sbjct  1    MGSINFNPFNNNWFNKPSTPFQPINLLTHF---NSLKPQQHSPPFAAISNPFSRKHKKTA  57

Query  252  ppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSE  431
            P  PG YRRMLDQFYWECET PD RH P+VEKIL+ED IFE KENPT+EEIEEN++W++E
Sbjct  58   PEQPGHYRRMLDQFYWECETRPDLRHAPEVEKILNEDPIFEKKENPTEEEIEENDKWWAE  117

Query  432  FKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            FKESPVVQFLA+AEEIADK+NE  L+ENSAP++
Sbjct  118  FKESPVVQFLAQAEEIADKLNELELKENSAPFR  150



>ref|XP_009621638.1| PREDICTED: uncharacterized protein LOC104113231 [Nicotiana tomentosiformis]
Length=510

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 125/153 (82%), Gaps = 3/153 (2%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkkek  251
            M SVNFNPF++NWF+KP  P + +++ T F   N  K Q  +PPFAAIS PFSRKP+K  
Sbjct  1    MGSVNFNPFNNNWFNKPSTPFQPINLLTHF---NSLKTQQNSPPFAAISNPFSRKPQKTA  57

Query  252  ppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSE  431
            P  PG YRRMLDQFYWECET PD RH PKVEKIL+ED IFE KENPTQEEIEEN++W++E
Sbjct  58   PEQPGHYRRMLDQFYWECETRPDLRHAPKVEKILNEDPIFEKKENPTQEEIEENDKWWAE  117

Query  432  FKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            FKESPVVQFLA+AEEIADK+NE  L+ENSAP++
Sbjct  118  FKESPVVQFLAQAEEIADKLNELELKENSAPFR  150



>emb|CDP06441.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 115/156 (74%), Gaps = 9/156 (6%)
 Frame = +3

Query  72   MASVNFN--PFSD-NWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpk  242
            MAS+NFN  PF+D NWF KP      +++ + FE++NPFKPQ   P FAA+S   S K  
Sbjct  1    MASLNFNFNPFNDDNWFKKP------INLVSLFENLNPFKPQASTPNFAALSFKPSPKKP  54

Query  243  kekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
            K +   PG Y +MLDQFYWECE LPD+RHTP+VE++L+ED +FE  ENPT EE+ EN + 
Sbjct  55   KNEAANPGKYEQMLDQFYWECENLPDYRHTPEVERLLNEDPVFEKLENPTPEELAENAKR  114

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            + EF+ SPVVQFLARAEEIA+KINE  L+ENS PY+
Sbjct  115  WEEFRASPVVQFLARAEEIANKINELELKENSTPYR  150



>gb|KJB77060.1| hypothetical protein B456_012G118300 [Gossypium raimondii]
Length=337

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 122/159 (77%), Gaps = 10/159 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPP--FAAI--SLPFSRkp  239
            MAS+NFNPF ++WF KP NPI+ +++ +   S   F+PQT +P   FA+I  S PF++KP
Sbjct  1    MASINFNPF-ESWFRKPQNPIQPINLLSLAHS---FRPQTSSPSPNFASINFSSPFNKKP  56

Query  240  kk--ekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieen  413
            KK       PG Y++MLDQF+WECE LPD+RHTP+VEKIL ED +FE KENPT+EEI+EN
Sbjct  57   KKPDSDSDTPGPYKQMLDQFFWECENLPDYRHTPEVEKILDEDPVFEKKENPTEEEIKEN  116

Query  414  eRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            E+W+ +F+ SPVVQFLARAEEIAD+IN   L+EN  P++
Sbjct  117  EKWWRDFRASPVVQFLARAEEIADEINRMELKENEEPFR  155



>gb|KJB77059.1| hypothetical protein B456_012G118300 [Gossypium raimondii]
Length=513

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 122/159 (77%), Gaps = 10/159 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPP--FAAI--SLPFSRkp  239
            MAS+NFNPF ++WF KP NPI+ +++ +   S   F+PQT +P   FA+I  S PF++KP
Sbjct  1    MASINFNPF-ESWFRKPQNPIQPINLLSLAHS---FRPQTSSPSPNFASINFSSPFNKKP  56

Query  240  kk--ekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieen  413
            KK       PG Y++MLDQF+WECE LPD+RHTP+VEKIL ED +FE KENPT+EEI+EN
Sbjct  57   KKPDSDSDTPGPYKQMLDQFFWECENLPDYRHTPEVEKILDEDPVFEKKENPTEEEIKEN  116

Query  414  eRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            E+W+ +F+ SPVVQFLARAEEIAD+IN   L+EN  P++
Sbjct  117  EKWWRDFRASPVVQFLARAEEIADEINRMELKENEEPFR  155



>ref|XP_006481101.1| PREDICTED: uncharacterized protein LOC102626315 [Citrus sinensis]
Length=523

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 113/159 (71%), Gaps = 7/159 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpk---  242
            MAS+NFNPF +NWF+KP NP+  ++ H+  ES + F P      FA+IS    ++     
Sbjct  1    MASINFNPF-ENWFNKPTNPLPIINFHSLTESFSFFNPGKPTSNFASISSSLFKRKTPKK  59

Query  243  ---kekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieen  413
               + +   PG Y++MLDQ++WECE LPD+RH P+VE+IL E+ +FE KENP++EEI+EN
Sbjct  60   PDPETERQEPGYYKKMLDQYFWECENLPDYRHAPEVEEILKEEPLFEKKENPSEEEIKEN  119

Query  414  eRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            E W+  F+ESPVVQF+ARAEEIAD +NE  L++N  PY+
Sbjct  120  EEWWKSFRESPVVQFMARAEEIADYLNEVELKKNDKPYR  158



>ref|XP_006429475.1| hypothetical protein CICLE_v10011480mg [Citrus clementina]
 gb|ESR42715.1| hypothetical protein CICLE_v10011480mg [Citrus clementina]
Length=523

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 113/159 (71%), Gaps = 7/159 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpk---  242
            MAS+NFNPF +NWF+KP NP+  ++ H+  ES + F P      FA+IS    ++     
Sbjct  1    MASINFNPF-ENWFNKPTNPLPIINFHSLTESFSFFNPGKPTSNFASISSSLFKRKTPKK  59

Query  243  ---kekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieen  413
               + +   PG Y++MLDQ++WECE LPD+RH P+VE+IL E+ +FE KENP++EEI+EN
Sbjct  60   PDPETERQEPGYYKKMLDQYFWECENLPDYRHAPEVEEILKEEPLFEKKENPSEEEIKEN  119

Query  414  eRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            E W+  F+ESPVVQF+ARAEEIAD +NE  L++N  PY+
Sbjct  120  EEWWKSFRESPVVQFMARAEEIADYLNEVELKKNDKPYR  158



>ref|XP_010257054.1| PREDICTED: uncharacterized protein LOC104597291 [Nelumbo nucifera]
Length=512

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFS---Rkpk  242
            MASVNF  F +NWF KP NP+  + + +F  S   F   +  P FA IS  +S    K  
Sbjct  1    MASVNFGWF-ENWFQKPQNPVPQISLTSFNNS--QFLKSSSAPNFAFISGSYSFGKGKKS  57

