BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig665

Length=814
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004251615.1|  PREDICTED: cyclin-dependent kinase F-1             305   2e-97   Solanum lycopersicum
ref|XP_009608932.1|  PREDICTED: cyclin-dependent kinase F-1             304   7e-97   Nicotiana tomentosiformis
ref|XP_006353467.1|  PREDICTED: cyclin-dependent kinase F-1-like        304   7e-97   Solanum tuberosum [potatoes]
ref|XP_009803573.1|  PREDICTED: cyclin-dependent kinase F-1             303   2e-96   Nicotiana sylvestris
emb|CDP03307.1|  unnamed protein product                                300   5e-95   Coffea canephora [robusta coffee]
ref|XP_002284217.1|  PREDICTED: cyclin-dependent kinase F-1             296   7e-94   Vitis vinifera
ref|XP_002325003.2|  CDK-activating kinase 1at family protein           294   6e-93   
ref|XP_011048376.1|  PREDICTED: cyclin-dependent kinase F-1             293   2e-92   Populus euphratica
ref|XP_010249662.1|  PREDICTED: cyclin-dependent kinase F-1-like        288   9e-91   
ref|XP_004299987.1|  PREDICTED: cyclin-dependent kinase F-1             288   9e-91   Fragaria vesca subsp. vesca
emb|CAN73707.1|  hypothetical protein VITISV_023714                     287   1e-90   Vitis vinifera
ref|XP_012076728.1|  PREDICTED: cyclin-dependent kinase F-1 isofo...    286   9e-90   Jatropha curcas
ref|XP_009336876.1|  PREDICTED: cyclin-dependent kinase F-1-like        285   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_007013117.1|  CDK-activating kinase 1AT                          284   7e-89   Theobroma cacao [chocolate]
ref|XP_011093610.1|  PREDICTED: cyclin-dependent kinase F-1             283   2e-88   Sesamum indicum [beniseed]
ref|XP_009352498.1|  PREDICTED: cyclin-dependent kinase F-1-like        282   3e-88   Pyrus x bretschneideri [bai li]
ref|XP_008242579.1|  PREDICTED: cyclin-dependent kinase F-1             281   5e-88   Prunus mume [ume]
ref|XP_008362935.1|  PREDICTED: cyclin-dependent kinase F-1-like        281   6e-88   
ref|XP_007204340.1|  hypothetical protein PRUPE_ppa005578mg             281   7e-88   Prunus persica
gb|KDO42248.1|  hypothetical protein CISIN_1g020467mg                   276   9e-88   Citrus sinensis [apfelsine]
gb|EPS60458.1|  hypothetical protein M569_14345                         276   4e-86   Genlisea aurea
ref|XP_006451198.1|  hypothetical protein CICLE_v10008156mg             275   1e-85   Citrus clementina [clementine]
ref|XP_006475656.1|  PREDICTED: cyclin-dependent kinase F-1-like        275   2e-85   Citrus sinensis [apfelsine]
ref|XP_002514275.1|  cak1, putative                                     274   3e-85   Ricinus communis
ref|XP_010105058.1|  Cyclin-dependent kinase F-1                        273   5e-85   Morus notabilis
ref|XP_010540963.1|  PREDICTED: cyclin-dependent kinase F-1             274   6e-85   Tarenaya hassleriana [spider flower]
gb|AAF34804.1|AF230740_1  CDK-activating kinase                         274   6e-85   Euphorbia esula [wolf's milk]
ref|XP_002869461.1|  cdk-activating kinase 1at                          273   2e-84   
ref|XP_006412893.1|  hypothetical protein EUTSA_v10025049mg             271   5e-84   Eutrema salsugineum [saltwater cress]
ref|XP_010254056.1|  PREDICTED: cyclin-dependent kinase F-1-like        269   4e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006285995.1|  hypothetical protein CARUB_v10007522mg             269   4e-83   Capsella rubella
gb|KJB07191.1|  hypothetical protein B456_001G006600                    268   1e-82   Gossypium raimondii
ref|XP_008458494.1|  PREDICTED: cyclin-dependent kinase F-1             268   1e-82   Cucumis melo [Oriental melon]
ref|XP_004139347.1|  PREDICTED: cyclin-dependent kinase F-1             267   3e-82   Cucumis sativus [cucumbers]
ref|NP_194627.1|  cyclin-dependent kinase F-1                           266   3e-82   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35237.1|  BnaA01g07940D                                          266   7e-82   Brassica napus [oilseed rape]
ref|XP_010438365.1|  PREDICTED: cyclin-dependent kinase F-1             266   7e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010433152.1|  PREDICTED: cyclin-dependent kinase F-1-like        263   6e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009129100.1|  PREDICTED: cyclin-dependent kinase F-1             263   1e-80   Brassica rapa
ref|XP_010688250.1|  PREDICTED: cyclin-dependent kinase F-1             262   2e-80   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU29812.1|  hypothetical protein MIMGU_mgv1a005844mg                262   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_010447904.1|  PREDICTED: cyclin-dependent kinase F-1-like        262   2e-80   Camelina sativa [gold-of-pleasure]
gb|KHN16612.1|  Cyclin-dependent kinase F-1                             258   1e-79   Glycine soja [wild soybean]
ref|XP_003530518.1|  PREDICTED: cyclin-dependent kinase F-1-like ...    258   1e-79   Glycine max [soybeans]
ref|XP_004503449.1|  PREDICTED: cyclin-dependent kinase F-1-like        258   9e-79   Cicer arietinum [garbanzo]
gb|AET05246.2|  cyclin-dependent kinase                                 257   1e-78   Medicago truncatula
gb|KJB54228.1|  hypothetical protein B456_009G026100                    253   1e-78   Gossypium raimondii
ref|XP_003630770.1|  Protein kinase                                     257   2e-78   
ref|XP_007160323.1|  hypothetical protein PHAVU_002G312000g             254   2e-78   Phaseolus vulgaris [French bean]
ref|XP_003525274.1|  PREDICTED: cyclin-dependent kinase F-1-like        254   2e-78   Glycine max [soybeans]
ref|XP_010915858.1|  PREDICTED: cyclin-dependent kinase F-1-like        251   5e-76   Elaeis guineensis
emb|CDY06853.1|  BnaC01g09520D                                          256   7e-74   
ref|XP_009404441.1|  PREDICTED: cyclin-dependent kinase F-1-like        244   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783260.1|  PREDICTED: cyclin-dependent kinase F-1-like        243   3e-73   Phoenix dactylifera
ref|XP_004513007.1|  PREDICTED: cyclin-dependent kinase F-1-like        242   3e-73   Cicer arietinum [garbanzo]
ref|XP_009421449.1|  PREDICTED: cyclin-dependent kinase F-1-like        238   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010047911.1|  PREDICTED: cyclin-dependent kinase F-1             239   2e-71   Eucalyptus grandis [rose gum]
ref|XP_003620628.1|  Protein kinase                                     235   7e-71   Medicago truncatula
gb|ACU19808.1|  unknown                                                 236   1e-70   Glycine max [soybeans]
gb|ABR18101.1|  unknown                                                 235   2e-70   Picea sitchensis
ref|XP_007152857.1|  hypothetical protein PHAVU_004G165900g             234   2e-70   Phaseolus vulgaris [French bean]
ref|XP_003534210.1|  PREDICTED: cyclin-dependent kinase F-1-like        227   2e-67   Glycine max [soybeans]
ref|XP_009380563.1|  PREDICTED: cyclin-dependent kinase F-1-like        228   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008801528.1|  PREDICTED: cyclin-dependent kinase F-1-like        225   2e-66   Phoenix dactylifera
ref|XP_006833351.1|  PREDICTED: cyclin-dependent kinase F-1             219   3e-64   Amborella trichopoda
ref|XP_010925885.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-depen...    210   1e-60   Elaeis guineensis
ref|XP_003563822.1|  PREDICTED: cyclin-dependent kinase F-1             187   5e-52   Brachypodium distachyon [annual false brome]
dbj|BAK00218.1|  predicted protein                                      185   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001150420.1|  CAK1AT                                             181   2e-49   Zea mays [maize]
ref|XP_002437039.1|  hypothetical protein SORBIDRAFT_10g019630          179   1e-48   Sorghum bicolor [broomcorn]
gb|EMS50112.1|  Cyclin-dependent kinase F-1                             177   4e-48   Triticum urartu
ref|XP_004965464.1|  PREDICTED: cyclin-dependent kinase F-1-like        176   1e-47   Setaria italica
sp|A2YCH5.1|CDKF1_ORYSI  RecName: Full=Cyclin-dependent kinase F-...    165   1e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001057551.1|  Os06g0334400                                       163   7e-43   
ref|XP_002981667.1|  hypothetical protein SELMODRAFT_444958             153   2e-39   Selaginella moellendorffii
ref|XP_002967851.1|  hypothetical protein SELMODRAFT_408721             153   3e-39   Selaginella moellendorffii
ref|XP_001770144.1|  predicted protein                                  148   7e-39   
emb|CCK68222.1|  hypothetical protein KNAG_0A05580                      120   4e-28   Kazachstania naganishii CBS 8797
ref|XP_003866466.1|  serine/threonine protein kinase                    120   6e-28   Candida orthopsilosis Co 90-125
ref|XP_001528082.1|  serine/threonine-protein kinase KIN28              120   6e-28   Lodderomyces elongisporus NRRL YB-4239
ref|XP_003668608.1|  hypothetical protein NDAI_0B03310                  119   7e-28   Naumovozyma dairenensis CBS 421
emb|CCE43061.1|  hypothetical protein CPAR2_207040                      119   1e-27   Candida parapsilosis
ref|XP_003955249.1|  hypothetical protein KAFR_0A06790                  119   1e-27   Kazachstania africana CBS 2517
gb|EWG91686.1|  Kin28p                                                  119   1e-27   Saccharomyces cerevisiae P301
gb|AJU99024.1|  Kin28p                                                  118   2e-27   Saccharomyces cerevisiae YJM1385
ref|XP_009267171.1|  Serine/threonine-protein kinase crk1               119   2e-27   Wallemia ichthyophaga EXF-994
ref|NP_010175.1|  TFIIH complex serine/threonine-protein kinase s...    117   3e-27   Saccharomyces cerevisiae S288C
gb|AJV11620.1|  Kin28p                                                  117   3e-27   Saccharomyces cerevisiae YJM1447
dbj|GAA22140.1|  K7_Kin28p                                              117   3e-27   Saccharomyces cerevisiae Kyokai no. 7
ref|NP_983813.1|  ADL283Wp                                              117   5e-27   Eremothecium gossypii ATCC 10895
ref|XP_004179295.1|  hypothetical protein TBLA_0B09590                  116   7e-27   Tetrapisispora blattae CBS 6284
gb|EEU08975.1|  Kin28p                                                  116   8e-27   Saccharomyces cerevisiae JAY291
gb|AAT97347.1|  GDBD-TEV-Kin28-HA fusion protein                        118   1e-26   Yeast two-hybrid vector pMK498-TEV
gb|KDQ18931.1|  hypothetical protein BOTBODRAFT_28411                   117   1e-26   Botryobasidium botryosum FD-172 SS1
dbj|BAO41303.1|  serine/threonine-protein kinase KIN28                  116   1e-26   Kluyveromyces marxianus DMKU3-1042
gb|AAT97348.1|  GDBD-TEV-CTDx3-Kin28-HA fusion protein                  118   1e-26   Yeast two-hybrid vector pMK500-TEV
ref|XP_003645675.1|  hypothetical protein Ecym_3371                     115   1e-26   Eremothecium cymbalariae DBVPG#7215
gb|KGK39601.1|  hypothetical protein JL09_g1189                         115   3e-26   Pichia kudriavzevii
ref|XP_006958623.1|  Pkinase-domain-containing protein                  115   3e-26   Wallemia mellicola CBS 633.66
gb|AAT97349.1|  GDBD-TEV-CTDx3-Kin28(E54Q)-HA fusion protien            117   4e-26   Yeast two-hybrid vector pMK502-TEV
gb|EIE91553.1|  hypothetical protein RO3G_16264                         115   4e-26   Rhizopus delemar RA 99-880
ref|XP_003675055.1|  hypothetical protein NCAS_0B06000                  114   5e-26   Naumovozyma castellii CBS 4309
ref|XP_001645393.1|  hypothetical protein Kpol_534p14                   114   5e-26   Vanderwaltozyma polyspora DSM 70294
ref|XP_009012918.1|  hypothetical protein HELRODRAFT_74648              114   6e-26   Helobdella robusta
ref|XP_454616.1|  hypothetical protein                                  114   6e-26   Kluyveromyces lactis
ref|XP_006125616.1|  PREDICTED: cyclin-dependent kinase 20-like         111   7e-26   Pelodiscus sinensis [Chinese softshell turtle]
gb|KFH72507.1|  CMGC/CDK/CDK7 protein kinase                            114   7e-26   Mortierella verticillata NRRL 6337
emb|CCA67882.1|  probable KIN28-cyclin-dependent ser/thr protein ...    114   1e-25   Serendipita indica DSM 11827
emb|CEG73455.1|  Putative CMGC/CDK/CDK7 protein kinase                  114   1e-25   Rhizopus microsporus
gb|ERZ97612.1|  hypothetical protein GLOINDRAFT_340045                  114   1e-25   
ref|XP_003685049.1|  hypothetical protein TPHA_0C04650                  113   1e-25   Tetrapisispora phaffii CBS 4417
ref|XP_003682840.1|  hypothetical protein TDEL_0G02620                  113   1e-25   Torulaspora delbrueckii
ref|XP_009657622.1|  Protein tyrosine kinase                            113   2e-25   Verticillium dahliae VdLs.17
ref|XP_007376851.1|  hypothetical protein SPAPADRAFT_56779              113   2e-25   Spathaspora passalidarum NRRL Y-27907
ref|XP_003002407.1|  Protein tyrosine kinase                            113   2e-25   Verticillium alfalfae VaMs.102
ref|XP_002618382.1|  conserved hypothetical protein                     112   2e-25   Clavispora lusitaniae ATCC 42720
emb|CDO94741.1|  unnamed protein product                                112   2e-25   Kluyveromyces dobzhanskii CBS 2104
gb|EUB56284.1|  Cell division protein kinase 20                         112   2e-25   Echinococcus granulosus
ref|XP_002492173.1|  Serine/threonine protein kinase, subunit of ...    112   3e-25   Komagataella phaffii GS115
dbj|GAA99786.1|  hypothetical protein E5Q_06489                         112   3e-25   Mixia osmundae IAM 14324
gb|KIJ55700.1|  hypothetical protein M422DRAFT_200034                   112   3e-25   Sphaerobolus stellatus SS14
gb|KEP52864.1|  CMGC/CDK/CDK7 kinase                                    112   3e-25   Rhizoctonia solani 123E
ref|XP_002494675.1|  ZYRO0A07062p                                       111   4e-25   Zygosaccharomyces rouxii
ref|XP_007404399.1|  hypothetical protein MELLADRAFT_32688              112   4e-25   Melampsora larici-populina 98AG31
emb|CDF87308.1|  BN860_03466g1_1                                        111   4e-25   Zygosaccharomyces bailii CLIB 213
emb|CEI89902.1|  Putative CMGC/CDK/CDK7 protein kinase                  112   5e-25   Rhizopus microsporus
emb|CDH13015.1|  probable KIN28-Cyclin-dependent ser/thr protein ...    111   5e-25   Zygosaccharomyces bailii ISA1307
ref|XP_003172211.1|  CMGC/CDK/CDK7 protein kinase                       112   6e-25   Nannizzia gypsea CBS 118893
ref|XP_799108.3|  PREDICTED: cyclin-dependent kinase 20-like            111   6e-25   Strongylocentrotus purpuratus [purple urchin]
ref|XP_002549916.1|  serine/threonine-protein kinase KIN28              111   6e-25   Candida tropicalis MYA-3404
gb|KFY14499.1|  hypothetical protein V491_06025                         110   6e-25   Pseudogymnoascus sp. VKM F-3775
ref|XP_001020875.2|  Protein kinase domain containing protein           111   7e-25   Tetrahymena thermophila SB210
ref|XP_005841872.1|  hypothetical protein GUITHDRAFT_83848              111   7e-25   Guillardia theta CCMP2712
emb|CEP61484.1|  LALA0S03e03884g1_1                                     111   7e-25   Lachancea lanzarotensis
gb|EMG45554.1|  Serine/threonine protein kinase (Stpk), putative        111   7e-25   Candida maltosa Xu316
gb|ESW97639.1|  Serine/threonine-protein kinase KIN28                   111   7e-25   Ogataea parapolymorpha DL-1
emb|CBK20791.2|  unnamed protein product                                113   8e-25   Blastocystis hominis
ref|XP_006625499.1|  PREDICTED: cyclin-dependent kinase 20-like         111   8e-25   Lepisosteus oculatus
ref|XP_003333897.2|  CMGC/CDK/CDK7 protein kinase                       111   8e-25   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|KIK61670.1|  hypothetical protein GYMLUDRAFT_73182                   111   8e-25   Gymnopus luxurians FD-317 M1
gb|KIM82969.1|  hypothetical protein PILCRDRAFT_447116                  111   8e-25   Piloderma croceum F 1598
gb|KGQ91282.1|  serine/threonine-protein kinase KIN28                   111   9e-25   Candida albicans P94015
gb|KGR03866.1|  serine/threonine-protein kinase KIN28                   111   9e-25   Candida albicans GC75
gb|EPZ31846.1|  Protein kinase, catalytic domain-containing protein     111   9e-25   Rozella allomycis CSF55
gb|KHC40692.1|  serine/threonine-protein kinase KIN28                   111   9e-25   Candida albicans P76055
ref|XP_002417288.1|  serine/threonine protein kinase (stpk), puta...    111   9e-25   Candida dubliniensis CD36
ref|XP_718828.1|  likely protein kinase                                 111   9e-25   Candida albicans SC5314
gb|KFY48459.1|  hypothetical protein V496_10268                         110   9e-25   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KFA65474.1|  hypothetical protein S40285_00412                       110   1e-24   Stachybotrys chlorohalonata IBT 40285
gb|KEY64313.1|  hypothetical protein S7711_06357                        110   1e-24   Stachybotrys chartarum IBT 7711
gb|KFY15206.1|  hypothetical protein V492_02162                         110   1e-24   Pseudogymnoascus sp. VKM F-4246
gb|KFZ03799.1|  hypothetical protein V501_09303                         110   1e-24   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
ref|XP_002594508.1|  hypothetical protein BRAFLDRAFT_124968             110   1e-24   Branchiostoma floridae
ref|XP_011276854.1|  Serine/threonine-protein kinase                    110   1e-24   Wickerhamomyces ciferrii
gb|KIP10011.1|  hypothetical protein PHLGIDRAFT_34114                   110   1e-24   Phlebiopsis gigantea 11061_1 CR5-6
gb|EGE01384.1|  CMGC/CDK/CDK7 protein kinase                            111   1e-24   Trichophyton equinum CBS 127.97
gb|KFY72795.1|  hypothetical protein V499_07081                         110   2e-24   Pseudogymnoascus sp. VKM F-103
gb|ELR07477.1|  CMGC/CDK/CDK7 protein kinase                            110   2e-24   Pseudogymnoascus destructans 20631-21
gb|EEQ42529.1|  serine/threonine-protein kinase KIN28                   110   2e-24   Candida albicans WO-1
gb|EMS18428.1|  cyclin-dependent protein kinase                         110   2e-24   Rhodotorula toruloides NP11
ref|XP_001382915.2|  serine-threonine kinase, subunit of RNA Pol ...    110   2e-24   Scheffersomyces stipitis CBS 6054
gb|ETE70966.1|  Cyclin-dependent kinase 20                              110   2e-24   Ophiophagus hannah
ref|XP_003216903.1|  PREDICTED: cyclin-dependent kinase 20              110   2e-24   Anolis carolinensis [Carolina anole]
gb|ENH78817.1|  serine threonine-protein kinase                         110   2e-24   
ref|XP_007781978.1|  CMGC/CDK/CDK7 protein kinase                       110   2e-24   Coniosporium apollinis CBS 100218
emb|CEL61726.1|  cyclin-dependent kinase 7                              110   2e-24   Rhizoctonia solani AG-1 IB
ref|XP_007877362.1|  hypothetical protein PFL1_01661                    110   2e-24   Anthracocystis flocculosa PF-1
ref|XP_007839773.1|  Negative regulator of the PHO system               110   2e-24   Pestalotiopsis fici W106-1
ref|XP_007320727.1|  hypothetical protein SERLADRAFT_451075             110   2e-24   Serpula lacrymans var. lacrymans S7.9
ref|XP_007422275.1|  PREDICTED: cyclin-dependent kinase 20-like i...    110   2e-24   
emb|CDQ75933.1|  unnamed protein product                                111   2e-24   Oncorhynchus mykiss
gb|KFY47858.1|  hypothetical protein V495_01778                         110   2e-24   Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFY56126.1|  hypothetical protein V497_06489                         110   2e-24   Pseudogymnoascus sp. VKM F-4516 (FW-969)
gb|KIM33959.1|  hypothetical protein M408DRAFT_325514                   110   2e-24   Serendipita vermifera MAFF 305830
gb|KDB18977.1|  negative regulator of the PHO system                    109   2e-24   Ustilaginoidea virens
gb|KIJ20802.1|  hypothetical protein PAXINDRAFT_95799                   110   3e-24   Paxillus involutus ATCC 200175
gb|EGD96938.1|  CMGC/CDK/CDK7 protein kinase                            110   3e-24   Trichophyton tonsurans CBS 112818
ref|XP_006684978.1|  Pkinase-domain-containing protein                  109   3e-24   Yamadazyma tenuis ATCC 10573
gb|EPS94542.1|  hypothetical protein FOMPIDRAFT_1033293                 110   3e-24   Fomitopsis pinicola FP-58527 SS1
gb|EJU03529.1|  CMGC/CDK/CDK7 protein kinase                            110   3e-24   Dacryopinax primogenitus
emb|CDR42046.1|  CYFA0S08e02982g1_1                                     109   3e-24   Cyberlindnera fabianii
ref|XP_447246.1|  hypothetical protein                                  109   3e-24   [Candida] glabrata
ref|XP_008038263.1|  CMGC/CDK/CDK7 protein kinase                       110   3e-24   Trametes versicolor FP-101664 SS1
ref|XP_002554617.1|  KLTH0F09504p                                       109   3e-24   Lachancea thermotolerans CBS 6340
emb|CEP17028.1|  hypothetical protein                                   109   3e-24   Parasitella parasitica
gb|KFY19972.1|  hypothetical protein V493_07784                         109   3e-24   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
emb|CDS13810.1|  hypothetical protein LRAMOSA05984                      109   3e-24   Lichtheimia ramosa
ref|XP_007910804.1|  putative negative regulator of the pho syste...    109   3e-24   Phaeoacremonium minimum UCRPA7
ref|XP_001911361.1|  hypothetical protein                               110   3e-24   Podospora anserina S mat+
ref|XP_004039435.1|  ribosomal protein, putative                        111   4e-24   Ichthyophthirius multifiliis
ref|XP_001212026.1|  serine/threonine-protein kinase crk1               110   4e-24   Aspergillus terreus NIH2624
ref|XP_005166746.1|  PREDICTED: cyclin-dependent kinase 20 isofor...    109   4e-24   Danio rerio [leopard danio]
gb|KFY36233.1|  hypothetical protein V494_05195                         109   4e-24   Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|XP_007884830.1|  PREDICTED: cyclin-dependent kinase 20              109   4e-24   Callorhinchus milii [Australian ghost shark]
ref|XP_009260698.1|  hypothetical protein FPSE_09306                    109   4e-24   Fusarium pseudograminearum CS3096
ref|XP_003352099.1|  hypothetical protein SMAC_02534                    109   4e-24   Sordaria macrospora k-hell
gb|KIL00759.1|  hypothetical protein PAXRUDRAFT_7974                    109   4e-24   Paxillus rubicundulus Ve08.2h10
gb|EQB45449.1|  hypothetical protein CGLO_15662                         109   4e-24   Colletotrichum gloeosporioides Cg-14
ref|XP_001739634.1|  cyclin-dependent kinase C-2                        109   4e-24   Entamoeba dispar SAW760
ref|XP_007272551.1|  serine threonine-protein kinase                    109   4e-24   
ref|XP_009302023.1|  PREDICTED: cyclin-dependent kinase 20 isofor...    109   4e-24   Danio rerio [leopard danio]
ref|XP_006269082.1|  PREDICTED: cyclin-dependent kinase 20-like i...    109   4e-24   
gb|KFY82684.1|  hypothetical protein V500_10382                         110   5e-24   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
emb|CEG72662.1|  Putative CMGC/CDK/CDK5 protein kinase                  108   5e-24   Rhizopus microsporus
ref|XP_006032081.1|  PREDICTED: cyclin-dependent kinase 20-like         109   5e-24   
ref|XP_009848364.1|  hypothetical protein NEUTE1DRAFT_120280            109   5e-24   Neurospora tetrasperma FGSC 2508
ref|XP_960739.1|  serine/threonine-protein kinase                       109   5e-24   Neurospora crassa OR74A
ref|XP_011428987.1|  PREDICTED: cyclin-dependent kinase 20-like         108   5e-24   Crassostrea gigas
gb|EXX78044.1|  Pho85p                                                  109   5e-24   Rhizophagus irregularis DAOM 197198w
ref|XP_007507759.1|  PREDICTED: cyclin-dependent kinase 20-like i...    108   5e-24   Monodelphis domestica
emb|CDM32461.1|  Serine/threonine-protein kinase crk1                   109   5e-24   Penicillium roqueforti FM164
gb|KIL84711.1|  hypothetical protein FAVG1_11938                        108   5e-24   Fusarium avenaceum
emb|CDK27712.1|  unnamed protein product                                108   6e-24   Kuraishia capsulata CBS 1993
gb|EAS01666.2|  cyclin-dependent kinase-like Serine/Threonine kin...    108   6e-24   Tetrahymena thermophila SB210
gb|EYE93309.1|  Pkinase-domain-containing protein                       109   6e-24   Aspergillus ruber CBS 135680
gb|EMD38943.1|  hypothetical protein CERSUDRAFT_151723                  108   6e-24   Gelatoporia subvermispora B
emb|CDH55675.1|  cmgc cdk cdk7 protein kinase                           108   6e-24   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003012701.1|  hypothetical protein ARB_00952                     109   7e-24   Trichophyton benhamiae CBS 112371
gb|KIM44567.1|  hypothetical protein M413DRAFT_442537                   108   7e-24   Hebeloma cylindrosporum h7
ref|XP_001484761.1|  conserved hypothetical protein                     108   7e-24   Meyerozyma guilliermondii ATCC 6260
gb|EDK38392.2|  conserved hypothetical protein                          108   7e-24   Meyerozyma guilliermondii ATCC 6260
ref|XP_007507757.1|  PREDICTED: cyclin-dependent kinase 20-like i...    108   7e-24   Monodelphis domestica
gb|KIO25847.1|  hypothetical protein M407DRAFT_15177                    108   8e-24   Tulasnella calospora MUT 4182
gb|KFH44204.1|  Negative regulator of the PHO system-like protein       108   8e-24   Acremonium chrysogenum ATCC 11550
gb|ESA15089.1|  hypothetical protein GLOINDRAFT_40294                   108   8e-24   
gb|KIW01693.1|  hypothetical protein PV09_06874                         108   8e-24   Verruconis gallopava
ref|XP_003374534.1|  serine/threonine-protein kinase PCTAIRE-2          107   8e-24   Trichinella spiralis
gb|KFX91619.1|  hypothetical protein O988_07667                         111   8e-24   Pseudogymnoascus sp. VKM F-3808
emb|CCL99679.1|  predicted protein                                      108   9e-24   Fibroporia radiculosa
ref|XP_007507754.1|  PREDICTED: cyclin-dependent kinase 20-like i...    108   9e-24   Monodelphis domestica
ref|XP_007304419.1|  Pkinase-domain-containing protein                  108   9e-24   Stereum hirsutum FP-91666 SS1
ref|XP_002741922.1|  PREDICTED: cyclin-dependent kinase 20-like         108   9e-24   Saccoglossus kowalevskii
dbj|GAN10642.1|  cyclin-dependent protein kinase PhoA                   107   9e-24   Mucor ambiguus
ref|XP_007507756.1|  PREDICTED: cyclin-dependent kinase 20-like i...    108   9e-24   Monodelphis domestica
ref|XP_004040130.1|  hypothetical protein IMG5_000530                   108   1e-23   Ichthyophthirius multifiliis
ref|XP_007603296.1|  hypothetical protein CFIO01_11206                  108   1e-23   
ref|XP_003236978.1|  CMGC/CDK/CDK7 protein kinase                       108   1e-23   Trichophyton rubrum CBS 118892
gb|ENH85958.1|  negative regulator of the pho system                    108   1e-23   
ref|XP_007819810.1|  Protein kinase, catalytic domain protein           108   1e-23   Metarhizium robertsii ARSEF 23
ref|XP_007812823.1|  negative regulator of the PHO system               108   1e-23   Metarhizium acridum CQMa 102
ref|XP_001363256.2|  PREDICTED: cyclin-dependent kinase 20-like i...    108   1e-23   Monodelphis domestica
gb|KFG83333.1|  negative regulator of the PHO system                    108   1e-23   Metarhizium anisopliae
gb|EKV17480.1|  hypothetical protein PDIG_14320                         108   1e-23   Penicillium digitatum PHI26
ref|XP_002627299.1|  cyclin-dependent protein kinase PhoA               107   1e-23   Blastomyces gilchristii SLH14081
ref|XP_001743107.1|  hypothetical protein                               107   1e-23   Monosiga brevicollis MX1
emb|CEG81380.1|  Putative Serine/threonine-protein kinase pef1          105   1e-23   Rhizopus microsporus
ref|XP_002563401.1|  Pc20g09050                                         108   1e-23   Penicillium rubens Wisconsin 54-1255
ref|XP_651330.1|  protein kinase domain containing protein              108   1e-23   Entamoeba histolytica HM-1:IMSS
ref|XP_002841818.1|  hypothetical protein                               108   1e-23   Tuber melanosporum Mel28
gb|EFQ33264.1|  hypothetical protein GLRG_08408                         107   1e-23   Colletotrichum graminicola M1.001
gb|EMF09982.1|  Pkinase-domain-containing protein                       108   1e-23   Sphaerulina musiva SO2202
gb|KGO45850.1|  hypothetical protein PEXP_019740                        108   1e-23   Penicillium expansum
ref|XP_007245900.1|  PREDICTED: cyclin-dependent kinase 20-like i...    107   1e-23   
ref|XP_007792384.1|  putative negative regulator of the pho syste...    107   1e-23   
gb|KDN71314.1|  hypothetical protein CSUB01_10379                       107   1e-23   Colletotrichum sublineola
emb|CCF40108.1|  PHO system negative regulator                          107   1e-23   Colletotrichum higginsianum
gb|EPB81866.1|  CMGC/CDK/CDK5 protein kinase                            107   1e-23   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007283580.1|  negative regulator of the pho system               107   1e-23   
ref|XP_005112397.1|  PREDICTED: cyclin-dependent kinase 20-like         107   1e-23   Aplysia californica
ref|XP_462466.2|  DEHA2G21230p                                          107   1e-23   Debaryomyces hansenii CBS767
ref|XP_008856746.1|  protein kinase domain containing protein           108   1e-23   Entamoeba nuttalli P19
gb|EXK94780.1|  CMGC/CDK/CDK5 protein kinase                            107   1e-23   Fusarium oxysporum f. sp. raphani 54005
ref|XP_003049020.1|  predicted protein                                  107   1e-23   [Nectria] haematococca mpVI 77-13-4
gb|KFY85419.1|  hypothetical protein V500_08420                         107   1e-23   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|EWG46831.1|  CMGC/CDK/CDK5 protein kinase                            107   1e-23   Fusarium verticillioides 7600
gb|EGU73421.1|  hypothetical protein FOXB_16059                         107   1e-23   Fusarium oxysporum Fo5176
gb|KGO67699.1|  hypothetical protein PITC_064620                        108   1e-23   Penicillium italicum
gb|KFY07671.1|  hypothetical protein V492_06919                         107   2e-23   Pseudogymnoascus sp. VKM F-4246
gb|KDE07438.1|  CMGC/CDK/CDK7 protein kinase                            108   2e-23   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_008718374.1|  serine/threonine-protein kinase pef1               108   2e-23   Cyphellophora europaea CBS 101466
gb|KKA21120.1|  Non-specific serine/threonine protein kinase            108   2e-23   Rasamsonia emersonii CBS 393.64
gb|KJA28124.1|  hypothetical protein HYPSUDRAFT_62514                   107   2e-23   Hypholoma sublateritium FD-334 SS-4
gb|KFX94261.1|  hypothetical protein V490_04425                         107   2e-23   Pseudogymnoascus sp. VKM F-3557
gb|EIE81290.1|  serine/threonine-protein kinase pef1                    107   2e-23   Rhizopus delemar RA 99-880
ref|XP_007842942.1|  cmgc cdk cdk7 protein kinase                       107   2e-23   
ref|NP_001089767.1|  uncharacterized protein LOC734831                  107   2e-23   Xenopus laevis [clawed frog]
ref|XP_002119796.1|  PREDICTED: cyclin-dependent kinase 20-like         107   2e-23   Ciona intestinalis [sea vase]
ref|XP_001229713.1|  hypothetical protein CHGG_03197                    107   2e-23   Chaetomium globosum CBS 148.51
ref|XP_006675915.1|  hypothetical protein BATDEDRAFT_85661              107   2e-23   Batrachochytrium dendrobatidis JAM81
ref|XP_007006369.1|  hypothetical protein TREMEDRAFT_33381              107   2e-23   
emb|CDW52238.1|  cyclin dependent kinase 16                             107   2e-23   
ref|XP_001831450.1|  CMGC/CDK/CDK7 protein kinase                       107   2e-23   
gb|KFY72433.1|  hypothetical protein V499_07440                         108   2e-23   
ref|XP_003006228.1|  serine/threonine-protein kinase crk1               107   2e-23   
ref|XP_005813849.1|  PREDICTED: cyclin-dependent kinase 20-like i...    107   2e-23   
gb|EMP26343.1|  Cyclin-dependent kinase 20                              107   2e-23   
gb|KEZ42948.1|  Negative regulator of the PHO system                    107   2e-23   
emb|CDO73257.1|  hypothetical protein BN946_scf185008.g19               107   2e-23   
ref|XP_010899289.1|  PREDICTED: cyclin-dependent kinase 20              107   3e-23   
ref|XP_002469215.1|  predicted protein                                  103   3e-23   
gb|KFY58031.1|  hypothetical protein V496_06262                         107   3e-23   
ref|XP_568694.1|  cyclin-dependent protein kinase                       107   3e-23   
gb|KIJ62016.1|  hypothetical protein HYDPIDRAFT_176767                  107   3e-23   
ref|XP_009548747.1|  hypothetical protein HETIRDRAFT_36188              107   3e-23   
gb|ACO13953.1|  Cell cycle-related kinase                               107   3e-23   
gb|EQK98012.1|  negative regulator of the PHO system                    107   3e-23   
gb|ELR05961.1|  CMGC/CDK/CDK5 protein kinase                            106   3e-23   
dbj|GAK68166.1|  CMGC/CDK/CDK7 protein kinase                           107   3e-23   
dbj|GAD96006.1|  serine/threonine-protein kinase KIN28                  107   3e-23   
ref|XP_568695.1|  cyclin-dependent protein kinase                       107   3e-23   
ref|XP_006969719.1|  predicted protein                                  106   3e-23   
ref|XP_007681560.1|  hypothetical protein BAUCODRAFT_313765             107   3e-23   
ref|XP_012053336.1|  CMGC/CDK/CDK7 protein kinase                       107   3e-23   
gb|KIK08944.1|  hypothetical protein K443DRAFT_671994                   107   3e-23   
ref|XP_001440015.1|  hypothetical protein                               106   3e-23   
gb|EHK51046.1|  hypothetical protein TRIATDRAFT_158499                  106   3e-23   
gb|EZF13184.1|  CMGC/CDK/CDK7 protein kinase                            106   3e-23   
gb|KIR27409.1|  CMGC/CDK/CDK7 protein kinase                            107   3e-23   
ref|XP_003663218.1|  hypothetical protein MYCTH_2304857                 106   3e-23   
gb|KGB79177.1|  CMGC/CDK/CDK7 protein kinase                            106   4e-23   
ref|XP_002796970.1|  serine/threonine-protein kinase crk1               107   4e-23   
ref|XP_958274.1|  cyclin-dependent protein kinase                       106   4e-23   
ref|XP_005813847.1|  PREDICTED: cyclin-dependent kinase 20-like i...    106   4e-23   
gb|EGC45750.1|  cyclin-dependent protein kinase                         106   4e-23   
ref|XP_001021911.1|  Ribosomal protein L13 containing protein           109   4e-23   
ref|XP_008400521.1|  PREDICTED: cyclin-dependent kinase 20 isofor...    106   4e-23   
ref|XP_003655184.1|  hypothetical protein THITE_2096446                 109   4e-23   
emb|CDK26684.1|  unnamed protein product                                106   4e-23   
ref|XP_008400520.1|  PREDICTED: cyclin-dependent kinase 20 isofor...    106   4e-23   
gb|EEH37908.2|  serine/threonine-protein kinase crk1                    107   4e-23   
ref|XP_011383763.1|  PREDICTED: cyclin-dependent kinase 7               106   5e-23   
gb|KII87180.1|  hypothetical protein PLICRDRAFT_112805                  106   5e-23   
emb|CBI28045.3|  unnamed protein product                                106   5e-23   
gb|KIK23616.1|  hypothetical protein PISMIDRAFT_450005                  106   5e-23   
gb|EPB82278.1|  CMGC/CDK/CDK5 protein kinase                            105   5e-23   
ref|XP_006693062.1|  hypothetical protein CTHT_0026030                  106   5e-23   
ref|XP_007378388.1|  Pkinase-domain-containing protein                  106   5e-23   
ref|XP_001446038.1|  hypothetical protein                               106   5e-23   
gb|KDR80596.1|  hypothetical protein GALMADRAFT_240926                  106   5e-23   
gb|EHK21016.1|  hypothetical protein TRIVIDRAFT_78176                   105   5e-23   
gb|KIV90224.1|  serine/threonine-protein kinase pef1                    106   5e-23   
ref|XP_007363029.1|  CMGC/CDK/CDK7 protein kinase                       106   5e-23   
dbj|GAA96702.1|  hypothetical protein E5Q_03373                         105   5e-23   
ref|XP_004204296.1|  Piso0_000133                                       106   5e-23   
gb|KIW24441.1|  serine/threonine-protein kinase pef1                    106   5e-23   
ref|XP_001428041.1|  hypothetical protein                               106   5e-23   
gb|AHC00607.1|  mitogen-activated protein kinase                        106   6e-23   
gb|KGB38393.1|  Cyclin-dependent kinase 20                              106   6e-23   
gb|EEH19085.1|  CMGC/CDK/CDK7 protein kinase                            106   6e-23   
ref|XP_001261293.1|  serine/threonine protein kinase (Kin28), put...    106   6e-23   
ref|XP_004204852.1|  Piso0_000133                                       105   6e-23   
ref|XP_010759679.1|  CMGC/CDK/CDK7 protein kinase                       106   6e-23   
emb|CCG80955.1|  Serine/threonine-protein kinase crk1                   105   6e-23   
gb|KHJ42311.1|  hypothetical protein D918_07650                         105   6e-23   
emb|CEG67305.1|  Putative CMGC/CDK/CDK5 protein kinase                  105   6e-23   
gb|AAU87546.1|  cdc2 protein kinase                                     105   6e-23   
ref|XP_008400518.1|  PREDICTED: cyclin-dependent kinase 20 isofor...    106   7e-23   
ref|XP_749136.1|  serine/threonine protein kinase (Kin28)               106   7e-23   
gb|ELU06525.1|  hypothetical protein CAPTEDRAFT_148267                  105   7e-23   
ref|XP_008173962.1|  PREDICTED: cyclin-dependent kinase 20              105   7e-23   
gb|EPE10305.1|  protein tyrosine kinase                                 105   7e-23   
gb|KIO07859.1|  hypothetical protein M404DRAFT_998012                   105   7e-23   
dbj|GAC95988.1|  hypothetical protein PHSY_003566                       105   8e-23   
ref|XP_002506580.1|  predicted protein                                  105   8e-23   
ref|XP_502400.1|  YALI0D04334p                                          105   9e-23   
gb|KIW73430.1|  serine/threonine-protein kinase pef1                    105   9e-23   
ref|XP_006461957.1|  hypothetical protein AGABI2DRAFT_223023            105   9e-23   
gb|KFH63709.1|  CMGC/CDK/CDK5 protein kinase                            105   9e-23   
gb|EEH10784.1|  cyclin-dependent protein kinase PhoA                    105   9e-23   
ref|XP_008722174.1|  serine/threonine-protein kinase pef1               105   1e-22   
gb|ELT98514.1|  hypothetical protein CAPTEDRAFT_160136                  105   1e-22   
ref|XP_001555725.1|  hypothetical protein BC1G_05099                    105   1e-22   
gb|AAD39491.1|AF145051_1  cyclin-dependent protein kinase               105   1e-22   
gb|KHJ35799.1|  putative negative regulator of the pho system           105   1e-22   
gb|KJJ11875.1|  Kinesin motor region                                    108   1e-22   
gb|EPQ65594.1|  Cyclin-dependent kinase                                 105   1e-22   
ref|XP_006454569.1|  hypothetical protein AGABI2DRAFT_189819            105   1e-22   
gb|KIY73317.1|  CMGC/CDK/CDK7 protein kinase                            105   1e-22   
ref|XP_001273212.1|  serine/threonine protein kinase (Kin28), put...    105   1e-22   
gb|AAD29956.1|AF116453_1  cyclin-dependent protein kinase PHOSs         105   1e-22   
gb|EEH02639.1|  serine/threonine-protein kinase crk1                    105   1e-22   
ref|XP_002842403.1|  hypothetical protein                               105   1e-22   
ref|XP_001874615.1|  predicted protein                                  105   1e-22   
ref|XP_007069864.1|  PREDICTED: cyclin-dependent kinase 20-like         106   1e-22   
ref|XP_005823668.1|  hypothetical protein GUITHDRAFT_89936              104   1e-22   
ref|XP_007507747.1|  PREDICTED: cyclin-dependent kinase 20-like i...    105   1e-22   
gb|ETS65298.1|  hypothetical protein PaG_00022                          105   1e-22   
gb|EGC42567.1|  serine/threonine protein kinase crk1                    105   1e-22   
ref|XP_003068144.1|  serine/threonine protein kinase crk1, putative     105   1e-22   
ref|XP_004666279.1|  PREDICTED: cyclin-dependent kinase 20-like         105   1e-22   
gb|KDQ27010.1|  hypothetical protein PLEOSDRAFT_1093880                 105   1e-22   
ref|XP_003795072.1|  PREDICTED: cyclin-dependent kinase 20-like i...    105   1e-22   
gb|EAS28721.3|  CMGC/CDK/CDK7 protein kinase                            105   1e-22   
ref|XP_007401134.1|  hypothetical protein PHACADRAFT_153133             105   1e-22   
ref|XP_007770905.1|  Pkinase-domain-containing protein                  105   1e-22   
ref|XP_006671003.1|  negative regulator of the PHO system               104   1e-22   
gb|KFD65806.1|  hypothetical protein M514_04710                         107   1e-22   
emb|CCE32282.1|  probable PHO85-cyclin-dependent protein kinase         105   1e-22   
ref|XP_007343825.1|  Pkinase-domain-containing protein                  105   1e-22   
gb|KKA30353.1|  hypothetical protein TD95_001042                        105   1e-22   
ref|XP_001593129.1|  serine/threonine-protein kinase                    105   1e-22   
gb|EPS31308.1|  hypothetical protein PDE_06263                          105   1e-22   
ref|XP_010751924.1|  PREDICTED: cyclin-dependent kinase 20              104   1e-22   
gb|KIW08686.1|  serine/threonine-protein kinase pef1                    104   1e-22   
emb|CBQ69313.1|  probable KIN28-cyclin-dependent ser/thr protein ...    105   2e-22   
ref|XP_008601664.1|  Protein tyrosine kinase                            104   2e-22   
gb|EME39344.1|  hypothetical protein DOTSEDRAFT_179851                  105   2e-22   
gb|KIM95126.1|  hypothetical protein OIDMADRAFT_106654                  104   2e-22   
ref|XP_009217952.1|  CMGC/CDK/CDK5 protein kinase                       104   2e-22   
ref|XP_003795071.1|  PREDICTED: cyclin-dependent kinase 20-like i...    104   2e-22   
gb|KIX92590.1|  serine/threonine-protein kinase pef1                    105   2e-22   
gb|KFY25184.1|  hypothetical protein V493_04765                         105   2e-22   
ref|XP_001224868.1|  hypothetical protein CHGG_07212                    105   2e-22   
emb|CDI55432.1|  probable KIN28-cyclin-dependent ser/thr protein ...    104   2e-22   
ref|XP_010197560.1|  PREDICTED: cyclin-dependent kinase 1 isoform X2    103   2e-22   
ref|XP_007742475.1|  CMGC/CDK/CDK5 protein kinase                       105   2e-22   
ref|XP_007752739.1|  CMGC/CDK/CDK5 protein kinase                       104   2e-22   
ref|XP_008170925.1|  PREDICTED: cyclin-dependent kinase 18              105   2e-22   
gb|KIW78456.1|  serine/threonine-protein kinase pef1                    104   2e-22   
ref|XP_007543720.1|  PREDICTED: cyclin-dependent kinase 20 isofor...    104   2e-22   
gb|ESZ95100.1|  negative regulator of the PHO system                    104   2e-22   
ref|XP_001540206.1|  serine/threonine-protein kinase crk1               104   2e-22   
gb|KIW49476.1|  serine/threonine-protein kinase pef1                    104   2e-22   
gb|KIM68121.1|  hypothetical protein SCLCIDRAFT_106387                  104   2e-22   
gb|EIF48950.1|  serine threonine-protein kinase kin28                   103   2e-22   
gb|KIK48145.1|  hypothetical protein CY34DRAFT_798526                   104   2e-22   
ref|XP_001591780.1|  negative regulator of the PHO system               104   2e-22   
ref|XP_009158650.1|  non-specific serine/threonine protein kinase       104   2e-22   
ref|XP_007719706.1|  CMGC/CDK/CDK5 protein kinase                       104   2e-22   
gb|KIH88337.1|  negative regulator of the pho system protein            105   3e-22   
ref|XP_009497155.1|  CMGC/CDK/CDK7 protein kinase                       105   3e-22   
ref|XP_001949786.2|  PREDICTED: cyclin-dependent kinase 2-like is...    103   3e-22   
gb|KIM84660.1|  hypothetical protein PILCRDRAFT_818250                  104   3e-22   
gb|KKA28359.1|  hypothetical protein TD95_000190                        104   3e-22   
ref|XP_011109279.1|  hypothetical protein H072_3299                     104   3e-22   
ref|XP_003389499.1|  PREDICTED: cyclin-dependent kinase 20-like         103   3e-22   
gb|KIW45176.1|  serine/threonine-protein kinase pef1                    104   3e-22   
emb|CEP07789.1|  hypothetical protein                                   103   3e-22   
ref|XP_002627009.1|  serine/threonine-protein kinase crk1               104   3e-22   
ref|XP_003662109.1|  hypothetical protein MYCTH_2302277                 103   3e-22   
gb|KIY67507.1|  Pkinase-domain-containing protein                       104   3e-22   
gb|KIK96940.1|  hypothetical protein PAXRUDRAFT_825422                  104   3e-22   
gb|KIK70390.1|  hypothetical protein GYMLUDRAFT_32391                   103   3e-22   
ref|XP_010197559.1|  PREDICTED: cyclin-dependent kinase 1 isoform X1    103   3e-22   
ref|XP_008188165.1|  PREDICTED: cyclin-dependent kinase 2-like is...    103   3e-22   
emb|CAN64857.1|  hypothetical protein VITISV_030492                     106   3e-22   
gb|KIJ07762.1|  hypothetical protein PAXINDRAFT_173312                  104   3e-22   
ref|XP_003348950.1|  hypothetical protein SMAC_01971                    106   3e-22   
gb|EQL38884.1|  CMGC/CDK/CDK7 protein kinase                            104   3e-22   
ref|XP_003300409.1|  hypothetical protein PTT_11653                     103   4e-22   
gb|EST09267.1|  Protein kinase                                          103   4e-22   
gb|ELQ34676.1|  negative regulator of the PHO system                    104   4e-22   
gb|KIY52951.1|  Pkinase-domain-containing protein                       103   4e-22   
ref|XP_003713655.1|  CMGC/CDK/CDK5 protein kinase                       103   4e-22   
ref|XP_007065166.1|  PREDICTED: cyclin-dependent kinase 18 isofor...    104   4e-22   
ref|XP_007912304.1|  putative serine threonine-protein kinase pro...    103   4e-22   
gb|EHA27228.1|  serine/threonine protein kinase, subunit of TFIIH...    103   4e-22   
gb|KIM33097.1|  hypothetical protein M408DRAFT_62531                    103   4e-22   
gb|KFP30649.1|  Cyclin-dependent kinase 1                               103   4e-22   
gb|EWC46175.1|  hypothetical protein DRE_04553                          104   4e-22   
ref|XP_007065164.1|  PREDICTED: cyclin-dependent kinase 18 isofor...    104   4e-22   
ref|XP_008933297.1|  PREDICTED: cyclin-dependent kinase 18              100   4e-22   
ref|XP_007730925.1|  CMGC/CDK/CDK5 protein kinase                       103   4e-22   
ref|XP_009950747.1|  PREDICTED: cyclin-dependent kinase 1 isoform X1    103   4e-22   
ref|XP_005762633.1|  cdc2-like protein serine/threonine kinase          103   4e-22   
dbj|GAM85859.1|  hypothetical protein ANO11243_038670                   103   4e-22   
ref|XP_011127954.1|  hypothetical protein AOL_s00215g450                106   4e-22   
ref|XP_004209538.1|  PREDICTED: cyclin-dependent kinase 20-like         103   4e-22   
ref|XP_007065165.1|  PREDICTED: cyclin-dependent kinase 18 isofor...    104   4e-22   
emb|CDJ85539.1|  Serine threonine protein kinase-related domain c...    103   4e-22   
emb|CAK46410.1|  unnamed protein product                                103   4e-22   
ref|XP_001729849.1|  hypothetical protein MGL_2835                      103   4e-22   
gb|KFQ12502.1|  Cyclin-dependent kinase 1                               103   4e-22   
ref|XP_007261586.1|  Pkinase-domain-containing protein                  103   4e-22   
gb|KEF59979.1|  CMGC/CDK/CDK5 protein kinase                            103   4e-22   
gb|EYC46032.1|  hypothetical protein Y032_0410g941                      105   4e-22   
ref|XP_004069584.1|  PREDICTED: cyclin-dependent kinase 17              105   4e-22   
dbj|GAM35905.1|  hypothetical protein TCE0_017f04593                    103   4e-22   
ref|XP_007580094.1|  putative cyclin-dependent protein kinase pro...    103   4e-22   
gb|EPZ35493.1|  Negative regulator of the PHO system                    103   4e-22   
ref|XP_003632535.2|  PREDICTED: probable serine/threonine-protein...    106   5e-22   
ref|XP_006681331.1|  hypothetical protein BATDEDRAFT_13581              103   5e-22   
ref|XP_002146407.1|  serine/threonine protein kinase (Kin28), put...    103   5e-22   
ref|XP_005537285.1|  CDK-activating kinase                              103   5e-22   
gb|EMP30833.1|  Cyclin-dependent kinase 18                              104   5e-22   
ref|XP_007805782.1|  Negative regulator of the PHO system               103   5e-22   
gb|KIX06030.1|  serine/threonine-protein kinase pef1                    103   5e-22   
ref|XP_006628604.1|  PREDICTED: cyclin-dependent kinase 18-like         104   5e-22   
emb|CCF50055.1|  probable KIN28-cyclin-dependent ser/thr protein ...    103   5e-22   
ref|XP_007289428.1|  negative regulator of the PHO system               103   5e-22   
gb|EMP26913.1|  Cyclin-dependent kinase 17                              103   5e-22   
ref|XP_005816536.1|  PREDICTED: cyclin-dependent kinase 18-like         104   5e-22   
gb|KII94397.1|  hypothetical protein PLICRDRAFT_695396                  103   5e-22   
ref|XP_010769863.1|  PREDICTED: cyclin-dependent kinase 18              100   5e-22   
gb|KIV80546.1|  serine/threonine-protein kinase pef1                    103   5e-22   
ref|XP_006696473.1|  hypothetical protein CTHT_0061570                  103   5e-22   
ref|XP_007663307.1|  PREDICTED: cyclin-dependent kinase 20 isofor...    102   5e-22   
dbj|GAN10649.1|  cmgc cdk cdk7 protein kinase                           103   6e-22   
emb|CEJ81352.1|  Putative Cyclin-dependent protein kinase PHOSs         103   6e-22   
ref|XP_002478697.1|  serine/threonine protein kinase (Kin28), put...    103   6e-22   
gb|KEQ92746.1|  hypothetical protein AUEXF2481DRAFT_68315               102   6e-22   
ref|XP_006139252.1|  PREDICTED: cyclin-dependent kinase 18 isofor...    104   6e-22   
ref|XP_005934561.1|  PREDICTED: cyclin-dependent kinase 18-like i...    103   6e-22   
ref|XP_005750475.1|  PREDICTED: cyclin-dependent kinase 20-like i...    102   6e-22   
ref|XP_003446010.1|  PREDICTED: cyclin-dependent kinase 20-like i...    102   6e-22   
ref|XP_008031027.1|  hypothetical protein SETTUDRAFT_98593              104   6e-22   
ref|XP_003295217.1|  hypothetical protein DICPUDRAFT_160441             102   6e-22   
gb|EKG17053.1|  hypothetical protein MPH_05743                          103   6e-22   
ref|XP_003033246.1|  hypothetical protein SCHCODRAFT_15275              103   6e-22   
gb|EMD89848.1|  hypothetical protein COCHEDRAFT_1105920                 103   6e-22   



