BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig641

Length=1012
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086042.1|  PREDICTED: LOW QUALITY PROTEIN: protein E6-like  96.7    1e-19   Sesamum indicum [beniseed]
ref|XP_009757117.1|  PREDICTED: protein E6                            96.7    2e-19   Nicotiana sylvestris
dbj|BAM28759.1|  ROX1 homologue                                       96.3    3e-19   Nicotiana tabacum [American tobacco]
ref|XP_009613470.1|  PREDICTED: homeobox protein 2                    94.0    2e-18   Nicotiana tomentosiformis
gb|ABH01084.1|  putative ROX1                                         92.0    9e-18   Nicotiana tabacum [American tobacco]
ref|XP_004232917.1|  PREDICTED: homeobox protein 2-like               84.0    7e-15   Solanum lycopersicum
ref|XP_006364298.1|  PREDICTED: protein E6-like                       80.1    2e-13   Solanum tuberosum [potatoes]
dbj|BAM28758.1|  ROX1 homologue                                       79.7    2e-13   Nicotiana benthamiana
ref|XP_009769426.1|  PREDICTED: homeobox protein 2-like               78.2    3e-13   Nicotiana sylvestris
ref|XP_009758887.1|  PREDICTED: probable serine/threonine-protein...  77.8    2e-12   Nicotiana sylvestris
ref|XP_009591056.1|  PREDICTED: probable serine/threonine-protein...  75.1    1e-11   
ref|XP_011096354.1|  PREDICTED: protein E6-like                       72.8    3e-11   Sesamum indicum [beniseed]
ref|XP_009783548.1|  PREDICTED: probable cyclin-dependent serine/...  73.9    6e-11   Nicotiana sylvestris
ref|XP_009772856.1|  PREDICTED: probable serine/threonine-protein...  73.6    6e-11   Nicotiana sylvestris
ref|XP_009593819.1|  PREDICTED: probable WRKY transcription facto...  71.2    6e-11   Nicotiana tomentosiformis
ref|XP_009591057.1|  PREDICTED: GATA zinc finger domain-containin...  72.8    8e-11   
emb|CDO99498.1|  unnamed protein product                              70.1    4e-10   Coffea canephora [robusta coffee]
ref|XP_009618543.1|  PREDICTED: probable serine/threonine-protein...  69.7    1e-09   Nicotiana tomentosiformis
gb|EYU43374.1|  hypothetical protein MIMGU_mgv1a012195mg              65.9    6e-09   Erythranthe guttata [common monkey flower]
ref|XP_011001231.1|  PREDICTED: protein E6-like                       60.8    3e-07   Populus euphratica
ref|XP_006361067.1|  PREDICTED: homeobox protein 2-like               58.5    3e-06   
ref|XP_011027781.1|  PREDICTED: protein E6-like                       56.6    1e-05   Populus euphratica
sp|Q01197.1|E6_GOSHI  RecName: Full=Protein E6                        54.3    3e-05   Gossypium hirsutum [American cotton]
gb|AAA33056.1|  5' start site is putative; putative                   53.9    5e-05   Gossypium hirsutum [American cotton]
gb|EPS61380.1|  hypothetical protein M569_13417                       53.9    6e-05   Genlisea aurea
ref|XP_009352859.1|  PREDICTED: protein E6                            52.4    3e-04   Pyrus x bretschneideri [bai li]
gb|AAY43794.1|  E6-like                                               51.2    3e-04   Gossypium hirsutum [American cotton]
gb|AAB03081.1|  E6                                                    51.6    3e-04   Gossypium barbadense [Egyptian cotton]
gb|AAY43792.1|  E6-3                                                  51.6    3e-04   Gossypium hirsutum [American cotton]
gb|AAY43790.1|  E6-1                                                  51.6    4e-04   Gossypium hirsutum [American cotton]
ref|XP_002279294.1|  PREDICTED: protein E6                            51.2    5e-04   Vitis vinifera
gb|AAY43793.1|  E6-4                                                  50.4    7e-04   Gossypium hirsutum [American cotton]
gb|AAF91226.1|AF218378_1  protein kinase                              50.4    8e-04   Gossypium hirsutum [American cotton]
gb|KJB57495.1|  hypothetical protein B456_009G167000                  50.1    9e-04   Gossypium raimondii



>ref|XP_011086042.1| PREDICTED: LOW QUALITY PROTEIN: protein E6-like [Sesamum indicum]
Length=282

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 103/200 (52%), Gaps = 48/200 (24%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRES------TTAAAK  289
            AR+SQ+F+K+   +     +   + Q+ +PNF+ E+EN  YGLYG ES      TTA   
Sbjct  29   ARDSQYFNKV---SSTTNTKEIPSNQQAEPNFLPENENS-YGLYGHESGQLPPSTTAY--  82

Query  290  NLPSWEENIPNKKYLPKNYSPVSYVTVPEDTSAGAGAGKQKTSMPSDTFMQSGYTNGGEN  469
                 E   P+ KYLPKNY+PV+YVT P+  S      + KT   ++T   + Y  G +N
Sbjct  83   ---DTESKQPSHKYLPKNYNPVAYVTQPDVVSENTPFTEDKTFTSTNTDNNNYYNGGDQN  139

Query  470  YFNNQKE-------RYPSATTTTGNRNDQY------------------------NGGDAN  556
            Y+NNQ+E        YP A T   NRN  Y                        NGG+AN
Sbjct  140  YYNNQQEDQEPEFRSYPGAATN--NRNYHYNGGSSFNSFAAAPPPTTRRNNYFNNGGEAN  197