Query  243  kekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
            K     PG Y+RMLDQFYWECETLPDHR+TP+VEKIL+ED +FE KENPT+EEI +N +W
Sbjct  58   KHPSETPGKYKRMLDQFYWECETLPDHRNTPEVEKILNEDPVFEKKENPTEEEINDNAQW  117

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            + EF++ PVVQFL R EEI DKINE  L+EN  PY+
Sbjct  118  WEEFRKDPVVQFLKRVEEIDDKINEMELKENEVPYR  153



>gb|KDO63237.1| hypothetical protein CISIN_1g041094mg [Citrus sinensis]
Length=523

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 114/159 (72%), Gaps = 7/159 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpk---  242
            MAS+NFNPF +NWF+KP NP+  ++ H+  ES + F P      FA+IS    ++     
Sbjct  1    MASINFNPF-ENWFNKPTNPLPIINFHSLTESFSFFNPGKPTSNFASISSSLFKRKTPKK  59

Query  243  ---kekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieen  413
               + +P  PG Y++MLDQ++WECE LPD+RH P+VE+IL E+ +FE KENP++EEI+EN
Sbjct  60   PDPETEPQEPGYYKKMLDQYFWECENLPDYRHAPEVEEILKEEPLFEKKENPSEEEIKEN  119

Query  414  eRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            E W+  F+ESPVVQF+ARAEEIAD +NE  L++N  PY+
Sbjct  120  EEWWKSFRESPVVQFMARAEEIADYLNEVELKKNDKPYR  158



>ref|XP_006359553.1| PREDICTED: uncharacterized protein LOC102601433 [Solanum tuberosum]
Length=509

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 121/153 (79%), Gaps = 4/153 (3%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkkek  251
            M S+NFNPF++NWF+KP  P + +++ + F+S+   KP   +PPFAAIS PFSRKPK   
Sbjct  1    MGSINFNPFNNNWFNKPSTPFQPINLLSHFDSL---KPHQHSPPFAAISNPFSRKPKTPP  57

Query  252  ppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSE  431
                  YR+MLDQF+WECET PD RH PKVE+I++ED IFE KENPT+EEIEENE+WF+E
Sbjct  58   EKPGH-YRKMLDQFHWECETRPDFRHAPKVERIMNEDPIFEKKENPTKEEIEENEKWFAE  116

Query  432  FKESPVVQFLARAEEIADKINETALRENSAPYQ  530
             +ESPVVQFL +AEEIADKIN+  L+ENSAP++
Sbjct  117  LRESPVVQFLLQAEEIADKINDLELQENSAPFR  149



>ref|XP_007026599.1| TRNA pseudouridine synthase B [Theobroma cacao]
 gb|EOY07101.1| TRNA pseudouridine synthase B [Theobroma cacao]
Length=513

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 115/157 (73%), Gaps = 6/157 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAIS----LPFSRkp  239
            MAS+NFNPF ++WF KP NPI+ V++ +  +S  P K  + +P FA+I+         K 
Sbjct  1    MASINFNPF-ESWFRKPQNPIQPVNLPSLADSFLP-KTSSNSPNFASINASSLFKKKPKK  58

Query  240  kkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
              E    PG Y++MLDQF+WECE LPD+RHTP+VE IL+ED +FE KENPT+EE++ENE+
Sbjct  59   PDEDSDKPGPYKQMLDQFFWECENLPDYRHTPEVENILNEDPLFEKKENPTEEEVKENEK  118

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+ +F+ SPVVQFLARAEEIAD+IN   L+EN  PY+
Sbjct  119  WWQDFRSSPVVQFLARAEEIADEINRMELKENDEPYR  155



>ref|XP_006287499.1| hypothetical protein CARUB_v10000709mg [Capsella rubella]
 gb|EOA20397.1| hypothetical protein CARUB_v10000709mg [Capsella rubella]
Length=524

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 112/156 (72%), Gaps = 7/156 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkpkke  248
            M+S+NFNPF  NWF KPPNP+  ++   F    + F P++++P FA+I LP FS+K  K 
Sbjct  1    MSSMNFNPFQ-NWFEKPPNPVPSIN---FVSLADSFFPKSQSPNFASIGLPKFSKKSPKP  56

Query  249  kppgp--gMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
            +      G Y+++ +QF WECE +PD+RHTP+V+KIL+EDS+FE KENP+ EEIE  E+W
Sbjct  57   ETGTEEPGTYKQIAEQFLWECENIPDYRHTPEVDKILNEDSVFEKKENPSTEEIEAEEKW  116

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            +  F+ SPVVQF+ RAEEIA+ +N+  L +N  PY+
Sbjct  117  WERFRASPVVQFMTRAEEIAEDMNKMELEDNDTPYR  152



>ref|XP_010490537.1| PREDICTED: uncharacterized protein LOC104768300 [Camelina sativa]
Length=523

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 111/158 (70%), Gaps = 9/158 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkpkke  248
            M+S+NFNPF  NWF KPPNP+  ++   F    + F P++++P FA+I LP FS+K  K 
Sbjct  1    MSSLNFNPFQ-NWFEKPPNPVPTIN---FVSLADTFFPKSQSPNFASIGLPKFSKKSPKT  56

Query  249  kppgpgM---YRRMLDQFYWECETLPDHRHTPKVEKILS-EDSIFetkenptqeeieene  416
            +         Y+++ +QF WECE +PDHRHTP+V+KIL+ ED++FE KENPT EEIE  E
Sbjct  57   ETGAEEQPGKYKQIAEQFLWECENIPDHRHTPEVDKILNEEDTVFEKKENPTTEEIEAEE  116

Query  417  RWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            +W+  F+ SPVVQF+ RA+EIAD +N+  L +N  PY+
Sbjct  117  KWWERFRASPVVQFMTRAQEIADDMNKMELDDNDTPYR  154



>emb|CDY11192.1| BnaA03g00280D [Brassica napus]
Length=519

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 110/157 (70%), Gaps = 11/157 (7%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPP-FAAISLPF---SRkp  239
            M+S+NFNPF  NWF KPPNP+  ++   F ES+ P   +++ PP FA+I LP     +K 
Sbjct  1    MSSMNFNPFQ-NWFEKPPNPVPSIN---FAESLFP---KSQAPPKFASIGLPKFLKKKKA  53

Query  240  kkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
            + E+    GMY++M +QF WECE  PD+RH P+V+KIL ED +FE KENP+ +E+E  E+
Sbjct  54   EPEEREEAGMYKKMAEQFLWECENRPDYRHAPQVDKILKEDPLFENKENPSPQEVEAEEK  113

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+  F+ SPVVQF+ARAEEIAD +N+  L EN  PY+
Sbjct  114  WWERFRASPVVQFMARAEEIADDMNKMELEENDTPYR  150



>gb|AAP40502.1| unknown protein [Arabidopsis thaliana]
Length=527

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 111/157 (71%), Gaps = 8/157 (5%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkp---  239
            M+S+NFNPF  NWF KPPNP+  ++   F    + F P++++P FA+I LP FS+K    
Sbjct  1    MSSMNFNPFQ-NWFEKPPNPVPSIN---FVSLADSFFPKSQSPNFASIGLPKFSKKSPKP  56