>ref|XP_004251615.1| PREDICTED: cyclin-dependent kinase F-1 [Solanum lycopersicum]
Length=470

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 166/186 (89%), Gaps = 1/186 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD P +KSWSIHTRKEIT+KYEIF R+G+GAYSDVY+ RRRSDS+TVALKEIHDYQSA R
Sbjct  1    MDPPSTKSWSIHTRKEITVKYEIFNRIGAGAYSDVYKARRRSDSVTVALKEIHDYQSAAR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQTLQ+CPNVVV+HE+FW EDED+VLVLE+L TDL  +IK AKK W+ GL++GEIK
Sbjct  61   EIEALQTLQHCPNVVVLHEYFWREDEDAVLVLEYLHTDLDCLIKEAKK-WEKGLSLGEIK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQP  678
            RWM+QIL  VDACHRNSIVHRDLKPSNLLIS +GILKLADFGQAR+LLAPG  A D+ QP
Sbjct  120  RWMMQILCGVDACHRNSIVHRDLKPSNLLISSDGILKLADFGQARILLAPGFVANDNQQP  179

Query  679  YGKASP  696
            Y +++P
Sbjct  180  YVQSTP  185



>ref|XP_009608932.1| PREDICTED: cyclin-dependent kinase F-1 [Nicotiana tomentosiformis]
Length=473

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 178/226 (79%), Gaps = 2/226 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD P  KSWSIHTRKEIT KYEIF R+G+GAYSDVY+ RRRSDS+TVALKEIHDYQSA R
Sbjct  1    MDPPHEKSWSIHTRKEITTKYEIFNRIGAGAYSDVYKARRRSDSVTVALKEIHDYQSACR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ LQ+CPNVVV++E+FW EDED+VLVLE+LPTDL ++IK A KNW+NGL +GEIK
Sbjct  61   EIEALQILQHCPNVVVLYEYFWREDEDAVLVLEYLPTDLSSLIKEA-KNWENGLGLGEIK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-Q  675
            +WMVQIL  VDACHRNSIVHRDLKP NLLISDNG+LKLADFGQAR+LL PG  A +D  Q
Sbjct  120  KWMVQILCGVDACHRNSIVHRDLKPENLLISDNGVLKLADFGQARILLVPGFVAANDNQQ  179

Query  676  PYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRFAD  813
            PY +++P+  T      F  + + +   G     Q ++ + +R  +
Sbjct  180  PYVQSNPDQATVAGPSHFKHISDVSSEGGLFIEEQASLVQPERLGE  225



>ref|XP_006353467.1| PREDICTED: cyclin-dependent kinase F-1-like [Solanum tuberosum]
Length=470

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 165/186 (89%), Gaps = 1/186 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD P +KSWSIHTRKEIT+KYEIF R+G+GAYSDVY+ RRRSDS+TVALKEIHDYQSA R
Sbjct  1    MDPPSTKSWSIHTRKEITVKYEIFNRIGAGAYSDVYKARRRSDSVTVALKEIHDYQSAAR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQTLQ+CPNVVV+HE+FW EDED+VLVLE+L TDL  +IK AKK W+ GL++GEIK
Sbjct  61   EIEALQTLQHCPNVVVLHEYFWREDEDAVLVLEYLHTDLDCLIKEAKK-WEKGLSLGEIK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQP  678
            RWM+QILS VDACHRNSIVHRDLKPSNLLIS +GILKLADFGQAR+LLAPG  A D+  P
Sbjct  120  RWMMQILSGVDACHRNSIVHRDLKPSNLLISSDGILKLADFGQARILLAPGFVANDNQPP  179

Query  679  YGKASP  696
            Y + +P
Sbjct  180  YVQTTP  185



>ref|XP_009803573.1| PREDICTED: cyclin-dependent kinase F-1 [Nicotiana sylvestris]
Length=473

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD P  KSWSIHTRKEIT KYEIF R+G+GAYSDVY+ RRRSDS+ VALKEIHDYQSA R
Sbjct  1    MDPPHEKSWSIHTRKEITTKYEIFNRIGAGAYSDVYKARRRSDSVIVALKEIHDYQSACR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ LQ+CPNVVV++E+FW EDED+VLVLE+LPTDL ++IK A KNW+NGL +GEIK
Sbjct  61   EIEALQILQHCPNVVVLYEYFWREDEDAVLVLEYLPTDLSSLIKEA-KNWENGLGLGEIK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-Q  675
            +WMVQIL  VDACHRNSIVHRDLKP NLLISDNG+LKLADFGQAR+LLAPG  A +D  Q
Sbjct  120  KWMVQILCGVDACHRNSIVHRDLKPENLLISDNGVLKLADFGQARILLAPGFVAANDNQQ  179

Query  676  PYGKASPNVPT  708
            PY +++P+  T
Sbjct  180  PYVQSNPDQAT  190



>emb|CDP03307.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 172/212 (81%), Gaps = 3/212 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD PPSKSWSIHTR+EI  KY+I + VGSGAYSDVYR RR SD+LTVALKE+HDYQSA R
Sbjct  1    MDLPPSKSWSIHTRREIISKYQILDHVGSGAYSDVYRARRLSDNLTVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKN-W-DNGLTVGE  492
            EIEALQTLQNCPNVVV+HE+FW+EDED+VLVLE+LPTDL  VI+ AK+  W D GL  GE
Sbjct  61   EIEALQTLQNCPNVVVLHEYFWAEDEDAVLVLEYLPTDLSDVIREAKRGEWKDQGLRTGE  120

Query  493  IKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAV-DD  669
            IKRWMVQIL  VDACHRNSIVHRDLKP+NLLIS +G+LKLADFGQAR+LLAPG  A+ ++
Sbjct  121  IKRWMVQILCGVDACHRNSIVHRDLKPTNLLISADGVLKLADFGQARILLAPGYFAIGEN  180

Query  670  GQPYGKASPNVPTPMYTPEFVPVMENAYREGQ  765
             Q + + SPN       PE  P  ++A  EGQ
Sbjct  181  SQSHEQRSPNDAIVANPPETNPSTDSADDEGQ  212



>ref|XP_002284217.1| PREDICTED: cyclin-dependent kinase F-1 [Vitis vinifera]
Length=471

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 176/221 (80%), Gaps = 3/221 (1%)
 Frame = +1

Query  151  PSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEA  330
            PS+SWSIHTR EI  KYEI ERVG+GAYSDVY+GRR SD L VALKEIHDYQSA REIEA
Sbjct  4    PSRSWSIHTRPEIIQKYEILERVGAGAYSDVYKGRRLSDDLIVALKEIHDYQSAFREIEA  63

Query  331  LQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMV  510
            LQ LQ+ PNVVV+HE+FWSEDED+VLVLEFL TDL ++IK AK+NW++G++ GEIKRWMV
Sbjct  64   LQVLQSSPNVVVLHEYFWSEDEDAVLVLEFLRTDLASLIKDAKRNWEDGISGGEIKRWMV  123

Query  511  QILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKA  690
            QIL AVDACHRNSIVHRDLKPSNLLIS+ G+LKLADFGQAR+L+ PG    D+   +   
Sbjct  124  QILHAVDACHRNSIVHRDLKPSNLLISETGVLKLADFGQARILIEPGF---DNPHLHEPH  180

Query  691  SPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRFAD  813
             PN  T +   E +P  +N+++EG  +  +  ++KE+  +D
Sbjct  181  DPNQVTIIQHAEVIPEADNSHQEGSGNQERGTMSKEEYASD  221



>ref|XP_002325003.2| CDK-activating kinase 1at family protein [Populus trichocarpa]
 gb|EEF03568.2| CDK-activating kinase 1at family protein [Populus trichocarpa]
Length=478

 Score =   294 bits (753),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 178/228 (78%), Gaps = 14/228 (6%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP+KSWSIHTR EI  KYEI ER+GSGAYSDVY+ RR SD+LTVALKEIHDYQSA REIE
Sbjct  6    PPAKSWSIHTRPEIISKYEIQERIGSGAYSDVYKARRHSDNLTVALKEIHDYQSASREIE  65

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDN-GLTVGEIKRW  504
            ALQ LQNCPNVVV+HE+FW EDED+VLVLEFL TDL AVIK  +K  D  G++VGE+KRW
Sbjct  66   ALQVLQNCPNVVVLHEYFWREDEDAVLVLEFLRTDLAAVIKQGEKRDDGVGVSVGEVKRW  125

Query  505  MVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-QPY  681
            MVQIL  VDACHRN IVHRDLKPSNLL+SD+G+LKLADFGQAR+L+ PG  A D+  QPY
Sbjct  126  MVQILCGVDACHRNMIVHRDLKPSNLLVSDDGVLKLADFGQARILMEPGFVAADENIQPY  185

Query  682  GKASPNVPTPMY----TP--EFVPVMENAYREGQSHHYQRNVAKEDRF  807
             +       P++    TP  E VP ++++ +EG  +  Q  +++E+ F
Sbjct  186  EQ------NPLFQEHATPPAEVVPEIDSSSQEGHRNEKQGTISREESF  227



>ref|XP_011048376.1| PREDICTED: cyclin-dependent kinase F-1 [Populus euphratica]
 ref|XP_011048380.1| PREDICTED: cyclin-dependent kinase F-1-like [Populus euphratica]
Length=478

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 178/228 (78%), Gaps = 14/228 (6%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP+KSWSIHTR EI  KYEI ER+GSGAYSDVY+ RR SD+LTVALKEIHDYQSA REIE
Sbjct  6    PPAKSWSIHTRPEIISKYEIQERIGSGAYSDVYKARRHSDNLTVALKEIHDYQSASREIE  65

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDN-GLTVGEIKRW  504
            ALQ LQNCPNVVV+HE+FW EDED+VLVLEFL TD+ AVIK  +K  D  G++VGE+KRW
Sbjct  66   ALQVLQNCPNVVVLHEYFWREDEDAVLVLEFLRTDMAAVIKQGEKRDDGVGISVGEVKRW  125

Query  505  MVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-QPY  681
            MVQIL  VDACHRN IVHRDLKPSNLL+SD+G+LKLADFGQAR+L+ PG  A D+  QPY
Sbjct  126  MVQILCGVDACHRNMIVHRDLKPSNLLVSDDGVLKLADFGQARILMEPGFVAADENIQPY  185

Query  682  GKASPNVPTPMY----TP--EFVPVMENAYREGQSHHYQRNVAKEDRF  807
             +       P++    TP  E VP ++++ +EG  +  Q  +++E+ F
Sbjct  186  EQ------NPLFHEHATPPAEVVPEIDSSSQEGHRNEKQGMISREESF  227



>ref|XP_010249662.1| PREDICTED: cyclin-dependent kinase F-1-like [Nelumbo nucifera]
 ref|XP_010249663.1| PREDICTED: cyclin-dependent kinase F-1-like [Nelumbo nucifera]
Length=470

 Score =   288 bits (738),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PPSKSWSI +R EIT +Y+I E+VGSG YSDVY+  R SD LTVALKE+HDYQSA REIE
Sbjct  3    PPSKSWSIFSRTEITQRYKILEQVGSGTYSDVYKAVRLSDGLTVALKEVHDYQSAFREIE  62

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            ALQ LQ+ PN++ +HE+FW EDED+VLVLEFL TDL +VIK AK+NWDNG++VGEIKRWM
Sbjct  63   ALQILQSSPNIIALHEYFWREDEDAVLVLEFLTTDLASVIKEAKRNWDNGISVGEIKRWM  122

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGK  687
            +QIL  VDACHRNSIVHRDLKP+NLLIS +G+LKLADFGQAR+LL PG  A D       
Sbjct  123  IQILHGVDACHRNSIVHRDLKPANLLISSDGVLKLADFGQARILLEPGFVAEDTNLHEQN  182

Query  688  ASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKE  798
             S    TP   PE +P  +N+  E   +  Q   +KE
Sbjct  183  ISNQTWTPQ-QPETIPQTDNSCLEYSHNQVQATASKE  218



>ref|XP_004299987.1| PREDICTED: cyclin-dependent kinase F-1 [Fragaria vesca subsp. 
vesca]
Length=457

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MDSPP+KSWSIHTR EI  KY+I ERVGSGAYSDVYR RR SD LTVALKE+HDYQSA R
Sbjct  1    MDSPPAKSWSIHTRPEIIAKYQILERVGSGAYSDVYRARRLSDDLTVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQTLQ CPNVVV+HE+FW EDED+VLVLEFL +DL  VI+AAKKN   G+  GE+K
Sbjct  61   EIEALQTLQACPNVVVLHEYFWREDEDAVLVLEFLASDLETVIRAAKKNGAAGIRCGEVK  120

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQP  678
            RWM+Q+LS +DACHRN IVHRDLKPSNLLI ++G+LKLADFGQAR+LL PG A  +  + 
Sbjct  121  RWMLQMLSGIDACHRNMIVHRDLKPSNLLIGEDGVLKLADFGQARILLEPGYAPDEAYEQ  180

Query  679  YGKASPNVPTP  711
              ++  NV  P
Sbjct  181  SARSQANVVQP  191



>emb|CAN73707.1| hypothetical protein VITISV_023714 [Vitis vinifera]
Length=435

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 175/232 (75%), Gaps = 14/232 (6%)
 Frame = +1

Query  151  PSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEA  330
            PS+SWSIHTR EI  KYEI ERVG+GAYSDVY+GRR SD L VALKEIHDYQSA REIEA
Sbjct  4    PSRSWSIHTRPEIIQKYEILERVGAGAYSDVYKGRRLSDDLIVALKEIHDYQSAFREIEA  63

Query  331  LQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMV  510
            LQ LQ+ PNVVV+HE+FWSEDED+VLVLEFL TDL ++IK AK+NW++G++ GEIKRWMV
Sbjct  64   LQVLQSSPNVVVLHEYFWSEDEDAVLVLEFLRTDLASLIKDAKRNWEDGISGGEIKRWMV  123

Query  511  QILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFG-----------QARMLLAPGLA  657
            QIL AVDACHRNSIVHRDLKPSNLLIS+ G+LKLADFG           QAR+L+ PG  
Sbjct  124  QILHAVDACHRNSIVHRDLKPSNLLISETGVLKLADFGQVKVFNLAVDFQARILIEPGF-  182

Query  658  AVDDGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRFAD  813
              D+   +    PN  T +   E +P  +N+++EG  +     ++KE+  +D
Sbjct  183  --DNPHLHEPHDPNQVTIIQHAEVIPEADNSHQEGSGNQEXGTMSKEEYASD  232



>ref|XP_012076728.1| PREDICTED: cyclin-dependent kinase F-1 isoform X1 [Jatropha curcas]
 ref|XP_012076729.1| PREDICTED: cyclin-dependent kinase F-1 isoform X2 [Jatropha curcas]
 gb|KDP33697.1| hypothetical protein JCGZ_07268 [Jatropha curcas]
Length=483

 Score =   286 bits (732),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 163/210 (78%), Gaps = 4/210 (2%)
 Frame = +1

Query  154  SKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEAL  333
            SKSWSIHTR EI  KYEI+ERVGSGAYSDVY+ RR SD+  VALKEIHDYQSA REIEAL
Sbjct  11   SKSWSIHTRPEIIAKYEIYERVGSGAYSDVYKARRLSDNTIVALKEIHDYQSAFREIEAL  70

Query  334  QTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
            Q LQNCPNVV+MHE+FW EDED+VLVLEFL TDL AVIK  KK   NG++VGE+KRWMVQ
Sbjct  71   QMLQNCPNVVIMHEYFWREDEDAVLVLEFLRTDLAAVIKEGKK---NGISVGEVKRWMVQ  127

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVD-DGQPYGKA  690
            IL  VDACHRN IVHRDLKP NLLIS++GILKLADFGQARML+ P   A D + QPY + 
Sbjct  128  ILCGVDACHRNMIVHRDLKPGNLLISEDGILKLADFGQARMLIEPAFVATDGNPQPYDQN  187

Query  691  SPNVPTPMYTPEFVPVMENAYREGQSHHYQ  780
              +    +   E VP ++N  +E Q +  Q
Sbjct  188  PVDQEQVVPPAEIVPDVDNLSQEAQGNQEQ  217



>ref|XP_009336876.1| PREDICTED: cyclin-dependent kinase F-1-like [Pyrus x bretschneideri]
Length=464

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 171/223 (77%), Gaps = 2/223 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MDSPP+KSWSIH+R EI  KY+I ERVGSGAYSDVYR  R SD+LTVALKE+HDYQSA R
Sbjct  1    MDSPPAKSWSIHSRPEIIAKYKILERVGSGAYSDVYRAIRLSDNLTVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ L +CPNV+V++E+FW EDED+VLVLEFL TDL  VIK+AKK  + G+  GE+K
Sbjct  61   EIEALQALHSCPNVIVLYEYFWREDEDAVLVLEFLTTDLATVIKSAKKR-EGGIGSGEVK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQP  678
            RWM+QILS VD+CH N +VHRDLKP NLLI D+G+LKLADFGQAR+LL PG    ++  P
Sbjct  120  RWMLQILSGVDSCHGNMVVHRDLKPCNLLIGDDGVLKLADFGQARILLEPGYVPDENPHP  179

Query  679  YGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
            Y +++P+  +    PE +P  + +  EG     Q  ++KE+ F
Sbjct  180  YERSAPS-QSAFQPPEVIPEKDESCEEGYRAQEQGTMSKEEYF  221



>ref|XP_007013117.1| CDK-activating kinase 1AT [Theobroma cacao]
 gb|EOY30736.1| CDK-activating kinase 1AT [Theobroma cacao]
Length=475

 Score =   284 bits (726),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 174/227 (77%), Gaps = 8/227 (4%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+ PP KSWSIHTR EI  KYEI ERVGSGAYSDVYR RR SD+L VALKE+HDYQSA R
Sbjct  1    MERPPPKSWSIHTRPEIVAKYEIMERVGSGAYSDVYRARRLSDNLIVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ LQNCPN+VV+HE+FW EDED+VLVLEFL TDL AVI+ AK+  + G+ +GE+K
Sbjct  61   EIEALQMLQNCPNIVVLHEYFWREDEDAVLVLEFLRTDLAAVIREAKRK-EGGVRLGEVK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-Q  675
            RWM+QIL  VDACHRN IVHRDLKP NLL+SD+G+LKLADFGQARML+ P   A +D  Q
Sbjct  120  RWMLQILCGVDACHRNMIVHRDLKPGNLLVSDDGVLKLADFGQARMLMEPRFVADNDNQQ  179

Query  676  PYGKAS---PNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
            PY + +    N+  P+   + VP  ++    G ++  + ++++E+ F
Sbjct  180  PYEQNTGYHENISPPL---DAVPGTDSLQNPGYNNQVEEDMSREEYF  223



>ref|XP_011093610.1| PREDICTED: cyclin-dependent kinase F-1 [Sesamum indicum]
Length=473

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 151/173 (87%), Gaps = 3/173 (2%)
 Frame = +1

Query  169  IHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQTLQN  348
            I+TR+EIT KYEI ERVGSGAYSDVYR RRRSDSLTVALKE+HDYQSA REIEALQTLQN
Sbjct  15   IYTRREITSKYEILERVGSGAYSDVYRARRRSDSLTVALKEVHDYQSAFREIEALQTLQN  74

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAV  528
            CPN++V+HE+FW EDED+VLVLE+LPTDL AVIKAAKK W+ G+++GE+KRWMVQIL  +
Sbjct  75   CPNIIVLHEYFWREDEDAVLVLEYLPTDLAAVIKAAKKEWEGGISLGEVKRWMVQILRGL  134

Query  529  DACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGK  687
            D CHRNSIVHRDLKPSNLLIS  G+LK+ADFGQAR+LLAP      DG  Y +
Sbjct  135  DVCHRNSIVHRDLKPSNLLISAEGLLKIADFGQARILLAPVFV---DGDAYNQ  184



>ref|XP_009352498.1| PREDICTED: cyclin-dependent kinase F-1-like [Pyrus x bretschneideri]
Length=465

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 171/224 (76%), Gaps = 3/224 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MDSPP+KSWSIH+R EI  KY+I ERVGSGAYSDVYR  R SD+LTVALKE+HDYQSA R
Sbjct  1    MDSPPAKSWSIHSRPEIIAKYKILERVGSGAYSDVYRAIRLSDNLTVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ L +C NV++++E+FW EDED+VLVLEFL TDL  VI++AKK  + G+  GE+K
Sbjct  61   EIEALQALHSCANVIILYEYFWREDEDAVLVLEFLTTDLATVIRSAKKR-EGGIECGEVK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-Q  675
            RWM+QILS VDACHRN +VHRDLKP NLLI ++G+LKLADFGQAR+LL PG    D+  Q
Sbjct  120  RWMLQILSGVDACHRNMVVHRDLKPCNLLIGEDGVLKLADFGQARILLEPGYVPDDENPQ  179

Query  676  PYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             + +++P+  T    PE +P  E +  EG     Q  ++KE+ F
Sbjct  180  LFERSAPSQST-FQPPEVIPETEESCEEGYRAQEQGTMSKEEYF  222



>ref|XP_008242579.1| PREDICTED: cyclin-dependent kinase F-1 [Prunus mume]
Length=453

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MDSPP+KSWSIH+R EI  KY+I ERVGSGAYSDVYR  R SD LTVALKE+HDYQS  R
Sbjct  1    MDSPPAKSWSIHSRPEIIAKYKILERVGSGAYSDVYRAIRLSDKLTVALKEVHDYQSGFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ L +CPNVVV+HE+FW EDED+VLVLEFL TDL  VI++AKK  + G+  GE+K
Sbjct  61   EIEALQALHSCPNVVVLHEYFWREDEDAVLVLEFLTTDLATVIRSAKKR-EGGIGRGEVK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-Q  675
            RWM+QILS VDACHRN +VHRDLKPSNLLI DNG+LKLADFGQAR+LL PG    D+  +
Sbjct  120  RWMLQILSGVDACHRNMVVHRDLKPSNLLIGDNGMLKLADFGQARILLEPGYVPDDENPE  179

Query  676  PYGKASPN  699
            PY +++P+
Sbjct  180  PYAQSTPS  187



>ref|XP_008362935.1| PREDICTED: cyclin-dependent kinase F-1-like [Malus domestica]
Length=464

 Score =   281 bits (719),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 170/223 (76%), Gaps = 2/223 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MDSPP+KSWSIH+R EI  KY+I ERVGSGAYSDVYR  R SD+LTVALKE+HDYQSA R
Sbjct  1    MDSPPAKSWSIHSRPEIIAKYKILERVGSGAYSDVYRAIRLSDNLTVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ L +CPNV+V++E+FW EDED+VLVLEFL TDL  VIK+AKK  + G+  GE+K
Sbjct  61   EIEALQALHSCPNVIVLYEYFWREDEDAVLVLEFLTTDLATVIKSAKKR-EGGIGSGEVK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQP  678
            RWM+QILS VD+CHRN +VHRDLKP NLLI D+G+LKLADFGQAR+LL  G    ++   
Sbjct  120  RWMLQILSGVDSCHRNMVVHRDLKPCNLLIGDDGVLKLADFGQARILLEAGYVPDENPXL  179

Query  679  YGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
            Y +++P+  +    PE +P  + +  EG     Q  ++KE+ F
Sbjct  180  YERSAPS-QSAFQPPEXIPEXDESXEEGYRAQEQGTMSKEEYF  221



>ref|XP_007204340.1| hypothetical protein PRUPE_ppa005578mg [Prunus persica]
 gb|EMJ05539.1| hypothetical protein PRUPE_ppa005578mg [Prunus persica]
Length=453

 Score =   281 bits (718),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MDSPP+KSWSIH+R EI  KY+I ERVGSGAYSDVYR  R  D+LTVALKE+HDYQSA R
Sbjct  1    MDSPPAKSWSIHSRPEIITKYKILERVGSGAYSDVYRAIRFYDNLTVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ L +CPNVVV+HE+FW EDED+VLVLEFL TDL  VI++AKK  + G+  GE+K
Sbjct  61   EIEALQALHSCPNVVVLHEYFWREDEDAVLVLEFLTTDLATVIRSAKKR-EGGIGRGEVK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-Q  675
            RWM+QILS VDACHRN +VHRDLKPSNLLI DNG+LKLADFGQAR+LL PG    D+  +
Sbjct  120  RWMLQILSGVDACHRNMVVHRDLKPSNLLIGDNGVLKLADFGQARILLEPGYVPDDENPE  179

Query  676  PYGKASPN  699
            PY +++P 
Sbjct  180  PYAQSTPG  187



>gb|KDO42248.1| hypothetical protein CISIN_1g020467mg [Citrus sinensis]
Length=326

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 166/228 (73%), Gaps = 5/228 (2%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+ P  KSWSIHTR EI  KYEI E VGSGAYSDVY+GRR SD+L VALKE+HDYQSA R
Sbjct  1    MEQPLPKSWSIHTRPEIIAKYEILECVGSGAYSDVYKGRRLSDNLIVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKN----WDNGLTV  486
            EIEALQ LQN PNVVV+HE+FW EDED+VLVLEFL TDL  VI  +KK      D G++V
Sbjct  61   EIEALQILQNSPNVVVLHEYFWREDEDAVLVLEFLRTDLATVIAESKKKREDRGDRGISV  120

Query  487  GEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVD  666
            GEIKRWMVQILS VDACHRN+IVHRDLKP NLLI D+G+LKLADFGQAR+LL     A D
Sbjct  121  GEIKRWMVQILSGVDACHRNTIVHRDLKPGNLLIGDDGVLKLADFGQARILLGNEFDAPD  180

Query  667  -DGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             + QP    +P        P+    +E+A  EG  +  Q  +++ED F
Sbjct  181  GNSQPCEPNAPYQDNMSEAPQVDLEVEDASPEGDVNQEQGIMSREDYF  228



>gb|EPS60458.1| hypothetical protein M569_14345, partial [Genlisea aurea]
Length=460

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP+KSWSIH+R+EIT KYEI ERVG GAYSDVY+ RR SDSL VALKE+HDYQSA REIE
Sbjct  2    PPAKSWSIHSRREITGKYEILERVGYGAYSDVYKARRLSDSLIVALKEVHDYQSAFREIE  61

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            ALQTLQ  PNV+ +HE+FWSEDED+VLVLE+LPTDL AVI AAKK  D+G+   EIK WM
Sbjct  62   ALQTLQTHPNVIALHEYFWSEDEDAVLVLEYLPTDLAAVINAAKKESDHGILAAEIKYWM  121

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            VQIL  VDACHRNSIVHRDLKPSNLLIS +G+LK+ADFGQAR+L+AP
Sbjct  122  VQILRGVDACHRNSIVHRDLKPSNLLISTDGVLKIADFGQARILIAP  168



>ref|XP_006451198.1| hypothetical protein CICLE_v10008156mg [Citrus clementina]
 gb|ESR64438.1| hypothetical protein CICLE_v10008156mg [Citrus clementina]
Length=477

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 165/228 (72%), Gaps = 5/228 (2%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+ P  KSWSIHTR EI  KYEI E VGSGAYSDVY+GRR SD+L VALKE+HDYQSA R
Sbjct  1    MEQPLPKSWSIHTRPEIIAKYEILECVGSGAYSDVYKGRRLSDNLIVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKK----NWDNGLTV  486
            EIEALQ LQN PNVVV+HE+FW EDED+VLVLEFL TDL  VI  +KK      D G++V
Sbjct  61   EIEALQILQNSPNVVVLHEYFWREDEDAVLVLEFLKTDLATVIAESKKKREGGGDRGISV  120

Query  487  GEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVD  666
            GEIKRWMVQIL  VDACHRN+IVHRDLKP NLLI D+G+LKLADFGQAR+LL     A D
Sbjct  121  GEIKRWMVQILCGVDACHRNTIVHRDLKPGNLLIGDDGVLKLADFGQARILLGNEFNAPD  180

Query  667  -DGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             + QP    +P        P+    +E+A  EG  +  Q  +++ED F
Sbjct  181  GNSQPCESNAPYQDNMSEAPQVDLEVEDASPEGDVNQEQGIMSREDYF  228



>ref|XP_006475656.1| PREDICTED: cyclin-dependent kinase F-1-like [Citrus sinensis]
Length=477