Query  557  GGFKKQGMSDTRFLDGGRYY  616
             GF+ QGMSDTRFL+ G+YY
Sbjct  198  YGFQPQGMSDTRFLENGKYY  217



>ref|XP_009757117.1| PREDICTED: protein E6 [Nicotiana sylvestris]
Length=346

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRESTTAAAKNLPSWE  307
            AR+ QFF+KIP NN   + QT +  +EQ+PNF+ E+ENG YGLYG +S T    N P+  
Sbjct  24   ARDGQFFNKIPSNNGEKETQTVIPNKEQEPNFMPENENGAYGLYGHDSVTTPNTNNPTVH  83

Query  308  ENIPNKKYLPKNYSPVSYVTVPE  376
            + +PN KYLPKNY+PVSYVTVPE
Sbjct  84   D-LPNSKYLPKNYNPVSYVTVPE  105



>dbj|BAM28759.1| ROX1 homologue [Nicotiana tabacum]
Length=346

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRESTTAAAKNLPSWE  307
            AR+ QFF+KIP NN   + QT +  +EQ+PNF+ E+ENG YGLYG +S T    N P+  
Sbjct  24   ARDGQFFNKIPSNNGEKETQTVIPNKEQEPNFMPENENGAYGLYGHDSVTTPNTNNPTVH  83

Query  308  ENIPNKKYLPKNYSPVSYVTVPE  376
            + +PN KYLPKNY+PVSYVTVPE
Sbjct  84   D-LPNSKYLPKNYNPVSYVTVPE  105



>ref|XP_009613470.1| PREDICTED: homeobox protein 2 [Nicotiana tomentosiformis]
Length=346

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRESTTAAAKNLPSWE  307
            AR+ QFF+K+P NN   + QT +  +EQ+PNF+ E+ENG YGLYG +S T    N PS  
Sbjct  24   ARDGQFFNKVPSNNGEKETQTVIPNKEQEPNFMPENENGAYGLYGHDSVTT---NNPSV-  79

Query  308  ENIPNKKYLPKNYSPVSYVTVPE  376
             N+PN KYLPKNY+PVSYVTVPE
Sbjct  80   HNLPNSKYLPKNYNPVSYVTVPE  102



>gb|ABH01084.1| putative ROX1 [Nicotiana tabacum]
Length=346

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRESTTAAAKNLPSWE  307
            AR+ QFF+K+P NN   + QT +  +EQ+PNF+  +ENG YGLYG +S T    N PS  
Sbjct  24   ARDGQFFNKVPSNNGEKETQTVIPNKEQEPNFMPXNENGAYGLYGHDSVTT---NNPSV-  79

Query  308  ENIPNKKYLPKNYSPVSYVTVPE  376
             N+PN KYLPKNY+PVSYVTVPE
Sbjct  80   HNLPNSKYLPKNYNPVSYVTVPE  102



>ref|XP_004232917.1| PREDICTED: homeobox protein 2-like [Solanum lycopersicum]
Length=342

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTL-NPQEQQPNFVQESENGGYGLYGRESTTAAAKNLPSW  304
            AR+ QFF+K+P NN   +A T + N ++Q+PNF+ E+ENG YGLYG ES +  +    + 
Sbjct  25   ARDGQFFNKVPSNNGEKEAATVVPNKEQQEPNFMPENENGAYGLYGHESVSTPSTTTNTN  84

Query  305  EENIPNKKYLPKNYSPVSYVTVPED  379
            + N PN KYLPKNY+PVSYVTV ED
Sbjct  85   DNNFPNSKYLPKNYNPVSYVTVAED  109



>ref|XP_006364298.1| PREDICTED: protein E6-like [Solanum tuberosum]
Length=352

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 72/113 (64%), Gaps = 6/113 (5%)
 Frame = +2

Query  59   MASIVThfsifflfsllsplhhhARESQFFSKIPRNNVVIKAQTTLNPQEQQPNFVQESE  238
            MASI   FS+ FL +L + L  HAR+ QFF+K+P NN   + QT +  +EQ+PNF+ E+E
Sbjct  1    MASIAKSFSLIFLLALFTSLQVHARDGQFFNKVPSNNGEKETQTVVPNKEQEPNFMPENE  60

Query  239  NGGYGLYGRES------TTAAAKNLPSWEENIPNKKYLPKNYSPVSYVTVPED  379
            NG YGLYG ES      TT           N PN KYLPKNY+PVSYVTV ED
Sbjct  61   NGAYGLYGHESVSTPSTTTTTTHTNNPNVNNFPNSKYLPKNYNPVSYVTVAED  113



>dbj|BAM28758.1| ROX1 homologue [Nicotiana benthamiana]
Length=346

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRESTTAAAKNLPSWE  307
            AR+ QFF+K+ RNN   + QT +  +EQ+PNF+ E+ENG    YG +S T    N P+  
Sbjct  24   ARDGQFFNKVSRNNGEKQTQTVIPNKEQEPNFMPENENGA---YGHDSVTTPNTNNPTVH  80

Query  308  ENIPNKKYLPKNYSPVSYVTVPE  376
            + +P  KYLPKNY+PVSYVTVPE
Sbjct  81   D-LPISKYLPKNYNPVSYVTVPE  102



>ref|XP_009769426.1| PREDICTED: homeobox protein 2-like [Nicotiana sylvestris]
Length=267