Query  240  kkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
            +      PG Y+++ +QF WECE +PD+RHTP+V+K+L+ED +FE KENP+ EEIE  ++
Sbjct  57   ETAGTDEPGPYKQIAEQFLWECENIPDYRHTPEVDKLLNEDPVFEKKENPSTEEIEAEQK  116

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+  F+ SPVVQF+ RAEEIAD +N+  L +N  PY+
Sbjct  117  WWESFRASPVVQFMTRAEEIADDMNKMELEDNDTPYR  153



>ref|NP_568092.4| uncharacterized protein [Arabidopsis thaliana]
 sp|Q7Y1W1.1|TIC56_ARATH RecName: Full=Protein TIC 56, chloroplastic; AltName: Full=Translocon 
at the inner envelope membrane of chloroplasts 56; 
Short=AtTIC56; Flags: Precursor [Arabidopsis thaliana]
 gb|AAP41935.1| unknown protein [Arabidopsis thaliana]
 gb|AED90363.1| uncharacterized protein AT5G01590 [Arabidopsis thaliana]
Length=527

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 111/157 (71%), Gaps = 8/157 (5%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkp---  239
            M+S+NFNPF  NWF KPPNP+  ++   F    + F P++++P FA+I LP FS+K    
Sbjct  1    MSSMNFNPFQ-NWFEKPPNPVPSIN---FVSLADSFFPKSQSPNFASIGLPKFSKKSPKP  56

Query  240  kkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
            +      PG Y+++ +QF WECE +PD+RHTP+V+K+L+ED +FE KENP+ EEIE  ++
Sbjct  57   ETAGTDEPGPYKQIAEQFLWECENIPDYRHTPEVDKLLNEDPVFEKKENPSTEEIEAEQK  116

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+  F+ SPVVQF+ RAEEIAD +N+  L +N  PY+
Sbjct  117  WWESFRASPVVQFMTRAEEIADDMNKMELEDNDTPYR  153



>ref|XP_010451971.1| PREDICTED: uncharacterized protein LOC104734147 [Camelina sativa]
Length=526

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 112/158 (71%), Gaps = 9/158 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkpkke  248
            M+S+NFNPF  NWF KPPNP+  ++   F    + F P++++P FA+I LP FS+K  K 
Sbjct  1    MSSLNFNPFQ-NWFEKPPNPVPTIN---FVSLADTFFPKSQSPNFASIGLPKFSKKTPKT  56

Query  249  kppgp---gMYRRMLDQFYWECETLPDHRHTPKVEKILSE-DSIFetkenptqeeieene  416
            +       G Y+++ +QF WECE +PD+RHTP+V+KIL+E D++FE KENPT EEIE  E
Sbjct  57   ETGAEEQPGTYKQIGEQFLWECENIPDYRHTPEVDKILNEEDTVFEKKENPTTEEIEAEE  116

Query  417  RWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            +W+  F+ SPVVQFL RAEEIAD +N+  L +N  PY+
Sbjct  117  KWWERFRASPVVQFLTRAEEIADDMNKMELDDNDTPYR  154



>dbj|BAJ33920.1| unnamed protein product [Thellungiella halophila]
Length=371

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 108/156 (69%), Gaps = 7/156 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkpkke  248
            M+S+NFNPF  NWF +PPNP+  ++   F    + F P++++P FA+I LP FS+K  K 
Sbjct  1    MSSINFNPFQ-NWFERPPNPVPSIN---FVSLADSFFPKSQSPNFASIGLPKFSKKSTKP  56

Query  249  kppgpgMYR--RMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
            +       R  ++ +QF+WECE  PD+RH P+V+KIL+ED +FE KENP+ EEIE  E+W
Sbjct  57   ETETEEPGRCKKIAEQFFWECENRPDYRHAPEVDKILNEDPVFEKKENPSAEEIEAEEKW  116

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            +  F+ SPVVQF+ RAEEIAD +N+  L EN  PY+
Sbjct  117  WERFRASPVVQFMTRAEEIADDMNKMELEENDTPYR  152



>ref|XP_010423969.1| PREDICTED: uncharacterized protein LOC104709006 [Camelina sativa]
Length=522

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkpkke  248
            M+S+NFNPF  NWF KPPNP+  ++   F    + F P++++P FA+I LP FSRK  K 
Sbjct  1    MSSLNFNPFQ-NWFEKPPNPVPTIN---FVSLADTFFPKSQSPNFASIGLPKFSRKTPKP  56

Query  249  kppgp----gMYRRMLDQFYWECETLPDHRHTPKVEKILSE-DSIFetkenptqeeieen  413
            +        G Y+++ +QF WECE +PD+RHTP+V+KIL+E D++FE KENPT EEIE  
Sbjct  57   ETGAEEPEPGTYKQIGEQFLWECENIPDYRHTPEVDKILNEEDTVFEKKENPTTEEIEAE  116

Query  414  eRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            E+W+  F+ SPVVQFL RAEEIAD +N+  L +N  PY+
Sbjct  117  EKWWERFRASPVVQFLTRAEEIADDMNKMELDDNDTPYR  155



>emb|CAB82275.1| hypothetical protein [Arabidopsis thaliana]
Length=559

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 111/157 (71%), Gaps = 8/157 (5%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkp---  239
            M+S+NFNPF  NWF KPPNP+  ++   F    + F P++++P FA+I LP FS+K    
Sbjct  1    MSSMNFNPFQ-NWFEKPPNPVPSIN---FVSLADSFFPKSQSPNFASIGLPKFSKKSPKP  56

Query  240  kkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
            +      PG Y+++ +QF WECE +PD+RHTP+V+K+L+ED +FE KENP+ EEIE  ++
Sbjct  57   ETAGTDEPGPYKQIAEQFLWECENIPDYRHTPEVDKLLNEDPVFEKKENPSTEEIEAEQK  116

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+  F+ SPVVQF+ RAEEIAD +N+  L +N  PY+
Sbjct  117  WWESFRASPVVQFMTRAEEIADDMNKMELEDNDTPYR  153



>ref|XP_006398603.1| hypothetical protein EUTSA_v10013251mg [Eutrema salsugineum]
 gb|ESQ40056.1| hypothetical protein EUTSA_v10013251mg [Eutrema salsugineum]
Length=524

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 108/156 (69%), Gaps = 7/156 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkpkke  248
            M+S+NFNPF  NWF KPPNP+  ++   F    + F P++++P FA+I LP FS+K  K 
Sbjct  1    MSSINFNPFQ-NWFEKPPNPVPSIN---FVSLADSFFPKSQSPNFASIGLPKFSKKSTKP  56

Query  249  kppgpgMYR--RMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
            +       R  ++ +QF+WECE  PD+RH P+V+KIL+ED +FE KENP+ EEIE  E+W
Sbjct  57   ETETEEPGRCKKIAEQFFWECENRPDYRHAPEVDKILNEDPVFEKKENPSAEEIEAEEKW  116