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 165/228 (72%), Gaps = 5/228 (2%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+ P  KSWSIHTR EI  KYEI E VGSGAYSDVY+GRR SD+L VALKE+HDYQSA R
Sbjct  1    MEQPLPKSWSIHTRPEIIAKYEILECVGSGAYSDVYKGRRLSDNLIVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKK----NWDNGLTV  486
            EIEALQ LQN PNVVV+HE+FW EDED+VLVLEFL TDL  VI  +KK      D G++V
Sbjct  61   EIEALQILQNSPNVVVLHEYFWREDEDAVLVLEFLRTDLATVIAESKKKREGGGDRGISV  120

Query  487  GEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVD  666
            GEIKRWMVQIL  VDACHRN+IVHRDLKP NLLI D+G+LKLADFGQAR+LL     A D
Sbjct  121  GEIKRWMVQILCGVDACHRNTIVHRDLKPGNLLIGDDGVLKLADFGQARILLGNEFDAPD  180

Query  667  -DGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             + QP    +P        P+    +E+A  EG  +  Q  +++ED F
Sbjct  181  GNSQPCESNAPYQDNMSEAPQVDLEVEDASPEGDVNQEQGIMSREDYF  228



>ref|XP_002514275.1| cak1, putative [Ricinus communis]
 gb|EEF48229.1| cak1, putative [Ricinus communis]
Length=467

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = +1

Query  169  IHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQTLQN  348
            IHTR EI  KYEI ERVG+GAYSDVY+ RR SD+L VALKEIHDYQSA REIE LQ LQN
Sbjct  17   IHTRSEIISKYEIEERVGAGAYSDVYKARRLSDNLIVALKEIHDYQSAFREIETLQILQN  76

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAV  528
            CPNVVV+HE+FW EDED+VLVLEFL TDL AVIK  KK   NG++VGE+KRWMVQIL  V
Sbjct  77   CPNVVVLHEYFWREDEDAVLVLEFLRTDLAAVIKQGKK---NGISVGEVKRWMVQILCGV  133

Query  529  DACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-QPYGKASPNVP  705
            DACHRN+IVHRDLKPSNLLISD+G LKLADFGQAR+L+ PG  A D+  QPY     N  
Sbjct  134  DACHRNTIVHRDLKPSNLLISDDGRLKLADFGQARILMDPGFVATDENPQPYEHNLVNQE  193

Query  706  TPMYTPEFVPVMENAYREG  762
              +   E +P ME + +EG
Sbjct  194  PLVPAAEVIPEMEKSPQEG  212



>ref|XP_010105058.1| Cyclin-dependent kinase F-1 [Morus notabilis]
 gb|EXC03779.1| Cyclin-dependent kinase F-1 [Morus notabilis]
Length=461

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 166/225 (74%), Gaps = 10/225 (4%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD PP+KSWSIHTR EI  KY+I ERVGSGAYSDVYR RR SD   VALKE+HDYQSA R
Sbjct  1    MDPPPAKSWSIHTRPEIIQKYQILERVGSGAYSDVYRARRLSDDAVVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ L+N PN+VV+HE+FW EDED+VLVLEFL TDL ++I  AKK   N + VGE+K
Sbjct  61   EIEALQILRNSPNIVVLHEYFWREDEDAVLVLEFLRTDLASLIADAKKR--NEIAVGELK  118

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQP  678
            RWM+QILS VD+CHRN IVHRDLKPSNLLI D+G+LKLADFGQAR+L+ PG    ++   
Sbjct  119  RWMLQILSGVDSCHRNMIVHRDLKPSNLLIGDDGVLKLADFGQARILMEPGYVGSNENPL  178

Query  679  YGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQR--NVAKEDRF  807
             G  S      +  PE  P  E++Y+E  +   Q    ++KE+ +
Sbjct  179  NGAES------IQPPEATPPTESSYQERHTVQEQEYGTMSKEEEY  217



>ref|XP_010540963.1| PREDICTED: cyclin-dependent kinase F-1 [Tarenaya hassleriana]
Length=479

 Score =   274 bits (700),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 168/228 (74%), Gaps = 8/228 (4%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+ PP+ SWSIHTR EI  KYEIFERVG+G Y+DVYR RR +D LTVALKEI DYQSA R
Sbjct  1    MEKPPASSWSIHTRSEIVAKYEIFERVGAGTYADVYRARRIADGLTVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAK---KNWDNGLTVG  489
            EI+AL  L+  PNVVVMHE+FW EDE++VLVLEFL TDL AVI+ AK   KN  +G+ VG
Sbjct  61   EIDALTLLRGSPNVVVMHEYFWREDENAVLVLEFLKTDLAAVIREAKKRRKNGGDGIPVG  120

Query  490  EIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDD  669
            EIKRWM+QIL+ VDACHRN +VHRDLKP N+LISD+GILKLADFGQAR+L+ PG    ++
Sbjct  121  EIKRWMIQILAGVDACHRNMVVHRDLKPGNMLISDDGILKLADFGQARILMDPGFVPSEE  180

Query  670  GQPY-GKASPNVPTPMYTPEFVPVMENAYREG-QSHHYQRNVAKEDRF  807
             Q    K    +  P   PE +P  E + ++G    H Q  V+K++ F
Sbjct  181  NQQVEDKDGGTITGP---PEVIPECETSSQKGCDDGHKQEPVSKDEYF  225



>gb|AAF34804.1|AF230740_1 CDK-activating kinase [Euphorbia esula]
Length=480

 Score =   274 bits (700),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = +1

Query  124  EKETPMDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY  303
            E+  P   P +KSWSIHTR EI  KYEI ERVGSGAYSDVY+ RR SD+L VALKEIHDY
Sbjct  2    EQLPPSPPPHAKSWSIHTRPEIIAKYEIQERVGSGAYSDVYKARRLSDNLIVALKEIHDY  61

Query  304  QSALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLT  483
            QSA REIEAL  +QNCPN+VV+HE+FW EDED+VLVLEFL TDL ++IK  KKN   G+ 
Sbjct  62   QSAFREIEALHIVQNCPNIVVLHEYFWREDEDAVLVLEFLRTDLASLIKEGKKNGGIGVN  121

Query  484  VGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAV  663
             GEIKRWM+QILS +DACHRN +VHRDLKPSNLLISD+G+LKLADFGQAR+L+ PG  A 
Sbjct  122  AGEIKRWMMQILSGLDACHRNMVVHRDLKPSNLLISDDGVLKLADFGQARILMEPGFVAT  181



>ref|XP_002869461.1| cdk-activating kinase 1at [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45720.1| cdk-activating kinase 1at [Arabidopsis lyrata subsp. lyrata]
Length=480

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 166/228 (73%), Gaps = 5/228 (2%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EI  KYEIFERVGSGAY+DVYR RR SD L VALKEI DYQSA R
Sbjct  1    MDKQPASSWSIHTRPEIIAKYEIFERVGSGAYADVYRARRLSDGLIVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKN----WDNGLTV  486
            EI+AL  L   PNVVVMHE+FW EDE++VLVLEFL +DL AVI+ AK+       +G +V
Sbjct  61   EIDALTILNGHPNVVVMHEYFWREDENAVLVLEFLRSDLAAVIRDAKRKKKVEGGDGFSV  120

Query  487  GEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVD  666
            GEIKRWM+QIL+ VDACHRN IVHRDLKP N+LISD+G+LKLADFGQAR+L+ P + A D
Sbjct  121  GEIKRWMIQILTGVDACHRNLIVHRDLKPGNMLISDDGVLKLADFGQARILMEPDIVASD  180

Query  667  DGQPYGKASPN-VPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
            + Q   K   N   +    PE +P  EN+ R+G     Q  ++K++ F
Sbjct  181  ENQQVYKLEENDGESSTEPPEVIPDYENSPRQGSDGQEQVAMSKDEYF  228



>ref|XP_006412893.1| hypothetical protein EUTSA_v10025049mg [Eutrema salsugineum]
 gb|ESQ54346.1| hypothetical protein EUTSA_v10025049mg [Eutrema salsugineum]
Length=485

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 165/233 (71%), Gaps = 10/233 (4%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EI  KYEIFERVGSGAY+DVYR RR SD L VALKEI DYQSA R
Sbjct  1    MDKQPASSWSIHTRPEIIAKYEIFERVGSGAYADVYRARRISDGLIVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKK---------NWD  471
            EI+AL  L   PN+VVMHE+FW EDE++V+VLEFL TDL AVI+ AK+           D
Sbjct  61   EIDALTILSGSPNIVVMHEYFWREDENAVIVLEFLRTDLAAVIRDAKRRKKGSSGGEEGD  120

Query  472  NGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            +G T GEIKRWM+QILS VDACHRN IVHRDLKP N+L+SD+G+LKLADFGQAR+L+ P 
Sbjct  121  DGFTEGEIKRWMIQILSGVDACHRNLIVHRDLKPGNMLVSDDGVLKLADFGQARILMEPD  180

Query  652  LAAVDDGQ-PYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
              A D+ Q  Y     +  T    PE +P  EN+ ++G     +  ++K++ F
Sbjct  181  FVASDENQHAYKVEDKDGETSREPPEVIPDYENSSQQGSDGQEREVMSKDEYF  233



>ref|XP_010254056.1| PREDICTED: cyclin-dependent kinase F-1-like [Nelumbo nucifera]
Length=470

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PPSKSWSI +R EIT +Y+I E++GSG YSDVY+  R SD L VALKE+HDYQSA REIE
Sbjct  3    PPSKSWSIFSRTEITQRYKILEQIGSGTYSDVYKAVRLSDGLIVALKEVHDYQSAFREIE  62

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            ALQ LQN PN+V++HE+FW EDED+VLVLEFL TDL +VI+  K+N +NG+ VGE+KRWM
Sbjct  63   ALQILQNSPNIVMLHEYFWREDEDAVLVLEFLTTDLASVIRETKRNRENGIPVGEVKRWM  122

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGK  687
            +QIL  VDACHRNSIVHRDLKP+NLLIS +G+LKLADFGQ+R+L+ PG  A  D  P+ +
Sbjct  123  IQILHGVDACHRNSIVHRDLKPANLLISSDGVLKLADFGQSRILMEPGFDA-GDMNPHEQ  181

Query  688  ASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKE  798
               N    +   E VP  +N+      +   R + KE
Sbjct  182  NILNQSWMLQHCEVVPQSDNSCPGDSQNQEHRTMNKE  218



>ref|XP_006285995.1| hypothetical protein CARUB_v10007522mg [Capsella rubella]
 gb|EOA18893.1| hypothetical protein CARUB_v10007522mg [Capsella rubella]
Length=480

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 163/228 (71%), Gaps = 5/228 (2%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EI  KYEIFERVGSGAY+DVYR RR SD L VALKEI DYQSA R
Sbjct  1    MDKQPASSWSIHTRPEIIAKYEIFERVGSGAYADVYRARRLSDGLIVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDN----GLTV  486
            EI+AL  L   PNVVVMHE+FW EDE++VLVLEFL +DL AVI+ AK+        G +V
Sbjct  61   EIDALTILSGSPNVVVMHEYFWREDENAVLVLEFLRSDLAAVIRDAKRKKKGEGGVGFSV  120

Query  487  GEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVD  666
            GEIKRWM+QIL+ VDACHRN IVHRD+KP N+L+SD+G+LKLADFGQAR+L+   + A D
Sbjct  121  GEIKRWMIQILNGVDACHRNLIVHRDVKPGNMLVSDDGVLKLADFGQARILMESDIVASD  180

Query  667  DG-QPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
            +  Q Y     +  T    PE +P  EN+ R G     Q  ++K++ F
Sbjct  181  ENQQAYKLEDKDGETSTEPPEVIPDYENSPRLGSDGQEQEAISKDEYF  228



>gb|KJB07191.1| hypothetical protein B456_001G006600 [Gossypium raimondii]
Length=475

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+ P  KSWSIHTR EI  KY+I ERVGSGAYSDVYR RR SD L VALKE+HDYQSA R
Sbjct  1    MEQPLPKSWSIHTRPEIIAKYQILERVGSGAYSDVYRARRLSDDLIVALKEVHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ L+NCPNVVV+HE+FW EDED+VLVLEFL TDL AVI+ AKK  + G+ VGE+K
Sbjct  61   EIEALQMLRNCPNVVVLHEYFWREDEDAVLVLEFLRTDLSAVIRDAKKK-EGGVRVGEVK  119

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQ  675
            RWM+QIL  VDACHRN IVHRDLKP NLL+SD+G+LKLADFGQAR+L+  G    ++ Q
Sbjct  120  RWMLQILCGVDACHRNMIVHRDLKPGNLLVSDDGVLKLADFGQARILMESGFDGDNNQQ  178



>ref|XP_008458494.1| PREDICTED: cyclin-dependent kinase F-1 [Cucumis melo]
Length=482

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 167/231 (72%), Gaps = 9/231 (4%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+   +KSWSIH+R +I  KYEI ERVGSGAYSDVYR RR SD + VALKEIHDYQSA R
Sbjct  1    MEPSSAKSWSIHSRPDIIHKYEILERVGSGAYSDVYRARRLSDGVIVALKEIHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDN------GL  480
            EIEALQ LQ  PN+VV+HE+FW EDED+VLVLEF+ TDL  VI  AKK   +      GL
Sbjct  61   EIEALQILQGSPNIVVLHEYFWREDEDAVLVLEFMRTDLATVIAEAKKRGSDGVESGRGL  120

Query  481  TVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAA  660
             VGE+KRWM+QILS +DACHRN IVHRDLKPSNLLISD+G+LKLADFGQAR+L+ P    
Sbjct  121  AVGELKRWMIQILSGLDACHRNMIVHRDLKPSNLLISDDGMLKLADFGQARILMGPDYVE  180

Query  661  VDD-GQPYG-KASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             ++  QP    +S  VP+   +   +P  E++ REG     Q  ++KE+ F
Sbjct  181  SNEISQPCEINSSDQVPSSQPSA-VLPGTESSVREGNRTEEQEPISKEEYF  230



>ref|XP_004139347.1| PREDICTED: cyclin-dependent kinase F-1 [Cucumis sativus]
 gb|KGN60607.1| hypothetical protein Csa_2G003590 [Cucumis sativus]
Length=482

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 167/231 (72%), Gaps = 9/231 (4%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+   +KSWSIH+R +I  KYEI ERVGSGAYSDVYR RR SD + VALKEIHDYQSA R
Sbjct  1    MEPSSAKSWSIHSRPDIIHKYEILERVGSGAYSDVYRARRLSDGVIVALKEIHDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKK------NWDNGL  480
            EIEALQ LQ  PN+VV+HE+FW EDED+VLVLEF+ TDL  VI  AKK      +   GL
Sbjct  61   EIEALQILQGSPNIVVLHEYFWREDEDAVLVLEFMRTDLATVIAEAKKIGSDGVDSGRGL  120

Query  481  TVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAA  660
             VGE+KRWM+QILS +DACHRN IVHRDLKPSNLLISD+G+LKLADFGQAR+L+ P    
Sbjct  121  AVGELKRWMIQILSGLDACHRNMIVHRDLKPSNLLISDDGMLKLADFGQARILMDPDYVE  180

Query  661  VDD-GQPYG-KASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             ++  QP    +S  VP+   +   +P  E+  REG  +  Q  ++KE+ F
Sbjct  181  SNEISQPCEINSSDQVPSSQPSA-VLPGTESLVREGNRNEEQETISKEEYF  230



>ref|NP_194627.1| cyclin-dependent kinase F-1 [Arabidopsis thaliana]
 ref|NP_849468.1| cyclin-dependent kinase F-1 [Arabidopsis thaliana]
 sp|O80345.1|CDKF1_ARATH RecName: Full=Cyclin-dependent kinase F-1; Short=CDKF;1; AltName: 
Full=CDK-activating kinase 1-At; Short=CAK1-At [Arabidopsis 
thaliana]
 dbj|BAA28775.1| Cdk-activating kinase 1At [Arabidopsis thaliana]
 emb|CAB43912.1| Cdk-activating kinase CAK1At [Arabidopsis thaliana]
 emb|CAB79656.1| Cdk-activating kinase CAK1At [Arabidopsis thaliana]
 gb|AAK68756.1| Cdk-activating kinase CAK1At [Arabidopsis thaliana]
 gb|AAL47340.1| Cdk-activating kinase CAK1At [Arabidopsis thaliana]
 dbj|BAH19664.1| AT4G28980 [Arabidopsis thaliana]
 gb|AEE85567.1| cyclin-dependent kinase F-1 [Arabidopsis thaliana]
 gb|AEE85568.1| cyclin-dependent kinase F-1 [Arabidopsis thaliana]
Length=479

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 162/227 (71%), Gaps = 4/227 (2%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EI  KYEIFERVGSGAY+DVYR RR SD L VALKEI DYQSA R
Sbjct  1    MDKQPATSWSIHTRPEIIAKYEIFERVGSGAYADVYRARRLSDGLIVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKN----WDNGLTV  486
            EI+AL  L   PNVVVMHE+FW E+E++VLVLEFL +DL AVI+  K+       +G +V
Sbjct  61   EIDALTILNGSPNVVVMHEYFWREEENAVLVLEFLRSDLAAVIRDGKRKKKVEGGDGFSV  120

Query  487  GEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVD  666
            GEIKRWM+QIL+ VDACHRN IVHRDLKP N+LISD+G+LKLADFGQAR+L+   + A D
Sbjct  121  GEIKRWMIQILTGVDACHRNLIVHRDLKPGNMLISDDGVLKLADFGQARILMEHDIVASD  180

Query  667  DGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
            + Q   K           PE +P  EN+ R+G     +  ++K++ F
Sbjct  181  ENQQAYKLEDKDGETSEPPEVIPDYENSPRQGSDGQEREAMSKDEYF  227



>emb|CDY35237.1| BnaA01g07940D [Brassica napus]
Length=472

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 168/228 (74%), Gaps = 12/228 (5%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EIT KYEIFERVGSGAY+DVYR RR SD LTVALKEI DYQSA R
Sbjct  1    MDKQPASSWSIHTRPEITAKYEIFERVGSGAYADVYRARRISDGLTVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKK-----NWDNGLT  483
            EI+AL  L   PNVV+MHE+FW EDE++V+VLEFL +DL AVI+ AK+     +  +G +
Sbjct  61   EIDALSILHGSPNVVLMHEYFWREDENAVIVLEFLRSDLSAVIRDAKRRKKKGSGGDGFS  120

Query  484  VGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAV  663
            VGEIKRWM+QIL+ VDACHRN IVHRDLKP N+L+SD+G+LKLADFGQAR+L+ P   A 
Sbjct  121  VGEIKRWMIQILNGVDACHRNLIVHRDLKPGNMLVSDDGVLKLADFGQARILMEPDNVAA  180

Query  664  DDGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
            D+ +  G+AS         PE +P   N+ ++G     Q  +++++ F
Sbjct  181  DE-EREGEASRE------PPEVIPDYVNSSQKGSEGQEQEVLSRDEYF  221



>ref|XP_010438365.1| PREDICTED: cyclin-dependent kinase F-1 [Camelina sativa]
 ref|XP_010438366.1| PREDICTED: cyclin-dependent kinase F-1 [Camelina sativa]
Length=482

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 165/233 (71%), Gaps = 13/233 (6%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EI  KYEIFERVGSGAY+DVYR RR SD L VALKEI DYQSA R
Sbjct  1    MDKQPASSWSIHTRPEIIAKYEIFERVGSGAYADVYRARRLSDGLIVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKK----------NW  468
            EI+AL  L   PNVVVMHE+FW EDE++VLVLEFL +DL AVI+ AK+            
Sbjct  61   EIDALTILSGSPNVVVMHEYFWHEDENAVLVLEFLRSDLAAVIRDAKRKKKKKMMGGEEG  120

Query  469  DNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
              G +VGEIKRWM+QIL+ VDACHRN IVHRDLKP N+LISD+G+LKLADFGQAR+L+ P
Sbjct  121  GVGFSVGEIKRWMIQILNGVDACHRNLIVHRDLKPGNMLISDDGVLKLADFGQARILMEP  180

Query  649  GLAAVDDGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             + A DD +   K   +  T +  PE +P  EN+ R+G        ++K++ F
Sbjct  181  DIVASDDNKLEDK---DGETSIEPPEVIPDYENSPRQGSDGKELEAMSKDEYF  230



>ref|XP_010433152.1| PREDICTED: cyclin-dependent kinase F-1-like [Camelina sativa]
Length=482

 Score =   263 bits (673),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 163/233 (70%), Gaps = 13/233 (6%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EI  KYEIFERVGSGAY+DVYR RR SD L VALKEI DYQSA R
Sbjct  1    MDKQPASSWSIHTRPEIIAKYEIFERVGSGAYADVYRARRLSDGLIVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAA----------KKNW  468
            EI+AL  L   PNVVVMHE+FW EDE++VLVLEFL +DL  VI+ A          ++  
Sbjct  61   EIDALTILSGSPNVVVMHEYFWHEDENAVLVLEFLRSDLAVVIRDAKRKKKKKNMGEEEG  120

Query  469  DNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
              G +VGEIKRWM+QIL  VDACHRN IVHRDLKP N+LISD+G+LKLADFGQAR+L+ P
Sbjct  121  GVGFSVGEIKRWMIQILIGVDACHRNLIVHRDLKPGNMLISDDGVLKLADFGQARILMEP  180

Query  649  GLAAVDDGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             + A DD +   K   +  T +  PE +P  EN+ R+G        ++K++ F
Sbjct  181  DIVASDDNKLEDK---DGETSIEPPEVIPDYENSPRQGSDGKELEAMSKDEYF  230



>ref|XP_009129100.1| PREDICTED: cyclin-dependent kinase F-1 [Brassica rapa]
Length=472

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 166/228 (73%), Gaps = 12/228 (5%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EI  KYEIFERVGSGAY+DVYR RR SD LTVALKEI DYQSA R
Sbjct  1    MDKQPASSWSIHTRPEIIAKYEIFERVGSGAYADVYRARRISDGLTVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKK-----NWDNGLT  483
            EI+AL  L   PNVV+MHE+FW EDE++V+VLEFL +DL AVI+ AK+     +   G +
Sbjct  61   EIDALSLLHGSPNVVLMHEYFWREDENAVIVLEFLRSDLSAVIRDAKRRKKKGSGGEGFS  120

Query  484  VGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAV  663
            VGEIKRWM+QIL+ VDACHRN IVHRDLKP N+L+SD+G+LKLADFGQAR+L+ P   A 
Sbjct  121  VGEIKRWMIQILNGVDACHRNLIVHRDLKPGNMLVSDDGVLKLADFGQARILMEPDNVAT  180

Query  664  DDGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
            D+ +  G+AS         PE +P   N+ ++G     Q  +++++ F
Sbjct  181  DE-EREGEASRE------PPEVIPDYVNSSQKGSEGQEQEVLSRDEYF  221



>ref|XP_010688250.1| PREDICTED: cyclin-dependent kinase F-1 [Beta vulgaris subsp. 
vulgaris]
Length=480

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 5/184 (3%)
 Frame = +1

Query  139  MDSP-PSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSAL  315
            MDSP  SKSWSI+ RKEIT KYEI ER+GSG YSDVYR +RRSD  TVALKEIHDYQS+ 
Sbjct  1    MDSPTSSKSWSIYGRKEITAKYEIQERIGSGTYSDVYRAQRRSDGYTVALKEIHDYQSSF  60

Query  316  REIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAA---KKNWDNGLTV  486
            REIEALQTLQNCPNVVV+HEFFW EDED+VLVLE+L TDL ++I  A     N ++ L+ 
Sbjct  61   REIEALQTLQNCPNVVVLHEFFWREDEDAVLVLEYLKTDLASLIMEAKKKNNNNNDFLSP  120

Query  487  GEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGL-AAV  663
             +IKRW+VQIL  +DACHRNSIVHRDLKPSNLLIS++G+LKLADFGQAR+LL PG  A+V
Sbjct  121  PQIKRWIVQILHGLDACHRNSIVHRDLKPSNLLISEDGVLKLADFGQARILLEPGFVASV  180

Query  664  DDGQ  675
            +D Q
Sbjct  181  EDLQ  184



>gb|EYU29812.1| hypothetical protein MIMGU_mgv1a005844mg [Erythranthe guttata]
Length=468

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +1

Query  151  PSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEA  330
            PSKSWSI++R EIT KYEI  RVGSGAYSDVY+ RRRSDS+ VALKE+HDYQSA REIEA
Sbjct  7    PSKSWSIYSRSEITSKYEISGRVGSGAYSDVYKARRRSDSVMVALKEVHDYQSAFREIEA  66

Query  331  LQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMV  510
            L+TL+N PN+VV+HE+FWSEDE +VLVLE+LPTDL AV+K+A  N D  ++VGE+KRW+ 
Sbjct  67   LETLKNSPNIVVLHEYFWSEDEGAVLVLEYLPTDLAAVVKSA-ANKDGIISVGEVKRWID  125

Query  511  QILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            QIL  VD+CHRNSIVHRDLKPSNLLIS +G+LK+ADFGQAR+L+AP
Sbjct  126  QILRGVDSCHRNSIVHRDLKPSNLLISSDGVLKIADFGQARILIAP  171



>ref|XP_010447904.1| PREDICTED: cyclin-dependent kinase F-1-like [Camelina sativa]
Length=483

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 166/234 (71%), Gaps = 14/234 (6%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EI  KYEIFERVGSGAY+DVYR RR SD+L VALKEI DYQSA R
Sbjct  1    MDKQPASSWSIHTRPEIIAKYEIFERVGSGAYADVYRARRLSDNLIVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAA-----------KKN  465
            EI+AL  L   PNVVVMHE+FW EDE++VLVLEFL +DL AVI+ A           ++ 
Sbjct  61   EIDALTILSGSPNVVVMHEYFWHEDENAVLVLEFLRSDLAAVIRDAKRKKKNKKMGEEEE  120

Query  466  WDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLA  645
               G +VGEIKRWM+QIL+ VDACHRN IVHRDLKP N+LISD+G+LKLADFGQAR+L+ 
Sbjct  121  GGVGFSVGEIKRWMIQILNGVDACHRNLIVHRDLKPGNMLISDDGVLKLADFGQARILME  180

Query  646  PGLAAVDDGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
            P + A DD +   K   +  T +  PE +P  EN+ R+G        ++K++ F
Sbjct  181  PDIVASDDNKLEDK---DGETSIEPPEVIPDYENSPRQGSDGKELEAMSKDEYF  231



>gb|KHN16612.1| Cyclin-dependent kinase F-1 [Glycine soja]
Length=409

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP KSWSIHTR EI  KYE+ ERVGSGAY+DVYRGRR SD+LTVALKEIHDYQSA REI+
Sbjct  3    PPPKSWSIHTRSEIIAKYEVMERVGSGAYADVYRGRRLSDNLTVALKEIHDYQSAFREID  62

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            ALQ LQ  PNVVV+HE+FW EDED+VLVLEFL TDL  V+  A K  +  L  GE+KRWM
Sbjct  63   ALQLLQGSPNVVVLHEYFWREDEDAVLVLEFLRTDLATVVADAAKA-NQPLPAGELKRWM  121

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGK  687
            +QILS +DACHR+ ++HRDLKPSNLLIS+ G+LK+ADFGQAR+L  PG+ A ++ + Y +
Sbjct  122  IQILSGLDACHRHMVLHRDLKPSNLLISELGLLKIADFGQARILTEPGIDASNNHEEYSR  181



>ref|XP_003530518.1| PREDICTED: cyclin-dependent kinase F-1-like isoform X1 [Glycine 
max]
 ref|XP_006584822.1| PREDICTED: cyclin-dependent kinase F-1-like isoform X2 [Glycine 
max]
 ref|XP_006584823.1| PREDICTED: cyclin-dependent kinase F-1-like isoform X3 [Glycine 
max]
 ref|XP_006584824.1| PREDICTED: cyclin-dependent kinase F-1-like isoform X4 [Glycine 
max]
 ref|XP_006584825.1| PREDICTED: cyclin-dependent kinase F-1-like isoform X5 [Glycine 
max]
 ref|XP_006584826.1| PREDICTED: cyclin-dependent kinase F-1-like isoform X6 [Glycine 
max]
 ref|XP_006584827.1| PREDICTED: cyclin-dependent kinase F-1-like isoform X7 [Glycine 
max]
 ref|XP_006584828.1| PREDICTED: cyclin-dependent kinase F-1-like isoform X8 [Glycine 
max]
Length=409

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP KSWSIHTR EI  KYE+ ERVGSGAY+DVYRGRR SD+LTVALKEIHDYQSA REI+
Sbjct  3    PPPKSWSIHTRSEIIAKYEVMERVGSGAYADVYRGRRLSDNLTVALKEIHDYQSAFREID  62

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            ALQ LQ  PNVVV+HE+FW EDED+VLVLEFL TDL  V+  A K  +  L  GE+KRWM
Sbjct  63   ALQLLQGSPNVVVLHEYFWREDEDAVLVLEFLRTDLATVVADAAKA-NQPLPAGELKRWM  121

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGK  687
            +QILS +DACHR+ ++HRDLKPSNLLIS+ G+LK+ADFGQAR+L  PG+ A ++ + Y +
Sbjct  122  IQILSGLDACHRHMVLHRDLKPSNLLISELGLLKIADFGQARILTEPGIDASNNHEEYSR  181



>ref|XP_004503449.1| PREDICTED: cyclin-dependent kinase F-1-like [Cicer arietinum]
Length=474

 Score =   258 bits (658),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 153/205 (75%), Gaps = 2/205 (1%)
 Frame = +1

Query  151  PSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEA  330
            PSKSWSIHTR EI  KY++ ER+GSGAY+DVYRGRR SD +TVALKEIHDYQSA REIEA
Sbjct  6    PSKSWSIHTRSEIISKYQVMERIGSGAYADVYRGRRLSDDVTVALKEIHDYQSAFREIEA  65

Query  331  LQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMV  510
            LQ LQ  PNV+V+HE+FW EDED+VLVLE+L TDL  VI  A K     L VGE+KRWM+
Sbjct  66   LQMLQGSPNVIVLHEYFWREDEDAVLVLEYLTTDLTTVISDAAKE-GLSLPVGEMKRWMI  124

Query  511  QILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKA  690
            QIL  +DACHRN I+HRDLKPSNLLISD GILKLADFGQAR+L   G  A ++  P  + 
Sbjct  125  QILCGLDACHRNMIIHRDLKPSNLLISDRGILKLADFGQARILTEDGFDAFEENPPPCEH  184

Query  691  -SPNVPTPMYTPEFVPVMENAYREG  762
               N  + ++ PE  P  ++  + G
Sbjct  185  DGSNHESLLHQPEAFPHTDSTSQFG  209



>gb|AET05246.2| cyclin-dependent kinase [Medicago truncatula]
Length=474

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 157/216 (73%), Gaps = 2/216 (1%)
 Frame = +1

Query  154  SKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEAL  333
            +KSWSIHTR EI  KY++ ER+GSGAY+DVYRGRR SD LTVALKEIHDYQSA REIEAL
Sbjct  7    TKSWSIHTRSEIIAKYQVMERIGSGAYADVYRGRRLSDDLTVALKEIHDYQSAFREIEAL  66

Query  334  QTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
            Q LQ  PNVVV+HE+FW +DED+VLVLE+L TDL  VI  A K     + VGE+KRWM+Q
Sbjct  67   QMLQGSPNVVVLHEYFWRDDEDAVLVLEYLTTDLATVISNAAKE-GIPIPVGELKRWMIQ  125

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-QPYGKA  690
            IL  +DACHRN IVHRDLKPSNLLISD G+LKLADFGQAR+L+  G  A ++   P  + 
Sbjct  126  ILCGLDACHRNMIVHRDLKPSNLLISDCGVLKLADFGQARILIESGFDAFEENPPPCEED  185

Query  691  SPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKE  798
              N  + ++ PE  P   N  + G  +  Q +  +E
Sbjct  186  GSNHESSLHHPEAFPHTNNLSQLGFENQEQGSSHEE  221



>gb|KJB54228.1| hypothetical protein B456_009G026100 [Gossypium raimondii]
Length=344

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+ P  KSWSIHTR EI  KY I ERVGSG Y+DVYR RR SD+L VALKE H+YQS  R
Sbjct  14   MEHPLPKSWSIHTRPEIIAKYVIMERVGSGTYADVYRARRLSDNLIVALKEAHEYQSGFR  73

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            +IEALQ LQNCPN+VVMHE+FW EDED+VLVLEFL T+L AVI+ AKK  ++G+  GE+K
Sbjct  74   KIEALQLLQNCPNIVVMHEYFWREDEDAVLVLEFLRTNLAAVIEEAKKK-ESGVPFGEVK  132

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML--LAPGLAAVDDG  672
            R M+QIL  +DACHRN IVHRDLKP NL +SD+G+LKLADFGQAR+L  + PG  A +D 
Sbjct  133  RLMLQILRGIDACHRNMIVHRDLKPGNLFVSDDGVLKLADFGQARILMNMEPGFVADNDN  192

Query  673  QPY  681
            Q +
Sbjct  193  QQW  195



>ref|XP_003630770.1| Protein kinase [Medicago truncatula]
Length=479

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 157/216 (73%), Gaps = 2/216 (1%)
 Frame = +1

Query  154  SKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEAL  333
            +KSWSIHTR EI  KY++ ER+GSGAY+DVYRGRR SD LTVALKEIHDYQSA REIEAL
Sbjct  7    TKSWSIHTRSEIIAKYQVMERIGSGAYADVYRGRRLSDDLTVALKEIHDYQSAFREIEAL  66

Query  334  QTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
            Q LQ  PNVVV+HE+FW +DED+VLVLE+L TDL  VI  A K     + VGE+KRWM+Q
Sbjct  67   QMLQGSPNVVVLHEYFWRDDEDAVLVLEYLTTDLATVISNAAKE-GIPIPVGELKRWMIQ  125

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDG-QPYGKA  690
            IL  +DACHRN IVHRDLKPSNLLISD G+LKLADFGQAR+L+  G  A ++   P  + 
Sbjct  126  ILCGLDACHRNMIVHRDLKPSNLLISDCGVLKLADFGQARILIESGFDAFEENPPPCEED  185

Query  691  SPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKE  798
              N  + ++ PE  P   N  + G  +  Q +  +E
Sbjct  186  GSNHESSLHHPEAFPHTNNLSQLGFENQEQGSSHEE  221



>ref|XP_007160323.1| hypothetical protein PHAVU_002G312000g [Phaseolus vulgaris]
 ref|XP_007160324.1| hypothetical protein PHAVU_002G312000g [Phaseolus vulgaris]
 gb|ESW32317.1| hypothetical protein PHAVU_002G312000g [Phaseolus vulgaris]
 gb|ESW32318.1| hypothetical protein PHAVU_002G312000g [Phaseolus vulgaris]
Length=409

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 149/192 (78%), Gaps = 2/192 (1%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP KSWSIHTR EI  KYE+ ERVGSGAY+DVYRGRR SD LTVALKEIHDYQSA REI+
Sbjct  5    PPPKSWSIHTRSEIIAKYEVMERVGSGAYADVYRGRRLSDGLTVALKEIHDYQSAFREID  64

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            AL+ LQ  PNV+V+HE+FW EDED+VLVLEFL TDL  VI  A K  +  L  G++KRWM
Sbjct  65   ALELLQGFPNVIVLHEYFWREDEDAVLVLEFLRTDLATVIADAAKA-NQPLPAGQLKRWM  123

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLL-APGLAAVDDGQPYG  684
            +QILS VDACHRN ++HRDLKPSNLLIS+NG LK+ADFGQAR+L   PG  A ++ + Y 
Sbjct  124  IQILSGVDACHRNMVLHRDLKPSNLLISENGHLKIADFGQARILTEEPGFDASNNHEEYS  183

Query  685  KASPNVPTPMYT  720
            +   N  T + T
Sbjct  184  RDIDNKDTGINT  195



>ref|XP_003525274.1| PREDICTED: cyclin-dependent kinase F-1-like [Glycine max]
Length=411

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 148/185 (80%), Gaps = 1/185 (1%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP KSWSIHTR EI  KYE+ ERVGSGAY+DVYRGRR SD LTVALKEIHDYQSA REI+
Sbjct  5    PPPKSWSIHTRSEIIAKYEVMERVGSGAYADVYRGRRLSDGLTVALKEIHDYQSAFREID  64

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            ALQ L+  PNVVV+HE+FW EDED+VLVLEFL TDL  VI    K  +  L  GE+K WM
Sbjct  65   ALQLLEGSPNVVVLHEYFWREDEDAVLVLEFLRTDLATVIADTAKA-NQPLPAGELKCWM  123

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGK  687
            +QILS +DACHR+ ++HRDLKPSNLLIS++G+LK+ADFGQAR+L+ PG+ A ++ + Y +
Sbjct  124  IQILSGLDACHRHMVLHRDLKPSNLLISEHGLLKIADFGQARILMEPGIDASNNHEEYSR  183

Query  688  ASPNV  702
               ++
Sbjct  184  VLDDI  188



>ref|XP_010915858.1| PREDICTED: cyclin-dependent kinase F-1-like [Elaeis guineensis]
Length=477

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = +1

Query  145  SPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREI  324
            +P S+SWSI+ R EIT +YEI ER+GSGAY+DVYRGRRRSD + VALKEIHDYQS+ REI
Sbjct  5    APSSRSWSIYGRLEITQRYEILERIGSGAYADVYRGRRRSDGIVVALKEIHDYQSSFREI  64

Query  325  EALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRW  504
            EALQTL++ PNVV + E+FW EDED+VLVLEFLPTDL +VI+ AK+    GL  GE+K+W
Sbjct  65   EALQTLRDSPNVVDLLEYFWQEDEDAVLVLEFLPTDLASVIRDAKRG--PGLAAGEVKQW  122

Query  505  MVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            M+QIL  VDACHRNS+VHRDLKPSNLLIS  G+LKLADFGQ+R+L
Sbjct  123  MLQILRGVDACHRNSVVHRDLKPSNLLISAEGVLKLADFGQSRIL  167



>emb|CDY06853.1| BnaC01g09520D [Brassica napus]
Length=1408

 Score =   256 bits (655),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 161/229 (70%), Gaps = 9/229 (4%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            MD  P+ SWSIHTR EI  KYEIFERVGSGAY+DVYR RR SD LTVALKEI DYQSA R
Sbjct  1    MDKQPASSWSIHTRPEIIAKYEIFERVGSGAYADVYRARRISDGLTVALKEIFDYQSAFR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAA------KKNWDNGL  480
            EI+AL  L   PNVV+MHE+FW EDE++V+VLEFL +DL AVI+ A       +   +G 
Sbjct  61   EIDALSILHGSPNVVLMHEYFWREDENAVIVLEFLRSDLAAVIRDAKRRKKKGEGGGDGF  120

Query  481  TVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAA  660
            +VGEIKRWMVQIL+ VDACHRN IVHRDLKP N+LI D+G+LKLADFGQAR+L+     A
Sbjct  121  SVGEIKRWMVQILNGVDACHRNMIVHRDLKPGNMLIGDDGVLKLADFGQARILMESDNLA  180

Query  661  VDDGQPYGKASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             D+ Q   +       P   PE +P   N+ ++G     Q  +++++ F
Sbjct  181  TDENQQEEREGEASREP---PEVIPDYVNSSQKGSEGQEQEVLSRDEYF  226



>ref|XP_009404441.1| PREDICTED: cyclin-dependent kinase F-1-like [Musa acuminata subsp. 
malaccensis]
Length=494

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 150/196 (77%), Gaps = 12/196 (6%)
 Frame = +1

Query  139  MDSPP---------SKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKE  291
            MDS P         S+SWSI+ R EI  +YEI  R+GSGAY+DVYRGRRRSD L VALKE
Sbjct  1    MDSSPPQPMPVRTSSRSWSIYGRGEIAQRYEILGRIGSGAYADVYRGRRRSDGLIVALKE  60

Query  292  IHDYQSALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWD  471
            IHDY+S+ REIEALQ L+  PNVV + E+FW EDED+VLVLEFLP DL AVI+ AK++  
Sbjct  61   IHDYRSSFREIEALQALRGSPNVVELIEYFWHEDEDAVLVLEFLPADLAAVIREAKRS--  118

Query  472  NGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
             G+ +GE+K+WMVQIL  V+ACHR+S+VHRDLKPSNLLIS +G+LKLADFGQ+RML    
Sbjct  119  GGIAIGEVKQWMVQILRGVEACHRSSVVHRDLKPSNLLISADGVLKLADFGQSRMLQENR  178

Query  652  LAAVDDGQPYGKASPN  699
            L ++ D  P+ + S N
Sbjct  179  LISI-DSSPHEQFSEN  193



>ref|XP_008783260.1| PREDICTED: cyclin-dependent kinase F-1-like [Phoenix dactylifera]
Length=477

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = +1

Query  145  SPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREI  324
            +P S+SWSIH R EI  +YEI ER+GSGAY+DVYRG RRSD + VALKEIHDYQS+ REI
Sbjct  5    APSSRSWSIHGRSEIIQRYEILERIGSGAYADVYRGLRRSDGVLVALKEIHDYQSSFREI  64

Query  325  EALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRW  504
            +AL+TL++  NVV + E+FW EDED+VLVLEFLPTDL +VI+ AK+   +GL VGE+K+W
Sbjct  65   DALRTLRDSANVVNLLEYFWQEDEDAVLVLEFLPTDLASVIRDAKRG--SGLAVGEVKQW  122