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 109/214 (51%), Gaps = 41/214 (19%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTLNP--QEQQPNFVQESENGGYGLYGRES-TTAAAKNLP  298
            AR+++FF+KI   N   + +T      +EQ+PNF+ E+ENG YG+Y  ES   + +   P
Sbjct  24   ARDNKFFNKISTTNNGREKETKEGTPNKEQEPNFIPENENG-YGVYDHESGQLSPSTTNP  82

Query  299  SWEENIPNKKYLPKNYSPVSYVTVPEDTSAGAG------------AGKQKTSMPSDTFMQ  442
            +   NIPN KYLPKNY+PV+YV VP+D                  +G   T    D   Q
Sbjct  83   T--NNIPNSKYLPKNYNPVAYVIVPQDNPNNNNDDNNNNNYNQYCSGDHNTYDNEDNNNQ  140

Query  443  SGYTNGGENYFNNQKE--------RYPSATTTTGNR--NDQ-------YNGGDANGGFK-  568
              Y +GG  Y +NQ                 + GN   NDQ       YN  D + G + 
Sbjct  141  --YYSGGSTYNHNQYHNGGSNYNYNNNYPGNSVGNSYYNDQEQSYPLDYNHYDGDNGHRV  198

Query  569  -KQGMSDTRFLDGGRY-YN-NGERFPRNPLDNSR  661
             +Q MSDTRFL+ G+Y Y+ N E++ R+P +NSR
Sbjct  199  QQQRMSDTRFLENGKYSYDVNTEKYVRDPYENSR  232



>ref|XP_009758887.1| PREDICTED: probable serine/threonine-protein kinase clkA, partial 
[Nicotiana sylvestris]
Length=571

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 16/99 (16%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTLNP-QEQQPNFVQESENGGYGLYGRES-----TTAAAK  289
            ARESQFF+KIP NN   K    + P +EQ+ NF+ E+EN GYGLYG ES     +T    
Sbjct  17   ARESQFFNKIPSNNHTEKKTQVVIPNKEQEANFLPENENNGYGLYGYESGQLPPSTITTN  76

Query  290  NLP----------SWEENIPNKKYLPKNYSPVSYVTVPE  376
            N+           +   NI N KYLPKNY+PV++VTVP+
Sbjct  77   NVENPYKEINPATTLTNNIYNSKYLPKNYNPVAHVTVPK  115



>ref|XP_009591056.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
tomentosiformis]
Length=465

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 57/99 (58%), Gaps = 16/99 (16%)
 Frame = +2

Query  128  ARESQFFSKIPRN-NVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRES-------TTAA  283
            ARESQFF+KIP N N   K Q  +  +E +PNF+ E+EN GYGLYG ES       TT  
Sbjct  25   ARESQFFNKIPSNINAEKKTQVVIPNKESEPNFLPENENNGYGLYGHESGQLPPSTTTTN  84

Query  284  AKNLPSWE--------ENIPNKKYLPKNYSPVSYVTVPE  376
                P  E        +NI N KYL KNY  V+YVTVP+
Sbjct  85   DVEKPYKEINPTTTLTKNIHNSKYLFKNYDNVAYVTVPK  123



>ref|XP_011096354.1| PREDICTED: protein E6-like [Sesamum indicum]
Length=302

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 104/220 (47%), Gaps = 54/220 (25%)
 Frame = +2

Query  140  QFFSKIP----RNNVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRE------STTA---  280
            Q F+K+P    +N V    +   N Q++QPNF+ ++ N  YGLYG +      STT    
Sbjct  29   QIFNKVPSTGNKNAVPNDVKEAPNNQQEQPNFLPDNGNS-YGLYGHDTGLLPPSTTTGEP  87

Query  281  AAKNLPSWEENIPNKKYLPKNYSPVSYVTVPEDTSAGAGAGKQKTSMPSDTFMQSGYTNG  460
            A+ +L   E   P  KYLPKNY+ V+YVT PE+ S      ++KT   +       Y N 
Sbjct  88   ASTSLYDTETKQPVHKYLPKNYNTVAYVTEPEEVSDSNTFAQEKTYTTNPNSDNVNYHNA  147

Query  461  GENYFNNQKE------RYPSATTTT----------------------GNRNDQYNGG---  547
             +NY+N+Q+E      R  +ATT                        G  + +Y G    
Sbjct  148  RQNYYNSQQEEEETEHRSYAATTNNRDNNNYYYYNGGSSFNSQAQPQGLSDTRYRGDATL  207

Query  548  -----DANGGFKKQGMSDTRFLDGGRYY---NNGERFPRN  643
                 +++ GF+ QGMSDTR +  G+YY   N G R+ RN
Sbjct  208  NRRERNSDNGFEPQGMSDTRSVGNGKYYYDINTG-RYSRN  246



>ref|XP_009783548.1| PREDICTED: probable cyclin-dependent serine/threonine-protein 
kinase DDB_G0292550 [Nicotiana sylvestris]
Length=1001

 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 54/96 (56%), Gaps = 15/96 (16%)
 Frame = +2

Query  128  ARESQFFSKIP-RNNVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRES-------TTAA  283
            ARESQFF+ +P  NN   K Q  +  +EQ+PNF+ E+EN GYGLYG ES       TT  
Sbjct  25   ARESQFFNTVPSNNNAEKKTQVVIPNKEQEPNFLPENENNGYGLYGHESGQHPPSTTTIN  84

Query  284  AKNLPSWE-------ENIPNKKYLPKNYSPVSYVTV  370
                P  E        NI N KYL KNY  V+YVTV
Sbjct  85   DVEKPYKEINPTTLTNNIHNSKYLSKNYDHVAYVTV  120