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            +  F+ SPVVQF+ RAEEIAD +N+  L EN  PY+
Sbjct  117  WERFRASPVVQFMTRAEEIADDMNKMELEENDTPYR  152



>ref|XP_002873003.1| hypothetical protein ARALYDRAFT_907991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49262.1| hypothetical protein ARALYDRAFT_907991 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkkek  251
            M+S+NFNPF  NWF KPPNP+  ++   F    + F P++++P FAAI LP   K   + 
Sbjct  1    MSSMNFNPFQ-NWFEKPPNPVPSIN---FVSLADSFFPKSQSPNFAAIGLPKFSKKPPKP  56

Query  252  ppgpgM---YRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
              G      Y+++ +QF WECE +PD+RHTP+V+KIL+ED +FE KENP+ EEIE  ++W
Sbjct  57   ETGTDEPGPYKQIAEQFLWECENIPDYRHTPEVDKILNEDPVFEKKENPSTEEIEAEQKW  116

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            +  F+ SPVVQF+ RAEEIAD +N+  L +N  PY+
Sbjct  117  WERFRASPVVQFMTRAEEIADDMNKMELEDNDTPYR  152



>ref|XP_009130641.1| PREDICTED: uncharacterized protein LOC103855409 [Brassica rapa]
Length=519

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 109/157 (69%), Gaps = 11/157 (7%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPP-FAAISLPFSRkpkke  248
            M+S+NFNPF  NWF KPPNP+  ++   F ES   F  ++++PP FA+I LP   K KK 
Sbjct  1    MSSMNFNPFQ-NWFEKPPNPVPSIN---FAES---FFTKSQSPPKFASIGLPKLLKKKKA  53

Query  249  k---ppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
            +       GMY++M +QF WECE  PD+RH P+V+KIL ED +FE KENP+ +E+E  E+
Sbjct  54   EPEEREEAGMYKKMAEQFLWECENRPDYRHAPQVDKILKEDPLFENKENPSPQEVEAEEK  113

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+  F+ SPVVQF+ARAEEIAD +N+  L EN  PY+
Sbjct  114  WWERFRASPVVQFMARAEEIADDMNKMELEENDTPYR  150



>ref|XP_004246347.1| PREDICTED: uncharacterized protein LOC101255724 [Solanum lycopersicum]
Length=509

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 105/138 (76%), Gaps = 4/138 (3%)
 Frame = +3

Query  117  KPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkkekppgpgMYRRMLDQFY  296
            KP  P + +++ + F+S+   K +  +PPFAAIS PFSRKPK         YR+MLDQFY
Sbjct  16   KPSTPFQPMNLLSHFDSL---KSRQHSPPFAAISNPFSRKPKSAPEKPGH-YRKMLDQFY  71

Query  297  WECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPVVQFLARAEE  476
            WECET PD RH+P+VE+I++ED   E KENPT+EEIEENE+WF+EF+E+PV QFL +AEE
Sbjct  72   WECETRPDFRHSPEVERIMNEDPFIEKKENPTKEEIEENEKWFAEFRENPVFQFLLQAEE  131

Query  477  IADKINETALRENSAPYQ  530
            IADKINE  L+ENS PY+
Sbjct  132  IADKINELELQENSTPYR  149



>ref|XP_008442373.1| PREDICTED: uncharacterized protein LOC103486261 [Cucumis melo]
Length=512

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP--FSRkpkk  245
            M S+NFNPF +NWFS+ PNPI  +++  F +S++  +  + +P FA+ISL   F R  K 
Sbjct  1    MTSINFNPF-ENWFSRRPNPIPPLNLFAFRDSLS--QKSSTSPNFASISLSNIFKRPRKP  57

Query  246  ekppgp-gMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
            +K     G Y +ML+QFYWEC+ LPD+RHTP+VEKILSED +FE KE PTQEE+E+NE+ 
Sbjct  58   KKATDEPGYYGKMLEQFYWECDNLPDYRHTPEVEKILSEDPVFENKETPTQEELEKNEKL  117

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            +   ++SPVVQFL RAEEIA K NE  L+ N  PY+
Sbjct  118  WKAMRDSPVVQFLERAEEIAAKYNELELKANENPYR  153



>emb|CDX80763.1| BnaC03g00170D [Brassica napus]
Length=512

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 11/155 (7%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP--FSRkpkk  245
            M+S+NFNPF  +WF KPPNP+  ++   F ES  P     K+  FA+I LP    +KP+ 
Sbjct  1    MSSMNFNPFQ-SWFEKPPNPVPSIN---FAESFFP-----KSQKFASIGLPKLLKKKPEP  51

Query  246  ekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWF  425
            E+    GMY++M +QF WECE  PD+RH P+V+KIL+ED +FE KENP+ EE+E  E+W+
Sbjct  52   EETEEAGMYKKMAEQFLWECENRPDYRHAPQVDKILNEDPLFEKKENPSTEEVEAEEKWW  111

Query  426  SEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
              F+ SPVVQF+ARAEEIAD +N+  L EN  PY+
Sbjct  112  ERFRASPVVQFMARAEEIADDMNKMELEENDTPYR  146



>ref|XP_010676807.1| PREDICTED: uncharacterized protein LOC104892542 [Beta vulgaris 
subsp. vulgaris]
Length=511

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 104/157 (66%), Gaps = 9/157 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNWF---SKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP-FSRkp  239
            MAS+N  P  ++WF    KP NPI   +  +   S NP KP      F+++SL       
Sbjct  1    MASINLGPIGEHWFHWFEKPSNPISIPNFLSLTLSQNPPKPL-----FSSLSLSDPKNPK  55

Query  240  kkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
             K+       Y++MLDQF+WECE LPD RHTP+VEKIL+ED +F+TKENPT EEIEEN++
Sbjct  56   NKKPSKPTTKYKQMLDQFWWECENLPDVRHTPEVEKILNEDPVFDTKENPTLEEIEENKK  115

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+ EF+ SPV++FL RAEEIAD  NE  L+EN  PY+
Sbjct  116  WWEEFRSSPVIEFLIRAEEIADAYNEMELKENDRPYR  152



>ref|XP_008243087.1| PREDICTED: uncharacterized protein LOC103341349 [Prunus mume]
Length=517

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 112/161 (70%), Gaps = 9/161 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPP-FAAISL-------PF  227
            MAS+NFNPF ++WF KPP P+  +++ +  +S      QT   P F+A+SL       P 
Sbjct  1    MASINFNPF-ESWFKKPPTPLPPINLLSLTDSFFHRATQTTTSPNFSALSLSNLFKGPPK  59

Query  228  SRkpkkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeie  407
                   +P  PG Y  ML+Q++WECE  PD+RH P+V+KILSED IFE KENPT+EE+ 
Sbjct  60   PDPKTPSEPEKPGPYTEMLEQYFWECENAPDYRHAPEVDKILSEDPIFEKKENPTEEELR  119

Query  408  eneRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            ENE+++ +F+ESPVVQFLARAE+IA+KINE  L+EN  PY+
Sbjct  120  ENEKFWKKFRESPVVQFLARAEQIAEKINEMELKENDRPYR  160



>gb|KJB17109.1| hypothetical protein B456_002G265900 [Gossypium raimondii]
Length=509