Query  505  MVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            M+QIL  VDACHRNS+VHRDLKPSNLLIS +G+LK+ADFGQ+R+L
Sbjct  123  MLQILRGVDACHRNSVVHRDLKPSNLLISADGVLKVADFGQSRIL  167



>ref|XP_004513007.1| PREDICTED: cyclin-dependent kinase F-1-like [Cicer arietinum]
Length=428

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 135/172 (78%), Gaps = 1/172 (1%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP+KSWSIHTR EIT KYEI E +GSG+Y+DVYRGRR SD +TVALKEIHD+QSA REI+
Sbjct  3    PPTKSWSIHTRPEITTKYEILELIGSGSYADVYRGRRTSDGITVALKEIHDHQSASREID  62

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDN-GLTVGEIKRW  504
            AL+ L+   NVV MHEFFW EDED+VLVLEFL TDL AVIK      +  G +VGE+KRW
Sbjct  63   ALRILRGSENVVFMHEFFWREDEDAVLVLEFLRTDLAAVIKEVSGAGEGEGFSVGEVKRW  122

Query  505  MVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAA  660
            M  I+S V  CH N IVHRDLKP N L+SD+G+LKLADFGQAR+L+  G  A
Sbjct  123  MKMIVSGVHCCHVNRIVHRDLKPQNFLVSDDGVLKLADFGQARILMESGFDA  174



>ref|XP_009421449.1| PREDICTED: cyclin-dependent kinase F-1-like [Musa acuminata subsp. 
malaccensis]
Length=448

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 145/186 (78%), Gaps = 11/186 (6%)
 Frame = +1

Query  139  MDSPP---------SKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKE  291
            MDS P         S+SWSI+ R EI  +YEI  R+GSGAY+DVYRGRRRSD L VALKE
Sbjct  1    MDSSPPPQMPSQTSSRSWSIYGRGEIIERYEILGRIGSGAYADVYRGRRRSDGLVVALKE  60

Query  292  IHDYQSALREIEALQTLQNCPNVVVMHEFFWSED-EDSVLVLEFLPTDLGAVIKAAKKNW  468
            IHDYQS+ REIEALQ L+  PNVV + E+FW+ED ED+VLVLEFLP DLGAVI  AK+  
Sbjct  61   IHDYQSSFREIEALQALRGAPNVVDLIEYFWNEDEEDAVLVLEFLPADLGAVILEAKRG-  119

Query  469  DNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
              G+ +GE+K+WM+QIL AV+ACHR+S+VHRDLKPSNLLIS +G+LKLADFGQ+ ML   
Sbjct  120  GAGIAIGEVKQWMLQILRAVEACHRSSVVHRDLKPSNLLISADGVLKLADFGQSMMLQET  179

Query  649  GLAAVD  666
             L ++D
Sbjct  180  RLTSLD  185



>ref|XP_010047911.1| PREDICTED: cyclin-dependent kinase F-1 [Eucalyptus grandis]
 gb|KCW79936.1| hypothetical protein EUGRSUZ_C01269 [Eucalyptus grandis]
Length=484

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 151/213 (71%), Gaps = 9/213 (4%)
 Frame = +1

Query  157  KSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQ  336
            KSWSIHTR+EI  +YEI ERVGSGAYSDVYRGRR SD L VALKE+HDYQSA REIEALQ
Sbjct  13   KSWSIHTRREIIARYEILERVGSGAYSDVYRGRRLSDGLAVALKEVHDYQSAFREIEALQ  72

Query  337  TLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAK-------KNWDNGLTVGEI  495
             L+  P+VV++HE+FW EDED+VLVLEFL +DL AVI  A              L  GE+
Sbjct  73   ILRGSPHVVLLHEYFWREDEDAVLVLEFLRSDLAAVIADASRRPRDGGGGGAAALRAGEV  132

Query  496  KRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVD-DG  672
            KRWM+Q+L  VDACHRNSIVHRDLKP NLLIS+ G+LK+ADFGQAR+LL  G  A D + 
Sbjct  133  KRWMLQVLEGVDACHRNSIVHRDLKPGNLLISEEGVLKIADFGQARILLDDGNVAPDYEP  192

Query  673  QPYGKASPNVPTPMYTPEFVPVMENAYREGQSH  771
            + + + S      +  PE +   +    EGQ H
Sbjct  193  ESFEERSSEQADILQQPETMEA-DTTCPEGQEH  224



>ref|XP_003620628.1| Protein kinase [Medicago truncatula]
 gb|AES76846.1| cyclin-dependent kinase [Medicago truncatula]
Length=417

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 146/220 (66%), Gaps = 15/220 (7%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP+KSWSIHTR EIT KY IF  +GSG YSDVY GRR SD   VALKEIHD+QSA REI 
Sbjct  3    PPTKSWSIHTRPEITTKYSIFTHIGSGTYSDVYSGRRLSDGTPVALKEIHDHQSASREIT  62

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            AL+ L+   NVV MHEFFW EDED+V+VLEFL +DLG VI+       +G   GE+K WM
Sbjct  63   ALRILRGSENVVFMHEFFWREDEDAVIVLEFLKSDLGTVIR-------DGFGGGEVKGWM  115

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGK  687
            +QI+S V  CHRN IVHRDLKP N L+S+NG+LK+ADFGQAR+L+  G  A + G     
Sbjct  116  MQIVSGVYDCHRNGIVHRDLKPENFLVSENGVLKIADFGQARILVKSGFDATNHGSSSHS  175

Query  688  ASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
              P+        + +P+ +NA + G  +  +      D +
Sbjct  176  QHPH--------DVIPLSDNANQTGYENQDEEERMTHDEY  207



>gb|ACU19808.1| unknown [Glycine max]
Length=465

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 149/221 (67%), Gaps = 7/221 (3%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP K+WSIHTR EIT KY++  RVGSG Y+DVY  RR SD   V LKE+HD QSA REIE
Sbjct  3    PPPKTWSIHTRSEITAKYQVLSRVGSGVYADVYCARRLSDGAAVGLKEVHDSQSASREIE  62

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            AL+ L+   NVVV+HEFFW EDED+VLVLEFL TDL  VI       + G+ V E KRWM
Sbjct  63   ALRLLKGSRNVVVLHEFFWREDEDAVLVLEFLGTDLATVIG------EGGVGVAEAKRWM  116

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGL-AAVDDGQPYG  684
            VQ LSAVD CHRN IVHRDLKP+N L+SD+G LKLADFGQAR+L+  G  A  ++  PY 
Sbjct  117  VQALSAVDECHRNMIVHRDLKPANFLVSDDGALKLADFGQARILVESGFDAPQENPPPYE  176

Query  685  KASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
              + N  + +  PE +  + N  +    +  Q  V+ E+ F
Sbjct  177  DDASNSESSLQHPETISQLVNLNQTVYENPNQGTVSHEEYF  217



>gb|ABR18101.1| unknown [Picea sitchensis]
Length=433

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALR  318
            M+     SWS+H  KEI  +YEI ERVGSG YSDVYRGRR+ D L VALKE+HDYQS+ R
Sbjct  1    MEDNVQSSWSLHGNKEICARYEILERVGSGTYSDVYRGRRKEDGLIVALKEVHDYQSSWR  60

Query  319  EIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIK  498
            EIEALQ L  CPNVV ++E+FW E+ED+VLVLEFLP+DL +VIK+AK   +NG+   E+K
Sbjct  61   EIEALQRLSGCPNVVRLYEWFWRENEDAVLVLEFLPSDLYSVIKSAKNKGENGIAEAEVK  120

Query  499  RWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
             WM+QIL  +  CH N ++HRDLKPSNLLIS +GILKLADFGQAR+L  P 
Sbjct  121  AWMIQILQGLADCHANWVIHRDLKPSNLLISADGILKLADFGQARILEEPA  171



>ref|XP_007152857.1| hypothetical protein PHAVU_004G165900g [Phaseolus vulgaris]
 gb|ESW24851.1| hypothetical protein PHAVU_004G165900g [Phaseolus vulgaris]
Length=437

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 151/220 (69%), Gaps = 9/220 (4%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP+KSW IHTR EIT KYE+   VGSGAY+DVY GRRRSD   VALKE+HD  SA REIE
Sbjct  3    PPTKSWGIHTRSEITAKYEVIGWVGSGAYADVYDGRRRSDGAAVALKEVHDSHSASREIE  62

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            AL+ LQ   NVVV+HEFFW EDED+VLVLEFL TDL AVI            VGE+KRWM
Sbjct  63   ALRVLQGSQNVVVLHEFFWREDEDAVLVLEFLGTDLAAVIGEGGV------GVGEVKRWM  116

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGK  687
            +Q LSAVD CHRN IVHRDLKP+N L+SD+G+LKLADFGQAR+L+  G    D  Q    
Sbjct  117  LQALSAVDECHRNMIVHRDLKPANFLVSDDGVLKLADFGQARILVESGF---DGPQEDDD  173

Query  688  ASPNVPTPMYTPEFVPVMENAYREGQSHHYQRNVAKEDRF  807
             S +  +     E +  +EN  + GQ +   R+++ E+ F
Sbjct  174  VSNSERSLQQHREAISQLENLNQTGQENPDHRSLSHEEYF  213



>ref|XP_003534210.1| PREDICTED: cyclin-dependent kinase F-1-like [Glycine max]
Length=449

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 131/177 (74%), Gaps = 5/177 (3%)
 Frame = +1

Query  148  PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIE  327
            PP K+WSIH R EIT KYE+  RVGSGAY+DVYR  R SD  +VALKE+HD QSA REIE
Sbjct  3    PPPKTWSIHMRSEITAKYEVLNRVGSGAYADVYRAIRLSDGASVALKEVHDSQSASREIE  62

Query  328  ALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
            AL+ L+   NVVV+HEFFW EDED+VLVLEFL TDL AVI            VGEIK WM
Sbjct  63   ALRLLKGSRNVVVLHEFFWREDEDAVLVLEFLGTDLAAVIGEGDGV-----GVGEIKGWM  117

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQP  678
            VQ LSAVD CHRN IVHRDLKPSN L+SD+G+LKL DFGQAR+L+  G  A  +  P
Sbjct  118  VQALSAVDECHRNMIVHRDLKPSNFLVSDDGVLKLGDFGQARILVESGFNAPQENPP  174



>ref|XP_009380563.1| PREDICTED: cyclin-dependent kinase F-1-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 133/164 (81%), Gaps = 4/164 (2%)
 Frame = +1

Query  154  SKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEAL  333
            S+SWSI+ R EIT +Y+I  R+GSGAY+DVYRGRRRSD L VALKEIHDYQS+ REIEAL
Sbjct  15   SRSWSIYGRAEITGRYDILGRIGSGAYADVYRGRRRSDGLDVALKEIHDYQSSAREIEAL  74

Query  334  QTLQNCPNVVVMHEFFWS--EDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWM  507
              L+  PNVV + E+FW   EDED+VLVLEFLP DL AVI+ AK+       VGE+K+WM
Sbjct  75   LALRGAPNVVDLLEYFWGEDEDEDAVLVLEFLPADLAAVIRDAKRA--GAFAVGEVKQWM  132

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            +QIL  ++ CHR+S+VHRDLKPSNLLIS +GILKLADFGQ+R+L
Sbjct  133  IQILRGLETCHRSSVVHRDLKPSNLLISADGILKLADFGQSRIL  176



>ref|XP_008801528.1| PREDICTED: cyclin-dependent kinase F-1-like [Phoenix dactylifera]
Length=476

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = +1

Query  169  IHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQTLQN  348
            I+ R EIT +YEI ER+G GAY+DVYR RRRSD + VALKEIHDYQS+ REIEALQ LQ+
Sbjct  13   IYGRSEITQRYEILERIGYGAYADVYRARRRSDGVVVALKEIHDYQSSFREIEALQILQD  72

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAV  528
             PNVV + E+FW EDE +VLVLEFLP+DL +VI+ AK+    G+ VGE+K+WM+QIL  V
Sbjct  73   SPNVVDLLEYFWQEDE-AVLVLEFLPSDLASVIRDAKRG--GGIAVGEVKQWMLQILRGV  129

Query  529  DACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
             ACHRN++VHRDLKPSNLLIS  GILKLADFGQ+R+L
Sbjct  130  GACHRNAVVHRDLKPSNLLISSQGILKLADFGQSRIL  166



>ref|XP_006833351.1| PREDICTED: cyclin-dependent kinase F-1 [Amborella trichopoda]
 gb|ERM98629.1| hypothetical protein AMTR_s00109p00093510 [Amborella trichopoda]
Length=464

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 132/184 (72%), Gaps = 9/184 (5%)
 Frame = +1

Query  154  SKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEAL  333
            S+SWSIHT   IT +Y+I   +GSGAYSDVY+ +R  D L VALKEIHD QSA+RE++AL
Sbjct  5    SRSWSIHTNPAITQRYQILHGIGSGAYSDVYKAKRLFDGLIVALKEIHDQQSAIRELQAL  64

Query  334  QTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
            QTL   PN+V + E+FWS+ +D VLVLEFLP DL  +I  AKK W+ G+ V E+KRWM+Q
Sbjct  65   QTLNGAPNIVQLIEYFWSDHDDPVLVLEFLPMDLNGLIAEAKKEWNGGIRVSEMKRWMIQ  124

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKAS  693
            +L  V+ACH  SI+HRDLKPSNLL+S +G +KLADFGQA +L  P         PY    
Sbjct  125  VLKGVEACHGCSIMHRDLKPSNLLVSADGEVKLADFGQAIILQEP---------PYASEE  175

Query  694  PNVP  705
             NVP
Sbjct  176  VNVP  179



>ref|XP_010925885.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-dependent kinase F-1 [Elaeis 
guineensis]
Length=477

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 142/193 (74%), Gaps = 9/193 (5%)
 Frame = +1

Query  139  MDSPP--SKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSA  312
            MD PP  S+SWSI+ + EIT +YEI E +G GAY+DVYR  RRSD + VALKE+HDY+S+
Sbjct  1    MDPPPLSSRSWSIYGQSEITQRYEILECIGYGAYADVYRACRRSDGVVVALKEVHDYESS  60

Query  313  LREIEALQTLQNCPNVVVMHEFFWS----EDEDSVLVLEFLPTDLGAVIKAAKKNWDNGL  480
             REIEALQ L++ PN V + E+FW      DED+VLVLEFLPTDL +VI  AK+    G+
Sbjct  61   FREIEALQILRDAPNAVDLLEYFWQEDDDADEDAVLVLEFLPTDLASVICDAKRG--GGI  118

Query  481  TVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAA  660
             VGE+K+W++QIL  + ACH+N++VHRDLKPSNLLIS  G+LKLADFGQ+R+L      +
Sbjct  119  AVGEVKQWILQILRGLGACHQNAVVHRDLKPSNLLISAEGVLKLADFGQSRILQETRFIS  178

Query  661  VDDGQPYGKASPN  699
              DG  + + S N
Sbjct  179  T-DGSLHQQGSEN  190



>ref|XP_003563822.1| PREDICTED: cyclin-dependent kinase F-1 [Brachypodium distachyon]
Length=446

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 121/163 (74%), Gaps = 5/163 (3%)
 Frame = +1

Query  160  SWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQT  339
            SWSIH R ++T +YE+  R GSGAY+DVYRGRRRSD   VALKE+HD  SA RE++AL  
Sbjct  12   SWSIHGRPDVTSRYEVLGRAGSGAYADVYRGRRRSDGAAVALKEVHDALSAQREVDALLA  71

Query  340  L--QNCPNVVVMHEFFWSED-EDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMV  510
            +   + P+VV + + F   D +D VLVLE+LP DL AV++  ++    G+  G++KRWM+
Sbjct  72   VASDSSPHVVALLDHFPGGDHDDDVLVLEWLPLDLAAVVRDGRRA--GGVPAGQLKRWML  129

Query  511  QILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            Q++  V ACHR  +VHRDLKP NLLIS++G+LK+ADFGQAR+L
Sbjct  130  QVIQGVAACHRAGVVHRDLKPGNLLISEDGVLKIADFGQARIL  172



>dbj|BAK00218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 121/163 (74%), Gaps = 5/163 (3%)
 Frame = +1

Query  160  SWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQT  339
            SWSIH R ++T +Y++  R GSGAY+DVYRGRRRSD   VALKE+HD  SA RE +AL  
Sbjct  13   SWSIHGRPDVTSRYDVLGRAGSGAYADVYRGRRRSDGAPVALKEVHDAVSAQREADALLA  72

Query  340  L--QNCPNVVVMHEFFWSED-EDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMV  510
            +  ++ P+VV + + F   D +D VLVLE+LP DL AV++  ++    GL  G++KRWM+
Sbjct  73   VASESSPHVVALLDHFPGGDHDDDVLVLEWLPLDLAAVVREGRRA--GGLPAGQLKRWML  130

Query  511  QILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            Q++  V ACHR  +VHRDLKP NLLIS++G+LK+ADFGQAR+L
Sbjct  131  QVIEGVAACHRAGLVHRDLKPGNLLISEHGVLKVADFGQARIL  173



>ref|NP_001150420.1| CAK1AT [Zea mays]
 gb|ACG39033.1| CAK1AT [Zea mays]
 gb|AFW76713.1| CAK1AT [Zea mays]
Length=481

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 117/166 (70%), Gaps = 6/166 (4%)
 Frame = +1

Query  160  SWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQT  339
            SWSIH R ++T +YE+  R GSG+Y+DVYRGRRRSD   VALKE+HD  SA  E+EAL  
Sbjct  9    SWSIHGRADVTSRYEVLGRAGSGSYADVYRGRRRSDGAAVALKEVHDAVSARSEVEALLA  68

Query  340  LQNCPNVVVMHEFFWSED-EDSVLVLEFLPTDLGAVIK-----AAKKNWDNGLTVGEIKR  501
            +   PNVV + + F   D +D VLVLE+LP DL AV++     A       G+   ++KR
Sbjct  69   IPPSPNVVALIDHFPGGDCDDDVLVLEWLPLDLAAVVRDARRRAGGGEGGEGIPASQLKR  128

Query  502  WMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            WM+Q+L  V ACHR  +VHRDLKP NLLIS++G+LK+ADFGQAR+L
Sbjct  129  WMLQVLEGVAACHRAGVVHRDLKPENLLISEDGVLKVADFGQARIL  174



>ref|XP_002437039.1| hypothetical protein SORBIDRAFT_10g019630 [Sorghum bicolor]
 gb|EER88406.1| hypothetical protein SORBIDRAFT_10g019630 [Sorghum bicolor]
Length=479

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 116/166 (70%), Gaps = 6/166 (4%)
 Frame = +1

Query  160  SWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQT  339
            SWSIH R ++T +YE+    GSGAY+DVYRGRRRSD   VALKE+HD  SA RE EAL  
Sbjct  8    SWSIHGRADVTSRYEVLGHAGSGAYADVYRGRRRSDGSAVALKEVHDAVSARREAEALLA  67

Query  340  LQNCPNVVVMHEFFWSED-EDSVLVLEFLPTDLGAVIK-----AAKKNWDNGLTVGEIKR  501
            +   PNVV + + F   D +D VLVLE+LP DL AV++     A       G+   ++KR
Sbjct  68   IPPSPNVVALLDHFPGGDCDDDVLVLEWLPLDLAAVVRDARRRAGGGEGPGGIPASQLKR  127

Query  502  WMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            WM+Q+L  V ACHR  +VHRDLKP NLLIS++G+LK+ADFGQAR+L
Sbjct  128  WMLQVLEGVAACHRAGVVHRDLKPENLLISEDGVLKVADFGQARIL  173



>gb|EMS50112.1| Cyclin-dependent kinase F-1 [Triticum urartu]
Length=461

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 116/159 (73%), Gaps = 5/159 (3%)
 Frame = +1

Query  160  SWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEAL--  333
            SWSIH R ++T +Y++  R GSGAY+DVYRGRRRSD   VALKE+HD  SA RE +AL  
Sbjct  11   SWSIHGRPDVTSRYDVLGRAGSGAYADVYRGRRRSDGAPVALKEVHDAVSAQREADALLA  70

Query  334  QTLQNCPNVVVMHEFFWSED-EDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMV  510
               ++ P+V+ + + F   D +D VLVLE+LP DL AV++  ++    GL  G++KRWM+
Sbjct  71   AASESSPHVITLLDHFPGGDHDDDVLVLEWLPLDLAAVVREGRRA--GGLPAGQLKRWML  128

Query  511  QILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQ  627
            Q++  V ACHR  +VHRDLKP NLLIS++G+LK+ADFGQ
Sbjct  129  QVIEGVAACHRAVLVHRDLKPGNLLISEDGVLKVADFGQ  167



>ref|XP_004965464.1| PREDICTED: cyclin-dependent kinase F-1-like [Setaria italica]
Length=477

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = +1

Query  160  SWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQT  339
            SWSIH R ++T +YE+  R GSGAY+DVYRGRRRSD  TVALKE+HD  SA RE EAL  
Sbjct  8    SWSIHGRADVTSRYEVLGRAGSGAYADVYRGRRRSDGATVALKEVHDAVSARREAEALLA  67

Query  340  LQNCPNVVVMHEFFWSED-EDSVLVLEFLPTDL---GAVIKAAKKNWDNGLTVGEIKRWM  507
            +   P+VV + + F   D +D VLVLE++P DL       +        G+   ++KRWM
Sbjct  68   VSPSPHVVALLDHFPGGDCDDDVLVLEWVPLDLAAVVRDARRRAAGGGGGIPTAQLKRWM  127

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            +Q+L  V ACHR  +VHRDLKP+NLLIS++G+LK+ADFGQAR+L
Sbjct  128  LQVLEGVAACHRAGVVHRDLKPANLLISEDGVLKVADFGQARIL  171



>sp|A2YCH5.1|CDKF1_ORYSI RecName: Full=Cyclin-dependent kinase F-1; Short=CDKF;1 [Oryza 
sativa Indica Group]
 gb|EAZ00786.1| hypothetical protein OsI_22813 [Oryza sativa Indica Group]
Length=479

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 114/165 (69%), Gaps = 1/165 (1%)
 Frame = +1

Query  160  SWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQT  339
            SWSIH R ++T +YE+  R GSGAY+DVYRGRRRSD   VALKE+HD  SA RE +AL  
Sbjct  11   SWSIHGRPDVTSRYEVLGRAGSGAYADVYRGRRRSDGAPVALKEVHDAVSARREADALLA  70

Query  340  LQNCPNVVVMHEFFWSED-EDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQI  516
                 +VV + + F   D +D VLVLE+LP DL AV++AA     +     + KRWM+Q+
Sbjct  71   AAPSRHVVALLDHFPGGDHDDDVLVLEWLPLDLSAVVRAAAAARPSAPPAAQRKRWMLQV  130

Query  517  LSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            L  V ACH   +VHRDLKP+NLLIS++G+LK+AD GQAR+L   G
Sbjct  131  LEGVAACHSAGVVHRDLKPANLLISEDGVLKVADLGQARILQETG  175



>ref|NP_001057551.1| Os06g0334400 [Oryza sativa Japonica Group]
 sp|Q5Z754.1|CDKF1_ORYSJ RecName: Full=Cyclin-dependent kinase F-1; Short=CDKF;1 [Oryza 
sativa Japonica Group]
 dbj|BAD61885.1| putative cyclin-dependent kinase-activating kinase 1At [Oryza 
sativa Japonica Group]
 dbj|BAF19465.1| Os06g0334400 [Oryza sativa Japonica Group]
Length=479

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 115/165 (70%), Gaps = 1/165 (1%)
 Frame = +1

Query  160  SWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQT  339
            SWSIH R ++T +YE+  R GSGAY+DVYRGRRRSD   VALKE+HD  SA RE +AL  
Sbjct  11   SWSIHGRPDVTSRYEVLGRAGSGAYADVYRGRRRSDGAPVALKEVHDAVSARREADALLA  70

Query  340  LQNCPNVVVMHEFFWSED-EDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQI  516
                 +VV + + F   D +D VLVLE+LP DL AV++AA     + L   + KRWM+Q+
Sbjct  71   AAPSRHVVALLDHFPGGDHDDDVLVLEWLPLDLSAVVRAAAAARPSALPAAQRKRWMLQV  130

Query  517  LSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            L  V ACH   +VHRDLKP+NLLIS++G+LK+AD GQAR+L   G
Sbjct  131  LEGVAACHSAGVVHRDLKPANLLISEDGVLKVADLGQARILQETG  175



>ref|XP_002981667.1| hypothetical protein SELMODRAFT_444958 [Selaginella moellendorffii]
 gb|EFJ17149.1| hypothetical protein SELMODRAFT_444958 [Selaginella moellendorffii]
Length=453

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 105/160 (66%), Gaps = 4/160 (3%)
 Frame = +1

Query  160  SWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQT  339
            SWSI+  +E+  +Y + + +GSGAYSDVY G+RR D L VALKE+HD +S+ RE+ ALQ 
Sbjct  17   SWSIYENREVLARYAVLDPIGSGAYSDVYHGKRRDDGLHVALKEVHDGKSSSRELAALQL  76

Query  340  LQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQIL  519
            L N  +VV + +  W      +LVLEFLP  L  VI+  K   +      E + WM QIL
Sbjct  77   LTNSSHVVQLLDHVWLH-PGVLLVLEFLPGSLAEVIEERK---EIPFQEFEARNWMEQIL  132

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
             AV  CH   I+HRDLKPSNLLIS +G+LK+ADFG A +L
Sbjct  133  KAVAECHSAGILHRDLKPSNLLISSDGVLKVADFGTALVL  172



>ref|XP_002967851.1| hypothetical protein SELMODRAFT_408721 [Selaginella moellendorffii]
 gb|EFJ31198.1| hypothetical protein SELMODRAFT_408721 [Selaginella moellendorffii]
Length=457

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 106/162 (65%), Gaps = 4/162 (2%)
 Frame = +1

Query  154  SKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEAL  333
            + SWSI+  +E+  +Y + + +GSGAYSDVY G+RR D L VALKE+HD +S+ RE+ AL
Sbjct  16   ASSWSIYENREVLARYAVLDPIGSGAYSDVYHGKRRDDGLHVALKEVHDGKSSSRELAAL  75

Query  334  QTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
            Q L N  +VV + +  W      +LVLEFLP  L  VI+  K   +      E + WM Q
Sbjct  76   QLLTNSSHVVQLLDHVWLH-PGVLLVLEFLPGSLAEVIEERK---EIPFQEFEARNWMEQ  131

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            IL AV  CH   I+HRDLKPSNLLIS +G+LK+ADFG A +L
Sbjct  132  ILKAVAECHSAGILHRDLKPSNLLISSDGVLKVADFGTALVL  173



>ref|XP_001770144.1| predicted protein [Physcomitrella patens]
 gb|EDQ65126.1| predicted protein, partial [Physcomitrella patens]
Length=293

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 101/145 (70%), Gaps = 6/145 (4%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQSALREIEALQTLQNCPNVVVMHEF  378
            YE+ ER+G G Y +VY+G+R+SD L VALKE  D Q A RE+EAL  L N PNVV + E+
Sbjct  1    YEVLERLGEGTYGEVYKGQRKSDGLVVALKETRDPQCAAREVEALLAL-NHPNVVKLIEY  59

Query  379  FWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVH  558
            F  +  + +LVLEFLP+DL   +       D  ++  EIK WM+QIL  V ACHR SI+H
Sbjct  60   F-VQGPNLILVLEFLPSDLYRELDGR----DGRISEPEIKGWMLQILRGVAACHRASILH  114

Query  559  RDLKPSNLLISDNGILKLADFGQAR  633
            RDLKPSNLL+  +G +K+ADFGQAR
Sbjct  115  RDLKPSNLLVGADGSVKVADFGQAR  139



>emb|CCK68222.1| hypothetical protein KNAG_0A05580 [Kazachstania naganishii CBS 
8797]
Length=305

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 97/152 (64%), Gaps = 13/152 (9%)
 Frame = +1

Query  214  RVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVMH  372
            +VG G Y+ VY G R+SDS  +A+KEI   +       SA+RE++ LQ L++ PNV+ + 
Sbjct  10   KVGEGTYAVVYLGTRQSDSKKIAIKEIKTSEFKDGLDMSAIREVKYLQELEH-PNVIRLM  68

Query  373  EFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSI  552
            + F + +  + LVLEFLP+DL  VIK     +    T  +IK W++  L  V  CHRN +
Sbjct  69   DIFMAYNNLN-LVLEFLPSDLEVVIKDKSVLF----TQADIKSWLLMTLRGVHHCHRNFV  123

Query  553  VHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +HRDLKP+NLLIS  GI+K+ADFG AR +  P
Sbjct  124  LHRDLKPNNLLISPEGIIKVADFGLARAVPNP  155



>ref|XP_003866466.1| serine/threonine protein kinase [Candida orthopsilosis Co 90-125]
 emb|CCG21026.1| serine/threonine protein kinase [Candida orthopsilosis Co 90-125]
Length=393

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 103/181 (57%), Gaps = 23/181 (13%)
 Frame = +1

Query  214  RVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVMH  372
            +VG G Y+ VY G++ S    +A+KEI           SA+RE++ LQ L++ PNV+ + 
Sbjct  72   KVGEGTYAVVYLGKQTSTKRPIAIKEIKTGLFKDGLDMSAIREVKYLQELKH-PNVIELI  130

Query  373  EFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSI  552
            + F + + +  LVLEFLP DL  +IK     + +     +IK WM+  L  +  CHRN I
Sbjct  131  DVFATSNNNLNLVLEFLPCDLEVLIKDKNIVFKSA----DIKSWMLMTLRGIHHCHRNFI  186

Query  553  VHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPTPMY-TPEF  729
            +HRDLKP+NLLIS NG+LK+ADFG AR L          G P    S NV T  Y  PE 
Sbjct  187  LHRDLKPNNLLISPNGLLKIADFGLARSL----------GNPNEDLSSNVVTRWYRAPEL  236

Query  730  V  732
            +
Sbjct  237  L  237



>ref|XP_001528082.1| serine/threonine-protein kinase KIN28 [Lodderomyces elongisporus 
NRRL YB-4239]
 gb|EDK42424.1| serine/threonine-protein kinase KIN28 [Lodderomyces elongisporus 
NRRL YB-4239]
Length=369

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 118/222 (53%), Gaps = 30/222 (14%)
 Frame = +1

Query  103  LITKQEREKETPMDS----PPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDS  270
            L+++Q +     M +    PPS S      K I  KY    +VG G Y+ VY G+++S  
Sbjct  12   LLSEQNKGNSASMTNANHLPPSLS---DQNKAIQNKYTKERKVGEGTYAVVYLGKQQSTK  68

Query  271  LTVALKEIHDY-------QSALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPT  429
             ++A+KEI           SA+RE++ LQ L++  NV+ + + F + D +  LVLEFLP 
Sbjct  69   RSIAIKEIKTGLFKDGLDMSAIREVKYLQELKH-QNVIELIDVFSATDNNLNLVLEFLPF  127

Query  430  DLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILK  609
            DL  +IK    + D      +IK WM+  L  +  CHRN I+HRDLKP+NLLIS  G LK
Sbjct  128  DLEVLIK----DKDIVFKSADIKSWMLMTLRGIHHCHRNHILHRDLKPNNLLISPLGQLK  183

Query  610  LADFGQARMLLAPGLAAVDDGQPYGKASPNVPTPMY-TPEFV  732
            +ADFG AR L          G P    S NV T  Y  PE +
Sbjct  184  IADFGLARSL----------GNPNEDLSCNVVTRWYRAPELL  215



>ref|XP_003668608.1| hypothetical protein NDAI_0B03310 [Naumovozyma dairenensis CBS 
421]
 emb|CCD23365.1| hypothetical protein NDAI_0B03310 [Naumovozyma dairenensis CBS 
421]
Length=313

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 101/161 (63%), Gaps = 17/161 (11%)
 Frame = +1

Query  193  IKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNC  351
            ++Y   ++VG G Y+ VY G ++S    +A+KEI   +       SA+RE++ LQ +Q+ 
Sbjct  12   VEYTKEKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEMQH-  70

Query  352  PNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGL--TVGEIKRWMVQILSA  525
             NV+ + + F + D  + LVLEFLPTDL  +IK      D  +  T  +IK WM+  L  
Sbjct  71   DNVIELIDIFMAYDNLN-LVLEFLPTDLEVIIK------DKSILFTPADIKSWMLMTLRG  123

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            V  CHRN I+HRDLKP+NLL+S +GI+K+ADFG AR + AP
Sbjct  124  VHHCHRNFILHRDLKPNNLLVSPDGIIKVADFGLARAIPAP  164



>emb|CCE43061.1| hypothetical protein CPAR2_207040 [Candida parapsilosis]
Length=362

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 103/181 (57%), Gaps = 23/181 (13%)
 Frame = +1

Query  214  RVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVMH  372
            +VG G Y+ VY G++ +    +A+KEI           SA+RE++ LQ L++ PNV+ + 
Sbjct  41   KVGEGTYAVVYLGKQTATKRPIAIKEIKTGLFKDGLDMSAIREVKYLQELKH-PNVIELI  99

Query  373  EFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSI  552
            + F + + +  LVLEFLP DL  +IK     + +     +IK WM+  L  +  CHRN I
Sbjct  100  DVFATSNNNLNLVLEFLPCDLEVLIKDKSIVFKSA----DIKSWMLMTLRGIHHCHRNFI  155

Query  553  VHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPTPMY-TPEF  729
            +HRDLKP+NLLIS NG+LK+ADFG AR L          G P    S NV T  Y  PE 
Sbjct  156  LHRDLKPNNLLISPNGLLKIADFGLARSL----------GNPNEDLSSNVVTRWYRAPEL  205

Query  730  V  732
            +
Sbjct  206  L  206



>ref|XP_003955249.1| hypothetical protein KAFR_0A06790 [Kazachstania africana CBS 
2517]
 emb|CCF56114.1| hypothetical protein KAFR_0A06790 [Kazachstania africana CBS 
2517]
Length=304

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = +1

Query  193  IKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNC  351
            ++Y   ++VG G Y+ VY G +RS +  +A+KEI   +       SA+RE++ LQ L N 
Sbjct  1    MEYSKEKKVGEGTYAVVYVGTQRSTNRQIAIKEIKTSEFKDGLDMSAIREVKYLQEL-NH  59

Query  352  PNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVD  531
            PNV+ + + F + D  + LVLEFLP+DL  +IK    + +   T G+IK WM+  L  + 
Sbjct  60   PNVISLIDIFMAYDNLN-LVLEFLPSDLEVIIK----DRNILFTPGDIKAWMLMTLRGIH  114

Query  532  ACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
              HRN ++HRDLKP+NLL+S +G++K+ADFG AR++  P
Sbjct  115  HIHRNFVLHRDLKPNNLLLSPDGMIKIADFGLARIMPGP  153



>gb|EWG91686.1| Kin28p [Saccharomyces cerevisiae P301]
Length=306

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTL  342
            ++ ++Y   ++VG G Y+ VY G + S    +A+KEI   +       SA+RE++ LQ +
Sbjct  2    KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM  61

Query  343  QNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILS  522
            Q+ PNV+ + + F S D  + LVLEFLPTDL  VIK     +    T  +IK WM+  L 
Sbjct  62   QH-PNVIELIDIFMSYDNLN-LVLEFLPTDLEVVIKDKSILF----TPADIKAWMLMTLR  115

Query  523  AVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             V  CHRN I+HRDLKP+NLL S +G +K+ADFG AR + AP
Sbjct  116  GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP  157



>gb|AJU99024.1| Kin28p [Saccharomyces cerevisiae YJM1385]
 gb|AJV03236.1| Kin28p [Saccharomyces cerevisiae YJM1400]
 gb|AJV15749.1| Kin28p [Saccharomyces cerevisiae YJM1479]
Length=306

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTL  342
            ++ ++Y   ++VG G Y+ VY G + S    +A+KEI   +       SA+RE++ LQ +
Sbjct  2    KVNMEYTKEKKVGEGTYAVVYLGSQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM  61

Query  343  QNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILS  522
            Q+ PNV+ + + F + D  + LVLEFLPTDL  VIK     +    T  +IK WM+  L 
Sbjct  62   QH-PNVIELIDIFMAYDNLN-LVLEFLPTDLEVVIKDKSILF----TPADIKAWMLMTLR  115

Query  523  AVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             V  CHRN I+HRDLKP+NLL S +G +K+ADFG AR + AP
Sbjct  116  GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP  157



>ref|XP_009267171.1| Serine/threonine-protein kinase crk1 [Wallemia ichthyophaga EXF-994]
 gb|EOR02004.1| Serine/threonine-protein kinase crk1 [Wallemia ichthyophaga EXF-994]
Length=351

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 98/165 (59%), Gaps = 17/165 (10%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            I  +Y    +VG G Y+ VY+G        VA+K+I   Q       SA+RE++ LQ L+
Sbjct  8    IMKRYSKERKVGEGTYASVYQGHCVETGRMVAIKKIKIGQFKDGLDMSAIREVKFLQELK  67

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQIL  519
            +  NV+ M + F S  ++  LVLEFL TDL  +IK      D  L    G+IK WM   L
Sbjct  68   H-ENVIEMLDVF-SAKQNLNLVLEFLTTDLELIIK------DRSLIFRPGDIKSWMAMTL  119

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGL  654
              VD CHRN I+HRDLKP+NLLI+D GILK+ADFG AR +  PG+
Sbjct  120  RGVDWCHRNFILHRDLKPNNLLINDKGILKVADFGLARDVADPGM  164