>ref|XP_009772856.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
sylvestris]
Length=547

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 56/97 (58%), Gaps = 16/97 (16%)
 Frame = +2

Query  128  ARESQFFSKIP-RNNVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRES-----TTAAAK  289
            ARESQFF+KIP  NN   K Q  +  +EQ+P+F+  +EN GYGLYG ES     +T    
Sbjct  25   ARESQFFNKIPSNNNAEKKTQVVIPNKEQEPHFLPTNENNGYGLYGHESGQLPPSTTTTN  84

Query  290  NL----------PSWEENIPNKKYLPKNYSPVSYVTV  370
            ++          P+   NI N KYL KNY  V+YVTV
Sbjct  85   DVEKPYKEINPTPTLTNNIHNSKYLSKNYDHVAYVTV  121



>ref|XP_009593819.1| PREDICTED: probable WRKY transcription factor protein 1 [Nicotiana 
tomentosiformis]
Length=239

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 16/90 (18%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTT-LNP-QEQQPNFVQESENGGYGLYGRES------TTAA  283
            AR+SQFF+KI  NN   + +T  + P +E++PNF+ E+ENG YG+YG+ES      TT  
Sbjct  24   ARDSQFFNKISTNNNGHEKETKEVTPNKEKEPNFIPENENG-YGVYGQESGQLSPFTTTP  82

Query  284  AKNLPSWEENIPNKKYLPKNYSPVSYVTVP  373
              NLP       N KYLPKNY PV+YVTVP
Sbjct  83   MNNLP-------NSKYLPKNYDPVAYVTVP  105



>ref|XP_009591057.1| PREDICTED: GATA zinc finger domain-containing protein 14-like 
[Nicotiana tomentosiformis]
Length=458

 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 55/97 (57%), Gaps = 16/97 (16%)
 Frame = +2

Query  128  ARESQFFSKIPRN-NVVIKAQTTLNPQEQQPNFVQESENGGYGLYGRES-------TTAA  283
            ARESQF +KI  N N   K Q  +  +EQ+PNF+ E+EN GYG+YG ES       TT  
Sbjct  25   ARESQFLNKISSNYNAEKKTQVVIPNKEQEPNFLPENENNGYGIYGHESGQLSLSTTTTN  84

Query  284  AKNLPSWE--------ENIPNKKYLPKNYSPVSYVTV  370
                P  E         NI N KYLPKNY+ V+YVTV
Sbjct  85   DVEKPYKEINPTTTLTNNIHNSKYLPKNYNHVAYVTV  121



>emb|CDO99498.1| unnamed protein product [Coffea canephora]
Length=302

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 61/110 (55%), Gaps = 29/110 (26%)
 Frame = +2

Query  128  ARESQFFSKIPRNN-------VVIKAQTTLN-PQEQQPNFVQESENGGYGLYGRE-----  268
            AR+ Q F+KIP NN        V +++ TLN  QEQ+PNF+ E+ENGGYGLYG E     
Sbjct  21   ARDPQLFNKIPSNNGAKETQVAVPRSEETLNNKQEQEPNFIPENENGGYGLYGHESGQLP  80

Query  269  -STTA----------AAKNLPSWEENIPNK---KYLPKNYSPVSYVTVPE  376
             STT           A  NLP    N P     KYLPKNY+  SYVT PE
Sbjct  81   PSTTTTINPSGEPYKATTNLPY--NNEPRDSYPKYLPKNYNTESYVTEPE  128



>ref|XP_009618543.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
tomentosiformis]
Length=497

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 54/97 (56%), Gaps = 16/97 (16%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKAQTTLNP-QEQQPNFVQESENGGYGLYGRE------STTAAA  286
            ARESQFF+KIP N V  K    + P +E +PNF+ E+EN  YGLYG E      STT   
Sbjct  25   ARESQFFNKIPGNVVAEKKTQVVIPNKESEPNFLPENENNVYGLYGHESGQLPPSTTTTN  84

Query  287  KNLPSWEE---------NIPNKKYLPKNYSPVSYVTV  370
                S++E         NI N KYL KNY  V YVTV
Sbjct  85   DVEKSYKEINPTTTLTNNIHNSKYLSKNYDHVVYVTV  121



>gb|EYU43374.1| hypothetical protein MIMGU_mgv1a012195mg [Erythranthe guttata]
Length=259

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 83/171 (49%), Gaps = 14/171 (8%)
 Frame = +2

Query  128  ARESQFFSKIPRNNV----VIKAQTTLNPQEQQPNFVQESENGGYGLYGRESTTAAAKNL  295
            ARE+QFF+K    N     ++       P   QP+F+ E+ENG YGL G  S        
Sbjct  27   ARENQFFNKASTTNTNNDNLVPDDVEKEPLNNQPDFLPENENG-YGLSGHNSVQLPPS-A  84

Query  296  PSWEENIPNKKYLPKNYSPVSYVTVPEDTSAGA---GAGKQKTSMPSDTFMQSGYTNGGE  466
             + E   P  KYLP+NY+PV+YVT PE T+  A                +  S   N  +
Sbjct  85   ATTESKRPLPKYLPRNYNPVAYVTEPEATNTFAEEKSYYNNGGGGGERNYYYSNNNNNQQ  144