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 114/157 (73%), Gaps = 6/157 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP--FSRkpkk  245
            MAS+ F+ F ++WF KP NPI+ +++ +  +S  P    + +P FA+IS    FSRKPKK
Sbjct  1    MASIKFDAF-ESWFRKPQNPIQPINLLSLTQSFLP-TTSSNSPNFASISSSGFFSRKPKK  58

Query  246  ekppgp--gMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
                    G Y++M+DQF+WECE LPD+RHTP+VE  L+ED  FE KENPT++E++ENE+
Sbjct  59   PGLDSDKPGPYKQMVDQFFWECENLPDYRHTPEVENFLNEDPFFENKENPTEDELKENEK  118

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+ +F+ SPVVQFLARAEEIAD+IN   L+EN  P++
Sbjct  119  WWQDFRASPVVQFLARAEEIADEINRIELKENEEPFR  155



>ref|XP_010543186.1| PREDICTED: uncharacterized protein LOC104816184 [Tarenaya hassleriana]
Length=520

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 110/156 (71%), Gaps = 7/156 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP--FSRkpkk  245
            M+S+NFNPF  NWF KP NP+  V++ +  +S   F P++++P FA+I LP  F R  K 
Sbjct  1    MSSMNFNPFH-NWFEKPSNPVPSVNLLSLADS---FFPRSQSPNFASIGLPKLFKRSKKP  56

Query  246  ekppgpgM-YRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
            +        Y ++ +QF  ECE LPD+RHTP+VEKIL+ED +F+ KENPTQEE+EE E+W
Sbjct  57   DSGTDEPGPYMQLAEQFLEECENLPDYRHTPEVEKILNEDPVFDKKENPTQEEVEEEEKW  116

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            +  F+ SPVVQFLARAEEIAD +N+  L EN  PY+
Sbjct  117  WERFRASPVVQFLARAEEIADDMNKMELEENDTPYR  152



>gb|KHG02124.1| putative histone-lysine N-methyltransferase ATXR3 -like protein 
[Gossypium arboreum]
Length=509

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 115/157 (73%), Gaps = 6/157 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP--FSRkpkk  245
            MAS+ F+PF ++WF KP NPI+ +++ +  +S  P    + +P FA+IS    F +KPKK
Sbjct  1    MASIKFDPF-ESWFRKPQNPIQPINLLSLSQSFLP-TTSSNSPNFASISSSGLFRKKPKK  58

Query  246  ek--ppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
                   PG Y++M+DQF+WECE LPD+RHTP+VE  L+ED  FE KENPT+EEI+ENE+
Sbjct  59   PDPDSDKPGPYKQMVDQFFWECENLPDYRHTPEVENFLNEDPFFENKENPTEEEIKENEK  118

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+ +F+ SPVVQFLARAEEIAD+IN   L+EN  P++
Sbjct  119  WWQDFRASPVVQFLARAEEIADEINRIELKENEEPFR  155



>ref|XP_006576506.1| PREDICTED: uncharacterized protein LOC100781480 [Glycine max]
Length=529

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 101/169 (60%), Gaps = 20/169 (12%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP------FSR  233
            MAS+NFNPF  NWFSKPPNP+    +           P +  P FAAISLP         
Sbjct  1    MASINFNPFGGNWFSKPPNPLSVPSLPNNLTDA----PSSLPPNFAAISLPNPFRRRPKP  56

Query  234  kpkkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILS----------EDSIFetke  383
            KPK E+P  PG Y ++  Q  WECE LPDHRHTP+V+KIL+          +DS+F  +E
Sbjct  57   KPKPEEPVEPGHYEQLARQVLWECENLPDHRHTPEVDKILADNDAAFGGNNDDSVFVLRE  116

Query  384  nptqeeieeneRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            + T+EE+ EN       + SPVVQF+ARAEEI DK+NE  L+EN  PY 
Sbjct  117  DATEEEVRENAELVERLRSSPVVQFMARAEEILDKMNEMELKENERPYH  165



>gb|AFK39343.1| unknown [Lotus japonicus]
Length=402

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 104/157 (66%), Gaps = 10/157 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNW--FSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkk  245
            MAS+NFNPF  NW  FS+P NP+  ++    F   +   P      FAAI+L F R PKK
Sbjct  1    MASINFNPFGGNWNWFSEPSNPLPPLNTLLTFSDNHHHSPN-----FAAINL-FRRNPKK  54

Query  246  e--kppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
            +      PG Y RM  QF+WECE LPDHRHTP+VE+IL++D  FE KENPT+EEI+EN  
Sbjct  55   KPDNDNEPGPYTRMAHQFFWECENLPDHRHTPEVEEILNDDPAFEKKENPTEEEIKENME  114

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
               + K SPV+QFL RAEEIADK+NE  L+EN  PY 
Sbjct  115  MLEKIKSSPVMQFLVRAEEIADKMNEMELKENENPYH  151



>ref|XP_002323019.1| hypothetical protein POPTR_0016s13190g [Populus trichocarpa]
 gb|EEF04780.1| hypothetical protein POPTR_0016s13190g [Populus trichocarpa]
Length=534

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 103/143 (72%), Gaps = 9/143 (6%)
 Frame = +3

Query  117  KPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISL--PFSRkpkke---kppgpgMYRRM  281
            KPP P+  +++ +       FK  +K P F+++S+  PF +  K +       PG YR+M
Sbjct  17   KPPKPLPSINLLSLIS----FKNSSKTPNFSSLSISNPFKKPQKPDPDPTQQQPGYYRQM  72

Query  282  LDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPVVQFL  461
            +DQ++WECE LPD+RHTP+VEKIL+ED +FE KENPT EEIEENERW++EF+ SPVV+FL
Sbjct  73   IDQYFWECENLPDYRHTPEVEKILNEDPVFEKKENPTPEEIEENERWWAEFRASPVVKFL  132

Query  462  ARAEEIADKINETALRENSAPYQ  530
             RA +IAD+INE  L+ NS PY+
Sbjct  133  TRAHQIADEINEMELKANSIPYR  155



>ref|XP_012089787.1| PREDICTED: protein TIC 56, chloroplastic [Jatropha curcas]
 ref|XP_012089788.1| PREDICTED: protein TIC 56, chloroplastic [Jatropha curcas]
 ref|XP_012089789.1| PREDICTED: protein TIC 56, chloroplastic [Jatropha curcas]
 gb|KDP22841.1| hypothetical protein JCGZ_00428 [Jatropha curcas]
Length=512

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 6/156 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISL--PFSRkpkk  245
            MASVNFN F DNWF KPPNP+  V++     S+     Q+ N  FA+IS   P  +  + 
Sbjct  1    MASVNFN-FFDNWFKKPPNPLPPVNLVPLINSLTTKTSQSTN--FASISFSNPLKKPKEP  57

Query  246  ekppgpgMY-RRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRW  422
            E       Y ++MLDQ+++ECE LPD+RHTP+VEKIL+E    E KENPT+EEI+EN++W
Sbjct  58   ETESKEPGYWQQMLDQYFYECENLPDYRHTPEVEKILNEHPFLEKKENPTEEEIKENQQW  117