>ref|NP_010175.1| TFIIH complex serine/threonine-protein kinase subunit KIN28 [Saccharomyces 
cerevisiae S288c]
 sp|P06242.1|KIN28_YEAST RecName: Full=Serine/threonine-protein kinase KIN28 [Saccharomyces 
cerevisiae S288c]
 emb|CAA28019.1| protein kinase [Saccharomyces cerevisiae]
 emb|CAA64904.1| KIN28 [Saccharomyces cerevisiae]
 emb|CAA98675.1| KIN28 [Saccharomyces cerevisiae]
 gb|EDN60251.1| transcription initiation factor TFIIH subunit [Saccharomyces 
cerevisiae YJM789]
 gb|EDV08378.1| serine/threonine-protein kinase KIN28 [Saccharomyces cerevisiae 
RM11-1a]
 emb|CAY78401.1| Kin28p [Saccharomyces cerevisiae EC1118]
 tpg|DAA11752.1| TPA: TFIIH complex serine/threonine-protein kinase subunit KIN28 
[Saccharomyces cerevisiae S288c]
 gb|EIW11099.1| Kin28p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG86975.1| Kin28p [Saccharomyces cerevisiae R008]
 gb|EWG96899.1| Kin28p [Saccharomyces cerevisiae R103]
 gb|AHY74905.1| Kin28p [Saccharomyces cerevisiae YJM993]
 gb|AJP37645.1| Kin28p [Saccharomyces cerevisiae YJM1078]
 gb|AJU57758.1| Kin28p [Saccharomyces cerevisiae YJM189]
 gb|AJU58461.1| Kin28p [Saccharomyces cerevisiae YJM193]
 gb|AJU59149.1| Kin28p [Saccharomyces cerevisiae YJM195]
 gb|AJU59859.1| Kin28p [Saccharomyces cerevisiae YJM244]
 gb|AJU60525.1| Kin28p [Saccharomyces cerevisiae YJM248]
 gb|AJU61211.1| Kin28p [Saccharomyces cerevisiae YJM270]
 gb|AJU61924.1| Kin28p [Saccharomyces cerevisiae YJM271]
 gb|AJU62620.1| Kin28p [Saccharomyces cerevisiae YJM320]
 gb|AJU63319.1| Kin28p [Saccharomyces cerevisiae YJM326]
 gb|AJU64040.1| Kin28p [Saccharomyces cerevisiae YJM428]
 gb|AJU64725.1| Kin28p [Saccharomyces cerevisiae YJM450]
 gb|AJU65437.1| Kin28p [Saccharomyces cerevisiae YJM451]
 gb|AJU66156.1| Kin28p [Saccharomyces cerevisiae YJM453]
 gb|AJU66837.1| Kin28p [Saccharomyces cerevisiae YJM456]
 gb|AJU68268.1| Kin28p [Saccharomyces cerevisiae YJM541]
 gb|AJU68962.1| Kin28p [Saccharomyces cerevisiae YJM554]
 gb|AJU69655.1| Kin28p [Saccharomyces cerevisiae YJM555]
 gb|AJU70368.1| Kin28p [Saccharomyces cerevisiae YJM627]
 gb|AJU71053.1| Kin28p [Saccharomyces cerevisiae YJM681]
 gb|AJU71765.1| Kin28p [Saccharomyces cerevisiae YJM682]
 gb|AJU72476.1| Kin28p [Saccharomyces cerevisiae YJM683]
 gb|AJU73187.1| Kin28p [Saccharomyces cerevisiae YJM689]
 gb|AJU73900.1| Kin28p [Saccharomyces cerevisiae YJM693]
 gb|AJU74613.1| Kin28p [Saccharomyces cerevisiae YJM969]
 gb|AJU75320.1| Kin28p [Saccharomyces cerevisiae YJM972]
 gb|AJU76027.1| Kin28p [Saccharomyces cerevisiae YJM975]
 gb|AJU76736.1| Kin28p [Saccharomyces cerevisiae YJM978]
 gb|AJU77448.1| Kin28p [Saccharomyces cerevisiae YJM981]
 gb|AJU78158.1| Kin28p [Saccharomyces cerevisiae YJM984]
 gb|AJU78870.1| Kin28p [Saccharomyces cerevisiae YJM987]
 gb|AJU79581.1| Kin28p [Saccharomyces cerevisiae YJM990]
 gb|AJU80182.1| Kin28p [Saccharomyces cerevisiae YJM996]
 gb|AJU81574.1| Kin28p [Saccharomyces cerevisiae YJM1129]
 gb|AJU82279.1| Kin28p [Saccharomyces cerevisiae YJM1133]
 gb|AJU82858.1| Kin28p [Saccharomyces cerevisiae YJM1190]
 gb|AJU83569.1| Kin28p [Saccharomyces cerevisiae YJM1199]
 gb|AJU84281.1| Kin28p [Saccharomyces cerevisiae YJM1202]
 gb|AJU84992.1| Kin28p [Saccharomyces cerevisiae YJM1208]
 gb|AJU85690.1| Kin28p [Saccharomyces cerevisiae YJM1242]
 gb|AJU86395.1| Kin28p [Saccharomyces cerevisiae YJM1244]
 gb|AJU87043.1| Kin28p [Saccharomyces cerevisiae YJM1248]
 gb|AJU87730.1| Kin28p [Saccharomyces cerevisiae YJM1250]
 gb|AJU88421.1| Kin28p [Saccharomyces cerevisiae YJM1252]
 gb|AJU89109.1| Kin28p [Saccharomyces cerevisiae YJM1273]
 gb|AJU89819.1| Kin28p [Saccharomyces cerevisiae YJM1304]
 gb|AJU90534.1| Kin28p [Saccharomyces cerevisiae YJM1307]
 gb|AJU91250.1| Kin28p [Saccharomyces cerevisiae YJM1311]
 gb|AJU91969.1| Kin28p [Saccharomyces cerevisiae YJM1326]
 gb|AJU92682.1| Kin28p [Saccharomyces cerevisiae YJM1332]
 gb|AJU93402.1| Kin28p [Saccharomyces cerevisiae YJM1336]
 gb|AJU94109.1| Kin28p [Saccharomyces cerevisiae YJM1338]
 gb|AJU94805.1| Kin28p [Saccharomyces cerevisiae YJM1341]
 gb|AJU95509.1| Kin28p [Saccharomyces cerevisiae YJM1342]
 gb|AJU96214.1| Kin28p [Saccharomyces cerevisiae YJM1355]
 gb|AJU96911.1| Kin28p [Saccharomyces cerevisiae YJM1356]
 gb|AJU97611.1| Kin28p [Saccharomyces cerevisiae YJM1381]
 gb|AJU98323.1| Kin28p [Saccharomyces cerevisiae YJM1383]
 gb|AJU99720.1| Kin28p [Saccharomyces cerevisiae YJM1386]
 gb|AJV00437.1| Kin28p [Saccharomyces cerevisiae YJM1387]
 gb|AJV01862.1| Kin28p [Saccharomyces cerevisiae YJM1389]
 gb|AJV02564.1| Kin28p [Saccharomyces cerevisiae YJM1399]
 gb|AJV03942.1| Kin28p [Saccharomyces cerevisiae YJM1401]
 gb|AJV04654.1| Kin28p [Saccharomyces cerevisiae YJM1402]
 gb|AJV05367.1| Kin28p [Saccharomyces cerevisiae YJM1415]
 gb|AJV06070.1| Kin28p [Saccharomyces cerevisiae YJM1417]
 gb|AJV06778.1| Kin28p [Saccharomyces cerevisiae YJM1418]
 gb|AJV07486.1| Kin28p [Saccharomyces cerevisiae YJM1419]
 gb|AJV08175.1| Kin28p [Saccharomyces cerevisiae YJM1433]
 gb|AJV08864.1| Kin28p [Saccharomyces cerevisiae YJM1434]
 gb|AJV09570.1| Kin28p [Saccharomyces cerevisiae YJM1439]
 gb|AJV10271.1| Kin28p [Saccharomyces cerevisiae YJM1443]
 gb|AJV12304.1| Kin28p [Saccharomyces cerevisiae YJM1450]
 gb|AJV13665.1| Kin28p [Saccharomyces cerevisiae YJM1463]
 gb|AJV14330.1| Kin28p [Saccharomyces cerevisiae YJM1477]
 gb|AJV15035.1| Kin28p [Saccharomyces cerevisiae YJM1478]
 gb|AJV16457.1| Kin28p [Saccharomyces cerevisiae YJM1526]
 gb|AJV17164.1| Kin28p [Saccharomyces cerevisiae YJM1527]
 gb|AJV18587.1| Kin28p [Saccharomyces cerevisiae YJM1573]
 gb|AJV19304.1| Kin28p [Saccharomyces cerevisiae YJM1574]
 gb|AJV20006.1| Kin28p [Saccharomyces cerevisiae YJM1592]
 gb|AJV20717.1| Kin28p [Saccharomyces cerevisiae YJM1615]
 prf||2102251A protein kinase
Length=306

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTL  342
            ++ ++Y   ++VG G Y+ VY G + S    +A+KEI   +       SA+RE++ LQ +
Sbjct  2    KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM  61

Query  343  QNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILS  522
            Q+ PNV+ + + F + D  + LVLEFLPTDL  VIK     +    T  +IK WM+  L 
Sbjct  62   QH-PNVIELIDIFMAYDNLN-LVLEFLPTDLEVVIKDKSILF----TPADIKAWMLMTLR  115

Query  523  AVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             V  CHRN I+HRDLKP+NLL S +G +K+ADFG AR + AP
Sbjct  116  GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP  157



>gb|AJV11620.1| Kin28p [Saccharomyces cerevisiae YJM1447]
Length=306

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTL  342
            ++ ++Y   ++VG G Y+ VY G + S    +A+KEI   +       SA+RE++ LQ +
Sbjct  2    KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM  61

Query  343  QNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILS  522
            Q+ PNV+ + + F + D  + LVLEFLPTDL  VIK     +    T  +IK WM+  L 
Sbjct  62   QH-PNVIELIDIFMAYDNLN-LVLEFLPTDLEVVIKDKSILF----TPADIKAWMLMTLR  115

Query  523  AVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             V  CHRN I+HRDLKP+NLL S +G +K+ADFG AR + AP
Sbjct  116  GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP  157



>dbj|GAA22140.1| K7_Kin28p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|AJU67553.1| Kin28p [Saccharomyces cerevisiae YJM470]
 gb|AJU80883.1| Kin28p [Saccharomyces cerevisiae YJM1083]
 gb|AJV01148.1| Kin28p [Saccharomyces cerevisiae YJM1388]
 gb|AJV12957.1| Kin28p [Saccharomyces cerevisiae YJM1460]
 gb|AJV17870.1| Kin28p [Saccharomyces cerevisiae YJM1549]
Length=306

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTL  342
            ++ ++Y   ++VG G Y+ VY G + S    +A+KEI   +       SA+RE++ LQ +
Sbjct  2    KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM  61

Query  343  QNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILS  522
            Q+ PNV+ + + F + D  + LVLEFLPTDL  VIK     +    T  +IK WM+  L 
Sbjct  62   QH-PNVIELIDIFMAYDNLN-LVLEFLPTDLEVVIKDKSILF----TPADIKAWMLMTLR  115

Query  523  AVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             V  CHRN I+HRDLKP+NLL S +G +K+ADFG AR + AP
Sbjct  116  GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP  157



>ref|NP_983813.1| ADL283Wp [Ashbya gossypii ATCC 10895]
 gb|AAS51637.1| ADL283Wp [Ashbya gossypii ATCC 10895]
 gb|AEY95933.1| FADL283Wp [Ashbya gossypii FDAG1]
Length=306

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 17/161 (11%)
 Frame = +1

Query  193  IKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNC  351
            + Y   ++VG G Y+ VY G R++D   +A+KEI   Q       SA+RE++ LQ +++ 
Sbjct  4    VNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA  63

Query  352  PNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGL--TVGEIKRWMVQILSA  525
             NV+ + + F ++ E+  LVLEFLP DL  +IK      D+ L  T  +IK W++  L  
Sbjct  64   -NVIELVDLFMAQ-ENLNLVLEFLPADLEMLIK------DSSLLFTQADIKSWLLMTLRG  115

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            V  CHR+ I+HRDLKP+NLL++ +G LK+ADFG AR L AP
Sbjct  116  VHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAP  156



>ref|XP_004179295.1| hypothetical protein TBLA_0B09590 [Tetrapisispora blattae CBS 
6284]
 emb|CCH59776.1| hypothetical protein TBLA_0B09590 [Tetrapisispora blattae CBS 
6284]
Length=307

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 101/160 (63%), Gaps = 17/160 (11%)
 Frame = +1

Query  193  IKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNC  351
            ++Y   ++VG G Y+ VY G ++S +  +A+KEI   +       SA+RE++ LQ L++ 
Sbjct  1    MEYSKEKKVGEGTYAVVYLGTKQSTNRRIAIKEIKTSEFKDGLDMSAIREVKYLQELRH-  59

Query  352  PNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVG--EIKRWMVQILSA  525
             N++ + + F + D  + LVLEFLPTDL  +IK      DN +     +IK W++  L  
Sbjct  60   ENIIELVDIFMAYDNLN-LVLEFLPTDLERIIK------DNSIIFSPSDIKSWILMTLRG  112

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLA  645
            V  CHRN I+HRDLKP+NLLIS NGI+KLADFG AR + A
Sbjct  113  VHHCHRNFILHRDLKPNNLLISPNGIIKLADFGLARAIPA  152



>gb|EEU08975.1| Kin28p [Saccharomyces cerevisiae JAY291]
Length=303

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 95/153 (62%), Gaps = 13/153 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G + S    +A+KEI   +       SA+RE++ LQ +Q+ PNV+ +
Sbjct  8    KKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-PNVIEL  66

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F + D  + LVLEFLPTDL  VIK     +    T  +IK WM+  L  V  CHRN 
Sbjct  67   IDIFMAYDNLN-LVLEFLPTDLEVVIKDKSILF----TPADIKAWMLMTLRGVYHCHRNF  121

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            I+HRDLKP+NLL S +G +K+ADFG AR + AP
Sbjct  122  ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP  154



>gb|AAT97347.1| GDBD-TEV-Kin28-HA fusion protein [Yeast two-hybrid vector pMK498-TEV]
Length=535

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTL  342
            ++ ++Y   ++VG G Y+ VY G + S    +A+KEI   +       SA+RE++ LQ +
Sbjct  183  KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM  242

Query  343  QNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILS  522
            Q+ PNV+ + + F + D  + LVLEFLPTDL  VIK     +    T  +IK WM+  L 
Sbjct  243  QH-PNVIELIDIFMAYDNLN-LVLEFLPTDLEVVIKDKSILF----TPADIKAWMLMTLR  296

Query  523  AVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             V  CHRN I+HRDLKP+NLL S +G +K+ADFG AR + AP
Sbjct  297  GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP  338



>gb|KDQ18931.1| hypothetical protein BOTBODRAFT_28411 [Botryobasidium botryosum 
FD-172 SS1]
Length=357

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 96/153 (63%), Gaps = 13/153 (8%)
 Frame = +1

Query  214  RVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVMH  372
            ++G G Y+ VYRGR+ S    VA+K+I   Q       SA+RE++ L+ L++ PNV+ + 
Sbjct  20   KIGEGTYAVVYRGRQSSTGRQVAIKKIKVGQFKDGLDMSAVREVKYLRELKH-PNVIELL  78

Query  373  EFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSI  552
            + F S  ++  LVLEFL +DL AVIK    +  N     +IK WM   L  ++ CHRN +
Sbjct  79   DVF-SSKQNLNLVLEFLESDLEAVIK----DRSNVFKPADIKSWMAMTLRGLEFCHRNFV  133

Query  553  VHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            +HRDLKP+NLLI+ +G LK+ADFG AR    PG
Sbjct  134  LHRDLKPNNLLIAADGQLKIADFGLARDFADPG  166



>dbj|BAO41303.1| serine/threonine-protein kinase KIN28 [Kluyveromyces marxianus 
DMKU3-1042]
 dbj|BAP72755.1| serine/threonine-protein kinase KIN28 [Kluyveromyces marxianus]
Length=310

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 95/153 (62%), Gaps = 13/153 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++ G G Y+ VY G ++S    +A+KEI   Q       SALRE++ LQ L++  N++ +
Sbjct  14   KKAGEGTYAVVYLGTKKSTGRQIAVKEIKTSQFKDGLDMSALREVKFLQELKH-DNIIEL  72

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S D  + LVLEFLP DL  +IK     +    T  +IK W++  L  V  CHRN 
Sbjct  73   IDVFMSNDNLN-LVLEFLPADLEIIIKDTSIMF----TQADIKSWLLMTLRGVHHCHRNF  127

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            I+HRDLKP+NLL++ NG LK+ADFG AR++ +P
Sbjct  128  ILHRDLKPNNLLLAPNGQLKIADFGLARLMASP  160



>gb|AAT97348.1| GDBD-TEV-CTDx3-Kin28-HA fusion protein [Yeast two-hybrid vector 
pMK500-TEV]
Length=556

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTL  342
            ++ ++Y   ++VG G Y+ VY G + S    +A+KEI   +       SA+RE++ LQ +
Sbjct  204  KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEM  263

Query  343  QNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILS  522
            Q+ PNV+ + + F + D  + LVLEFLPTDL  VIK     +    T  +IK WM+  L 
Sbjct  264  QH-PNVIELIDIFMAYDNLN-LVLEFLPTDLEVVIKDKSILF----TPADIKAWMLMTLR  317

Query  523  AVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             V  CHRN I+HRDLKP+NLL S +G +K+ADFG AR + AP
Sbjct  318  GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP  359



>ref|XP_003645675.1| hypothetical protein Ecym_3371 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET38858.1| Hypothetical protein Ecym_3371 [Eremothecium cymbalariae DBVPG#7215]
Length=306

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            KY   ++VG G Y+ VY G ++SD   +A+KEI   Q       SA+RE++ LQ +++  
Sbjct  5    KYTKTKKVGEGTYAVVYLGIKQSDGRQIAVKEIKTSQFKDGLDMSAIREVKYLQEMKHI-  63

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NV+ + + +  +D  + LVLE+LP DL  +IK     +    T  +IK WM+  +  V  
Sbjct  64   NVIELVDLYMDQDNLN-LVLEYLPADLEMIIKDKSILF----TQADIKSWMLMTIRGVHH  118

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            CHRN I+HRDLKP+NLL++ +G LKLADFG AR + AP
Sbjct  119  CHRNFILHRDLKPNNLLLAPDGQLKLADFGLARSMAAP  156



>gb|KGK39601.1| hypothetical protein JL09_g1189 [Pichia kudriavzevii]
Length=297

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 108/188 (57%), Gaps = 27/188 (14%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPN  357
            Y  F+++G G Y+ VY G++++    VA+KEI           SA+RE++ LQ L++ PN
Sbjct  7    YTKFKKLGEGTYAVVYLGKQKTTGREVAVKEIKTEGFKDGLDMSAIREVKYLQELKH-PN  65

Query  358  VVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVG--EIKRWMVQILSAVD  531
            ++ + + F  E ++  LVLE LP DL  V++      D  + +   ++KRW++ IL  V 
Sbjct  66   IIELVDVFSDEKQNLNLVLEVLPGDLEKVLR------DKSIIISPVDVKRWLLMILRGVY  119

Query  532  ACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPTP  711
             CHRN I+HRDLKP+NLL+  +G +K+ADFG AR L           QP  + + NV T 
Sbjct  120  HCHRNGILHRDLKPNNLLMDPDGNIKIADFGLARSL----------DQPTERLTSNVVTR  169

Query  712  MY-TPEFV  732
             Y  PE +
Sbjct  170  WYRAPELL  177



>ref|XP_006958623.1| Pkinase-domain-containing protein [Wallemia sebi CBS 633.66]
 gb|EIM21270.1| Pkinase-domain-containing protein [Wallemia sebi CBS 633.66]
Length=352

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 98/165 (59%), Gaps = 17/165 (10%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            I  +Y    +VG G Y+ VY+G        VA+K+I   Q       SA+RE++ LQ L+
Sbjct  8    IMKRYSKERKVGEGTYASVYQGHCVETGRMVAIKKIKIGQFKDGLDMSAVREVKFLQELK  67

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQIL  519
            +  NV+ M + F S  ++  LVLEFL TDL  +IK      D  +    G+IK WM   L
Sbjct  68   H-ENVIEMLDVF-SAKQNLNLVLEFLTTDLELIIK------DRSIIFRPGDIKSWMAMTL  119

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGL  654
              VD CHR+ ++HRDLKP+NLLI+D GILK+ADFG AR +  PG+
Sbjct  120  RGVDWCHRHFVLHRDLKPNNLLINDKGILKVADFGLARDVAEPGM  164



>gb|AAT97349.1| GDBD-TEV-CTDx3-Kin28(E54Q)-HA fusion protien [Yeast two-hybrid 
vector pMK502-TEV]
Length=556

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTL  342
            ++ ++Y   ++VG G Y+ VY G + S    +A+KEI   +       SA+R+++ LQ +
Sbjct  204  KVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIRQLKYLQEM  263

Query  343  QNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILS  522
            Q+ PNV+ + + F + D  + LVLEFLPTDL  VIK     +    T  +IK WM+  L 
Sbjct  264  QH-PNVIELIDIFMAYDNLN-LVLEFLPTDLEVVIKDKSILF----TPADIKAWMLMTLR  317

Query  523  AVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             V  CHRN I+HRDLKP+NLL S +G +K+ADFG AR + AP
Sbjct  318  GVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAP  359



>gb|EIE91553.1| hypothetical protein RO3G_16264 [Rhizopus delemar RA 99-880]
Length=340

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 111/192 (58%), Gaps = 28/192 (15%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            +T KY+   ++G G Y+ VYRG   +   TVA+K+I   Q       +A+RE++ LQ L+
Sbjct  11   VTQKYQKDAKIGEGTYAVVYRGTEINTGRTVAIKKIKMGQFKDGLDLTAIREVKYLQELR  70

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQIL  519
            + PNV+ + + + S   +  LVLE+L +DL  VIK      D  +     +IK WM+ +L
Sbjct  71   H-PNVIELIDVY-SHKTNLNLVLEYLDSDLEQVIK------DKSILFMPADIKSWMLMML  122

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
              +D CHR+ I+HRD+KP+NLLIS NGILK+ADFG AR          D G P  + +  
Sbjct  123  RGLDHCHRHFILHRDMKPNNLLISSNGILKIADFGLAR----------DWGDPSKQMTSQ  172

Query  700  VPTPMY-TPEFV  732
            V T  Y +PE +
Sbjct  173  VVTRWYRSPELL  184



>ref|XP_003675055.1| hypothetical protein NCAS_0B06000 [Naumovozyma castellii CBS 
4309]
 emb|CCC68684.1| hypothetical protein NCAS_0B06000 [Naumovozyma castellii CBS 
4309]
Length=312

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 97/153 (63%), Gaps = 13/153 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G ++S    +A+KEI   +       SA+RE++ LQ +Q+  NV+ +
Sbjct  18   KKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEIQH-DNVIEL  76

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F + D  + LVLEFLP+DL  +IK    +     T  +IK WM+  L  V  CHRN 
Sbjct  77   VDIFMAYDNLN-LVLEFLPSDLEVIIK----DRSILFTPADIKSWMLMTLRGVHHCHRNF  131

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            I+HRDLKP+NLL+S +G++K+ADFG AR + +P
Sbjct  132  ILHRDLKPNNLLLSPDGVIKVADFGLARAVPSP  164



>ref|XP_001645393.1| hypothetical protein Kpol_534p14 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO17535.1| hypothetical protein Kpol_534p14 [Vanderwaltozyma polyspora DSM 
70294]
Length=339

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 100/161 (62%), Gaps = 13/161 (8%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            I  +Y   ++VG G Y+ VY G ++S    +A+KEI   +       SA+RE++ LQ +Q
Sbjct  36   IVSEYTKEKKVGEGTYAVVYLGTKQSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEIQ  95

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
            +  NV+ + + F + D  + LVLEFLPTDL  +IK   KN     T  +IK WM+  L  
Sbjct  96   HV-NVIELVDIFMAYDNLN-LVLEFLPTDLEVIIK--DKNI--LFTPADIKSWMLMTLRG  149

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            V  CHRN I+HRDLKP+NLL+S +G +K+ADFG AR + +P
Sbjct  150  VYHCHRNFIMHRDLKPNNLLLSPDGQIKVADFGLARAVPSP  190



>ref|XP_009012918.1| hypothetical protein HELRODRAFT_74648 [Helobdella robusta]
 gb|ESO08896.1| hypothetical protein HELRODRAFT_74648 [Helobdella robusta]
Length=332

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 96/155 (62%), Gaps = 12/155 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y+I  R+G GA+  V++ +       VALK++   +       +ALREI+ALQ +    
Sbjct  3    QYKILGRIGEGAHGVVFKAKHVESGDLVALKKVPLKKIEEGIPNTALREIKALQEIDEHE  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NVV + E    +    VLV E++ +DL  VIK    N++  LT  +IK +MV +L  V  
Sbjct  63   NVVKLREVL-PQGMGFVLVFEYMLSDLSEVIK----NYEQPLTEAQIKSYMVMLLKGVAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            CH+N+I+HRDLKP+NLLIS +G+LK+ADFG AR+ 
Sbjct  118  CHQNNIMHRDLKPANLLISSSGLLKIADFGLARVF  152



>ref|XP_454616.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAD36964.1| serine/threonine-protein kinase KIN28 [Kluyveromyces lactis]
 emb|CAG99703.1| KLLA0E14785p [Kluyveromyces lactis]
Length=310

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 99/165 (60%), Gaps = 13/165 (8%)
 Frame = +1

Query  175  TRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEAL  333
            T K     Y   ++ G G Y+ VY G ++S   ++A+KEI   Q       SALRE++ L
Sbjct  2    TLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFL  61

Query  334  QTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
            Q L++  NV+ + + F + D  + LVLEFLP DL  +IK     +    +  +IK W++ 
Sbjct  62   QELKHV-NVIELVDVFMANDNLN-LVLEFLPADLEIIIKDTSIMF----SPADIKSWILM  115

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             L  V  CHRN I+HRDLKP+NLL++ +G LK+ADFG AR++ +P
Sbjct  116  TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASP  160



>ref|XP_006125616.1| PREDICTED: cyclin-dependent kinase 20-like, partial [Pelodiscus 
sinensis]
Length=203

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 96/159 (60%), Gaps = 12/159 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V+R +      TVALK++   +        ALREI+ALQ ++  P
Sbjct  3    QYSILGRIGEGAHGIVFRAKHIETGETVALKKVALRRLEDGIPNQALREIKALQEIEENP  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            +VV +   F       VLV E++ +DL  VI++A++     L+  ++K +M+ +L  V  
Sbjct  63   HVVKLKAVF-PHGAGFVLVFEYMLSDLAEVIRSAQQP----LSQAQVKGYMLMLLQGVAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            CH N+I+HRDLKP+NLLIS  G LK+ADFG AR+  + G
Sbjct  118  CHANNIMHRDLKPANLLISSTGQLKIADFGLARVFSSDG  156



>gb|KFH72507.1| CMGC/CDK/CDK7 protein kinase [Mortierella verticillata NRRL 6337]
Length=338

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 100/158 (63%), Gaps = 13/158 (8%)
 Frame = +1

Query  181  KEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQT  339
            +E+   Y+   +VG GAY+ VY G + S + TVA+K+I   Q       SA+RE++ LQ 
Sbjct  13   EEVYRDYKKDRKVGEGAYAVVYLGTQVSTNKTVAIKKIKIGQFKDGLDMSAIREVKTLQE  72

Query  340  LQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQIL  519
            L++ PNVV + E F+ +   + LVLE+L +DL  +IK     +    T G++K WM+  L
Sbjct  73   LRH-PNVVELMEVFFHKTNLN-LVLEYLESDLEMIIKDKSIVF----TAGDVKHWMLMTL  126

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQAR  633
              +D CHRN I+HRD+KP+NLL+  +G LK+ADFG AR
Sbjct  127  RGLDHCHRNWILHRDMKPNNLLLGRDGQLKIADFGLAR  164



>emb|CCA67882.1| probable KIN28-cyclin-dependent ser/thr protein kinase [Piriformospora 
indica DSM 11827]
Length=377

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 106/183 (58%), Gaps = 19/183 (10%)
 Frame = +1

Query  127  KETPMDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ  306
            ++TPMDS   ++     R +   KY    +VG GAY+ VY+GR  +    VA+K+I   Q
Sbjct  4    EDTPMDSVEKENLR---RAQ---KYTKDAKVGEGAYAVVYKGREIATGRQVAIKKIKVGQ  57

Query  307  -------SALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKN  465
                   SA+RE++ LQ L + PNV+ + + F S   +  LVLEFL  DL  +I    + 
Sbjct  58   FKDGLDMSAVREVKYLQELHH-PNVIELLDVF-SSKTNLNLVLEFLDGDLEMMINDKTQK  115

Query  466  WDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLA  645
            +       ++K WMV  L  ++ CHRN I+HRDLKP+NLL++ +G LKLADFG AR    
Sbjct  116  FQ----AADMKSWMVMTLRGLEFCHRNHILHRDLKPNNLLLASDGQLKLADFGLARDFAD  171

Query  646  PGL  654
            PGL
Sbjct  172  PGL  174



>emb|CEG73455.1| Putative CMGC/CDK/CDK7 protein kinase [Rhizopus microsporus]
 emb|CEI88004.1| Putative CMGC/CDK/CDK7 protein kinase [Rhizopus microsporus]
Length=342

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 100/164 (61%), Gaps = 17/164 (10%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            I  KY+   +VG G Y+ VYRG   + S TVA+K+I   Q       +A+RE++ LQ ++
Sbjct  11   IAQKYQKDAKVGEGTYAVVYRGTEVATSRTVAIKKIKMGQFKDGMDLTAIREVKYLQEIR  70

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQIL  519
            + PNV+ + + + S   +  LVLE+L +DL  VIK      D  +     +IK WM+ IL
Sbjct  71   H-PNVIELIDVY-SYKTNLNLVLEYLESDLEQVIK------DKSILFMPADIKSWMLMIL  122

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
              +D CHR+ I+HRD+KP+NLLIS NG LK+ADFG AR    PG
Sbjct  123  RGLDHCHRHFILHRDMKPNNLLISSNGTLKIADFGLARDWGDPG  166



>gb|ERZ97612.1| hypothetical protein GLOINDRAFT_340045 [Rhizophagus irregularis 
DAOM 181602]
Length=362

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 112/200 (56%), Gaps = 34/200 (17%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ----------SALREIEAL  333
            +I  KY   +++G G Y+ VYRG  R+   TVA+K+I   Q          SA+RE++ L
Sbjct  13   QIENKYLKEKKIGEGTYAKVYRGTERATGRTVAIKKIKLVQTEIGSQGIELSAVREVKCL  72

Query  334  QTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVG--EIKRWM  507
            + L++ PNV+ + + + S   +  LVLE+L +DL  +IK      D  +     +IK WM
Sbjct  73   RELRH-PNVIELIDIY-SHKSNLKLVLEYLDSDLEMIIK------DKSILFQAPDIKSWM  124

Query  508  VQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGK  687
            +  L  +D CHRN I+HRD+KP+NLL+  +G LK+ADFG AR          D G P+ K
Sbjct  125  LMTLRGLDHCHRNWILHRDMKPNNLLVGKDGQLKIADFGLAR----------DYGDPHAK  174

Query  688  -ASPNVPTPMY-TPE--FVP  735
              SP V T  Y  PE  F+P
Sbjct  175  NMSPQVVTRWYRAPELFFMP  194



>ref|XP_003685049.1| hypothetical protein TPHA_0C04650 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE62615.1| hypothetical protein TPHA_0C04650 [Tetrapisispora phaffii CBS 
4417]
Length=309

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 100/162 (62%), Gaps = 13/162 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTL  342
            +I  +Y   ++VG G Y+ VY G ++S    +A+KEI   +       SA+RE++ LQ +
Sbjct  4    KIVSEYTKEKKVGEGTYAVVYLGTKQSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEI  63

Query  343  QNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILS  522
             +  NV+ + + F + +  + LVLE+LPTDL  VIK    + +   T  +IK WM+  L 
Sbjct  64   NHI-NVIELVDIFMAYNNLN-LVLEYLPTDLEVVIK----DQNILFTPADIKSWMLMTLR  117

Query  523  AVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             V  CHRN I+HRDLKP+NLLIS +G +K+ADFG AR + AP
Sbjct  118  GVYHCHRNFILHRDLKPNNLLISPDGQIKVADFGLARAIPAP  159



>ref|XP_003682840.1| hypothetical protein TDEL_0G02620 [Torulaspora delbrueckii]
 emb|CCE93629.1| hypothetical protein TDEL_0G02620 [Torulaspora delbrueckii]
Length=304

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 95/156 (61%), Gaps = 13/156 (8%)
 Frame = +1

Query  193  IKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNC  351
            ++Y    +VG G Y+ VY G ++S    +A+KEI   +       SA+RE++ LQ +Q+ 
Sbjct  4    VEYTKERKVGEGTYAVVYLGTKQSSGRKIAVKEIKTSEFKDGLDMSAIREVKYLQEIQH-  62

Query  352  PNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVD  531
             NV+ + + F + D  + LVLEFLP+DL  VIK    +     T  +IK WM+  L  V 
Sbjct  63   ENVIELIDIFLAYDNLN-LVLEFLPSDLEKVIK----DRSILFTPADIKSWMLMTLRGVH  117

Query  532  ACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
             CHRN I+HRDLKP+NLL+S  GI+K+ADFG AR  
Sbjct  118  HCHRNFILHRDLKPNNLLLSPEGIIKVADFGLARTF  153



>ref|XP_009657622.1| Protein tyrosine kinase [Verticillium dahliae VdLs.17]
 gb|EGY15459.1| Protein tyrosine kinase [Verticillium dahliae VdLs.17]
Length=323

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNG-LTVGEIKRWMVQILSAVDAC  537
            V +H+   +E++  +LV EFL  DL    K    N D G L   +IK +M Q+L  +D C
Sbjct  69   VALHDVIHTENK-LMLVFEFLDGDLK---KYMDTNGDRGALKPAQIKSFMYQLLRGIDFC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLI+  G LKL DFG AR    P
Sbjct  125  HQNRVLHRDLKPQNLLINSKGQLKLGDFGLARAFGIP  161



>ref|XP_007376851.1| hypothetical protein SPAPADRAFT_56779 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW30818.1| hypothetical protein SPAPADRAFT_56779 [Spathaspora passalidarum 
NRRL Y-27907]
Length=336

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 104/189 (55%), Gaps = 24/189 (13%)
 Frame = +1

Query  190  TIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQN  348
            T  Y    +VG G Y+ VY G + +    +A+KEI           SALRE++ LQ L++
Sbjct  21   THNYSKERKVGEGTYAVVYLGHQVTTGREIAIKEIKTGIFKDGLDMSALREVKYLQELRH  80

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAV  528
             PNV+ + + F S   +  LVLE LP DL  +IK    + +   T+G+IK WM+  L  +
Sbjct  81   -PNVIELVDVF-STPHNLNLVLELLPCDLEVLIK----DKEVVFTMGDIKSWMLMTLRGI  134

Query  529  DACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPT  708
              CHRN I+HRDLKP+NLLI+ +G LK+ADFG AR L          G P    S NV T
Sbjct  135  HHCHRNFILHRDLKPNNLLIAPDGQLKIADFGLARAL----------GNPNEDLSSNVVT  184

Query  709  PMY-TPEFV  732
              Y  PE +
Sbjct  185  RWYRAPELL  193



>ref|XP_003002407.1| Protein tyrosine kinase [Verticillium alfalfae VaMs.102]
 gb|EEY20868.1| Protein tyrosine kinase [Verticillium alfalfae VaMs.102]
Length=323

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNG-LTVGEIKRWMVQILSAVDAC  537
            V +H+   +E++  +LV EFL  DL    K    N D G L   +IK +M Q+L  +D C
Sbjct  69   VALHDVIHTENK-LMLVFEFLDGDLK---KYMDTNGDRGALKPAQIKSFMYQLLRGIDFC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLI+  G LKL DFG AR    P
Sbjct  125  HQNRVLHRDLKPQNLLINSKGQLKLGDFGLARAFGIP  161



>ref|XP_002618382.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gb|EEQ37718.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
Length=315

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 92/148 (62%), Gaps = 12/148 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G++ S    +A+KEI           SA+RE++ LQ L++  NV+ +
Sbjct  8    KKVGEGTYAVVYVGKQISTGRQIAIKEIKTGLFKDGLDMSAIREVKYLQELRHR-NVIEL  66

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S D +  LVLEFLP DL  +IK  K  + +     +IK W++  L  +  CHRN 
Sbjct  67   MDVFMSADNNLNLVLEFLPCDLEVLIKDQKVVFKSS----DIKAWLLMTLRGIHHCHRNF  122

Query  550  IVHRDLKPSNLLISDNGILKLADFGQAR  633
            I+HRDLKPSNLL++ +G LK+ADFG AR
Sbjct  123  ILHRDLKPSNLLLAPDGQLKIADFGLAR  150



>emb|CDO94741.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=310

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 96/153 (63%), Gaps = 13/153 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++ G G Y+ VY G ++S   ++A+KEI   Q       SALRE++ LQ L++  NV+ +
Sbjct  14   KKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELRHI-NVIEL  72

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F + D  + LVLEFLP DL  +IK     +    +  +IK W++  L  V  CHRN 
Sbjct  73   IDVFMASDNLN-LVLEFLPADLELIIKDTSIMF----SPADIKSWILMTLRGVHHCHRNF  127

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            I+HRDLKP+NLL++ +G LK+ADFG AR++ +P
Sbjct  128  ILHRDLKPNNLLLAPDGQLKIADFGLARLMGSP  160



>gb|EUB56284.1| Cell division protein kinase 20 [Echinococcus granulosus]
Length=348

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 95/157 (61%), Gaps = 12/157 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            KY +   +G GA+  V +GR +     VALK+I   +       +A+REI+ALQ + + P
Sbjct  3    KYAVVSLIGEGAHGVVLKGRHKDSGELVALKKIPLRKLEEGIPHTAIREIKALQLMSSHP  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            N+V + E F        LV +++ TDL  ++++     ++ L  G+IK +MV +LS V  
Sbjct  63   NIVRLREVF-PHGMGFTLVFDYMVTDLSEILRSI----ESPLCEGKIKAYMVMLLSGVGF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLA  645
             H NSI+HRDLKP+NLLI   G+LK+ADFG AR+ L+
Sbjct  118  LHSNSIMHRDLKPANLLIDSKGVLKIADFGLARLFLS  154



>ref|XP_002492173.1| Serine/threonine protein kinase, subunit of the transcription 
factor TFIIH [Komagataella pastoris GS115]
 emb|CAY69893.1| Serine/threonine protein kinase, subunit of the transcription 
factor TFIIH [Komagataella pastoris GS115]
 emb|CCA37738.1| cyclin-dependent kinase 7 [Komagataella pastoris CBS 7435]
Length=319

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 107/192 (56%), Gaps = 28/192 (15%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQ  345
            +TI Y   ++VG G Y+ VY G++      +A+KEI           SA+RE++ LQ L+
Sbjct  1    MTISYTKEKKVGEGTYAVVYLGKQLPSERNIAVKEIKVGTFKDGVDMSAIREVKYLQELK  60

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQIL  519
            +  NV+ + + F  E+ +  LVLEFLP DL  +IK      D  L    G++K WM+  L
Sbjct  61   H-QNVIELVDVF-DEEGNINLVLEFLPMDLEIIIK------DTSLLFQPGDVKSWMLMTL  112

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
              +  CHRN I+HRDLKP+NLLIS +G LK+ADFG AR L           QP  + + N
Sbjct  113  RGLHHCHRNFILHRDLKPNNLLISPDGELKIADFGLARSL----------SQPNERLTSN  162

Query  700  VPTPMY-TPEFV  732
            V T  Y  PE +
Sbjct  163  VVTRWYRAPELL  174



>dbj|GAA99786.1| hypothetical protein E5Q_06489 [Mixia osmundae IAM 14324]
 gb|KEI37844.1| hypothetical protein L969DRAFT_95699 [Mixia osmundae IAM 14324]
Length=367

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 97/164 (59%), Gaps = 17/164 (10%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            I   Y   +RVG G Y+ V+ GR+ S    +A+K+I   Q       SALRE++ L+ L+
Sbjct  11   IMSMYTKDKRVGEGTYATVFEGRQLSTGRRIAIKKIKAGQFKDGLDMSALREVKYLRELR  70

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQIL  519
            + PNV+ + + F S   +  LVLE+L  DL  +IK      D  L    G+IK WM+  +
Sbjct  71   H-PNVIELLDVF-SSKANLNLVLEYLNADLEMIIK------DRSLVFQSGDIKSWMLMTM  122

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
              ++ CHRN ++HRD+KP+NLLIS  G+LK+ADFG AR    PG
Sbjct  123  KGLEFCHRNFVLHRDMKPNNLLISSEGVLKIADFGLARDYAEPG  166



>gb|KIJ55700.1| hypothetical protein M422DRAFT_200034 [Sphaerobolus stellatus 
SS14]
Length=366

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 100/164 (61%), Gaps = 13/164 (8%)
 Frame = +1

Query  181  KEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQT  339
            +++  +++   +VG G Y+ VYRGR  + S  VA+K+I   Q       SA+RE++ L+ 
Sbjct  9    RDVQSRWQKLAKVGEGTYAVVYRGREVATSRQVAIKKIKVGQFKDGLDMSAIREVKYLRE  68

Query  340  LQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQIL  519
            + + PNV+ + + F S  ++  LVLEFL +DL  +IK    +  N     +IK W+   L
Sbjct  69   IHH-PNVIELLDVF-SAKKNLNLVLEFLESDLELIIK----DRSNVFLPADIKSWLAMTL  122

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
              ++ CHRN I+HRDLKP+NLL++ +G LK+ADFG AR    PG
Sbjct  123  RGLEFCHRNFILHRDLKPNNLLVAADGQLKIADFGLARDFADPG  166



>gb|KEP52864.1| CMGC/CDK/CDK7 kinase [Rhizoctonia solani 123E]
Length=364

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 92/153 (60%), Gaps = 13/153 (8%)
 Frame = +1

Query  214  RVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVMH  372
            ++G G Y+ VY+GR  +    +A+K+I   Q       SA+RE+  L+ L N PNV+ + 
Sbjct  20   KIGEGTYAIVYKGREAATGRQIAIKKIKVGQMKEGLDQSAIREVRYLREL-NHPNVIELL  78

Query  373  EFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSI  552
            + F S   +  LVLEFL TDL A+IK    +  N     +IK WM   L  ++ CHRN +
Sbjct  79   DVF-SSKTNLNLVLEFLETDLEAIIK----DRSNVFLPADIKSWMAMTLRGLEYCHRNWL  133

Query  553  VHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            +HRDLKP+NLLI+ +G LK+ADFG AR    PG
Sbjct  134  LHRDLKPNNLLIAADGQLKIADFGLARDFADPG  166



>ref|XP_002494675.1| ZYRO0A07062p [Zygosaccharomyces rouxii]
 emb|CAR25742.1| ZYRO0A07062p [Zygosaccharomyces rouxii]
Length=300

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 99/158 (63%), Gaps = 17/158 (11%)
 Frame = +1

Query  193  IKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNC  351
            ++Y   ++VG G Y+ VY G ++S +  +A+KEI   +       SA+RE++ LQ +Q+ 
Sbjct  1    MEYTKEKKVGEGTYAVVYLGTKQSTARRIAIKEIKTSEFKDGLDMSAIREVKYLQEMQH-  59

Query  352  PNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGL--TVGEIKRWMVQILSA  525
             NV+ + + F +  E+  LVLEFLP+DL  +IK      D  +  T  +IK WM+  L  
Sbjct  60   QNVIELVDIFMA-SENLNLVLEFLPSDLEMIIK------DKSILFTPADIKSWMLMTLRG  112

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            V  CHRN I+HRDLKP+NLLI+ +G +K+ADFG AR +
Sbjct  113  VHHCHRNFILHRDLKPNNLLIAPDGQIKVADFGLARTM  150



>ref|XP_007404399.1| hypothetical protein MELLADRAFT_32688 [Melampsora larici-populina 
98AG31]
 gb|EGG12024.1| hypothetical protein MELLADRAFT_32688 [Melampsora larici-populina 
98AG31]
Length=362

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 94/164 (57%), Gaps = 17/164 (10%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            I   Y   +++G G Y+ VY G  +     VA+K+I   Q       SA+RE++ LQ L 
Sbjct  11   IQQSYTKEKKIGEGTYASVYEGHEKKTGRKVAIKKIKAGQFKDGLDMSAIREVKFLQELS  70

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLT--VGEIKRWMVQIL  519
            + PNV+ + + F S   +  LVLEFL TDL AVIK      D  L     +IK WM   +
Sbjct  71   H-PNVIGLLDVF-SSKSNLNLVLEFLDTDLEAVIK------DRSLVFQASDIKSWMYMTI  122