Query  467  NYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKK-QGMSDTRFLDGGRYY  616
                 ++E  P   +    R++ YNGG+    F++ QGMSDTR L+ G+YY
Sbjct  145  QEEEEEEEEPPYRRSYPNTRSNYYNGGE----FRRPQGMSDTRSLENGKYY  191



>ref|XP_011001231.1| PREDICTED: protein E6-like [Populus euphratica]
Length=258

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 86/197 (44%), Gaps = 58/197 (29%)
 Frame = +2

Query  128  ARESQFFSK------------IPRNNVVIKA-----QTTLNPQEQQPNFVQESENGGYGL  256
            ARESQFFSK            I  NN   K      +  L+ QEQ P F+ +++NG YGL
Sbjct  23   ARESQFFSKVSGATTTPSTTTISNNNAQDKTHPGKEEEGLSKQEQDPAFIPDNQNG-YGL  81

Query  257  YGRESTTAAAKNLPSWEENIPNKKYLPKNYSPVSYVTVPEDTSAG---------------  391
            YG+EST       P+  + + N  Y    Y P    T  +++                  
Sbjct  82   YGQESTQ-----FPTTTK-LANAPYTTTTYQPYKTQTQNQESYTNYPTDTTTNTNTNYYN  135

Query  392  --AGAGKQKTSMPSDTFMQSGYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGF  565
              A   +Q+ +    +  +SGYTN G     NQK  Y             YNG ++    
Sbjct  136  NNAYDQEQQQNFGETSLQESGYTNMG-----NQKNNY------------YYNGANSYSND  178

Query  566  KKQGMSDTRFLDGGRYY  616
            +KQGMSDTR+L+ G+YY
Sbjct  179  EKQGMSDTRYLEKGKYY  195



>ref|XP_006361067.1| PREDICTED: homeobox protein 2-like [Solanum tuberosum]
Length=295

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 17/93 (18%)
 Frame = +2

Query  128  ARESQFFSKIPRNNV---VIKAQT--TLNP-QEQQPNFVQESENGGYGLYGRE----STT  277
            AR+SQFF+KI   N+    I+ +T   + P + Q+PNF+ ++EN  Y +YG E      +
Sbjct  26   ARDSQFFNKIHTTNINNDHIEKETKVVVTPNKNQEPNFIPKNENA-YDVYGHELGQLPPS  84

Query  278  AAAKNLPSWEENIPNKKYLPKNYSPVSYVTVPE  376
                NL      IPN KYLPKNY+ V+YVTVP+
Sbjct  85   TPTTNL------IPNNKYLPKNYNSVAYVTVPQ  111



>ref|XP_011027781.1| PREDICTED: protein E6-like [Populus euphratica]
Length=269

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 92/221 (42%), Gaps = 54/221 (24%)
 Frame = +2

Query  128  ARESQFFSK------------IPRNNVVIKA-----QTTLNPQEQQPNFVQESENGGYGL  256
            ARESQFFSK            I  NNV  KA     + + N QE+ P F+ +++NG YGL
Sbjct  23   ARESQFFSKVGATTATPSTTTINNNNVQDKALPSKEEESFNKQEKDPAFIPDTQNG-YGL  81

Query  257  YGRES----TTAAAKNLPSWEENIPNKKYLPKNYSPVSYVT--------VPEDTSAGA--  394
            YG+ES    TT    N P          Y    Y P    T         P D++     
Sbjct  82   YGQESSRFPTTTKLANAP----------YTTTTYQPYKTQTQTQETYTNYPADSTTTNNH  131

Query  395  ----GAGKQKTSMPSDTFMQSGYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGG  562
                   +Q+ +    +  +S YTN G    NN+K    + +    N          N  
Sbjct  132  YNNNAYEEQQQNFGETSLQESEYTNMGNQ--NNKKYYNGANSYNNNNNKYYNGANSYNND  189

Query  563  FKKQGMSDTRFLDGGRYY-----NNGERFPRNPLDNSRNQF  670
             +KQGMSDTR+L+ GRYY      N   +P     NSRN +
Sbjct  190  -EKQGMSDTRYLENGRYYYDVNNENSNYYPNQYQQNSRNNY  229



>sp|Q01197.1|E6_GOSHI RecName: Full=Protein E6 [Gossypium hirsutum]
 gb|AAA33055.1| 5' start site is putative; putative [Gossypium hirsutum]
 gb|AAB03079.1| E6 [Gossypium hirsutum]
 gb|ACI43385.1| E6-1 protein kinase [Gossypium hirsutum]
Length=238

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 95/197 (48%), Gaps = 37/197 (19%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKA-------------QTTLNPQEQQPNFVQESENGGYGLYGRE  268
            ARE  +FSK PR N+  K              QTT  P+EQ+P F+ E++NG YGLYG E
Sbjct  25   ARE--YFSKFPRVNINEKETTTREQKHETFVPQTTQKPEEQEPRFIPETQNG-YGLYGHE  81

Query  269  STTAAAKNLPSWEENIPNKKYL-PKNYSPVS-YVTVPEDTSAGAGAGKQKTSMPSDTFMQ  442
            S ++     PS+      + Y+ P  + P   Y ++PE ++      K       + +  
Sbjct  82   SGSSR----PSFTTKETYEPYVTPVRFHPDEPYNSIPESSN-----NKDTYYYNKNAYES  132

Query  443  SGYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKKQGMSDTRFLDGGRYYNN  622
            +   N GE  F  +       +T     N+ YNG +     +KQGMSDTR+L+ G+YY +
Sbjct  133  TKQQNLGEAIFTEK-----GWSTKENQNNNYYNGNNGYNNGEKQGMSDTRYLENGKYYYD  187