Query  423  FSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            + +F+ SPVV+FLARAEEIADKINE  L+ENS PY+
Sbjct  118  WEDFESSPVVKFLARAEEIADKINELELKENSIPYR  153



>ref|XP_007134661.1| hypothetical protein PHAVU_010G065700g [Phaseolus vulgaris]
 ref|XP_007134662.1| hypothetical protein PHAVU_010G065700g [Phaseolus vulgaris]
 gb|ESW06655.1| hypothetical protein PHAVU_010G065700g [Phaseolus vulgaris]
 gb|ESW06656.1| hypothetical protein PHAVU_010G065700g [Phaseolus vulgaris]
Length=529

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 102/165 (62%), Gaps = 14/165 (8%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP--FSRkpkk  245
            MAS+NFNPF  NWFSKPPNP+          + N     + +P FAAISLP  F RKPK+
Sbjct  1    MASINFNPFGGNWFSKPPNPLSLPSFPN--NAFNLADAPSLHPNFAAISLPNPFRRKPKE  58

Query  246  ekppgp--gMYRRMLDQFYWECETLPDHRHTPKVEKILSE--------DSIFetkenptq  395
            +       G +  +  Q  WE +TLPDHRHTP+V+KIL+E        DS+FE +E+ T+
Sbjct  59   KPAEPSEPGHFELLARQALWEAQTLPDHRHTPEVDKILAENDAAFGSDDSVFEKREDATE  118

Query  396  eeieeneRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            EEI EN       + SPVVQFLARAEEI DK+NE  L+EN  PY 
Sbjct  119  EEIRENAEVVEMMRSSPVVQFLARAEEILDKMNEYELKENEKPYH  163



>ref|XP_011466446.1| PREDICTED: LOW QUALITY PROTEIN: protein TIC 56, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=516

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 111/159 (70%), Gaps = 11/159 (7%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISL--PFS----R  233
            MAS+NFNPF + WF KPPNP+  +++ +  +S +P  P     PFAA+SL  PF      
Sbjct  1    MASINFNPF-EGWFRKPPNPLPPINLLSLADSFSPKTPT----PFAALSLSNPFKPKTPD  55

Query  234  kpkkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieen  413
               +  P  PG Y +ML+QF+WECE LPD+RHTP+V++IL  D I E KENPT+EEI EN
Sbjct  56   PKPEPDPEKPGHYTQMLEQFFWECENLPDYRHTPEVDRILESDPILEKKENPTEEEIREN  115

Query  414  eRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            E+++ EF+ SPV +FL RAE+IADKINE  L+EN  PY+
Sbjct  116  EKFWEEFRASPVTRFLTRAEQIADKINEMELKENDRPYR  154



>ref|XP_011046822.1| PREDICTED: uncharacterized protein LOC105141339 [Populus euphratica]
 ref|XP_011015609.1| PREDICTED: uncharacterized protein LOC105119188 [Populus euphratica]
Length=514

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 102/143 (71%), Gaps = 9/143 (6%)
 Frame = +3

Query  117  KPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISL--PFSRkpkke---kppgpgMYRRM  281
            KPP P+  +++ +     N     +K P F+++S+  PF +  K +       PG YR+M
Sbjct  17   KPPRPLPSINLLSLISLNN----GSKTPNFSSLSISNPFKKPQKPDPDPTLQQPGYYRQM  72

Query  282  LDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPVVQFL  461
            +DQ++WECE LPD+RHTP+VEKIL+ED +FE KENPT EEIEENERW++EF+ SPVV+FL
Sbjct  73   IDQYFWECENLPDYRHTPEVEKILNEDPVFEKKENPTPEEIEENERWWAEFRASPVVKFL  132

Query  462  ARAEEIADKINETALRENSAPYQ  530
             RA +IAD+INE  L+ NS PY+
Sbjct  133  TRAHQIADEINEMELKANSIPYR  155



>ref|XP_007205052.1| hypothetical protein PRUPE_ppa004296mg [Prunus persica]
 gb|EMJ06251.1| hypothetical protein PRUPE_ppa004296mg [Prunus persica]
Length=517

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 113/161 (70%), Gaps = 9/161 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPP-FAAISL-------PF  227
            MAS+NFNPF ++WF KPPNP+  +++ +  +S      QT   P F+A+SL       P 
Sbjct  1    MASINFNPF-ESWFKKPPNPLPPINLLSLTDSFFHRATQTTTSPNFSALSLSNLFKGPPK  59

Query  228  SRkpkkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeie  407
                   +P  PG Y  ML+Q++WECE  PD+RH P+V+KILSED IFE KENPT+EE+ 
Sbjct  60   PDPKTPSEPEKPGPYTEMLEQYFWECENAPDYRHAPEVDKILSEDPIFEKKENPTEEELR  119

Query  408  eneRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            ENE+++ EF+ESPVVQFLARAE+IA+KINE  L+EN  PY+
Sbjct  120  ENEKFWKEFRESPVVQFLARAEQIAEKINEMELKENDRPYR  160



>ref|XP_010036629.1| PREDICTED: uncharacterized protein LOC104425569 [Eucalyptus grandis]
 gb|KCW88214.1| hypothetical protein EUGRSUZ_A00607 [Eucalyptus grandis]
Length=513

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISL----PFSRkp  239
            MAS+NF+ F DNWF++P NP+   ++      ++        P FA++S     P     
Sbjct  1    MASLNFS-FFDNWFARPTNPLPLPNLAAAARPLS--AASRAAPNFASLSSSLGPPKPDGE  57

Query  240  kkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
             K      G+Y + +D+++WECE LPD+RHTP+VEKIL+ED +FE KENPT++E+ ENE+
Sbjct  58   PKPDGKEDGIYTQAMDRYFWECENLPDYRHTPEVEKILNEDPVFEAKENPTEQEVRENEK  117

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            W+ +F+ SPVVQF+ RAEE+AD+ NE  L+EN  PY+
Sbjct  118  WWQDFRSSPVVQFMQRAEEVADQFNELELQENDEPYR  154



>ref|XP_010093551.1| hypothetical protein L484_013987 [Morus notabilis]
 gb|EXB54258.1| hypothetical protein L484_013987 [Morus notabilis]
Length=526

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 110/167 (66%), Gaps = 22/167 (13%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDV-----HTFFESVNPFKPQTKNPPFAAISLP--FS  230
            MAS+NFNPF ++WFSKPP PI  +++      +FF + +P K       FA++S    F 
Sbjct  1    MASINFNPF-ESWFSKPPKPIPPLNLLKLNDFSFFRTESPSK-------FASLSASNLFD  52

Query  231  RkpkkekppgpgM-------YRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenp  389
            R  ++ +             Y +MLDQ++WECE LPD+R+ P+VEKIL+ED IFE KENP
Sbjct  53   RDKQQLETNPSSSTEEPKGPYSQMLDQYFWECENLPDYRYAPEVEKILNEDPIFEKKENP  112

Query  390  tqeeieeneRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            T+EEI EN +++ +F  +PVV+FL RAEEIAD +NE  L+EN  PY+
Sbjct  113  TEEEIRENAKFWEDFWANPVVKFLRRAEEIADIVNEMELKENENPYR  159