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
              +D CH+N I+HRD+KP+NLLI+ +G LK+ADFG AR    PG
Sbjct  123  KGLDFCHQNWILHRDMKPNNLLIASDGTLKIADFGLAREYADPG  166



>emb|CDF87308.1| BN860_03466g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH15625.1| KIN28-Cyclin-dependent ser/thr protein kinase [Zygosaccharomyces 
bailii ISA1307]
Length=300

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 98/158 (62%), Gaps = 17/158 (11%)
 Frame = +1

Query  193  IKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNC  351
            ++Y   ++VG G Y+ VY G ++S    +A+KEI   +       SA+RE++ LQ +Q+ 
Sbjct  1    MEYTKEKKVGEGTYAVVYLGTKQSTKRKIAVKEIKTSEFKDGLDMSAIREVKYLQEMQH-  59

Query  352  PNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGL--TVGEIKRWMVQILSA  525
             NV+ + + F +  E+  LVLEFLP+DL  +IK      D  +  T  +IK WM+  L  
Sbjct  60   ENVIELVDIFMA-SENLNLVLEFLPSDLEVIIK------DKSILFTPADIKSWMLMTLRG  112

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            V  CHRN I+HRDLKP+NLLI+ +G +K+ADFG AR +
Sbjct  113  VHHCHRNFILHRDLKPNNLLIAPDGKIKVADFGLARTM  150



>emb|CEI89902.1| Putative CMGC/CDK/CDK7 protein kinase [Rhizopus microsporus]
Length=342

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 17/164 (10%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            I  KY+   ++G G Y+ VYRG   + S TVA+K+I   Q       +A+RE++ LQ ++
Sbjct  11   IAQKYQKDAKIGEGTYAVVYRGTEVATSRTVAIKKIKMGQFKDGMDLTAIREVKYLQEIR  70

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQIL  519
            + PNV+ + + + S   +  LVLE+L +DL  VIK      D  +     +IK WM+ IL
Sbjct  71   H-PNVIELIDVY-SYKTNLNLVLEYLESDLEQVIK------DKSILFMPADIKSWMLMIL  122

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
              +D CHR+ I+HRD+KP+NLLIS NG LK+ADFG  R    PG
Sbjct  123  RGLDHCHRHFILHRDMKPNNLLISSNGTLKIADFGLTRDWGDPG  166



>emb|CDH13015.1| probable KIN28-Cyclin-dependent ser/thr protein kinase [Zygosaccharomyces 
bailii ISA1307]
Length=320

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 96/152 (63%), Gaps = 17/152 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G ++S +  +A+KEI   +       SA+RE++ LQ +Q+  NV+ +
Sbjct  27   KKVGEGTYAVVYLGTKQSTNRKIAVKEIKTSEFKDGLDMSAIREVKYLQEMQH-ENVIEL  85

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGL--TVGEIKRWMVQILSAVDACHR  543
             + F +  E+  LVLEFLP+DL  +IK      D  +  T  +IK WM+  L  V  CHR
Sbjct  86   VDIFMA-SENLNLVLEFLPSDLEVIIK------DKSILFTPADIKSWMLMTLRGVHHCHR  138

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            N I+HRDLKP+NLLI+ +G +K+ADFG AR +
Sbjct  139  NFILHRDLKPNNLLIAPDGKIKVADFGLARTM  170



>ref|XP_003172211.1| CMGC/CDK/CDK7 protein kinase [Microsporum gypseum CBS 118893]
 gb|EFR01800.1| CMGC/CDK/CDK7 protein kinase [Microsporum gypseum CBS 118893]
Length=406

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 112/201 (56%), Gaps = 25/201 (12%)
 Frame = +1

Query  106  ITKQERE------KETPMDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSD  267
            IT QE +         P  S P    +     ++  KY   +++G G Y+ VY G  R D
Sbjct  27   ITSQENQLAPGSDSAAPKLSMPEPELAEQLNADVRRKYVKDKKLGEGTYAVVYLGHLRDD  86

Query  268  SLT-VALKEIH---DYQS-----ALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEF  420
              + VA+K+I    +Y+      A+RE++ LQ L + PNV+ +H+ F S+D++  LVLEF
Sbjct  87   PTSLVAIKKIKLNAEYKDGLSMDAIREVKYLQELSH-PNVIALHDVFSSKDQNLNLVLEF  145

Query  421  LPT-DLGAVIKAAKKNWDNGLTVG--EIKRWMVQILSAVDACHRNSIVHRDLKPSNLLIS  591
            LP  DL  +IK      DN +  G  +IK W+  +   V  CH+N I+HRD+KP+NLLI+
Sbjct  146  LPLGDLEMLIK------DNSIQYGVADIKAWISMLARGVWFCHKNFILHRDIKPNNLLIA  199

Query  592  DNGILKLADFGQARMLLAPGL  654
             NG +KLADFG AR    P L
Sbjct  200  SNGEVKLADFGLARSFADPYL  220



>ref|XP_799108.3| PREDICTED: cyclin-dependent kinase 20-like [Strongylocentrotus 
purpuratus]
 ref|XP_001185563.2| PREDICTED: cyclin-dependent kinase 20-like [Strongylocentrotus 
purpuratus]
Length=338

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 93/155 (60%), Gaps = 12/155 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I +R+G GA+  V++ +       VALK++   +       +ALREI+ALQ ++   
Sbjct  3    QYSILDRIGEGAHGIVFKAKHIETGEIVALKKVPLRKLDDGIPNTALREIKALQEIEENQ  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
             VV + + F       VLV EF+ +DL  VI+    N D  LT  ++K +M+ +L  +  
Sbjct  63   YVVKLKDVF-PHGTGFVLVFEFMLSDLSEVIR----NSDQPLTEAQVKSYMLMLLKGITH  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            CH NSI+HRDLKP+NLLIS+ G LK+ADFG AR+ 
Sbjct  118  CHENSIMHRDLKPANLLISETGHLKIADFGLARVF  152



>ref|XP_002549916.1| serine/threonine-protein kinase KIN28 [Candida tropicalis MYA-3404]
 gb|EER32542.1| serine/threonine-protein kinase KIN28 [Candida tropicalis MYA-3404]
Length=352

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 103/188 (55%), Gaps = 24/188 (13%)
 Frame = +1

Query  193  IKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNC  351
            + Y    +VG G Y+ VY G++ S    +A+KEI           SALRE++ LQ L++ 
Sbjct  30   LNYTKERKVGEGTYAVVYLGKQVSTKRKIAIKEIKTGLFKDGLDMSALREVKYLQELKH-  88

Query  352  PNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVD  531
            PNV+ + + F S   +  LVLEFLP DL  +IK     + +     +IK W++  L  + 
Sbjct  89   PNVIELIDVF-STKNNLNLVLEFLPCDLEVLIKDKSIVFKSS----DIKSWLLMTLRGIH  143

Query  532  ACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPTP  711
             CHRN I+HRDLKP+NLL+S +G LK+ADFG AR L          G P    S NV T 
Sbjct  144  HCHRNFILHRDLKPNNLLLSPDGQLKIADFGLARAL----------GNPNEDLSSNVVTR  193

Query  712  MY-TPEFV  732
             Y  PE +
Sbjct  194  WYRAPELL  201



>gb|KFY14499.1| hypothetical protein V491_06025, partial [Pseudogymnoascus pannorum 
VKM F-3775]
Length=251

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 109/188 (58%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y       A+RE++ LQ L +
Sbjct  60   KYIKGKKLGEGTYANVYLGTLRSDPTHFVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  119

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S D++  LVLE+LP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  120  -PNIITLHSVFSSRDQNLNLVLEYLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  173

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  174  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARAF----------ADPYKQMTSN  223

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  224  VITRWYRP  231



>ref|XP_001020875.2| Protein kinase domain containing protein [Tetrahymena thermophila]
 gb|AAD46564.1|AF157636_1 cyclin-dependent protein kinase homolog [Tetrahymena thermophila]
 gb|EAS00630.2| cyclin-dependent kinase-like Serine/Threonine kinase family protein 
[Tetrahymena thermophila SB210]
Length=318

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 87/159 (55%), Gaps = 8/159 (5%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +YE   +VG G Y +VY+ +    S  VALK+I           +ALREI  L+ LQ  P
Sbjct  10   RYEKLLKVGEGTYGEVYKAKDIQSSEIVALKKIKLENEDEGVPSTALREISILKELQPHP  69

Query  355  NVVVMHEFFWSEDEDSV-LVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVD  531
            N+V MHE  +   E  + LV EF+  DL   +   +K+    L   +IK  M QIL+ ++
Sbjct  70   NIVCMHEVIYQPQEKKLYLVFEFVDQDLKKFLDQYRKDKKLQLRPYQIKLMMYQILNGLN  129

Query  532  ACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             CH   I+HRDLKP N+LI   G +K+ADFG AR    P
Sbjct  130  FCHSRRIIHRDLKPQNILIDAKGNIKIADFGLARAFGVP  168



>ref|XP_005841872.1| hypothetical protein GUITHDRAFT_83848 [Guillardia theta CCMP2712]
 gb|EKX54892.1| hypothetical protein GUITHDRAFT_83848 [Guillardia theta CCMP2712]
Length=350

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 99/185 (54%), Gaps = 21/185 (11%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALK------EIHD--YQSALREIEALQTLQNCP  354
            Y++   VG G +  V +  ++     VA+K      +IH+    SA+ EI  +Q L + P
Sbjct  14   YKVLHEVGRGTFGVVCKAIKKKTGEEVAIKNIKLVHKIHEGVSTSAIDEIRIMQELHH-P  72

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVG--EIKRWMVQILSAV  528
            NV+ +HE F   +    LVL+F+P D+  +IKA     D  + +   +IK +M   L  +
Sbjct  73   NVLSIHEVFSPREGTLSLVLDFIPMDMEMIIKAKDMTSDKYVPMPSEDIKAYMQMFLRGI  132

Query  529  DACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPT  708
            +ACH+N ++HRDLKP+NLL+S NG+LKL DFG AR            G P  K SP   T
Sbjct  133  NACHQNFVLHRDLKPANLLLSANGVLKLCDFGLARTY----------GSPNAKFSPQAVT  182

Query  709  PMYTP  723
              Y P
Sbjct  183  LWYRP  187



>emb|CEP61484.1| LALA0S03e03884g1_1 [Lachancea lanzarotensis]
Length=308

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 95/153 (62%), Gaps = 13/153 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G ++S+   +A+KEI           SA+RE++ LQ +Q+  NV+ +
Sbjct  11   KKVGEGTYAVVYVGTKQSNERRIAIKEIKTSGFKDGLDMSAIREVKYLQEMQHV-NVIEL  69

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F ++   + LVLEFLP DL  +IK     +    T  +IK W++  L  V  CHRN 
Sbjct  70   IDVFMAQSNLN-LVLEFLPADLEMIIKDTSILF----TQADIKSWLLMTLRGVHHCHRNF  124

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            I+HRDLKP+NLL++ +G LKLADFG AR + +P
Sbjct  125  ILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP  157



>gb|EMG45554.1| Serine/threonine protein kinase (Stpk), putative [Candida maltosa 
Xu316]
Length=346

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 100/179 (56%), Gaps = 24/179 (13%)
 Frame = +1

Query  142  DSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY------  303
            DSP S    I       + Y    +VG G Y+ VY G++ S    +A+KEI         
Sbjct  13   DSPSSSGKQI-------LNYTKERKVGEGTYAVVYLGKQVSTKRKIAIKEIKTGLFKDGL  65

Query  304  -QSALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGL  480
              SALRE++ LQ L++ PNV+ + + F S   +  LVLEFLP DL  +IK      D  +
Sbjct  66   DMSALREVKYLQELKH-PNVIELIDVF-SATNNLNLVLEFLPCDLEVLIK------DKSI  117

Query  481  T--VGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
                 +IK W++  L  +  CHRN I+HRDLKP+NLL++ +G LK+ADFG AR L+ P 
Sbjct  118  VFKASDIKSWLLMTLRGIHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARALVNPN  176



>gb|ESW97639.1| Serine/threonine-protein kinase KIN28 [Ogataea parapolymorpha 
DL-1]
Length=305

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 106/190 (56%), Gaps = 23/190 (12%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQ  345
            ++  Y   ++VG G Y+ VY G++ +    +A+KEI           SA+RE++ LQ L+
Sbjct  1    MSTAYTKEKKVGEGTYAVVYLGKQIATGRNIAIKEIKTGAFKDGLDMSAIREMKYLQELK  60

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
            +  N++ + + F  ++++  L+LEFLP+DL  +I   K      +   +IK WM+  L  
Sbjct  61   H-QNIIELVDVFADKEKNLNLILEFLPSDLEMIINDKKLM----IVPADIKSWMLMTLRG  115

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVP  705
            +  CHRN I+HRDLKP+NLLIS  G +K+ADFG AR L          G P  K + NV 
Sbjct  116  LHHCHRNGILHRDLKPNNLLISPEGYVKIADFGLARSL----------GMPNEKLTSNVV  165

Query  706  TPMY-TPEFV  732
            T  Y  PE +
Sbjct  166  TRWYRGPELL  175



>emb|CBK20791.2| unnamed protein product [Blastocystis hominis]
Length=579

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 103/184 (56%), Gaps = 24/184 (13%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ--------SALREIEALQTLQNCP  354
            Y+I   +G G Y  VYRGRRRSD L VALK+I  Y         +++REI+ L ++ +  
Sbjct  17   YQILNEIGKGTYGYVYRGRRRSDGLIVALKKIKLYNEGQTGFPITSIREIQMLSSIDH-E  75

Query  355  NVVVMHEFFWSEDEDSV-LVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVD  531
            NVV + +    +D DSV +V+EF   D+  ++K+  + W    ++ E+K  + Q+L AV 
Sbjct  76   NVVKLVDIVVGKDRDSVYMVMEFCDQDIDYLLKSQSRPW----SLSEVKCLIRQLLCAVS  131

Query  532  ACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPTP  711
              H   I+HRDLK SNLL +++G LK+ADFG  R +          G P  + + NV T 
Sbjct  132  YLHERWIIHRDLKTSNLLYTNHGQLKVADFGLVRTM----------GFPLRRVTTNVVTL  181

Query  712  MYTP  723
             Y P
Sbjct  182  WYRP  185



>ref|XP_006625499.1| PREDICTED: cyclin-dependent kinase 20-like [Lepisosteus oculatus]
Length=344

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 95/159 (60%), Gaps = 12/159 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V++ +      TVALK++   +        ALREI+ALQ +++ P
Sbjct  3    QYSILGRIGEGAHGIVFKAKHIETGETVALKKVALRKLEDGIPSQALREIKALQEIEDNP  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
             VV +   F       VLV E++ +DL  VI+ +++     LT  ++K +M+ +L  V  
Sbjct  63   YVVKLKNVF-PHGTGFVLVFEYMLSDLSEVIRNSQRP----LTESQVKGYMMMLLKGVAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            CH NSI+HRDLKP+NLLIS  G LK+ADFG AR+  + G
Sbjct  118  CHENSIMHRDLKPANLLISSTGHLKIADFGLARLFSSEG  156



>ref|XP_003333897.2| CMGC/CDK/CDK7 protein kinase [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP89478.2| CMGC/CDK/CDK7 protein kinase [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=367

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 96/162 (59%), Gaps = 13/162 (8%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            I   Y    ++G G Y+ V+ G ++  +  VA+K+I   Q       SA+RE++ LQ L 
Sbjct  11   IQQSYTKERKIGEGTYASVFEGHQKKSNRKVAIKKIKAGQFKDGLDMSAIREVKFLQELS  70

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
            + PNV+ + + F S   +  LVLEFL TDL AVIK    + +      +IK WM+  +  
Sbjct  71   H-PNVIGLLDVF-SSKSNLNLVLEFLDTDLEAVIK----DRELVFQASDIKSWMLMTMQG  124

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            +D CH+N ++HRD+KP+NLLI+ +G LK+ADFG AR    PG
Sbjct  125  LDFCHQNWVLHRDMKPNNLLIASDGTLKIADFGLAREYADPG  166



>gb|KIK61670.1| hypothetical protein GYMLUDRAFT_73182 [Gymnopus luxurians FD-317 
M1]
Length=374

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VYRGR  S    VA+K+I   Q       SA+RE++ L+ L++ PNV+ +
Sbjct  19   QKVGEGTYAVVYRGREVSTGRRVAIKKIKVGQFKDGLDMSAIREVKYLRELKH-PNVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S   +  LVLEFL +DL  +IK      D  L     +IK WM      ++ CHR
Sbjct  78   LDVF-SSKTNLNLVLEFLDSDLEMIIK------DRSLVFLPADIKSWMAMTFRGLEFCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N I+HRDLKP+NLLI+ +G LK+ADFG AR    PG
Sbjct  131  NFILHRDLKPNNLLIASDGQLKIADFGLARDFADPG  166



>gb|KIM82969.1| hypothetical protein PILCRDRAFT_447116 [Piloderma croceum F 1598]
Length=371

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 92/156 (59%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VYRGR  S    VA+K+I   Q       SA+RE++ L+ LQ+  NV+ +
Sbjct  19   QKVGEGTYAVVYRGREVSTGRKVAIKKIKVSQFKDGLDMSAIREVKYLRELQH-QNVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S   +  LVLEFL TDL  +IK      D  L     +IK WM      ++ CHR
Sbjct  78   LDVF-SSKTNLNLVLEFLDTDLEMIIK------DRTLVFLPADIKSWMAMTFRGLEYCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N I+HRDLKP+NLL++ +G LKLADFG AR    PG
Sbjct  131  NFILHRDLKPNNLLVASDGQLKLADFGLARDFADPG  166



>gb|KGQ91282.1| serine/threonine-protein kinase KIN28 [Candida albicans P94015]
Length=343

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 13/154 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G++ S    +A+KEI           SALRE++ LQ L++ PNV+ +
Sbjct  28   KKVGEGTYAVVYLGKQISTKRQIAIKEIKTGLFKDGLDMSALREVKYLQELKH-PNVIEL  86

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S   +  LVLEFLP DL  +IK     + +     +IK W++  L  +  CHRN 
Sbjct  87   VDVF-SATNNLNLVLEFLPCDLEVLIKDKSIVFKSA----DIKSWLLMTLRGIHHCHRNF  141

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            I+HRDLKP+NLL++ +G LK+ADFG AR L+ P 
Sbjct  142  ILHRDLKPNNLLLAPDGQLKIADFGLARALVNPN  175



>gb|KGR03866.1| serine/threonine-protein kinase KIN28 [Candida albicans GC75]
 gb|KGU14995.1| serine/threonine-protein kinase KIN28 [Candida albicans P87]
 gb|KGU35697.1| serine/threonine-protein kinase KIN28 [Candida albicans P75063]
 gb|KHC49171.1| serine/threonine-protein kinase KIN28 [Candida albicans Ca6]
 gb|KHC76069.1| serine/threonine-protein kinase KIN28 [Candida albicans P75016]
Length=343

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 13/154 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G++ S    +A+KEI           SALRE++ LQ L++ PNV+ +
Sbjct  28   KKVGEGTYAVVYLGKQISTKRQIAIKEIKTGLFKDGLDMSALREVKYLQELKH-PNVIEL  86

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S   +  LVLEFLP DL  +IK     + +     +IK W++  L  +  CHRN 
Sbjct  87   VDVF-SATNNLNLVLEFLPCDLEVLIKDKSIVFKSA----DIKSWLLMTLRGIHHCHRNF  141

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            I+HRDLKP+NLL++ +G LK+ADFG AR L+ P 
Sbjct  142  ILHRDLKPNNLLLAPDGQLKIADFGLARALVNPN  175



>gb|EPZ31846.1| Protein kinase, catalytic domain-containing protein [Rozella 
allomycis CSF55]
Length=324

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 94/153 (61%), Gaps = 13/153 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCP  354
            KYE   ++G G Y+ VY+GR +  + T+A+K+I           SALREI+ LQ L++ P
Sbjct  3    KYEKICKIGEGTYAVVYKGRIKKTNETIAIKKIKVSNFTIGIDHSALREIKFLQELKH-P  61

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            N++ + + F S  ++  +VLEFL  DL  +IK      +      +IK WM  + + +  
Sbjct  62   NIIKLFDVF-SHKKNLNMVLEFLDADLEHLIKDT----NVVFMPADIKSWMWMLFNGLSY  116

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQAR  633
            CH + +VHRDLKP+NLL+S NG+LK+ADFG AR
Sbjct  117  CHMHFVVHRDLKPNNLLLSQNGVLKIADFGLAR  149



>gb|KHC40692.1| serine/threonine-protein kinase KIN28 [Candida albicans P76055]
Length=343

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 13/154 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G++ S    +A+KEI           SALRE++ LQ L++ PNV+ +
Sbjct  28   KKVGEGTYAVVYLGKQISTKRQIAIKEIKTGLFKDGLDMSALREVKYLQELKH-PNVIEL  86

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S   +  LVLEFLP DL  +IK     + +     +IK W++  L  +  CHRN 
Sbjct  87   VDVF-SATNNLNLVLEFLPCDLEVLIKDKSIVFKSA----DIKSWLLMTLRGIHHCHRNF  141

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            I+HRDLKP+NLL++ +G LK+ADFG AR L+ P 
Sbjct  142  ILHRDLKPNNLLLAPDGQLKIADFGLARALVNPN  175



>ref|XP_002417288.1| serine/threonine protein kinase (stpk), putative [Candida dubliniensis 
CD36]
 emb|CAX44916.1| serine/threonine protein kinase (stpk), putative [Candida dubliniensis 
CD36]
Length=343

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 13/154 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G++ S    +A+KEI           SALRE++ LQ L++ PNV+ +
Sbjct  28   KKVGEGTYAVVYLGKQISTKRQIAIKEIKTGLFKDGLDMSALREVKYLQELKH-PNVIEL  86

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S   +  LVLEFLP DL  +IK     + +     +IK W++  L  +  CHRN 
Sbjct  87   IDVF-SATNNLNLVLEFLPCDLEVLIKDKSIVFKSA----DIKSWLLMTLRGIHHCHRNF  141

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            I+HRDLKP+NLL++ +G LK+ADFG AR L+ P 
Sbjct  142  ILHRDLKPNNLLLAPDGQLKIADFGLARALVNPN  175



>ref|XP_718828.1| likely protein kinase [Candida albicans SC5314]
 ref|XP_718744.1| likely protein kinase [Candida albicans SC5314]
 gb|EAK99834.1| likely protein kinase [Candida albicans SC5314]
 gb|EAK99922.1| likely protein kinase [Candida albicans SC5314]
 gb|KGQ99048.1| serine/threonine-protein kinase KIN28 [Candida albicans P37005]
 gb|KGR15784.1| serine/threonine-protein kinase KIN28 [Candida albicans P57072]
 gb|KGR21685.1| serine/threonine-protein kinase KIN28 [Candida albicans P78048]
 gb|KGR23712.1| serine/threonine-protein kinase KIN28 [Candida albicans P37037]
 gb|KGT72111.1| serine/threonine-protein kinase KIN28 [Candida albicans 12C]
 gb|KGU17404.1| serine/threonine-protein kinase KIN28 [Candida albicans 19F]
 gb|KGU18905.1| serine/threonine-protein kinase KIN28 [Candida albicans L26]
 gb|KHC43487.1| serine/threonine-protein kinase KIN28 [Candida albicans P76067]
 gb|KHC57617.1| serine/threonine-protein kinase KIN28 [Candida albicans P60002]
 gb|KHC62271.1| serine/threonine-protein kinase KIN28 [Candida albicans P37039]
 gb|KHC68836.1| serine/threonine-protein kinase KIN28 [Candida albicans P75010]
 gb|KHC83435.1| serine/threonine-protein kinase KIN28 [Candida albicans SC5314]
 gb|KHC89471.1| serine/threonine-protein kinase KIN28 [Candida albicans SC5314]
Length=343

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 13/154 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G++ S    +A+KEI           SALRE++ LQ L++ PNV+ +
Sbjct  28   KKVGEGTYAVVYLGKQISTKRQIAIKEIKTGLFKDGLDMSALREVKYLQELKH-PNVIEL  86

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S   +  LVLEFLP DL  +IK     + +     +IK W++  L  +  CHRN 
Sbjct  87   VDVF-SATNNLNLVLEFLPCDLEVLIKDKSIVFKSA----DIKSWLLMTLRGIHHCHRNF  141

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            I+HRDLKP+NLL++ +G LK+ADFG AR L+ P 
Sbjct  142  ILHRDLKPNNLLLAPDGQLKIADFGLARALVNPN  175



>gb|KFY48459.1| hypothetical protein V496_10268, partial [Pseudogymnoascus pannorum 
VKM F-4515 (FW-2607)]
Length=325

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 109/188 (58%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y       A+RE++ LQ L +
Sbjct  60   KYIKGKKLGEGTYANVYLGTLRSDPTHFVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  119

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S D++  LVLEFLP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  120  -PNIITLHSVFSSRDQNLNLVLEFLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  173

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  174  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARAF----------ADPYKQMTSN  223

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  224  VITRWYRP  231



>gb|KFA65474.1| hypothetical protein S40285_00412 [Stachybotrys chlorohalonata 
IBT 40285]
Length=327

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 92/156 (59%), Gaps = 10/156 (6%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACH  540
            V +H+   +E++  +LV EF+  DL   +    +     L    IK +M Q+L  +D CH
Sbjct  69   VALHDVIHTENK-LMLVFEFMDGDLKRYMDTHGER--GALKPTTIKSFMYQLLKGIDFCH  125

Query  541  RNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +N ++HRDLKP NLLI++ G+LKL DFG AR    P
Sbjct  126  KNRVLHRDLKPQNLLINNKGVLKLGDFGLARAFGIP  161



>gb|KEY64313.1| hypothetical protein S7711_06357 [Stachybotrys chartarum IBT 
7711]
 gb|KFA52800.1| hypothetical protein S40293_00995 [Stachybotrys chartarum IBT 
40293]
 gb|KFA75324.1| hypothetical protein S40288_00183 [Stachybotrys chartarum IBT 
40288]
Length=331

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 92/156 (59%), Gaps = 10/156 (6%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACH  540
            V +H+   +E++  +LV EF+  DL   +    +     L    IK +M Q+L  +D CH
Sbjct  69   VALHDVIHTENK-LMLVFEFMDGDLKRYMDTHGER--GALKPTTIKSFMYQLLKGIDFCH  125

Query  541  RNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +N ++HRDLKP NLLI++ G+LKL DFG AR    P
Sbjct  126  KNRVLHRDLKPQNLLINNKGVLKLGDFGLARAFGIP  161



>gb|KFY15206.1| hypothetical protein V492_02162, partial [Pseudogymnoascus pannorum 
VKM F-4246]
Length=275

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQSAL-----REIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y   L     RE++ LQ L +
Sbjct  4    KYIKGKKLGEGTYANVYLGTLRSDPTHLVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  63

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S D++  LVLE+LP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  64   -PNIITLHSVFSSRDQNLNLVLEYLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  117

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  118  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARSF----------ADPYKQMTSN  167

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  168  VITRWYRP  175



>gb|KFZ03799.1| hypothetical protein V501_09303, partial [Pseudogymnoascus pannorum 
VKM F-4519 (FW-2642)]
Length=332

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 108/188 (57%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQSAL-----REIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y   L     RE++ LQ L +
Sbjct  60   KYIKGKKLGEGTYANVYLGTLRSDPTHFVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  119

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S D++  LVLEFLP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  120  -PNIITLHSVFSSRDQNLNLVLEFLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  173

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  174  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARAF----------ADPYKQMTSN  223

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  224  VITRWYRP  231



>ref|XP_002594508.1| hypothetical protein BRAFLDRAFT_124968 [Branchiostoma floridae]
 gb|EEN50519.1| hypothetical protein BRAFLDRAFT_124968 [Branchiostoma floridae]
Length=340

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 100/169 (59%), Gaps = 18/169 (11%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I ER+G GA+  V++ +       VALK++   +       +ALREI+ALQ ++   
Sbjct  3    QYTIMERIGEGAHGIVFKAKHVESGEVVALKKVPLRRLEDGIPNTALREIKALQEIEENQ  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            +VV + E F       VLV E++ +DL  V++    N +  LT  ++K +M+ +L  V  
Sbjct  63   HVVKLREVF-PHGTGFVLVFEYMLSDLSEVLR----NSNRPLTEAQVKSYMMMLLKGVAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPY  681
            CH N+I+HRDLKP+NLLIS+ G LK+ADFG AR+       A +DG+ Y
Sbjct  118  CHENNIMHRDLKPANLLISETGHLKIADFGLARVF------ANEDGRLY  160



>ref|XP_011276854.1| Serine/threonine-protein kinase [Wickerhamomyces ciferrii]
 emb|CCH41300.1| Serine/threonine-protein kinase [Wickerhamomyces ciferrii]
Length=317

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 98/158 (62%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y   ++VG G Y+ V+ G++      +A+KEI   Q       SALRE++ LQ L++  
Sbjct  13   RYTKSKKVGEGTYAVVFLGKQIESGRNIAIKEIKTGQFKDGLDMSALREVKYLQELRHV-  71

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NV+ + + F S D++  LVLEFLP DL  +IK    + +   +  ++K W++  L  V  
Sbjct  72   NVIELVDVF-SADDNLNLVLEFLPADLEMIIK----DREILFSPADMKSWLLMTLRGVHH  126

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            CHRN I+HRDLKP+NLL++ +G LK+ADFG AR L +P
Sbjct  127  CHRNYILHRDLKPNNLLLAPDGQLKIADFGLARSLGSP  164



>gb|KIP10011.1| hypothetical protein PHLGIDRAFT_34114 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=367

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            +++G G Y+ VYRGR  S    VA+K+I   Q       SA+RE++ L+ L++  NV+ +
Sbjct  19   QKIGEGTYAVVYRGREASTGRKVAIKKIKVGQFKDGLDMSAIREVKYLRELKH-QNVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S   +  LVLEFL T+L  VIK      D  L     +IK W+      ++ CHR
Sbjct  78   LDVF-SSKTNLNLVLEFLDTELELVIK------DRSLVFLPADIKAWIAMTFRGLEFCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N I+HRDLKP+NLLIS NG+LKLADFG AR    PG
Sbjct  131  NWILHRDLKPNNLLISANGVLKLADFGLARDFADPG  166



>gb|EGE01384.1| CMGC/CDK/CDK7 protein kinase [Trichophyton equinum CBS 127.97]
Length=406

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 108/186 (58%), Gaps = 19/186 (10%)
 Frame = +1

Query  133  TPMDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLT-VALKEIH---D  300
             P  S P    +  +  ++  KY   +++G G Y+ VY G  R D  + VA+K+I    +
Sbjct  42   VPKPSMPEPELAEQSNADVRRKYVKDKKLGEGTYAVVYLGHLRDDPTSLVAIKKIKLNAE  101

Query  301  YQS-----ALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKK  462
            Y+      A+RE++ LQ L + PNV+ +H+ F S+D++  LVLEFLP  DL  +IK    
Sbjct  102  YKDGLSMDAIREVKYLQELSH-PNVIALHDVFSSKDQNLNLVLEFLPLGDLEMLIK----  156

Query  463  NWDNGLTVG--EIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARM  636
              DN +  G  +IK W+  +   V  CH+N I+HRD+KP+NLLI+ +G +KLADFG AR 
Sbjct  157  --DNSIQYGVADIKAWISMLARGVWFCHKNFILHRDIKPNNLLIASDGEVKLADFGLARS  214

Query  637  LLAPGL  654
               P L
Sbjct  215  FADPYL  220



>gb|KFY72795.1| hypothetical protein V499_07081, partial [Pseudogymnoascus pannorum 
VKM F-103]
Length=363

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 109/188 (58%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y       A+RE++ LQ L +
Sbjct  60   KYIKGKKLGEGTYANVYLGTLRSDPTHFVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  119

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S D++  LVLEFLP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  120  -PNIITLHSVFSSRDQNLNLVLEFLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  173

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  174  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARAF----------ADPYKQMTSN  223

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  224  VITRWYRP  231



>gb|ELR07477.1| CMGC/CDK/CDK7 protein kinase [Pseudogymnoascus destructans 20631-21]
Length=384

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 109/188 (58%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y       A+RE++ LQ L +
Sbjct  60   KYIKGKKLGEGTYANVYLGTLRSDPTHFVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  119

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S D++  LVLEFLP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  120  -PNIITLHSVFSSRDQNLNLVLEFLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  173

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  174  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARAF----------ADPYKQMTSN  223

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  224  VITRWYRP  231



>gb|EEQ42529.1| serine/threonine-protein kinase KIN28 [Candida albicans WO-1]
 gb|KGU34030.1| serine/threonine-protein kinase KIN28 [Candida albicans P34048]
 gb|KGU37862.1| serine/threonine-protein kinase KIN28 [Candida albicans P57055]
 gb|KHC85253.1| serine/threonine-protein kinase KIN28 [Candida albicans P78042]
Length=343

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 94/154 (61%), Gaps = 13/154 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G++ +    +A+KEI           SALRE++ LQ L++ PNV+ +
Sbjct  28   KKVGEGTYAVVYLGKQITTKRQIAIKEIKTGLFKDGLDMSALREVKYLQELKH-PNVIEL  86

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S   +  LVLEFLP DL  +IK     + +     +IK W++  L  +  CHRN 
Sbjct  87   VDVF-SATNNLNLVLEFLPCDLEVLIKDKSIVFKSA----DIKSWLLMTLRGIHHCHRNF  141

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            I+HRDLKP+NLL++ +G LK+ADFG AR L+ P 
Sbjct  142  ILHRDLKPNNLLLAPDGQLKIADFGLARALVNPN  175



>gb|EMS18428.1| cyclin-dependent protein kinase [Rhodosporidium toruloides NP11]
 emb|CDR39924.1| RHTO0S04e12090g1_1 [Rhodosporidium toruloides]
Length=361

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 97/158 (61%), Gaps = 17/158 (11%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQ  345
            I  KY   ++VG G Y+ VY G+  + +  +A+K+I   Q       SA+RE++ L+ L+
Sbjct  11   IQRKYTKDKKVGEGTYAVVYVGKEVATARKIAIKKIKVGQFKDGLDMSAIREVKFLRELR  70

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQIL  519
            + PNV+ + + F S   +  LVLEFL TDL AVI+      D  L     ++K WM+  +
Sbjct  71   H-PNVIELLDVF-SNKSNLNLVLEFLDTDLEAVIR------DKALVFQGADVKSWMLMTM  122

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQAR  633
              +D CH N I+HRD+KP+NLLIS +G+LKLADFG AR
Sbjct  123  KGLDFCHTNWILHRDMKPNNLLISADGVLKLADFGLAR  160



>ref|XP_001382915.2| serine-threonine kinase, subunit of RNA Pol TFIIK [Scheffersomyces 
stipitis CBS 6054]
 gb|ABN64886.2| serine-threonine kinase, subunit of RNA Pol TFIIK [Scheffersomyces 
stipitis CBS 6054]
Length=338

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 103/187 (55%), Gaps = 24/187 (13%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCP  354
            KY    +VG G Y+ VY G + S    +A+KEI           SA+RE++ LQ L++ P
Sbjct  20   KYSKDRKVGEGTYAVVYLGNQVSTKRRIAIKEIKTGIFKDGLDMSAIREVKYLQELKH-P  78

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NV+ + + F S   +  LVLEFLP DL  +IK     + +     +IK W++  L  +  
Sbjct  79   NVIELVDVF-STTNNLNLVLEFLPCDLEVLIKDTSIVFKSS----DIKSWLLMTLRGIHH  133

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPTPM  714
            CHRN I+HRDLKP+NLL++ +G LK+ADFG AR L          G P    S NV T  
Sbjct  134  CHRNFILHRDLKPNNLLLAPDGQLKIADFGLARSL----------GNPNEDLSSNVVTRW  183

Query  715  Y-TPEFV  732
            Y +PE +
Sbjct  184  YRSPELL  190



>gb|ETE70966.1| Cyclin-dependent kinase 20, partial [Ophiophagus hannah]
Length=320

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 94/159 (59%), Gaps = 12/159 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V++ +      TVALK++   +        ALREI+ALQ ++   
Sbjct  3    QYSILGRIGEGAHGIVFKAKNIETGETVALKKVALRKLEDGIPNQALREIKALQEIEENQ  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            +VV + + F       VLV E++ +DL  VI+    N +  LT  ++K +M+ +L  V  
Sbjct  63   HVVQLKDVF-PHGTGFVLVFEYMLSDLSEVIR----NSEQPLTEAQVKGYMLMLLKGVAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            CH NSI+HRDLKP+NLLIS  G LK+ADFG AR+  + G
Sbjct  118  CHANSIMHRDLKPANLLISSTGQLKIADFGLARVFTSDG  156



>ref|XP_003216903.1| PREDICTED: cyclin-dependent kinase 20 [Anolis carolinensis]
Length=343

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 94/159 (59%), Gaps = 12/159 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V++ +      TVALK++   +        ALREI+ALQ ++   
Sbjct  3    QYSILGRIGEGAHGIVFKAKNIETGETVALKKVALRKLEDGIPNQALREIKALQEIEENQ  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            +VV + + F       VLV E++ +DL  VI+    N +  LT  ++K +M+ +L  V  
Sbjct  63   HVVKLKDVF-PHGTGFVLVFEYMLSDLSEVIR----NSEQPLTEAQVKGYMLMLLKGVAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            CH NSI+HRDLKP+NLLIS  G LK+ADFG AR+  + G
Sbjct  118  CHANSIMHRDLKPANLLISSTGQLKIADFGLARVFTSDG  156



>gb|ENH78817.1| serine threonine-protein kinase [Colletotrichum orbiculare MAFF 
240422]
Length=410

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 106/185 (57%), Gaps = 12/185 (6%)
 Frame = +1

Query  121  REKETPMDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH  297
            R+K  P+  PP+   +    +E   KY   +++G G Y+ V+ G  RSD S  VA+K+I 
Sbjct  45   RDKAAPISLPPTLDLAEQMNEEEKRKYVKGKKLGEGTYAIVFLGHLRSDKSSLVAIKKIK  104

Query  298  ---DYQS-----ALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKA  453
               +YQ      A+RE++ LQ LQ+ PN++ +   F S+D++  LVLE+LP  LG +   
Sbjct  105  IQKEYQEGMAPDAVRELKHLQELQH-PNIISLLSVFSSKDQNLNLVLEYLP--LGDLEML  161

Query  454  AKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQAR  633
             K          +IK WM  +  AV  CH N ++HRD+KP+NLLI+ +G +KLADFG AR
Sbjct  162  IKDTASVRYGAADIKAWMGMLTRAVWFCHENFVLHRDIKPNNLLIAADGEVKLADFGLAR  221

Query  634  MLLAP  648
                P
Sbjct  222  GFADP  226



>ref|XP_007781978.1| CMGC/CDK/CDK7 protein kinase [Coniosporium apollinis CBS 100218]
 gb|EON66661.1| CMGC/CDK/CDK7 protein kinase [Coniosporium apollinis CBS 100218]
Length=399

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 109/186 (59%), Gaps = 24/186 (13%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLT-VALKEIH---DYQS-----ALREIEALQTLQN  348
            +YE   ++G G Y+ V++G  +SD  + VA+K+I    +Y+      A+REI+ LQ L +
Sbjct  59   RYEKGRKLGEGTYAVVFKGHLKSDPASLVAIKKIKINANYKDGLAMDAIREIKFLQELSH  118

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
             PN++ +H  F S++    LVLEFLP  DL  +I+  K N   GL   +IK WMV +  A
Sbjct  119  -PNIIALHAVFTSKNLQLNLVLEFLPRGDLEMLIRDPK-NVHYGL--ADIKAWMVMLSRA  174

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVP  705
            V  CH+N ++HRD+KP+NLLI+++G +KLADFG AR              PY K +  V 
Sbjct  175  VYFCHQNFVLHRDIKPNNLLIAEDGEVKLADFGLARSF----------ADPYEKMTFEVI  224

Query  706  TPMYTP  723
            T  Y P
Sbjct  225  TRWYRP  230



>emb|CEL61726.1| cyclin-dependent kinase 7 [Rhizoctonia solani AG-1 IB]
Length=364

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 99/177 (56%), Gaps = 23/177 (13%)
 Frame = +1

Query  214  RVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVMH  372
            ++G G Y+ VY+GR  +    +A+K+I   Q       SA+RE+  L+ L++ PNV+ + 
Sbjct  20   KIGEGTYAIVYKGREAATGRQIAIKKIKVGQMKEGLDQSAIREVRYLRELKH-PNVIELL  78

Query  373  EFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSI  552
            + F S   +  LVLEFL TDL AVIK    +  N     +IK WM   L  ++ CHRN +
Sbjct  79   DVF-SSKTNLNLVLEFLETDLEAVIK----DRTNVFLPADIKSWMAMTLRGLEYCHRNWV  133

Query  553  VHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPTPMYTP  723
            +HRDLKP+NLLI+ +G LK+ADFG AR          D   P  K +  V T  Y P
Sbjct  134  LHRDLKPNNLLIAADGELKIADFGLAR----------DSTDPAQKMTCQVITRWYRP  180