Query  623  GER----FPRNPLDNSR  661
             +     +P N  DNSR
Sbjct  188  VKSENNYYP-NRFDNSR  203



>gb|AAA33056.1| 5' start site is putative; putative [Gossypium hirsutum]
Length=218

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 94/197 (48%), Gaps = 37/197 (19%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKA-------------QTTLNPQEQQPNFVQESENGGYGLYGRE  268
            ARE  +FSK PR N+  K              QTT  P+EQ+P F+ E++NG YGLYG E
Sbjct  5    ARE--YFSKFPRVNINEKETTTREQKHETFVPQTTQKPEEQEPRFIPETQNG-YGLYGHE  61

Query  269  STTAAAKNLPSWEENIPNKKYL-PKNYSPVS-YVTVPEDTSAGAGAGKQKTSMPSDTFMQ  442
            S ++     PS+      + Y+ P  + P   Y ++PE ++      K       + +  
Sbjct  62   SGSSR----PSFTTKETYEPYVTPVRFHPDEPYNSIPESSN-----NKDTYYYNKNAYES  112

Query  443  SGYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKKQGMSDTRFLDGGRYY--  616
            +   N GE  F  +       +T     N+ YNG +     +KQGMSDTR+L+ G+YY  
Sbjct  113  TKQQNLGEAIFTEK-----GWSTKENQNNNYYNGNNGYNNGEKQGMSDTRYLENGKYYYD  167

Query  617  --NNGERFPRNPLDNSR  661
              +    +P N  DNSR
Sbjct  168  VKSENNYYP-NRFDNSR  183



>gb|EPS61380.1| hypothetical protein M569_13417 [Genlisea aurea]
Length=246

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 77/155 (50%), Gaps = 36/155 (23%)
 Frame = +2

Query  203  QEQQPNFVQESENGGYGLYGRESTTAAAKNL-----PSWEENIPNKKYLPKNYSPVSYVT  367
            +E QP+FV E+EN  YGLY R+S+++++         S ++      +LPKNY+PV+YVT
Sbjct  68   KEAQPSFVPENENP-YGLYRRDSSSSSSAAAVDAAVESQKDFTLGNPHLPKNYNPVAYVT  126

Query  368  VPEDTS-AGAGAGKQKTSMPSDTFMQSGYTNGG---ENYFNNQKERYPSATTTTGNRNDQ  535
             PE+    G+  G+   S  +D F       GG   ENYF       P+A          
Sbjct  127  QPENFEPKGSYEGEVFQSSKTDDFAGGNRYYGGSSRENYF-------PAA----------  169

Query  536  YNGGDANGGFKKQGMSDTRFLDGGRYYN--NGERF  634
                   G F+ QGMSDTR    G+Y+   N ERF
Sbjct  170  -------GEFQPQGMSDTRAFQNGKYFYDVNAERF  197



>ref|XP_009352859.1| PREDICTED: protein E6 [Pyrus x bretschneideri]
Length=311

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 77/250 (31%), Positives = 99/250 (40%), Gaps = 79/250 (32%)
 Frame = +2

Query  128  ARESQFFSKI------------------PRNNVVIKAQTTLNPQ-EQQPNFVQESENGGY  250
            AR+SQFFSK+                  P+           NP+ EQ+P FVQE++NG Y
Sbjct  26   ARDSQFFSKVASSNNNNVKESELPKTESPKTETPKTESPVFNPEKEQEPTFVQETQNG-Y  84

Query  251  GLYGRESTTAAAKNLPSWEENIPNKKYLPKNYSPVSYVTVPEDTSAGAGAGKQKTSMP--  424
            GLYG ES       LP        +K    NY P  Y T           G    + P  
Sbjct  85   GLYGHES-----GQLPPATSTTGTEKQHTTNY-PERYNTHYNPNENNYYNGNNFEANPNG  138

Query  425  -SDT-FMQSGYTNGGE---NYFNNQK-ERYP-----------SATTTTGNRNDQYNG---  544
             SDT F QS YT       N+ NN+  E  P           S TTTT   N+  N    
Sbjct  139  LSDTRFAQSSYTTTTATPNNHQNNKNFEANPNGLSDTRFAQSSYTTTTATPNNHQNNNFE  198

Query  545  GDANG---------------------------GFKKQGMSDTRFLDGGRYYNNGERFPRN  643
             + NG                            F+KQGMSDTRFL+ G+YY +     R+
Sbjct  199  ANPNGLSDTRFGQSSYTTTTATPNNYQNNKYYNFEKQGMSDTRFLENGKYYYDA----RS  254

Query  644  PLDNSRNQFG  673
              + ++NQ+G
Sbjct  255  ESNYNQNQYG  264



>gb|AAY43794.1| E6-like [Gossypium hirsutum]
Length=221

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 92/199 (46%), Gaps = 38/199 (19%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKA-------------QTTLNPQEQQPNFVQESENGGYGLYGRE  268
            ARE  +FSK PR N+  K              QTT  P+EQ+P F+ E++NG YGLYG E
Sbjct  5    ARE--YFSKFPRVNINEKETTTREQKHETFVPQTTQKPEEQEPRFIPETQNG-YGLYGHE  61

Query  269  STTAAAKNL--PSWEENIPNKKYL-PKNYSPVS-YVTVPEDTSAGAGAGKQKTSMPSDTF  436
            S + +      PS+      + Y+ P  + P   Y ++PE ++      K       + +
Sbjct  62   SGSGSGSGSSRPSFTTKETYEPYVTPVRFHPDEPYNSIPESSN-----NKDTYYYNKNAY  116