>gb|EPS63731.1| hypothetical protein M569_11052, partial [Genlisea aurea]
Length=283

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 97/142 (68%), Gaps = 2/142 (1%)
 Frame = +3

Query  105  NWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkkekppgpgMYRRML  284
            NWF  P N + F  +      +N FKP +K P FA+IS PFS KPK      PG Y +ML
Sbjct  1    NWFHNP-NRVPFQPLSLVRSFLN-FKPSSKTPNFASISNPFSGKPKSRNGKQPGKYTKML  58

Query  285  DQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPVVQFLA  464
            +Q++WE E  PD+RHTP+VE+IL+E    E KENPT+EEIEENE+W+   + SPV +FL 
Sbjct  59   EQYFWEIENFPDYRHTPEVEEILNEHPFIEKKENPTKEEIEENEKWWDALEASPVTKFLI  118

Query  465  RAEEIADKINETALRENSAPYQ  530
            RAEEIAD INE  L+ENS PY+
Sbjct  119  RAEEIADSINEAELQENSVPYR  140



>ref|XP_002268305.1| PREDICTED: uncharacterized protein LOC100257554 [Vitis vinifera]
 emb|CBI18120.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 102/156 (65%), Gaps = 11/156 (7%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFK-PQTKNPPFAAISLPFSRkpk--  242
            M S+NFNPF  NWF K               S N    P+T N  FA+IS   + K    
Sbjct  1    MGSINFNPFG-NWFQK----PPNPIPPINLLSCNLLNTPKTLN--FASISGSNTSKKTPK  53

Query  243  -kekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
             ++    P  Y++ML+QF+WE ET+P++RH P+VE+IL+ED  FE KENPT+EEI ENE+
Sbjct  54   PEKPSDEPEKYKKMLEQFFWESETMPNYRHAPEVERILNEDPNFEKKENPTEEEIRENEK  113

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPY  527
            W++EF+ SPVVQFLARAEEIA K+NE  L EN+ PY
Sbjct  114  WWNEFRSSPVVQFLARAEEIATKMNEMELEENANPY  149



>ref|XP_003516979.1| PREDICTED: uncharacterized protein LOC100801248 isoform X1 [Glycine 
max]
 ref|XP_006573383.1| PREDICTED: uncharacterized protein LOC100801248 isoform X2 [Glycine 
max]
Length=525

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 100/166 (60%), Gaps = 18/166 (11%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLP--FSRkpkk  245
            MAS+NFNPF  NWFSKPPNP+    +        P  P    P FAAISLP  F R+PK 
Sbjct  1    MASINFNPFGGNWFSKPPNPLPLPSLPNTLTDA-PSLP----PNFAAISLPNPFRRRPKP  55

Query  246  ekppgp--gMYRRMLDQFYWECETLPDHRHTPKVEKILS---------EDSIFetkenpt  392
            +       G Y ++  Q  WECETLPDHRHTP+V+KIL+         +DS+F  +E+ T
Sbjct  56   KSAEPTEPGPYEQLARQVLWECETLPDHRHTPEVDKILADNDAAFGGDDDSVFVRREDAT  115

Query  393  qeeieeneRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
             EE+ EN       + SPVVQF+ARAEEI DK+NE  L+EN  PY 
Sbjct  116  DEEVRENAELVERLRSSPVVQFMARAEEILDKMNEMELKENERPYH  161



>ref|XP_009337729.1| PREDICTED: uncharacterized protein LOC103930159 [Pyrus x bretschneideri]
Length=519

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 115/163 (71%), Gaps = 11/163 (7%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPP-FAAISL---------  221
            MAS+NFNPF ++WF KPPNP+  +++    +S        ++PP F+++SL         
Sbjct  1    MASINFNPF-ESWFKKPPNPLPLINLLPLTDSFFHRTTAAQSPPNFSSLSLSNLFNGPPK  59

Query  222  PFSRkpkkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqee  401
            P  + P   +P  PG Y +ML++F+WECE  PD+RH P+VEKIL+ED IFE KENPT+EE
Sbjct  60   PDPKNPSDPEPEKPGHYTQMLERFFWECENDPDYRHAPEVEKILNEDPIFEKKENPTEEE  119

Query  402  ieeneRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            + ENER++ EF+ESPVV+FLA+AE+IAD +NE  L+EN  PY+
Sbjct  120  LRENERFWKEFRESPVVKFLAQAEKIADMVNEVELKENDRPYR  162



>ref|XP_010922611.1| PREDICTED: uncharacterized protein LOC105045882 [Elaeis guineensis]
 ref|XP_010922612.1| PREDICTED: uncharacterized protein LOC105045882 [Elaeis guineensis]
Length=517

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 95/155 (61%), Gaps = 4/155 (3%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkkek  251
            MA++N     D WF +PP P K  +   F    N F  + KNP  ++ S   S       
Sbjct  1    MAAINLGWLGD-WFPQPPKPSKHPNF-AFIGGRNLFFKKPKNPQNSSSSASSSSSSSSSA  58

Query  252  ppgp--gMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWF  425
                  G Y +ML QF+WECE  PD+RHTP+VE+IL +D  FE KENPT EEIEENERW+
Sbjct  59   ASEEPPGKYTQMLAQFFWECEHRPDYRHTPEVEQILDDDPFFEKKENPTPEEIEENERWW  118

Query  426  SEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
              F +SPVVQFL RAE IADKINE  L+EN  PYQ
Sbjct  119  DGFNKSPVVQFLRRAELIADKINEMELKENEHPYQ  153



>ref|XP_004137697.1| PREDICTED: protein TIC 56, chloroplastic [Cucumis sativus]
 gb|KGN58726.1| hypothetical protein Csa_3G730900 [Cucumis sativus]
Length=508

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSRkpkkek  251
            M S+NFNPF +NWFSKPPNPI  +++  F +S++  +  + +P FA+ SL  +   K +K
Sbjct  1    MTSINFNPF-ENWFSKPPNPIPPLNLIAFRDSLS--QKSSTSPNFASRSLS-NLFRKPKK  56

Query  252  ppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSE  431
             P PG Y +ML+QFYWEC+ LPD+RH P+VEKIL ED +FE KENPTQEE+E+NE+ +  
Sbjct  57   APEPGYYEKMLEQFYWECDNLPDYRHAPEVEKILKEDPLFENKENPTQEELEKNEKLWKA  116

Query  432  FKESPVVQFLARAEEIADKINETALRENSAPYQ  530
             ++SPVVQFL RAEEI  K NE  L+EN  P++
Sbjct  117  IRDSPVVQFLERAEEIEAKHNEMKLKENENPFR  149



>emb|CAN83946.1| hypothetical protein VITISV_043666 [Vitis vinifera]
Length=1352

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 11/156 (7%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFK-PQTKNPPFAAISLPFSRkpk--  242
            M S+NFNPF  NWF KPPNPI          S N    P+T N  FA+IS   + K    
Sbjct  1    MGSINFNPFG-NWFQKPPNPIP----PINLLSCNLLNTPKTLN--FASISGSNTSKKTPK  53