>ref|XP_007877362.1| hypothetical protein PFL1_01661 [Pseudozyma flocculosa PF-1]
 gb|EPQ30760.1| hypothetical protein PFL1_01661 [Pseudozyma flocculosa PF-1]
Length=377

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 101/182 (55%), Gaps = 24/182 (13%)
 Frame = +1

Query  139  MDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ----  306
            MDS  +K+ +I         Y   E+VG G Y+ V+  +       VA+K+I        
Sbjct  1    MDSASAKNLAIRNL------YAKIEKVGEGTYASVFLAKNTKTGRKVAIKKIKIVNNANG  54

Query  307  ---SALREIEALQTLQNCPNVVVMHEFFWSEDEDSVL--VLEFLPTDLGAVIKAAKKNWD  471
               +A+RE++ L+ LQ+ PNV++M + F S      L  VLEFL T+L A+IK      D
Sbjct  55   MDVTAIREVKFLKELQH-PNVILMIDVFSSGSVTPSLNLVLEFLDTNLEALIK------D  107

Query  472  NGL--TVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLA  645
             GL  T  ++K WM  +   ++ CHRN ++HRDLKP+NLLIS  G LK+ADFG AR    
Sbjct  108  RGLIFTSADVKSWMAMLCRGLEYCHRNWVLHRDLKPNNLLISPEGELKIADFGLAREFGD  167

Query  646  PG  651
            PG
Sbjct  168  PG  169



>ref|XP_007839773.1| Negative regulator of the PHO system [Pestalotiopsis fici W106-1]
 gb|ETS76057.1| Negative regulator of the PHO system [Pestalotiopsis fici W106-1]
Length=330

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNG-LTVGEIKRWMVQILSAVDAC  537
            V +H+   +E++  +LV E++  DL    K    + D G L    IK +M Q+L  +D C
Sbjct  69   VALHDVIHTENK-LMLVFEYMDGDLK---KYMDTHGDRGALKPMTIKSFMYQLLKGIDFC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLIS  G+LKL DFG AR    P
Sbjct  125  HQNRVLHRDLKPQNLLISPKGVLKLGDFGLARAFGIP  161



>ref|XP_007320727.1| hypothetical protein SERLADRAFT_451075 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN96621.1| hypothetical protein SERLA73DRAFT_170069 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO22189.1| hypothetical protein SERLADRAFT_451075 [Serpula lacrymans var. 
lacrymans S7.9]
Length=369

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 92/156 (59%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG GAY+ VYRGR  S    VA+K+I   Q       SA+RE++ L+ L +  NV+ +
Sbjct  19   QKVGEGAYAVVYRGREVSTGRKVAIKKIKVGQFKDGLDMSAVREVKYLRELHHL-NVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S   +  LVLEFL +DL  +IK      D  L     +IK WM      ++ CHR
Sbjct  78   LDVF-SSKTNLNLVLEFLDSDLEIIIK------DRSLVFLPADIKSWMAMTFRGLEFCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N ++HRDLKP+NLLI+ NG LK+ADFG AR    PG
Sbjct  131  NFVLHRDLKPNNLLIASNGQLKIADFGLARDFADPG  166



>ref|XP_007422275.1| PREDICTED: cyclin-dependent kinase 20-like isoform X1 [Python 
bivittatus]
Length=343

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 94/159 (59%), Gaps = 12/159 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V++ +      TVALK++   +        ALREI+ALQ ++   
Sbjct  3    QYSILGRIGEGAHGIVFKAKNIETGETVALKKVALRKLEDGIPNQALREIKALQEIEENQ  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            +VV + + F       VLV E++ +DL  VI+    N +  LT  ++K +M+ +L  V  
Sbjct  63   HVVQLKDVF-PHGTGFVLVFEYMLSDLSEVIR----NSEQPLTEAQVKGYMLMLLKGVAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            CH NSI+HRDLKP+NLLIS  G LK+ADFG AR+  + G
Sbjct  118  CHANSIMHRDLKPANLLISSTGQLKIADFGLARVFTSDG  156



>emb|CDQ75933.1| unnamed protein product [Oncorhynchus mykiss]
Length=479

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 106/188 (56%), Gaps = 20/188 (11%)
 Frame = +1

Query  112  KQEREKETPMDSPPSKSWSIHTRK----EITI----KYEIFERVGSGAYSDVYRGRRRSD  267
            + ERE E+  +SPP K  S  +R+    +I       Y    ++G G Y+ V++GR +  
Sbjct  112  QMEREMESENNSPPCKPLSRMSRRASLSDIGFGKLETYVKLGKLGEGTYATVFKGRSKLT  171

Query  268  SLTVALKEI---HDYQ---SALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPT  429
               VALKEI   H+     +A+RE+  L+ L++  N+V +H+   +E     LV E+L +
Sbjct  172  ENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHA-NIVTLHDIIHTE-RSLTLVFEYLDS  229

Query  430  DLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILK  609
            DL    K    N  N +++  +K +M Q+L  +  CH+  I+HRDLKP NLLI+D G LK
Sbjct  230  DL----KQYLDNCGNLMSMNNVKIFMFQLLRGLSYCHKRKILHRDLKPQNLLINDKGELK  285

Query  610  LADFGQAR  633
            LADFG AR
Sbjct  286  LADFGLAR  293



>gb|KFY47858.1| hypothetical protein V495_01778 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
Length=433

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 110/188 (59%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y       A+RE++ LQ L +
Sbjct  76   KYIKGKKLGEGTYANVYLGTLRSDPTHFVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  135

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S+D++  LVLEFLP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  136  -PNIITLHSVFSSKDQNLNLVLEFLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  189

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  190  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARSF----------ADPYKQMTSN  239

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  240  VITRWYRP  247



>gb|KFY56126.1| hypothetical protein V497_06489 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=417

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 110/188 (59%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y       A+RE++ LQ L +
Sbjct  76   KYIKGKKLGEGTYANVYLGTLRSDPTHFVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  135

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S+D++  LVLEFLP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  136  -PNIITLHSVFSSKDQNLNLVLEFLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  189

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  190  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARSF----------ADPYKQMTSN  239

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  240  VITRWYRP  247



>gb|KIM33959.1| hypothetical protein M408DRAFT_325514 [Serendipita vermifera 
MAFF 305830]
Length=376

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 95/160 (59%), Gaps = 13/160 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            KY    +VG GAY+ VY+GR  +    VA+K+I   Q       SA+RE++ L+ LQ+  
Sbjct  14   KYSKEVKVGEGAYAVVYKGREIATGRQVAIKKIKVGQFKDGLDMSAVREVKYLRELQH-D  72

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NV+ + + F S   +  LVLEFL  DL  +IK    +  N     +IK WMV  L  ++ 
Sbjct  73   NVIALLDVF-SSKTNLNLVLEFLDADLEIIIK----DRSNVFQPADIKSWMVMTLRGLEF  127

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGL  654
            CHRN I+HRDLKP+NLL++ +G LK+ADFG AR    P +
Sbjct  128  CHRNFILHRDLKPNNLLLASDGQLKIADFGLARDFADPNV  167



>gb|KDB18977.1| negative regulator of the PHO system [Ustilaginoidea virens]
 dbj|GAO16453.1| hypothetical protein UVI_037340 [Ustilaginoidea virens]
Length=326

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 91/156 (58%), Gaps = 10/156 (6%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACH  540
            V +H+   +E++  +LV E++  DL   +    +     L    IK +M Q+L  +D CH
Sbjct  69   VALHDVIHTENK-LMLVFEYMDGDLKRYMDTHGER--GALKPATIKSFMYQLLKGIDFCH  125

Query  541  RNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +N ++HRDLKP NLLI+  GILKL DFG AR    P
Sbjct  126  QNRVLHRDLKPQNLLINSKGILKLGDFGLARAFGIP  161



>gb|KIJ20802.1| hypothetical protein PAXINDRAFT_95799 [Paxillus involutus ATCC 
200175]
Length=368

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 91/156 (58%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VYRGR  S    VA+K+I   Q       SA+RE++ L+ L +  NV+ +
Sbjct  19   QKVGEGTYAVVYRGREASTGRKVAVKKIKVGQFKDGLDMSAIREVKYLRELHH-QNVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S   +  LVLEFL +DL  +IK      D  L     +IK WM      ++ CHR
Sbjct  78   LDVF-SSKTNLNLVLEFLDSDLEIIIK------DRSLVFLPADIKSWMAMTFRGLEFCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N I+HRDLKP+NLLI+ NG LKLADFG AR    PG
Sbjct  131  NFILHRDLKPNNLLIASNGQLKLADFGLARDFADPG  166



>gb|EGD96938.1| CMGC/CDK/CDK7 protein kinase [Trichophyton tonsurans CBS 112818]
 gb|EZF35117.1| CMGC/CDK/CDK7 protein kinase [Trichophyton interdigitale H6]
 gb|KDB23635.1| CMGC/CDK/CDK7 protein kinase [Trichophyton interdigitale MR816]
Length=406

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 107/186 (58%), Gaps = 19/186 (10%)
 Frame = +1

Query  133  TPMDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLT-VALKEIH---D  300
             P  S P    +     ++  KY   +++G G Y+ VY G  R D  + VA+K+I    +
Sbjct  42   VPKPSMPEPELAEQLNADVRRKYVKDKKLGEGTYAVVYLGHLRDDPTSLVAIKKIKLNAE  101

Query  301  YQS-----ALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKK  462
            Y+      A+RE++ LQ L + PNV+ +H+ F S+D++  LVLEFLP  DL  +IK    
Sbjct  102  YKDGLSMDAIREVKYLQELSH-PNVIALHDVFSSKDQNLNLVLEFLPLGDLEMLIK----  156

Query  463  NWDNGLTVG--EIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARM  636
              DN +  G  +IK W+  +   V  CH+N I+HRD+KP+NLLI+ +G +KLADFG AR 
Sbjct  157  --DNSIQYGVADIKAWISMLARGVWFCHKNFILHRDIKPNNLLIASDGEVKLADFGLARS  214

Query  637  LLAPGL  654
               P L
Sbjct  215  FADPYL  220



>ref|XP_006684978.1| Pkinase-domain-containing protein [Candida tenuis ATCC 10573]
 gb|EGV65292.1| Pkinase-domain-containing protein [Candida tenuis ATCC 10573]
Length=321

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 104/190 (55%), Gaps = 28/190 (15%)
 Frame = +1

Query  193  IKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNC  351
            +KY    +VG G Y+ VY G++     ++A+KEI           SA+RE++ LQ L++ 
Sbjct  7    LKYSKERKVGEGTYAVVYLGKQMKTKRSIAIKEIKTGLFKDGLDMSAIREVKYLQELKHL  66

Query  352  PNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSA  525
             NV+ + + F S +  + LVLEFLP DL  +IK      D  +     +IK W++  L  
Sbjct  67   -NVIELIDVFSSANNLN-LVLEFLPCDLEVLIK------DQSIIFKPSDIKSWLLMTLRG  118

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVP  705
            V  CHRN I+HRDLKP+NLLI+ +G LK+ADFG AR L          G P    SP V 
Sbjct  119  VHHCHRNFILHRDLKPNNLLIAPDGQLKIADFGLARSL----------GNPNEDLSPMVV  168

Query  706  TPMY-TPEFV  732
            T  Y  PE +
Sbjct  169  TRWYRAPELL  178



>gb|EPS94542.1| hypothetical protein FOMPIDRAFT_1033293 [Fomitopsis pinicola 
FP-58527 SS1]
Length=372

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 93/156 (60%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            +++G G Y+ VYRGR  +    VA+K+I   Q       SA+RE++ L+ L++  NV+ +
Sbjct  19   QKIGEGTYAVVYRGREIATGRKVAIKKIKVGQFKDGLDMSAIREVKYLRELKHA-NVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S  ++  LVLEFL TDL  VI+      D  L     +IK WM      ++ CHR
Sbjct  78   LDVF-STKQNLNLVLEFLDTDLELVIR------DRSLVFLPTDIKSWMAMTFRGLEFCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N I+HRDLKP+NLLI+ NG LKLADFG AR    PG
Sbjct  131  NFILHRDLKPNNLLIAANGQLKLADFGLARDFADPG  166



>gb|EJU03529.1| CMGC/CDK/CDK7 protein kinase [Dacryopinax sp. DJM-731 SS1]
Length=360

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 96/159 (60%), Gaps = 13/159 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y    ++G G ++ VY+GR+ S    VA+K+I   Q       +A+RE++ LQ L++ P
Sbjct  14   RYTKESKIGEGTFAVVYKGRQLSTGRPVAIKKIKVGQFRDGLDMTAIREVKFLQELKH-P  72

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NV+ + + + S   +  LVLEFL +DL  +IK    + +N     +IK WM      ++ 
Sbjct  73   NVIELLDVY-SNKSNLNLVLEFLDSDLEMIIK----DRNNVFKPADIKSWMAMTCRGLEF  127

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            CHRN I+HRDLKP+NLL++ NG LK+ADFG AR    PG
Sbjct  128  CHRNWILHRDLKPNNLLLAANGELKIADFGLARDFTDPG  166



>emb|CDR42046.1| CYFA0S08e02982g1_1 [Cyberlindnera fabianii]
Length=313

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 92/160 (58%), Gaps = 17/160 (11%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y   ++VG G Y+ VY G+  +    +A+KEI   Q       SALRE++ LQ L++  
Sbjct  13   QYTKAKKVGEGTYAVVYLGKEVTSGRDIAVKEIKTGQFKDGLDMSALREMKFLQELRHV-  71

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAV  528
            NV+ +   F  +  D  LVLEFLP DL  +IK      D  L      +K W++  L  V
Sbjct  72   NVIELVAVF-EQTGDLNLVLEFLPCDLEVLIK------DRSLVFSPANVKSWLLMTLRGV  124

Query  529  DACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
              CHRN I+HRDLKPSNLL+  +G LK+ADFG AR L AP
Sbjct  125  HHCHRNYILHRDLKPSNLLLGRDGQLKIADFGLARALGAP  164



>ref|XP_447246.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60179.1| unnamed protein product [Candida glabrata]
Length=307

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 96/155 (62%), Gaps = 17/155 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G ++S    +A+KEI   +       SA+RE++ LQ +Q+  NV+ +
Sbjct  10   KKVGEGTYAVVYVGTKQSTGRRIAVKEIKTSEFKDGLDMSAIREVKYLQEMQHV-NVIEL  68

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGL--TVGEIKRWMVQILSAVDACHR  543
             + F S    + LVLE+LPTDL  VIK      D  +  T  +IK WM+  +  V  CHR
Sbjct  69   VDIFMSYGNLN-LVLEYLPTDLEVVIK------DKSILFTPADIKSWMLMSVRGVHHCHR  121

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            N I+HRDLKP+NLLI+ +G +K+ADFG AR + +P
Sbjct  122  NFILHRDLKPNNLLIAPDGQIKVADFGLARAVPSP  156



>ref|XP_008038263.1| CMGC/CDK/CDK7 protein kinase [Trametes versicolor FP-101664 SS1]
 gb|EIW58669.1| CMGC/CDK/CDK7 protein kinase [Trametes versicolor FP-101664 SS1]
Length=368

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 94/156 (60%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            +++G GAY+ VY+GR  +    VA+K+I   Q       SA+RE++ L+ L++  NV+ +
Sbjct  19   QKIGEGAYAVVYKGREIATGRKVAIKKIKVGQFKDGLDMSAIREVKFLRELKH-QNVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S  ++  LVLEFL TDL  VIK      D  L     +IK WM      ++ CHR
Sbjct  78   LDVF-SSKKNLNLVLEFLDTDLELVIK------DRSLVFLPADIKSWMAMTFRGLEFCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N I+HRDLKP+NLLI+ NG LK+ADFG AR    PG
Sbjct  131  NFILHRDLKPNNLLIAANGQLKIADFGLARDFADPG  166



>ref|XP_002554617.1| KLTH0F09504p [Lachancea thermotolerans]
 emb|CAR24180.1| KLTH0F09504p [Lachancea thermotolerans CBS 6340]
Length=308

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 95/153 (62%), Gaps = 13/153 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G ++S +  VA+KEI           SA+RE++ LQ +Q+  NV+ +
Sbjct  11   KKVGEGTYAVVYVGTKQSSNRKVAIKEIKTSGFKDGLDMSAIREVKYLQEMQHI-NVIEL  69

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + + ++   + LVLEFLP DL  +IK     +    T  +IK W++  L  V  CHRN 
Sbjct  70   IDVYMAQSNLN-LVLEFLPADLEMIIKDTAILF----TQADIKSWLLMTLRGVHHCHRNF  124

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            I+HRDLKP+NLL++ +G LKLADFG AR + +P
Sbjct  125  ILHRDLKPNNLLLAPDGQLKLADFGLARNMGSP  157



>emb|CEP17028.1| hypothetical protein [Parasitella parasitica]
Length=303

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 92/157 (59%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPN  357
            +Y   ER+G G Y+ VY+G+ ++    VALKEI          +A+REI  L+ L++ PN
Sbjct  11   RYIRLERLGEGTYATVYKGKNKATGDIVALKEIRLDPEEGAPSTAIREISLLKELKH-PN  69

Query  358  VVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDAC  537
            ++ + +   +E    +LV E++  DL   + A  K   + L    IKR+M Q+L  +D C
Sbjct  70   ILCLIDVIHTEST-LMLVFEYMDQDLKKYMDANAKVTKSPLPSETIKRFMYQLLKGIDYC  128

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLI+ + +LKL DFG AR    P
Sbjct  129  HQNRVLHRDLKPQNLLINKHKVLKLGDFGLARAFGIP  165



>gb|KFY19972.1| hypothetical protein V493_07784 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=340

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQSAL-----REIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y   L     RE++ LQ L +
Sbjct  60   KYIKGKKLGEGTYANVYLGTLRSDPTHLVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  119

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S D++  LVLE+LP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  120  -PNIITLHSVFSSRDQNLNLVLEYLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  173

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  174  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARAF----------ADPYKQMTSN  223

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  224  VITRWYRP  231



>emb|CDS13810.1| hypothetical protein LRAMOSA05984 [Absidia idahoensis var. thermophila]
Length=346

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 99/161 (61%), Gaps = 17/161 (11%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            KY+   +VG G Y+ VYRG + + S  VA+K+I   Q       +A+RE++ LQ L++ P
Sbjct  16   KYQKTAKVGEGTYAVVYRGTQLATSRLVAIKKIKMGQFKDGLDWTAIREVKYLQELKH-P  74

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAV  528
            N++ + + F S   +  LVLE+L +DL  VIK      D  +     +IK WM+  L  +
Sbjct  75   NIIELIDVF-SHKTNLNLVLEYLDSDLEQVIK------DKTIMFMPADIKSWMLMTLRGL  127

Query  529  DACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            D CHR+ ++HRD+KP+NLL++ +G+LK+ADFG AR    PG
Sbjct  128  DHCHRHFVLHRDMKPNNLLLTHDGVLKIADFGLARDWGDPG  168



>ref|XP_007910804.1| putative negative regulator of the pho system protein [Togninia 
minima UCRPA7]
 gb|EOO04408.1| putative negative regulator of the pho system protein [Togninia 
minima UCRPA7]
Length=329

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 92/157 (59%), Gaps = 12/157 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNG-LTVGEIKRWMVQILSAVDAC  537
            V +H+   +E++  +LV E++  DL    K      D G L  G IK +M Q+L  +D C
Sbjct  69   VALHDVIHTENK-LMLVFEYMDGDLK---KYMDTQGDRGALKPGLIKSFMYQLLKGIDFC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLI+  G LKL DFG AR    P
Sbjct  125  HQNRVLHRDLKPQNLLINSKGQLKLGDFGLARAFGIP  161



>ref|XP_001911361.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP73186.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP25589.1| Putative serine/threonine-protein kinase [Podospora anserina 
S mat+]
Length=422

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 96/162 (59%), Gaps = 13/162 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLT-VALKEIH---DYQSAL-----REIEALQTLQN  348
            KY    ++G G Y++VY G  RSD  + VA+K+I     Y   L     RE++ LQ L+ 
Sbjct  78   KYVKGRKLGEGTYANVYLGHSRSDPTSLVAIKKIKVQAQYNDGLAPDAVRELKHLQELRG  137

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
             PN++ ++  F S+D++  LVLE+LP  DL  +IK   +        G+IK WM  +  A
Sbjct  138  HPNIIQLYSVFSSKDQNLNLVLEYLPLGDLEMLIKDVDRV---RYGAGDIKAWMGMLTRA  194

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            V  CH N ++HRD+KP+NLLI+ +G +KLADFG AR    PG
Sbjct  195  VWFCHENYVLHRDIKPNNLLIAADGEVKLADFGLARGFSDPG  236



>ref|XP_004039435.1| ribosomal protein, putative [Ichthyophthirius multifiliis]
 gb|EGR34131.1| ribosomal protein, putative [Ichthyophthirius multifiliis]
Length=557

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 100/183 (55%), Gaps = 22/183 (12%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            KYE  E++G G Y  VY+ + +  +   ALK+I           +A+REI  L+ LQ+  
Sbjct  10   KYEKLEKIGEGTYGVVYKAKDKQTNQLYALKKIRLESEDEGIPSTAIREISLLKELQHI-  68

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NVV +H+   S ++  +LV EF+  DL   +   K   + GL    +K  + Q+L  ++ 
Sbjct  69   NVVKLHDVIHS-NKKLILVFEFVAQDLKKFMVGFK---ETGLDAKVVKSLLYQLLKGIEI  124

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPTPM  714
            CH+N I+HRDLKP NLLISD+GILKLADFG AR   A G+       P    +  V T  
Sbjct  125  CHKNKILHRDLKPQNLLISDDGILKLADFGLAR---ASGI-------PVKNYTHEVVTLW  174

Query  715  YTP  723
            Y P
Sbjct  175  YRP  177



>ref|XP_001212026.1| serine/threonine-protein kinase crk1 [Aspergillus terreus NIH2624]
 gb|EAU36122.1| serine/threonine-protein kinase crk1 [Aspergillus terreus NIH2624]
Length=406

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 103/167 (62%), Gaps = 15/167 (9%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQ  336
            E+  KY   +++G G Y+ VY GR R+D S  VA+K+I    D++      A+RE++ LQ
Sbjct  60   EVRNKYIKDKKLGEGTYAVVYLGRLRADPSSHVAIKKIKVNADFKDGLSMDAIREVKYLQ  119

Query  337  TLQNCPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
             L + PN++ +H+ F S+D++  LVLE+LP  DL  +IK    ++     V ++K WM  
Sbjct  120  ELAH-PNIIALHDVFSSKDQNLNLVLEYLPLGDLEMLIKDGNIHY----GVADVKAWMGM  174

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGL  654
            +   V  CH N I+HRD+KP+NLLI+ +G +KLADFG AR    P L
Sbjct  175  LARGVWFCHENFILHRDIKPNNLLIASDGEVKLADFGLARSFSDPYL  221



>ref|XP_005166746.1| PREDICTED: cyclin-dependent kinase 20 isoform X2 [Danio rerio]
 ref|XP_009302024.1| PREDICTED: cyclin-dependent kinase 20 isoform X2 [Danio rerio]
 sp|A8WIP6.1|CDK20_DANRE RecName: Full=Cyclin-dependent kinase 20; AltName: Full=Cell 
cycle-related kinase; AltName: Full=Cell division protein kinase 
20 [Danio rerio]
Length=344

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 12/155 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V++ +      TVALK++   +        ALREI+ALQ +++  
Sbjct  3    QYSILGRIGEGAHGIVFKAKHIETGETVALKKVALRRLEDGIPNQALREIKALQEIEDNQ  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
             VV + + F       VLV E++ +DL  VI+    N    LT  ++K +M+ +L  V  
Sbjct  63   YVVKLKDVF-PHGTGFVLVFEYMLSDLSEVIR----NSQRPLTASQVKSYMMMLLKGVAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            CH NSI+HRDLKP+NLLIS  G LK+ADFG AR+ 
Sbjct  118  CHENSIMHRDLKPANLLISSTGHLKIADFGLARLF  152



>gb|KFY36233.1| hypothetical protein V494_05195 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=331

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQSAL-----REIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y   L     RE++ LQ L +
Sbjct  60   KYIKGKKLGEGTYANVYLGTLRSDPTHLVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  119

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S D++  LVLE+LP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  120  -PNIITLHSVFSSRDQNLNLVLEYLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  173

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  174  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARSF----------ADPYKQMTSN  223

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  224  VITRWYRP  231



>ref|XP_007884830.1| PREDICTED: cyclin-dependent kinase 20, partial [Callorhinchus 
milii]
Length=326

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 93/154 (60%), Gaps = 12/154 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y +  RVG GA+  V++ +      TVALK++   +        ALREI+ALQ +++  
Sbjct  3    RYSLLGRVGEGAHGIVFKAKDVETGDTVALKKVALRKLDEGIPNQALREIKALQEIEDNQ  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            +VV + E F       VLV E++ +DL  VI+    N D  LT  ++K +M+ +L  +  
Sbjct  63   HVVKLREVF-PHGTGFVLVFEYMLSDLSEVIR----NSDRPLTESQVKGYMMMLLKGLAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARM  636
            CH NSI+HRDLKP+NLLIS  G LK+ADFG AR+
Sbjct  118  CHANSIMHRDLKPANLLISSTGHLKIADFGLARV  151



>ref|XP_009260698.1| hypothetical protein FPSE_09306 [Fusarium pseudograminearum CS3096]
 ref|XP_011323921.1| negative regulator of the PHO system [Fusarium graminearum PH-1]
 gb|EKJ70553.1| hypothetical protein FPSE_09306 [Fusarium pseudograminearum CS3096]
 gb|ESU11345.1| negative regulator of the PHO system [Fusarium graminearum PH-1]
 gb|EYB30134.1| hypothetical protein FG05_05393 [Fusarium graminearum]
 emb|CEF87672.1| unnamed protein product [Fusarium graminearum]
Length=323

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 94/157 (60%), Gaps = 12/157 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNG-LTVGEIKRWMVQILSAVDAC  537
            V +H+   +E++  +LV E++  DL    +    N + G L    IK +M Q+L  +D C
Sbjct  69   VGLHDVIHTENK-LMLVFEYMDGDLK---RYMDTNGERGALKPTTIKSFMYQLLKGIDFC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLI++ GILKL DFG AR    P
Sbjct  125  HQNRVLHRDLKPQNLLINNKGILKLGDFGLARAFGIP  161



>ref|XP_003352099.1| hypothetical protein SMAC_02534 [Sordaria macrospora k-hell]
 emb|CCC09954.1| unnamed protein product [Sordaria macrospora k-hell]
Length=406

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 106/186 (57%), Gaps = 23/186 (12%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y++VY G  R D S+ VA+K+I    +YQ      A+RE++ LQ L+ 
Sbjct  62   KYIKGKKLGEGTYANVYLGHSRVDASVKVAIKKIKVQKEYQDGIAPDAIREMKYLQKLRG  121

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
              N++++H  F S+D++  LVLE+LP  DL  +I+             +IK WM  +  A
Sbjct  122  HANIIILHSVFSSKDQNLNLVLEYLPLGDLEMLIRDVDHV---RYGAADIKAWMGMLTRA  178

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVP  705
            V  CH N ++HRD+KP+NLLI+ +G +KLADFG AR    PG+          + + NV 
Sbjct  179  VWWCHDNYVLHRDIKPNNLLIAADGEVKLADFGLARSFADPGV----------RMTANVI  228

Query  706  TPMYTP  723
            T  Y P
Sbjct  229  TRWYRP  234



>gb|KIL00759.1| hypothetical protein PAXRUDRAFT_7974 [Paxillus rubicundulus Ve08.2h10]
Length=376

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 91/156 (58%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VYRGR  S    VA+K+I   Q       SA+RE++ L+ L +  NV+ +
Sbjct  19   QKVGEGTYAVVYRGREASTGRKVAVKKIKVGQFKDGLDMSAIREVKYLRELHH-QNVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S   +  LVLEFL +DL  +IK      D  L     +IK WM      ++ CHR
Sbjct  78   LDVF-SSKTNLNLVLEFLDSDLEIIIK------DRSLVFLPADIKSWMAMTFRGLEFCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N I+HRDLKP+NLLI+ NG LKLADFG AR    PG
Sbjct  131  NFILHRDLKPNNLLIASNGQLKLADFGLARDFADPG  166



>gb|EQB45449.1| hypothetical protein CGLO_15662 [Colletotrichum gloeosporioides 
Cg-14]
Length=407

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 106/185 (57%), Gaps = 12/185 (6%)
 Frame = +1

Query  121  REKETPMDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH  297
            ++K  P   PP+   +    +E   KY   +++G G Y+ V+ G  RSD S  VA+K+I 
Sbjct  42   KDKNAPASLPPTLDLAEQMNEEEKRKYVKGKKLGEGTYAIVFLGHLRSDKSSLVAIKKIK  101

Query  298  ---DYQS-----ALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKA  453
               +YQ      A+RE++ LQ LQ+ PN++ +   F S+D++  LVLE+LP  LG +   
Sbjct  102  VQKEYQEGMAPDAVRELKHLQELQH-PNIISLLSVFSSKDQNLNLVLEYLP--LGDLEML  158

Query  454  AKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQAR  633
             K   +      +IK WM  +  AV  CH N ++HRD+KP+NLLI+ +G +KLADFG AR
Sbjct  159  IKDTANVRYGAADIKAWMGMLTRAVWFCHENFVLHRDIKPNNLLIAADGEVKLADFGLAR  218

Query  634  MLLAP  648
                P
Sbjct  219  GFADP  223



>ref|XP_001739634.1| cyclin-dependent kinase C-2 [Entamoeba dispar SAW760]
 gb|EDR23991.1| cyclin-dependent kinase C-2, putative [Entamoeba dispar SAW760]
Length=394

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 99/160 (62%), Gaps = 14/160 (9%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ------SALREIEALQTLQN  348
            I  KYEI  ++G GAY+ VY+ R ++    VA+K++   +      ++LREI+ LQ + +
Sbjct  11   INDKYEIINQIGCGAYASVYKARTKTTGKLVAIKQLKSEKDQGFPVTSLREIQLLQEIHH  70

Query  349  CPNVV----VMHEFFWSEDEDSV-LVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
             PN++    V+H   + E   ++ LV EF+P DL + +K  +    N + VG++K +M+Q
Sbjct  71   -PNIIQLIEVLHANDFIERNTTISLVFEFMPHDLSSFLKCEE--IVNKVGVGQLKGYMLQ  127

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQAR  633
            IL A+   H N+I+HRD+K  N+LISD+  +KL DFG AR
Sbjct  128  ILQAIQFLHSNNILHRDIKTGNILISDDNHIKLGDFGLAR  167



>ref|XP_007272551.1| serine threonine-protein kinase [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA38379.1| serine threonine-protein kinase [Colletotrichum gloeosporioides 
Nara gc5]
Length=407

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 106/185 (57%), Gaps = 12/185 (6%)
 Frame = +1

Query  121  REKETPMDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH  297
            ++K  P   PP+   +    +E   KY   +++G G Y+ V+ G  RSD S  VA+K+I 
Sbjct  42   KDKNAPASLPPTLDLAEQMNEEEKRKYVKGKKLGEGTYAIVFLGHLRSDKSSLVAIKKIK  101

Query  298  ---DYQS-----ALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKA  453
               +YQ      A+RE++ LQ LQ+ PN++ +   F S+D++  LVLE+LP  LG +   
Sbjct  102  VQKEYQEGMAPDAVRELKHLQELQH-PNIISLLSVFSSKDQNLNLVLEYLP--LGDLEML  158

Query  454  AKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQAR  633
             K   +      +IK WM  +  AV  CH N ++HRD+KP+NLLI+ +G +KLADFG AR
Sbjct  159  IKDTANVRYGAADIKAWMGMLTRAVWFCHENFVLHRDIKPNNLLIAADGEVKLADFGLAR  218

Query  634  MLLAP  648
                P
Sbjct  219  GFADP  223



>ref|XP_009302023.1| PREDICTED: cyclin-dependent kinase 20 isoform X1 [Danio rerio]
Length=359

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 12/155 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V++ +      TVALK++   +        ALREI+ALQ +++  
Sbjct  18   QYSILGRIGEGAHGIVFKAKHIETGETVALKKVALRRLEDGIPNQALREIKALQEIEDNQ  77

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
             VV + + F       VLV E++ +DL  VI+    N    LT  ++K +M+ +L  V  
Sbjct  78   YVVKLKDVF-PHGTGFVLVFEYMLSDLSEVIR----NSQRPLTASQVKSYMMMLLKGVAF  132

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            CH NSI+HRDLKP+NLLIS  G LK+ADFG AR+ 
Sbjct  133  CHENSIMHRDLKPANLLISSTGHLKIADFGLARLF  167



>ref|XP_006269082.1| PREDICTED: cyclin-dependent kinase 20-like isoform X3 [Alligator 
mississippiensis]
Length=344

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 89/155 (57%), Gaps = 13/155 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V++ +      TVALK++   +        ALREI+ALQ   + P
Sbjct  3    QYIILGRIGEGAHGIVFKAKNIETGETVALKKVALRRLEDGIPNQALREIKALQETHDSP  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            +VV +H  F       VL  EFL +DLG V++A        L   + K + + +L  +  
Sbjct  63   HVVQLHAMF-PHGPGFVLAFEFLLSDLGTVLRA-----PGPLPPAQAKAFALMLLQGIAH  116

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            CH + IVHRDLKP+NLLIS +G LK+ADFG AR+L
Sbjct  117  CHSHRIVHRDLKPANLLISASGQLKIADFGLARVL  151



>gb|KFY82684.1| hypothetical protein V500_10382 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=493

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 108/188 (57%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQSAL-----REIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y   L     RE++ LQ L +
Sbjct  77   KYIKGKKLGEGTYANVYLGTLRSDPTHFVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  136

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S D++  LVLEFLP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  137  -PNIITLHSVFSSRDQNLNLVLEFLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  190

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  191  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARAF----------ADPYKQMTSN  240

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  241  VITRWYRP  248



>emb|CEG72662.1| Putative CMGC/CDK/CDK5 protein kinase [Rhizopus microsporus]
 emb|CEI93553.1| Putative CMGC/CDK/CDK5 protein kinase [Rhizopus microsporus]
Length=313

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 91/157 (58%), Gaps = 8/157 (5%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPN  357
            +Y   E++G G Y+ VY+G+ R+    VALKEIH         +A+REI  ++ L++ PN
Sbjct  10   RYTRLEKLGEGTYATVYKGKNRATGEIVALKEIHLDPEEGAPSTAIREISLMKELKH-PN  68

Query  358  VVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDAC  537
            +V + +   +E++ S LV E++  DL   + +  +     L V  IK +M Q+L  +  C
Sbjct  69   IVRLQDIIHTENKLS-LVFEYMDQDLKKYMDSTARATRGALDVSIIKSFMYQLLRGIAYC  127

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H N ++HRDLKP NLLI+ +  LKL DFG AR    P
Sbjct  128  HENRVLHRDLKPQNLLINKHLQLKLGDFGLARAFGIP  164



>ref|XP_006032081.1| PREDICTED: cyclin-dependent kinase 20-like [Alligator sinensis]
Length=344

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 89/155 (57%), Gaps = 13/155 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V++ +      TVALK++   +        ALREI+ALQ   + P
Sbjct  3    QYIILGRIGEGAHGIVFKAKNIETGETVALKKVALRRLEDGIPNQALREIKALQETHDSP  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            +VV +H  F       VL  EFL +DLG V++A        L   + K + + +L  +  
Sbjct  63   HVVQLHAMF-PHGPGFVLAFEFLLSDLGTVLRA-----PGPLPPAQAKAFALMLLQGIAH  116

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            CH + IVHRDLKP+NLLIS +G LK+ADFG AR+L
Sbjct  117  CHSHRIVHRDLKPANLLISASGQLKIADFGLARVL  151



>ref|XP_009848364.1| hypothetical protein NEUTE1DRAFT_120280 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO61267.1| hypothetical protein NEUTE1DRAFT_120280 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ74726.1| Pkinase-domain-containing protein [Neurospora tetrasperma FGSC 
2509]
Length=407

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 106/186 (57%), Gaps = 23/186 (12%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLT-VALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y++VY G  R DS T VA+K+I    +YQ      A+RE++ LQ L+ 
Sbjct  62   KYIKGKKLGEGTYANVYLGHSRLDSSTQVAIKKIKVQKEYQDGIAPDAIREMKYLQKLRG  121

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
              N++++H  F S+D++  LVLE+LP  DL  +I+             +IK WM  +  A
Sbjct  122  HANIIILHSVFSSKDQNLNLVLEYLPLGDLEMLIRDVDHV---RYGAADIKAWMGMLTRA  178

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVP  705
            +  CH N ++HRD+KP+NLLI+ +G +KLADFG AR    PG+          + + NV 
Sbjct  179  IWWCHDNYVLHRDIKPNNLLIAADGEVKLADFGLARSFADPGV----------RMTANVI  228

Query  706  TPMYTP  723
            T  Y P
Sbjct  229  TRWYRP  234



>ref|XP_960739.1| serine/threonine-protein kinase [Neurospora crassa OR74A]
 emb|CAC18156.2| probable cyclin-dependent ser/thr protein kinase KIN28 [Neurospora 
crassa]
 gb|EAA31503.1| serine/threonine-protein kinase [Neurospora crassa OR74A]
 gb|KHE88872.1| Pkinase-domain-containing protein [Neurospora crassa]
Length=407

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 106/186 (57%), Gaps = 23/186 (12%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLT-VALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y++VY G  R DS T VA+K+I    +YQ      A+RE++ LQ L+ 
Sbjct  62   KYIKGKKLGEGTYANVYLGHSRLDSSTQVAIKKIKVQKEYQDGIAPDAIREMKYLQKLRG  121

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
              N++++H  F S+D++  LVLE+LP  DL  +I+             +IK WM  +  A
Sbjct  122  HANIIILHSVFSSKDQNLNLVLEYLPLGDLEMLIRDVDHV---RYGAADIKAWMGMLTRA  178

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVP  705
            +  CH N ++HRD+KP+NLLI+ +G +KLADFG AR    PG+          + + NV 
Sbjct  179  IWWCHDNYVLHRDIKPNNLLIAADGEVKLADFGLARSFADPGV----------RMTANVI  228

Query  706  TPMYTP  723
            T  Y P
Sbjct  229  TRWYRP  234



>ref|XP_011428987.1| PREDICTED: cyclin-dependent kinase 20-like [Crassostrea gigas]
 gb|EKC35621.1| Cell cycle-related kinase [Crassostrea gigas]
Length=343

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 92/155 (59%), Gaps = 12/155 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            ++ I  R+G GA+  V + +       VALK++   +       +ALREI+ALQ +++ P
Sbjct  3    QHTILGRIGEGAHGIVLKAKHIESGEVVALKKVPLRKLEDGIPHTALREIKALQEIEDNP  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
             VV + E F       VL  E++ +DL  VI+    N +  LT G++K +M+ +L  V  
Sbjct  63   YVVKLREVF-PHGTSLVLAFEYMLSDLSEVIR----NTEKPLTEGQVKSYMLMLLKGVAF  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            CH N+I+HRDLKP+NLLIS  G LK+ADFG AR+ 
Sbjct  118  CHENNIMHRDLKPANLLISSTGHLKIADFGLARVF  152



>gb|EXX78044.1| Pho85p [Rhizophagus irregularis DAOM 197198w]
Length=411

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 94/157 (60%), Gaps = 10/157 (6%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH-DYQ-----SALREIEALQTLQNCPN  357
            +Y   E++G G Y+ VY+G+ R    TVALKEIH D +     +A+REI  ++ L++  N
Sbjct  7    EYVRLEKLGEGTYATVYKGKERRTGETVALKEIHLDSEEGAPSTAIREISLMKELKHA-N  65

Query  358  VVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDAC  537
            +V + +   +E++  +LV E++  DL   +     +    L    IK +M Q+L+ +D C
Sbjct  66   IVKLKDVIHTENK-LMLVFEYMDQDLKKYMDIHGNH--GALNSMTIKLFMYQMLTGIDFC  122

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H N ++HRDLKP NLLI+ NG LKLADFG AR    P
Sbjct  123  HENRVLHRDLKPQNLLINKNGQLKLADFGLARAFGIP  159



>ref|XP_007507759.1| PREDICTED: cyclin-dependent kinase 20-like isoform X14 [Monodelphis 
domestica]
Length=306

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 104/187 (56%), Gaps = 18/187 (10%)
 Frame = +1

Query  103  LITKQEREKETPMDSPPS-KSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTV  279
            L+  QE + E P +SP S  S + HT  +    Y I  R+G GA+  V++ +      TV
Sbjct  13   LLRGQEAQGE-PWESPGSIPSSTSHTMDQ----YSILGRIGEGAHGIVFKAKHVETGETV  67

Query  280  ALKEIHDYQ-------SALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLG  438
            ALK++   +        ALREI+ALQ +++   VV +   F       VL  EF+ +DL 
Sbjct  68   ALKKVALRRLEDGIPNQALREIKALQEIEDNQYVVKLKAVF-PHGAGFVLAFEFMLSDLS  126

Query  439  AVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLAD  618
             VI+  K+     L   ++K +M  +L  V  CH N+IVHRDLKP+NLLIS +G LK+AD
Sbjct  127  EVIRHGKRP----LAPAQVKAYMQMLLKGVAFCHANNIVHRDLKPANLLISSSGQLKIAD  182