Query  437  MQSGYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKKQGMSDTRFLDGGRYY  616
              +   N GE  F        +    +   N   N  + N   +KQGMSDTR+L+ G+YY
Sbjct  117  KSTKQQNLGEAIF--------TEKGWSTKENQNNNYYNGNINGEKQGMSDTRYLENGKYY  168

Query  617  ----NNGERFPRNPLDNSR  661
                +    +P N LDNSR
Sbjct  169  YDVKSENSYYP-NQLDNSR  186



>gb|AAB03081.1| E6 [Gossypium barbadense]
 gb|AAB03085.1| E6 [Gossypium barbadense]
 gb|ACI43386.1| E6-2 protein kinase [Gossypium hirsutum]
Length=246

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 91/196 (46%), Gaps = 27/196 (14%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKA-------------QTTLNPQEQQPNFVQESENGGYGLYGRE  268
            ARE  +FSK PR N+  K              QTT  P+EQ+P F+ E++NG YGLYG E
Sbjct  25   ARE--YFSKFPRVNINEKETTTREQKHETFVPQTTQKPEEQEPRFIPETQNG-YGLYGHE  81

Query  269  STTAAAKNLPSWEENIPNKKYLPKNYSPVSYV-TVPEDTSAGAGAGKQKTSMPSDTFMQS  445
            S + +     S   +   K+      +PV +    P ++   +   K       + +  +
Sbjct  82   SGSGSGSGSGSSRPSFTTKETYEPYVTPVRFHPDEPYNSIPESSNNKDTYYYNKNAYEST  141

Query  446  GYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKKQGMSDTRFLDGGRYYNNG  625
               N GE  F  +       +T     N+ YNG +     +KQGMSDTR+L+ G+YY + 
Sbjct  142  KQQNLGEAIFTEK-----GWSTKENQNNNYYNGNNGYNNGEKQGMSDTRYLENGKYYYDV  196

Query  626  ER----FPRNPLDNSR  661
            +     +P N  DNSR
Sbjct  197  KSENNYYP-NRFDNSR  211



>gb|AAY43792.1| E6-3 [Gossypium hirsutum]
Length=246

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 91/196 (46%), Gaps = 27/196 (14%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKA-------------QTTLNPQEQQPNFVQESENGGYGLYGRE  268
            ARE  +FSK PR N+  K              QTT  P+EQ+P F+ E++NG YGLYG E
Sbjct  25   ARE--YFSKFPRVNINEKETTTREQKHETFVPQTTQKPEEQEPRFIPETQNG-YGLYGHE  81

Query  269  STTAAAKNLPSWEENIPNKKYLPKNYSPVSYV-TVPEDTSAGAGAGKQKTSMPSDTFMQS  445
            S + +     S   +   K+      +PV +    P ++   +   K       + +  +
Sbjct  82   SGSGSGSGSGSSRPSFTTKETYEPYVTPVRFHPDEPYNSIPESSNNKDTYYYNKNAYEST  141

Query  446  GYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKKQGMSDTRFLDGGRYYNNG  625
               N GE  F  +       +T     N+ YNG +     +KQGMSDTR+L+ G+YY + 
Sbjct  142  KQQNLGEAIFTEK-----GWSTKGNQNNNYYNGNNGYNNGEKQGMSDTRYLENGKYYYDV  196

Query  626  ER----FPRNPLDNSR  661
            +     +P N  DNSR
Sbjct  197  KSENNYYP-NRFDNSR  211



>gb|AAY43790.1| E6-1 [Gossypium hirsutum]
Length=246

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 91/196 (46%), Gaps = 27/196 (14%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKA-------------QTTLNPQEQQPNFVQESENGGYGLYGRE  268
            ARE  +FSK PR N+  K              QTT  P+EQ+P F+ E++NG YGLYG E
Sbjct  25   ARE--YFSKFPRVNINEKETTTREQKHETFVPQTTQKPEEQEPRFIPETQNG-YGLYGHE  81

Query  269  STTAAAKNLPSWEENIPNKKYLPKNYSPVSYV-TVPEDTSAGAGAGKQKTSMPSDTFMQS  445
            S + +     S   +   K+      +PV +    P ++   +   K       + +  +
Sbjct  82   SGSGSGSGSGSSRPSFTTKETYEPYVTPVRFHPDEPYNSIPESSNNKDTYYYNKNAYEST  141

Query  446  GYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKKQGMSDTRFLDGGRYYNNG  625
               N GE  F  +       +T     N+ YNG +     +KQGMSDTR+L+ G+YY + 
Sbjct  142  KQQNLGEAIFTEK-----GWSTKENQNNNYYNGNNGYNNGEKQGMSDTRYLENGKYYYDV  196

Query  626  ER----FPRNPLDNSR  661
            +     +P N  DNSR
Sbjct  197  KSENNYYP-NRFDNSR  211



>ref|XP_002279294.1| PREDICTED: protein E6 [Vitis vinifera]
 emb|CAN60306.1| hypothetical protein VITISV_005068 [Vitis vinifera]
Length=253

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 88/217 (41%), Gaps = 69/217 (32%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVV---IKAQTTL-----------NPQEQQPNFVQESENGGYGLYGR  265
            AR+SQFFSK+   N     +K ++ L             QEQ+P FV +++ G YGLYG 
Sbjct  25   ARDSQFFSKVTNPNNNNNNVKEESQLPNKEELESKQLKEQEQEPTFVPDTQEG-YGLYGH  83