Query  243  -kekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneR  419
             ++    P  Y++ML+QF+WE ET+P++RH P+VE+IL+ED  FE KENPT+EEI ENE+
Sbjct  54   PEKPSDEPEKYKKMLEQFFWESETMPNYRHAPEVERILNEDPNFEKKENPTEEEIRENEK  113

Query  420  WFSEFKESPVVQFLARAEEIADKINETALRENSAPY  527
            W++EF+ SPVVQFLARAEEIA K+NE  L EN+ PY
Sbjct  114  WWNEFRSSPVVQFLARAEEIATKMNEMELEENANPY  149



>ref|XP_008388287.1| PREDICTED: uncharacterized protein LOC103450691 [Malus domestica]
Length=519

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 115/163 (71%), Gaps = 11/163 (7%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPP-FAAISL---------  221
            MAS+NFNPF ++WF KPPNP+  +++    +S        ++PP F+++SL         
Sbjct  1    MASINFNPF-ESWFKKPPNPLPPINLLPLTDSFFHRTTAAQSPPNFSSLSLSNLFNGPPK  59

Query  222  PFSRkpkkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqee  401
            P  + P   +P  PG Y +ML++F+WECE  PD+RH+P+VEKIL+ED IFE KENPT+EE
Sbjct  60   PDPKNPSDPEPEKPGHYTQMLERFFWECENDPDYRHSPEVEKILNEDPIFEKKENPTEEE  119

Query  402  ieeneRWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
            + ENER++ EF+ESPV +FLA+AE+IAD +NE  L+EN  PY+
Sbjct  120  LRENERFWKEFRESPVXKFLAQAEKIADMVNELELKENDRPYR  162



>ref|XP_008777698.1| PREDICTED: uncharacterized protein LOC103697588 [Phoenix dactylifera]
Length=511

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  270  YRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPV  449
            Y +ML+QF+WECE  PD+RHTP+VE+IL++D  FE KENPT EEIEENERW+ EF ++PV
Sbjct  61   YTQMLEQFFWECEHRPDYRHTPEVERILADDPFFEKKENPTPEEIEENERWWDEFNKNPV  120

Query  450  VQFLARAEEIADKINETALRENSAPYQ  530
            VQFL RAE +ADKINE  L+EN  PY+
Sbjct  121  VQFLRRAELVADKINEMELKENEHPYR  147



>ref|XP_009382875.1| PREDICTED: uncharacterized protein LOC103970706 [Musa acuminata 
subsp. malaccensis]
Length=520

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +3

Query  270  YRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPV  449
            Y +MLDQF+WEC+  PD RHTP+VE+IL++D+ F+ KENPT EE+EEN  W+ EF E+PV
Sbjct  63   YSQMLDQFFWECDHRPDFRHTPEVERILADDTCFDKKENPTPEEVEENREWWEEFNENPV  122

Query  450  VQFLARAEEIADKINETALRENSAPYQ  530
            V+FL RAE IAD+INE  L +N  PY+
Sbjct  123  VEFLRRAEVIADRINELELEKNKHPYR  149



>ref|XP_006853837.1| PREDICTED: protein TIC 56, chloroplastic [Amborella trichopoda]
 gb|ERN15304.1| hypothetical protein AMTR_s00036p00064050 [Amborella trichopoda]
Length=496

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +3

Query  270  YRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPV  449
            Y+  L++F WE E LPD+RH P+VE+IL EDS+F+ KE   +E+ +   +W+ +F++SPV
Sbjct  51   YKEKLERFLWEQENLPDYRHAPEVEEILHEDSVFDKKELTPEEKADNE-KWWDKFEKSPV  109

Query  450  VQFLARAEEIADKINETALRENSAPYQ  530
            V+FL RAEEIAD +NE  L+ENS P++
Sbjct  110  VKFLVRAEEIADAVNEMELKENSVPFR  136



>ref|XP_004506798.1| PREDICTED: uncharacterized protein LOC101498099 [Cicer arietinum]
Length=509

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 88/158 (56%), Gaps = 10/158 (6%)
 Frame = +3

Query  72   MASVNFNPFSDNWFSKPPNPIKFVDVHTFFESVNPFKPQTKNPPFAAISLPFSR-----k  236
            M+S+NFNPFS NWF     P            +N     + +P FA+ SL   +      
Sbjct  1    MSSINFNPFSGNWF-----PFSKPPTPLSLPPLNTILNLSHSPNFASTSLSTPKPSTTTT  55

Query  237  pkkekppgpgMYRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieene  416
                +    G + +M+ QF+ ECETLPDHRHTP+VE IL  + +FE + N T++E++EN+
Sbjct  56   TTAVEDDESGPFTKMVQQFFHECETLPDHRHTPQVENILKGNDLFEYRPNATEQELKEND  115

Query  417  RWFSEFKESPVVQFLARAEEIADKINETALRENSAPYQ  530
             +    K  PV++ L +AE   +K+NE  L++N  P++
Sbjct  116  EFMESLKNDPVIKMLLKAELGIEKMNEIELKKNEKPFR  153



>ref|XP_002526665.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35687.1| conserved hypothetical protein [Ricinus communis]
Length=505

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  270  YRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPV  449
            +++MLDQF++E E LPD+RHTP+VE+IL++    E KENPT+EEI ENER++ E + +PV
Sbjct  72   WQQMLDQFFYEHENLPDYRHTPEVERILNDHPYLEQKENPTEEEIRENERFWKEIESNPV  131

Query  450  VQFLARAEEIADKINETALRENSAPYQ  530
            V+FLARAE+I DKINE  L+ N  PY+
Sbjct  132  VKFLARAEQIDDKINEMELKANEIPYR  158



>gb|KEH28844.1| hypothetical protein MTR_4g014600 [Medicago truncatula]
Length=416

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +3

Query  270  YRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPV  449
            + +M+ QF++EC+ LP+HRHTP+V K+L+E+ I+E K N T++E+ ENE + +E   +P+
Sbjct  67   FTKMVQQFFYECDYLPNHRHTPQVNKVLNENDIYEVKPNATEQEMNENEEFMNEMYNNPI  126

Query  450  VQFLARAEEIADKINETALRENSAP  524
            +  L R E IADK+NE  L++N  P
Sbjct  127  IHMLMRYEYIADKVNEWELKKNEKP  151



>ref|XP_003604569.1| hypothetical protein MTR_4g014600 [Medicago truncatula]
 gb|AES86766.1| hypothetical protein MTR_4g014600 [Medicago truncatula]
Length=512

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +3

Query  270  YRRMLDQFYWECETLPDHRHTPKVEKILSEDSIFetkenptqeeieeneRWFSEFKESPV  449
            + +M+ QF++EC+ LP+HRHTP+V K+L+E+ I+E K N T++E+ ENE + +E   +P+
Sbjct  67   FTKMVQQFFYECDYLPNHRHTPQVNKVLNENDIYEVKPNATEQEMNENEEFMNEMYNNPI  126

Query  450  VQFLARAEEIADKINETALRENSAP  524
            +  L R E IADK+NE  L++N  P
Sbjct  127  IHMLMRYEYIADKVNEWELKKNEKP  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 580605835400