Query  619  FGQARML  639
            FG AR+ 
Sbjct  183  FGLARVF  189



>emb|CDM32461.1| Serine/threonine-protein kinase crk1 [Penicillium roqueforti 
FM164]
Length=404

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 100/164 (61%), Gaps = 13/164 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQ  336
            +I  +Y   ++VG G Y+ VY G  R D S  VA+K+I    +Y+      A+RE++ LQ
Sbjct  59   DIRERYVKDKKVGEGTYAVVYVGHLRHDPSSLVAIKKIKVNAEYKDGLAMDAVREVKYLQ  118

Query  337  TLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQI  516
             L++ PNV+ +H+ F S+D++  LVLEFLP   G  ++   K+ D    V +IK WM  +
Sbjct  119  ELKH-PNVIALHDVFSSKDQNLSLVLEFLP---GGDLEMLIKDSDIHYGVADIKAWMGML  174

Query  517  LSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
               V  CH N ++HRD+KP+NLLI+ +G +KLADFG AR    P
Sbjct  175  ARGVWWCHENFVLHRDIKPNNLLIASDGEVKLADFGLARSFADP  218



>gb|KIL84711.1| hypothetical protein FAVG1_11938 [Fusarium avenaceum]
Length=323

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNG-LTVGEIKRWMVQILSAVDAC  537
            V +H+   +E++  +LV EF+  DL    +    + D G L    +K +M Q+L  +D C
Sbjct  69   VGLHDVIHTENK-LMLVFEFMDGDLK---RYMDTHGDRGALKPTTVKSFMYQLLKGIDFC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLI+  GILKL DFG AR    P
Sbjct  125  HQNRVLHRDLKPQNLLINGKGILKLGDFGLARAFGIP  161



>emb|CDK27712.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=310

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 98/161 (61%), Gaps = 13/161 (8%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQ  345
            + + Y + ++VG G Y+ VY G++      +A+K+I           SALRE++ LQ L+
Sbjct  3    LPLNYTLDQKVGEGTYAVVYLGKQTLTGRQIAVKQIKTGGFKDGLDMSALREVKYLQELR  62

Query  346  NCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
            +  N++ + + + +  E+  LVLEFLP DL  +I+    + +   T G++K WM+  L  
Sbjct  63   H-ENIIELVDVY-ATPENLNLVLEFLPYDLEMLIR----DREVIFTPGDVKSWMLMFLRG  116

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +  CHRN I+HRDLKP+NLLIS +G LK+ADFG AR L  P
Sbjct  117  LHHCHRNGILHRDLKPNNLLISPSGSLKIADFGLARSLGLP  157



>gb|EAS01666.2| cyclin-dependent kinase-like Serine/Threonine kinase family protein 
[Tetrahymena thermophila SB210]
Length=308

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 88/153 (58%), Gaps = 12/153 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +YE   ++G G Y  VY+ R ++     ALK+I           +A+REI  L+ LQ+ P
Sbjct  10   RYEKLNKLGEGTYGVVYKAREKTTKELYALKKIRLESEDEGIPSTAIREISLLKELQH-P  68

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NVV +H+   S ++  VLV EF+  DL   +   K   D GL    IK  + Q+L  ++ 
Sbjct  69   NVVRLHDVIHS-NKKLVLVFEFVDQDLKKFMNNFK---DKGLDPHIIKSLLYQLLKGIEV  124

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQAR  633
            CH+N I+HRDLKP NLLIS   ILKLADFG AR
Sbjct  125  CHKNKILHRDLKPQNLLISKECILKLADFGLAR  157



>gb|EYE93309.1| Pkinase-domain-containing protein [Aspergillus ruber CBS 135680]
Length=400

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 101/165 (61%), Gaps = 15/165 (9%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQ  336
            E+  KY   +R+G G Y+ V+ GR ++D S  VA+K+I    +Y+      A+RE++ LQ
Sbjct  55   EVRQKYVKDKRLGEGTYAVVFLGRLQTDPSSFVAIKKIKVNAEYKDGLSMDAIREVKYLQ  114

Query  337  TLQNCPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
             L + PN++ +H+ F S+D++  LVLEFLP  DL  +IK    ++       +IK WM  
Sbjct  115  ELSH-PNIIALHDVFSSKDQNLNLVLEFLPLGDLEMLIKDGNVHYG----AADIKAWMGM  169

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +   V  CH N I+HRD+KP+NLLI+ +G +KLADFG AR    P
Sbjct  170  LARGVWFCHENFILHRDIKPNNLLIASDGEVKLADFGLARSFADP  214



>gb|EMD38943.1| hypothetical protein CERSUDRAFT_151723 [Ceriporiopsis subvermispora 
B]
Length=368

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 92/156 (59%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            +++G G Y+ VYRGR  +    VA+K+I   Q       SA+RE++ L+ L++  NV+ +
Sbjct  19   QKIGEGTYAVVYRGREVATGRKVAIKKIKVGQFKDGLDMSAIREVKYLRELKH-QNVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S   +  LVLEFL TDL  VIK      D  L     +IK WM      ++ CHR
Sbjct  78   LDVF-SSKTNLNLVLEFLDTDLELVIK------DRSLVFLPADIKSWMAMTFRGLEFCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N I+HRDLKP+NLLI+ +G LKLADFG AR    PG
Sbjct  131  NFILHRDLKPNNLLIASDGQLKLADFGLARDFADPG  166



>emb|CDH55675.1| cmgc cdk cdk7 protein kinase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=365

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 98/161 (61%), Gaps = 17/161 (11%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            KY+   +VG G Y+ VYRG + + S  VA+K+I   Q       +A+RE++ LQ L++ P
Sbjct  35   KYQKTAKVGEGTYAVVYRGTQLATSRLVAIKKIKMGQFKDGLDWTAIREVKYLQELKH-P  93

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAV  528
            N++ + + F S   +  LVLE+L +DL  VIK      D  +     +IK WM+  L  +
Sbjct  94   NIIELIDVF-SHKTNLNLVLEYLDSDLEQVIK------DKTIMFMPADIKSWMLMTLRGL  146

Query  529  DACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            D CHR  ++HRD+KP+NLL++ +G+LK+ADFG AR    PG
Sbjct  147  DHCHRRFVLHRDMKPNNLLLTHDGVLKIADFGLARDWGDPG  187



>ref|XP_003012701.1| hypothetical protein ARB_00952 [Arthroderma benhamiae CBS 112371]
 ref|XP_003025074.1| hypothetical protein TRV_00732 [Trichophyton verrucosum HKI 0517]
 gb|EFE32061.1| hypothetical protein ARB_00952 [Arthroderma benhamiae CBS 112371]
 gb|EFE44463.1| hypothetical protein TRV_00732 [Trichophyton verrucosum HKI 0517]
Length=406

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 19/165 (12%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLT-VALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y+ VY G  R D  + VA+K+I    +Y+      A+RE++ LQ L +
Sbjct  63   KYVKDKKLGEGTYAVVYLGHLRDDPTSLVAIKKIKLNAEYKDGLSMDAIREVKYLQELSH  122

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PNV+ +H+ F S+D++  LVLEFLP  DL  +IK      DN +  G  +IK W+  + 
Sbjct  123  -PNVIALHDVFSSKDQNLNLVLEFLPLGDLEMLIK------DNSIQYGVADIKAWISMLA  175

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGL  654
              V  CH+N I+HRD+KP+NLLI+ +G +KLADFG AR    P L
Sbjct  176  RGVWFCHKNFILHRDIKPNNLLIASDGEVKLADFGLARSFADPYL  220



>gb|KIM44567.1| hypothetical protein M413DRAFT_442537 [Hebeloma cylindrosporum 
h7]
Length=372

 Score =   108 bits (271),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 92/155 (59%), Gaps = 17/155 (11%)
 Frame = +1

Query  214  RVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVMH  372
            +VG G Y+ VY+GR  S    VA+K+I   Q       SA+RE++ L+ L++ PNV+ + 
Sbjct  20   KVGEGTYAVVYQGREASTGRKVAIKKIKVGQFKDGLDMSAIREVKYLRELKH-PNVIELL  78

Query  373  EFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHRN  546
            + F S   +  LVLEFL +DL  +IK      D  L     +IK WM      ++ CHRN
Sbjct  79   DVF-SSKTNLNLVLEFLDSDLEMIIK------DRSLVFLPADIKSWMAMTFRGLEFCHRN  131

Query  547  SIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
             I+HRDLKP+NLLI+ +G LK+ADFG AR    PG
Sbjct  132  FILHRDLKPNNLLIASDGELKIADFGLARDFADPG  166



>ref|XP_001484761.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=331

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 92/150 (61%), Gaps = 13/150 (9%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VY G++      +A+KEI           SALRE++ LQ L++ PNV+ +
Sbjct  21   KKVGEGTYAVVYLGKQVDTRRRIAIKEIKTGLFKDGLDMSALREVKYLQELKH-PNVIEL  79

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S +  + LVLEFLP DL  +IK     + +     +IK W++  L  +  CHRN 
Sbjct  80   IDVFLSSNNLN-LVLEFLPADLEVLIKDTSIVFKSA----DIKSWLLMTLRGIHHCHRNF  134

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARML  639
            I+HRDLKP+NLLI+ +G LK+ADFG AR L
Sbjct  135  ILHRDLKPNNLLIAPDGQLKIADFGLARSL  164



>gb|EDK38392.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=331

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 94/155 (61%), Gaps = 13/155 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCP  354
            +Y   ++VG G Y+ VY G++      +A+KEI           SALRE++ LQ L++ P
Sbjct  16   RYSKEKKVGEGTYAVVYLGKQVDTRRRIAIKEIKTGLFKDGLDMSALREVKYLQELKH-P  74

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NV+ + + F S +  + LVLEFLP DL  +IK     + +     +IK W++  L  +  
Sbjct  75   NVIELIDVFSSSNNLN-LVLEFLPADLEVLIKDTSIVFKSA----DIKSWLLMTLRGIHH  129

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            CHRN I+HRDLKP+NLLI+ +G LK+ADFG AR L
Sbjct  130  CHRNFILHRDLKPNNLLIAPDGQLKIADFGLARSL  164



>ref|XP_007507757.1| PREDICTED: cyclin-dependent kinase 20-like isoform X12 [Monodelphis 
domestica]
Length=320

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 104/187 (56%), Gaps = 18/187 (10%)
 Frame = +1

Query  103  LITKQEREKETPMDSPPS-KSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTV  279
            L+  QE + E P +SP S  S + HT  +    Y I  R+G GA+  V++ +      TV
Sbjct  13   LLRGQEAQGE-PWESPGSIPSSTSHTMDQ----YSILGRIGEGAHGIVFKAKHVETGETV  67

Query  280  ALKEIHDYQ-------SALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLG  438
            ALK++   +        ALREI+ALQ +++   VV +   F       VL  EF+ +DL 
Sbjct  68   ALKKVALRRLEDGIPNQALREIKALQEIEDNQYVVKLKAVF-PHGAGFVLAFEFMLSDLS  126

Query  439  AVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLAD  618
             VI+  K+     L   ++K +M  +L  V  CH N+IVHRDLKP+NLLIS +G LK+AD
Sbjct  127  EVIRHGKRP----LAPAQVKAYMQMLLKGVAFCHANNIVHRDLKPANLLISSSGQLKIAD  182

Query  619  FGQARML  639
            FG AR+ 
Sbjct  183  FGLARVF  189



>gb|KIO25847.1| hypothetical protein M407DRAFT_15177 [Tulasnella calospora MUT 
4182]
Length=341

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 91/152 (60%), Gaps = 13/152 (9%)
 Frame = +1

Query  214  RVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVMH  372
            +VG G Y+ VYRGR       VA+K+I   Q       SA+RE++ L+ LQ+ PNV+ + 
Sbjct  16   KVGEGTYAVVYRGRHAVTGRPVAIKKIKIGQFKDGLDMSAIREVKYLRELQH-PNVIELV  74

Query  373  EFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSI  552
            + F S   +  LVLEFL +DL  VIK    +  +     +IK WM   L  ++ CHRN I
Sbjct  75   DVF-SAKTNLNLVLEFLDSDLEVVIK----DRSHVFLPADIKSWMAMTLRGLEFCHRNWI  129

Query  553  VHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +HRDLKP+NLLI+ +G LK+ADFG AR    P
Sbjct  130  LHRDLKPNNLLIASDGQLKIADFGLARDFADP  161



>gb|KFH44204.1| Negative regulator of the PHO system-like protein [Acremonium 
chrysogenum ATCC 11550]
Length=335

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 90/156 (58%), Gaps = 10/156 (6%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACH  540
            V +H+   +E++  +LV EF+  DL   +    +     L    IK +M Q+L  +D CH
Sbjct  69   VALHDVIHTENK-LMLVFEFMDGDLKRYMDTQGER--GALKPATIKSFMYQLLKGIDFCH  125

Query  541  RNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +N ++HRDLKP NLLI+   +LKL DFG AR    P
Sbjct  126  QNRVLHRDLKPQNLLINSKAVLKLGDFGLARAFGIP  161



>gb|ESA15089.1| hypothetical protein GLOINDRAFT_40294 [Rhizophagus irregularis 
DAOM 181602]
Length=316

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 94/157 (60%), Gaps = 10/157 (6%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH-DYQ-----SALREIEALQTLQNCPN  357
            +Y   E++G G Y+ VY+G+ R    TVALKEIH D +     +A+REI  ++ L++  N
Sbjct  7    EYVRLEKLGEGTYATVYKGKERRTGETVALKEIHLDSEEGAPSTAIREISLMKELKHA-N  65

Query  358  VVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDAC  537
            +V + +   +E++  +LV E++  DL   +     +    L    IK +M Q+L+ +D C
Sbjct  66   IVKLKDVIHTENK-LMLVFEYMDQDLKKYMDIHGNH--GALNSMTIKLFMYQMLTGIDFC  122

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H N ++HRDLKP NLLI+ NG LKLADFG AR    P
Sbjct  123  HENRVLHRDLKPQNLLINKNGQLKLADFGLARAFGIP  159



>gb|KIW01693.1| hypothetical protein PV09_06874 [Verruconis gallopava]
Length=409

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 107/188 (57%), Gaps = 26/188 (14%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLT-VALKEIHDYQ--------SALREIEALQTLQN  348
            KY   + +G G Y+ VYRG  R+D  T VA+K+I   +        +A RE + L  L +
Sbjct  63   KYVKEKAIGEGTYAKVYRGHLRTDPKTLVAIKKIKIIEEFKDGIAPAAFRECKYLSELSH  122

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +   F S+D++  LVLE+LP  DL A+IKA      N L  G  +IK WM+ + 
Sbjct  123  -PNIIHLLGVFTSKDQNINLVLEYLPMGDLEAIIKA-----KNELRYGAADIKAWMLMVN  176

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N I+HRD+KP+N+ ++ +G LKLADFG AR ++ P     D  +P    + N
Sbjct  177  RAVWWCHENHILHRDIKPNNIFVAADGTLKLADFGLARSMVDP-----DPNRPM---TTN  228

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  229  VITMFYRP  236



>ref|XP_003374534.1| serine/threonine-protein kinase PCTAIRE-2 [Trichinella spiralis]
 gb|EFV56004.1| serine/threonine-protein kinase PCTAIRE-2 [Trichinella spiralis]
Length=256

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 100/186 (54%), Gaps = 31/186 (17%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ------SALREIEALQTLQNCPNV  360
            Y+  E++G G Y+ VY+GR R +   VALKEI   Q      +A+RE+  L+ L++  NV
Sbjct  57   YQKLEKLGEGTYATVYKGRSRLNDALVALKEIRLEQEEGAPCTAIREVSLLRDLRH-ANV  115

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACH  540
            V +H+  ++ D+   LV E+L +DL    K    +  N L++  +K +  QIL  +  CH
Sbjct  116  VTLHDIIYT-DKTLTLVFEYLDSDL----KQYMDSCGNILSMNNVKIFTFQILRGLAYCH  170

Query  541  RNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPNVPTPMYT  720
               ++HRDLKP NLLI+  G LKLADFG AR                   + +VPT  Y+
Sbjct  171  ARRVLHRDLKPQNLLINHRGELKLADFGLAR-------------------AKSVPTKTYS  211

Query  721  PEFVPV  738
             E V +
Sbjct  212  NEVVTL  217



>gb|KFX91619.1| hypothetical protein O988_07667 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=650

 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 109/188 (58%), Gaps = 28/188 (15%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQSAL-----REIEALQTLQN  348
            KY   +++G G Y++VY G  RSD +  VA+K+I    +Y   L     RE++ LQ L +
Sbjct  77   KYIKGKKLGEGTYANVYLGTLRSDPTHFVAIKKIKIQAEYTEGLAPDAVRELKHLQELSH  136

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLP-TDLGAVIKAAKKNWDNGLTVG--EIKRWMVQIL  519
             PN++ +H  F S+D++  LVLEFLP  DL  +IK  +     G+  G  +IK WM  + 
Sbjct  137  -PNIITLHSVFSSKDQNLNLVLEFLPLGDLEMLIKDVE-----GVRYGAADIKAWMGMLS  190

Query  520  SAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGLAAVDDGQPYGKASPN  699
             AV  CH N+++HRD+KP+NLLI+ +G++KLADFG AR              PY + + N
Sbjct  191  RAVWFCHANAVLHRDIKPNNLLIAADGMVKLADFGLARSF----------ADPYKQMTSN  240

Query  700  VPTPMYTP  723
            V T  Y P
Sbjct  241  VITRWYRP  248



>emb|CCL99679.1| predicted protein [Fibroporia radiculosa]
Length=368

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 92/156 (59%), Gaps = 17/156 (11%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            +++G G Y+ VYR R  +    VA+K+I   Q       SA+RE++ L+ L++ PNV+ +
Sbjct  19   QKIGEGTYAVVYRAREIATGRRVAIKKIKVGQFKDGLDMSAIREVKYLRELKH-PNVIEL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTV--GEIKRWMVQILSAVDACHR  543
             + F S   +  LVLEFL TDL  VIK      D  L     +IK WM      ++ CHR
Sbjct  78   LDVF-SSKTNLNLVLEFLDTDLELVIK------DRSLVFLPADIKSWMAMTFRGLEFCHR  130

Query  544  NSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            N I+HRDLKP+NLLI+ +G LK+ADFG AR    PG
Sbjct  131  NFILHRDLKPNNLLIASDGKLKIADFGLARDFADPG  166



>ref|XP_007507754.1| PREDICTED: cyclin-dependent kinase 20-like isoform X9 [Monodelphis 
domestica]
Length=345

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 104/187 (56%), Gaps = 18/187 (10%)
 Frame = +1

Query  103  LITKQEREKETPMDSPPS-KSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTV  279
            L+  QE + E P +SP S  S + HT  +    Y I  R+G GA+  V++ +      TV
Sbjct  13   LLRGQEAQGE-PWESPGSIPSSTSHTMDQ----YSILGRIGEGAHGIVFKAKHVETGETV  67

Query  280  ALKEIHDYQ-------SALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLG  438
            ALK++   +        ALREI+ALQ +++   VV +   F       VL  EF+ +DL 
Sbjct  68   ALKKVALRRLEDGIPNQALREIKALQEIEDNQYVVKLKAVF-PHGAGFVLAFEFMLSDLS  126

Query  439  AVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLAD  618
             VI+  K+     L   ++K +M  +L  V  CH N+IVHRDLKP+NLLIS +G LK+AD
Sbjct  127  EVIRHGKRP----LAPAQVKAYMQMLLKGVAFCHANNIVHRDLKPANLLISSSGQLKIAD  182

Query  619  FGQARML  639
            FG AR+ 
Sbjct  183  FGLARVF  189



>ref|XP_007304419.1| Pkinase-domain-containing protein [Stereum hirsutum FP-91666 
SS1]
 gb|EIM86789.1| Pkinase-domain-containing protein [Stereum hirsutum FP-91666 
SS1]
Length=372

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 91/154 (59%), Gaps = 13/154 (8%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCPNVVVM  369
            ++VG G Y+ VYRGR  +    VA+K+I   Q       SA+RE++ L+ L + PNV+ +
Sbjct  19   QKVGEGQYAVVYRGREAATGRKVAIKKIKVGQFKDGLDMSAIREVKFLRELSH-PNVIAL  77

Query  370  HEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNS  549
             + F S   +  LVLEFL +DL  +IK     +       +IK W+      ++ CHRN 
Sbjct  78   LDVF-SAKTNLNLVLEFLDSDLEMIIKGCPTLF----LPADIKSWIAMTFRGLEFCHRNY  132

Query  550  IVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
            I+HRDLKP+NLLI+ +G LK+ADFG AR    PG
Sbjct  133  ILHRDLKPNNLLIASDGQLKIADFGLARDFADPG  166



>ref|XP_002741922.1| PREDICTED: cyclin-dependent kinase 20-like [Saccoglossus kowalevskii]
Length=339

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 92/155 (59%), Gaps = 12/155 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y I  R+G GA+  V++ +       VA+K++   +       +ALREI+ALQ +    
Sbjct  3    QYTILGRIGEGAHGIVFKAKHIETGEVVAMKKVPLRRLEDGIPNTALREIKALQEIDESQ  62

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            +VV + + F       VLV EF+ +DL  VI+ + K     LT  ++K +M  +L  V  
Sbjct  63   HVVKLRDVF-PHGTGFVLVFEFMLSDLSEVIRNSAKP----LTEAQVKSYMQMLLKGVTY  117

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARML  639
            CH+NSI+HRDLKP+NLLIS+ G LK+ADFG AR+ 
Sbjct  118  CHKNSIMHRDLKPANLLISETGHLKIADFGLARVF  152



>dbj|GAN10642.1| cyclin-dependent protein kinase PhoA [Mucor ambiguus]
Length=301

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 8/152 (5%)
 Frame = +1

Query  211  ERVGSGAYSDVYRGRRRSDSLTVALKEIH-DYQ-----SALREIEALQTLQNCPNVVVMH  372
            E++G G Y+ V++G+ R+    VALKEIH D +     +A+REI  ++ L++ PN++ + 
Sbjct  16   EKLGEGTYATVFKGKSRATGEIVALKEIHLDAEEGAPSTAIREISLMKELKH-PNILRLI  74

Query  373  EFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSI  552
            +   +E +  +LV EF+  DL   + A  K     L    IK +M Q+L  +  CH N +
Sbjct  75   DVIHTESK-LMLVFEFMDQDLKKFMDANAKATHGALGTSTIKSFMYQLLKGIAYCHENRV  133

Query  553  VHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +HRDLKP NLLI+ +G LKL DFG AR    P
Sbjct  134  LHRDLKPQNLLINKHGELKLGDFGLARAFGIP  165



>ref|XP_007507756.1| PREDICTED: cyclin-dependent kinase 20-like isoform X11 [Monodelphis 
domestica]
Length=333

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 104/187 (56%), Gaps = 18/187 (10%)
 Frame = +1

Query  103  LITKQEREKETPMDSPPS-KSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTV  279
            L+  QE + E P +SP S  S + HT  +    Y I  R+G GA+  V++ +      TV
Sbjct  13   LLRGQEAQGE-PWESPGSIPSSTSHTMDQ----YSILGRIGEGAHGIVFKAKHVETGETV  67

Query  280  ALKEIHDYQ-------SALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLG  438
            ALK++   +        ALREI+ALQ +++   VV +   F       VL  EF+ +DL 
Sbjct  68   ALKKVALRRLEDGIPNQALREIKALQEIEDNQYVVKLKAVF-PHGAGFVLAFEFMLSDLS  126

Query  439  AVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLAD  618
             VI+  K+     L   ++K +M  +L  V  CH N+IVHRDLKP+NLLIS +G LK+AD
Sbjct  127  EVIRHGKRP----LAPAQVKAYMQMLLKGVAFCHANNIVHRDLKPANLLISSSGQLKIAD  182

Query  619  FGQARML  639
            FG AR+ 
Sbjct  183  FGLARVF  189



>ref|XP_004040130.1| hypothetical protein IMG5_000530 [Ichthyophthirius multifiliis]
 gb|EGR34826.1| hypothetical protein IMG5_000530 [Ichthyophthirius multifiliis]
Length=316

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 88/159 (55%), Gaps = 8/159 (5%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ-------SALREIEALQTLQNCP  354
            +Y+  E++G G Y +VY+ +   +   VALK+I           +ALREI  L+ LQ  P
Sbjct  8    RYQKVEKIGEGTYGEVYKAKDLQNQELVALKKIKLENEDEGVPSTALREISILKELQQHP  67

Query  355  NVVVMHEFFWSEDEDS-VLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVD  531
            N+V M+E  +   E   +LV E++  DL   +   +K+    L   +IK  M QIL+ ++
Sbjct  68   NIVNMNEVIYQPHEKKLILVFEYVDQDLKKFLDQYRKDKTLRLATYQIKLIMYQILNGLN  127

Query  532  ACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             CH   I+HRDLKP N+LI   G +K+ADFG AR    P
Sbjct  128  FCHSRRIIHRDLKPQNVLIDKKGNIKIADFGLARAFGVP  166



>ref|XP_007603296.1| hypothetical protein CFIO01_11206 [Colletotrichum fioriniae PJ7]
 gb|EXF73066.1| hypothetical protein CFIO01_11206 [Colletotrichum fioriniae PJ7]
Length=321

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNG-LTVGEIKRWMVQILSAVDAC  537
            V +H+   +E++  +LV E++  DL    K    + D G L   +IK +M Q+L  +D C
Sbjct  69   VALHDVIHTENK-LMLVFEYMDGDLK---KYMDTHGDRGALKPNQIKSFMYQLLRGIDFC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLI+  G LKL DFG AR    P
Sbjct  125  HQNRVLHRDLKPQNLLINGKGQLKLGDFGLARAFGIP  161



>ref|XP_003236978.1| CMGC/CDK/CDK7 protein kinase [Trichophyton rubrum CBS 118892]
Length=406

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 100/163 (61%), Gaps = 15/163 (9%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLT-VALKEIH---DYQS-----ALREIEALQTLQN  348
            KY   +++G G Y+ VY G  R D  + VA+K+I    +Y+      A+RE++ LQ L +
Sbjct  63   KYVKDKKLGEGTYAVVYLGHLRDDPTSLVAIKKIKLNAEYKDGLSMDAIREVKYLQELSH  122

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPT-DLGAVIKAAKKNWDNGLTVGEIKRWMVQILSA  525
             PNV+ +H+ F S+D++  LVLEFLP  DL  +IK +   +     V +IK W+  +   
Sbjct  123  -PNVIALHDVFSSKDQNLNLVLEFLPLGDLEMLIKDSSIQYG----VADIKAWISMLARG  177

Query  526  VDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPGL  654
            V  CH+N I+HRD+KP+NLLI+ +G +KLADFG AR    P L
Sbjct  178  VWFCHKNFILHRDIKPNNLLIASDGEVKLADFGLARSFADPYL  220



>gb|ENH85958.1| negative regulator of the pho system [Colletotrichum orbiculare 
MAFF 240422]
Length=321

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNG-LTVGEIKRWMVQILSAVDAC  537
            V +H+   +E++  +LV E++  DL    K    + D G L   +IK +M Q+L  +D C
Sbjct  69   VALHDVIHTENK-LMLVFEYMDGDLK---KYMDTHGDRGALKPNQIKSFMYQLLRGIDFC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLI+  G LKL DFG AR    P
Sbjct  125  HQNRVLHRDLKPQNLLINGKGQLKLGDFGLARAFGIP  161



>ref|XP_007819810.1| Protein kinase, catalytic domain protein [Metarhizium robertsii 
ARSEF 23]
 gb|EFZ01025.1| Protein kinase, catalytic domain protein [Metarhizium robertsii 
ARSEF 23]
 gb|EXV03567.1| cyclin-dependent protein kinase [Metarhizium robertsii]
 gb|KID73080.1| Protein kinase, ATP binding site, partial [Metarhizium brunneum 
ARSEF 3297]
 gb|KID89133.1| Serine/threonine-protein kinase, active site protein [Metarhizium 
guizhouense ARSEF 977]
 gb|KIE00391.1| Protein kinase, ATP binding site, partial [Metarhizium majus 
ARSEF 297]
 gb|KJK75434.1| hypothetical protein H634G_08797 [Metarhizium anisopliae BRIP 
53293]
 gb|KJK92319.1| hypothetical protein H633G_03788 [Metarhizium anisopliae BRIP 
53284]
Length=330

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 91/156 (58%), Gaps = 10/156 (6%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-DNI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACH  540
            V +H+   +E++  +LV E++  DL   +    +     L    IK +M Q+L  +D CH
Sbjct  69   VALHDVIHTENK-LMLVFEYMDGDLKRYMDMHGER--GALKPATIKSFMYQLLKGIDFCH  125

Query  541  RNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +N ++HRDLKP NLLI+  G+LKL DFG AR    P
Sbjct  126  QNRVLHRDLKPQNLLINSKGLLKLGDFGLARAFGIP  161



>ref|XP_007812823.1| negative regulator of the PHO system [Metarhizium acridum CQMa 
102]
 gb|EFY87506.1| negative regulator of the PHO system [Metarhizium acridum CQMa 
102]
Length=327

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 91/156 (58%), Gaps = 10/156 (6%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-DNI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACH  540
            V +H+   +E++  +LV E++  DL   +    +     L    IK +M Q+L  +D CH
Sbjct  69   VALHDVIHTENK-LMLVFEYMDGDLKRYMDMHGER--GALKPATIKSFMYQLLKGIDFCH  125

Query  541  RNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +N ++HRDLKP NLLI+  G+LKL DFG AR    P
Sbjct  126  QNRVLHRDLKPQNLLINSKGLLKLGDFGLARAFGIP  161



>ref|XP_001363256.2| PREDICTED: cyclin-dependent kinase 20-like isoform X1 [Monodelphis 
domestica]
Length=383

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 104/187 (56%), Gaps = 18/187 (10%)
 Frame = +1

Query  103  LITKQEREKETPMDSPPS-KSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTV  279
            L+  QE + E P +SP S  S + HT  +    Y I  R+G GA+  V++ +      TV
Sbjct  13   LLRGQEAQGE-PWESPGSIPSSTSHTMDQ----YSILGRIGEGAHGIVFKAKHVETGETV  67

Query  280  ALKEIHDYQ-------SALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLG  438
            ALK++   +        ALREI+ALQ +++   VV +   F       VL  EF+ +DL 
Sbjct  68   ALKKVALRRLEDGIPNQALREIKALQEIEDNQYVVKLKAVF-PHGAGFVLAFEFMLSDLS  126

Query  439  AVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLAD  618
             VI+  K+     L   ++K +M  +L  V  CH N+IVHRDLKP+NLLIS +G LK+AD
Sbjct  127  EVIRHGKRP----LAPAQVKAYMQMLLKGVAFCHANNIVHRDLKPANLLISSSGQLKIAD  182

Query  619  FGQARML  639
            FG AR+ 
Sbjct  183  FGLARVF  189



>gb|KFG83333.1| negative regulator of the PHO system [Metarhizium anisopliae]
 gb|KID69776.1| negative regulator of the PHO system, partial [Metarhizium anisopliae 
ARSEF 549]
Length=330

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 91/156 (58%), Gaps = 10/156 (6%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-DNI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACH  540
            V +H+   +E++  +LV E++  DL   +    +     L    IK +M Q+L  +D CH
Sbjct  69   VALHDVIHTENK-LMLVFEYMDGDLKRYMDMHGER--GALKPATIKSFMYQLLKGIDFCH  125

Query  541  RNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            +N ++HRDLKP NLLI+  G+LKL DFG AR    P
Sbjct  126  QNRVLHRDLKPQNLLINSKGLLKLGDFGLARAFGIP  161



>gb|EKV17480.1| hypothetical protein PDIG_14320 [Penicillium digitatum PHI26]
 gb|EKV21865.1| hypothetical protein PDIP_01800 [Penicillium digitatum Pd1]
Length=404

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 100/164 (61%), Gaps = 13/164 (8%)
 Frame = +1

Query  184  EITIKYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQ  336
            E+  +Y   ++VG G Y+ VY G  R D S  VA+K+I    +Y+      A+RE++ LQ
Sbjct  59   EVRERYVKDKKVGEGTYAVVYVGHLRHDPSSLVAIKKIKVNAEYKDGLAMDAVREVKYLQ  118

Query  337  TLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQI  516
             L++ PNV+ +H+ F S+D++  LVLEFLP   G  ++   K+ D    V +IK WM  +
Sbjct  119  ELKH-PNVIALHDVFSSKDQNLSLVLEFLP---GGDLEMLIKDSDIHYGVADIKAWMGML  174

Query  517  LSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
               +  CH N ++HRD+KP+NLLI+ +G +KLADFG AR    P
Sbjct  175  ARGIWWCHANFVLHRDIKPNNLLIAADGEVKLADFGLARSFADP  218



>ref|XP_002627299.1| cyclin-dependent protein kinase PhoA [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ74939.1| cyclin-dependent protein kinase PhoA [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ88471.1| cyclin-dependent protein kinase PhoA [Blastomyces dermatitidis 
ER-3]
 gb|EGE77363.1| cyclin-dependent protein kinase PhoA [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL38543.1| CMGC/CDK protein kinase [Blastomyces dermatitidis ATCC 26199]
 gb|EQL38544.1| CMGC/CDK protein kinase, variant [Blastomyces dermatitidis ATCC 
26199]
Length=309

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 92/156 (59%), Gaps = 12/156 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ VY+GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  11   FQRLEKLGEGTYATVYKGRNRQTGEMVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  69

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDACH  540
            + +++   +E++  +LV EF+  DL   ++      +N L    IK +M Q+L  V  CH
Sbjct  70   LSLYDIIHTENK-LMLVFEFMDKDLKKYMEVR----NNQLNYTTIKDFMHQLLRGVAFCH  124

Query  541  RNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
             N ++HRDLKP NLLI+ NG LKLADFG AR    P
Sbjct  125  HNRVLHRDLKPQNLLINTNGQLKLADFGLARAFGIP  160



>ref|XP_001743107.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91821.1| predicted protein [Monosiga brevicollis MX1]
Length=290

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 91/158 (58%), Gaps = 13/158 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDY-------QSALREIEALQTLQNCP  354
            KY   E++G G Y  VY+ + ++    VALK+I           +A+REI  L+ L + P
Sbjct  3    KYLKIEKIGEGTYGTVYKAKVKATGNLVALKKIKLEAEEEGVPSTAIREISLLKELSH-P  61

Query  355  NVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDA  534
            NVV + E   SE++   LV EFL  DL   I + +    NGL++  IK +M+Q+L  +D 
Sbjct  62   NVVSLMEVIHSENK-LYLVFEFLDQDLKKHIDSQR----NGLSMELIKSYMLQLLKGIDF  116

Query  535  CHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            CH   I+HRDLKP NLLI+  G +KLADFG AR    P
Sbjct  117  CHARRILHRDLKPQNLLINREGFIKLADFGLARAFGIP  154



>emb|CEG81380.1| Putative Serine/threonine-protein kinase pef1 [Rhizopus microsporus]
Length=199

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 90/157 (57%), Gaps = 12/157 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPN  357
            +Y   E++G G Y+ VY+G+ R    TVALKEIH         +A+REI  ++ L++  N
Sbjct  11   RYTRLEKLGEGTYATVYKGKSRITGETVALKEIHLDPEEGAPSTAIREISLMKELKH-TN  69

Query  358  VVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAVDAC  537
            ++ + +   +E +  +LV E++  DL   + A + N D       IK +M Q+L  +  C
Sbjct  70   IIRLLDVIHTESK-LILVSEYMDQDLKKFMDARQGNLD----TATIKSFMYQLLKGIAYC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H N ++HRDLKP NLLI+ +G LKL DFG AR    P
Sbjct  125  HENRVLHRDLKPQNLLINKHGELKLGDFGLARAFGIP  161



>ref|XP_002563401.1| Pc20g09050 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP86234.1| Pc20g09050 [Penicillium rubens Wisconsin 54-1255]
Length=404

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 97/160 (61%), Gaps = 13/160 (8%)
 Frame = +1

Query  196  KYEIFERVGSGAYSDVYRGRRRSD-SLTVALKEIH---DYQS-----ALREIEALQTLQN  348
            +Y    +VG G Y+ VY G  R D S  VA+K+I    +Y+      A+RE++ LQ L++
Sbjct  63   RYVKDRKVGEGTYAVVYVGHLRHDPSSLVAIKKIKVNAEYKDGLAMDAVREVKYLQELKH  122

Query  349  CPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQILSAV  528
             PNV+ +H+ F S+D++  LVLEFLP   G  ++   K+ D    V +IK WM  +   V
Sbjct  123  -PNVIALHDVFSSKDQNLSLVLEFLP---GGDLEMLIKDSDIQYGVADIKAWMGMLARGV  178

Query  529  DACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
              CH N ++HRD+KP+NLLI+ +G +KLADFG AR    P
Sbjct  179  WWCHENFVLHRDIKPNNLLIASDGEVKLADFGLARSFADP  218



>ref|XP_651330.1| protein kinase domain containing protein [Entamoeba histolytica 
HM-1:IMSS]
 gb|EAL45951.1| protein kinase domain containing protein [Entamoeba histolytica 
HM-1:IMSS]
 gb|EMD46512.1| cyclin-dependent kinase, putative [Entamoeba histolytica KU27]
 gb|EMH75498.1| protein kinase domain containing protein [Entamoeba histolytica 
HM-1:IMSS-B]
 gb|ENY65553.1| cyclin-dependent kinase C-2, putative [Entamoeba histolytica 
HM-1:IMSS-A]
Length=394

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 100/160 (63%), Gaps = 14/160 (9%)
 Frame = +1

Query  187  ITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIHDYQ------SALREIEALQTLQN  348
            I  KYEI  ++G GAY+ VY+ R ++    VA+K++ + +      ++LREI+ LQ + +
Sbjct  11   INDKYEIINQIGCGAYASVYKARTKTTGKLVAIKQLKNDRDQGFPVTSLREIQLLQEIHH  70

Query  349  CPNVV----VMHEFFWSEDEDSV-LVLEFLPTDLGAVIKAAKKNWDNGLTVGEIKRWMVQ  513
             PN++    V+H   + E   ++ LV EF+P DL + +K  +    + + +G++K +M+Q
Sbjct  71   -PNIIQLIEVLHANDFIERNTTISLVFEFMPHDLSSFLKCEE--IVSKVAIGQLKGYMLQ  127

Query  514  ILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQAR  633
            IL A+   H N+I+HRD+K  N+LISD+  +KL DFG AR
Sbjct  128  ILQAIQFLHSNNIIHRDIKTGNILISDDNHIKLGDFGLAR  167



>ref|XP_002841818.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ86009.1| unnamed protein product [Tuber melanosporum]
Length=378

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 107/204 (52%), Gaps = 22/204 (11%)
 Frame = +1

Query  133  TPMDSPPSKSWSIHTRKEITIKYEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH-----  297
            TP  +P     +    +E   KY    +VG G Y+ V+ G  +S +L VA+K+I      
Sbjct  9    TPAPAPNGGELAQQMNEETKKKYTKDRKVGEGTYAVVHLGHVKSTALPVAIKKIKLSAMV  68

Query  298  --DYQSALREIEALQTLQNCPNVVVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWD  471
                  A+RE++ LQ L++  N++ + + F S++++  LVLEFL +DL  +IK  K    
Sbjct  69   DGISMDAIREVKFLQELRH-ENIIRLIDVFSSKNQNLNLVLEFLDSDLEMIIKDTKI---  124

Query  472  NGLTVGEIKRWMVQILSAVDACHRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAPG  651
             G    +IK W+   L  +  CH+N ++HRD+KP+NLL++ NG LKLADFG AR      
Sbjct  125  -GFGGADIKSWLAMSLRGLWWCHKNFVLHRDIKPNNLLLATNGQLKLADFGLARSF----  179

Query  652  LAAVDDGQPYGKASPNVPTPMYTP  723
                    PY   +  V T  Y P
Sbjct  180  ------SDPYRAMTSTVITRWYRP  197



>gb|EFQ33264.1| hypothetical protein GLRG_08408 [Colletotrichum graminicola M1.001]
Length=321

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +1

Query  199  YEIFERVGSGAYSDVYRGRRRSDSLTVALKEIH------DYQSALREIEALQTLQNCPNV  360
            ++  E++G G Y+ V++GR R     VALKEIH         +A+REI  ++ L++  N+
Sbjct  10   FQQLEKLGEGTYATVFKGRNRQTGELVALKEIHLDSEEGTPSTAIREISLMKELKH-ENI  68

Query  361  VVMHEFFWSEDEDSVLVLEFLPTDLGAVIKAAKKNWDNG-LTVGEIKRWMVQILSAVDAC  537
            V +H+   +E++  +LV E++  DL    K    + D G L   +IK +M Q+L  +D C
Sbjct  69   VALHDVIHTENK-LMLVFEYMDGDLK---KYMDTHGDRGALKPHQIKSFMYQLLRGIDFC  124

Query  538  HRNSIVHRDLKPSNLLISDNGILKLADFGQARMLLAP  648
            H+N ++HRDLKP NLLI+  G LKL DFG AR    P
Sbjct  125  HQNRVLHRDLKPQNLLINGKGQLKLGDFGLARAFGIP  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1710808110896