Query  266  ESTTAAAKNLP--SWEENIPNKKYLPKNYSPVSYVTVPEDTSAGAGAGKQKTSMPSDTFM  439
                  +  LP  +   NIP        Y+  S                ++  +      
Sbjct  84   -----GSGQLPPSTTGNNIP--------YAEYSNNNNNNYYYNKNSYNAKQQGLKDTVLY  130

Query  440  QSGYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDA----------------NGGF--  565
             +GYT                   T  NRN+ YNG +                 N G+  
Sbjct  131  DTGYT-------------------TMSNRNNYYNGDNVYSSSSSNNNNNNNNNNNNGYNT  171

Query  566  KKQGMSDTRFLDGGRYYN--NGERFPRNPLDNSRNQF  670
            K+QGMSDTRFL+ GRYY   N E+  RN  +NSR ++
Sbjct  172  KQQGMSDTRFLENGRYYYDLNSEKNYRNEYENSRTEY  208



>gb|AAY43793.1| E6-4 [Gossypium hirsutum]
Length=244

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 94/199 (47%), Gaps = 35/199 (18%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKA-------------QTTLNPQEQQPNFVQESENGGYGLYGRE  268
            ARE  +FSK PR N   K              QTT  P+EQ+P F+ E++NG YGLYG E
Sbjct  25   ARE--YFSKFPRVNTNEKETTTREQEHETFVPQTTQKPEEQEPRFIPETQNG-YGLYGHE  81

Query  269  STTAAAKNL--PSWEENIPNKKYL-PKNYSPVS-YVTVPEDTSAGAGAGKQKTSMPSDTF  436
            S + +      PS+      + Y+ P  + P   Y ++PE ++      K       + +
Sbjct  82   SGSGSGSGSSRPSFTTKETYEPYVTPVRFHPDEPYNSIPESSN-----NKDTYYYNKNAY  136

Query  437  MQSGYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKKQGMSDTRFLDGGRYY  616
              +   N GE  F  +       +T     N+ YNG +     +KQGMSDTR+L+ G+YY
Sbjct  137  ESTKQQNLGEAIFTEK-----GWSTKENQNNNYYNGNNGYNNGEKQGMSDTRYLENGKYY  191

Query  617  NNGER----FPRNPLDNSR  661
             + +     +P N  DNSR
Sbjct  192  YDVKSENNYYP-NRFDNSR  209



>gb|AAF91226.1|AF218378_1 protein kinase [Gossypium hirsutum]
 gb|AAB03080.1| E6 [Gossypium hirsutum]
 gb|ACI43387.1| E6-3 protein kinase [Gossypium hirsutum]
Length=241

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 91/199 (46%), Gaps = 38/199 (19%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKA-------------QTTLNPQEQQPNFVQESENGGYGLYGRE  268
            ARE  +FSK PR N   K              QTT  P+EQ+P F+ E++NG YGLYG E
Sbjct  25   ARE--YFSKFPRVNTNEKETTTREQEHETFVPQTTQKPEEQEPRFIPETQNG-YGLYGHE  81

Query  269  STTAAAKNL--PSWEENIPNKKYL-PKNYSPVS-YVTVPEDTSAGAGAGKQKTSMPSDTF  436
            S + +      PS+      + Y+ P  + P   Y ++PE ++      K       + +
Sbjct  82   SGSGSGSGSSRPSFTTKETYEPYVTPVRFHPDEPYNSIPESSN-----NKDTYYYNKNAY  136

Query  437  MQSGYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKKQGMSDTRFLDGGRYY  616
              +   N GE  F        +    +   N   N  + N   +KQGMSDTR+L+ G+YY
Sbjct  137  KSTKQQNLGEAIF--------TEKGWSTKENQNNNYYNGNINGEKQGMSDTRYLENGKYY  188

Query  617  ----NNGERFPRNPLDNSR  661
                +    +P N LDNSR
Sbjct  189  YDVKSENSYYP-NQLDNSR  206



>gb|KJB57495.1| hypothetical protein B456_009G167000 [Gossypium raimondii]
Length=214

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 83/178 (47%), Gaps = 33/178 (19%)
 Frame = +2

Query  128  ARESQFFSKIPRNNVVIKA-------------QTTLNPQEQQPNFVQESENGGYGLYGRE  268
            ARE  +FSK PR N   K              QTT  P EQ+P F+ E++NG YGLYG E
Sbjct  25   ARE--YFSKFPRVNTNEKETTTREQEHETFVPQTTQKPGEQEPRFIPETQNG-YGLYGHE  81

Query  269  STTAAAKNLPSWEENIPNKKYL-PKNYSPVS-YVTVPEDTSAGAGAGKQKTSMPSDTFMQ  442
            S + +++  PS+      + Y+ P  + P   Y ++PE ++      K       + +  
Sbjct  82   SGSGSSR--PSFTTKETYEPYVTPVRFHPDEPYNSIPESSN-----NKDTYYYNKNAYKS  134

Query  443  SGYTNGGENYFNNQKERYPSATTTTGNRNDQYNGGDANGGFKKQGMSDTRFLDGGRYY  616
            +   N GE  F  +          +   N   N  + N   +KQGMSDTR+L+ G+YY
Sbjct  135  TKQQNLGEAIFTEKG--------WSTKENQNNNYYNGNINGEKQGMSDTRYLENGKYY  184



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2543375385617