BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig632

Length=771
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777669.1|  PREDICTED: probable ubiquitin-like-specific ...  65.9    7e-09   Nicotiana sylvestris
ref|XP_009777667.1|  PREDICTED: probable ubiquitin-like-specific ...  65.9    8e-09   Nicotiana sylvestris
ref|XP_006351213.1|  PREDICTED: probable ubiquitin-like-specific ...  63.2    6e-08   Solanum tuberosum [potatoes]
ref|XP_009777668.1|  PREDICTED: probable ubiquitin-like-specific ...  61.6    2e-07   Nicotiana sylvestris
ref|XP_009629817.1|  PREDICTED: probable ubiquitin-like-specific ...  61.2    2e-07   Nicotiana tomentosiformis
ref|XP_004250369.1|  PREDICTED: probable ubiquitin-like-specific ...  61.2    2e-07   Solanum lycopersicum
ref|XP_009777670.1|  PREDICTED: probable ubiquitin-like-specific ...  58.2    3e-06   Nicotiana sylvestris
ref|XP_010312817.1|  PREDICTED: probable ubiquitin-like-specific ...  56.2    1e-05   Solanum lycopersicum
ref|XP_010312818.1|  PREDICTED: probable ubiquitin-like-specific ...  56.2    1e-05   Solanum lycopersicum
ref|XP_009629818.1|  PREDICTED: probable ubiquitin-like-specific ...  56.2    1e-05   Nicotiana tomentosiformis
ref|XP_009629815.1|  PREDICTED: probable ubiquitin-like-specific ...  55.1    3e-05   Nicotiana tomentosiformis
ref|XP_009629816.1|  PREDICTED: probable ubiquitin-like-specific ...  55.1    3e-05   Nicotiana tomentosiformis
ref|XP_009629819.1|  PREDICTED: probable ubiquitin-like-specific ...  52.8    2e-04   Nicotiana tomentosiformis



>ref|XP_009777669.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X3 [Nicotiana sylvestris]
Length=896

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 63/126 (50%), Gaps = 10/126 (8%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPN-VLSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + ST   L+    PN  + G F   LE SS  GTA     Q  F  S S
Sbjct  77   ERMLRLGGIPTITSTKPRLYPDREPNNCIDGSF---LEGSSYTGTAF----QVIFYGSPS  129

Query  573  NDDSVDAVSDTDESLNVNSPT-PSARPANHDLCEDSPSSENCQGHWEMGENMAIVFHPDF  749
             D+SV   SD DES +  S +  SA P NHD+  D P S +    W M EN  IVF PD+
Sbjct  130  KDESVGTDSDVDESRSDESASYSSATPDNHDIL-DGPLSNHQFDQWGMFENKPIVFCPDY  188

Query  750  IYYRET  767
            +YYR T
Sbjct  189  LYYRGT  194



>ref|XP_009777667.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X1 [Nicotiana sylvestris]
Length=901

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 63/126 (50%), Gaps = 10/126 (8%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPN-VLSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + ST   L+    PN  + G F   LE SS  GTA     Q  F  S S
Sbjct  77   ERMLRLGGIPTITSTKPRLYPDREPNNCIDGSF---LEGSSYTGTAF----QVIFYGSPS  129

Query  573  NDDSVDAVSDTDESLNVNSPT-PSARPANHDLCEDSPSSENCQGHWEMGENMAIVFHPDF  749
             D+SV   SD DES +  S +  SA P NHD+  D P S +    W M EN  IVF PD+
Sbjct  130  KDESVGTDSDVDESRSDESASYSSATPDNHDIL-DGPLSNHQFDQWGMFENKPIVFCPDY  188

Query  750  IYYRET  767
            +YYR T
Sbjct  189  LYYRGT  194



>ref|XP_006351213.1| PREDICTED: probable ubiquitin-like-specific protease 2B-like 
[Solanum tuberosum]
Length=888

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 67/126 (53%), Gaps = 10/126 (8%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPNV-LSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + STN+  +    PN  + G F   LE SS  GTA     Q  F    S
Sbjct  71   ERMLRLGSMPNITSTNKRRYPDREPNNHIGGSF---LEGSSYRGTAF----QEIFSGPPS  123

Query  573  NDDSVDAVSDTDESLNVNSPTPSAR-PANHDLCEDSPSSENCQGHWEMGENMAIVFHPDF  749
            ND+SV AVSD DES +  S + S+  P NHD+  D P S +   HW M EN  IVF PD+
Sbjct  124  NDESVGAVSDVDESPSEESASYSSATPENHDIL-DGPLSNHHFDHWGMFENSPIVFCPDY  182

Query  750  IYYRET  767
            +YY+ T
Sbjct  183  LYYQGT  188



>ref|XP_009777668.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X2 [Nicotiana sylvestris]
Length=897

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 61/126 (48%), Gaps = 14/126 (11%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPN-VLSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + ST   L+    PN  + G F   LE SS  GTA        F+    
Sbjct  77   ERMLRLGGIPTITSTKPRLYPDREPNNCIDGSF---LEGSSYTGTA--------FQMEYV  125

Query  573  NDDSVDAVSDTDESLNVNSPT-PSARPANHDLCEDSPSSENCQGHWEMGENMAIVFHPDF  749
             D+SV   SD DES +  S +  SA P NHD+  D P S +    W M EN  IVF PD+
Sbjct  126  QDESVGTDSDVDESRSDESASYSSATPDNHDIL-DGPLSNHQFDQWGMFENKPIVFCPDY  184

Query  750  IYYRET  767
            +YYR T
Sbjct  185  LYYRGT  190



>ref|XP_009629817.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X3 [Nicotiana tomentosiformis]
Length=901

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 62/126 (49%), Gaps = 10/126 (8%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPN-VLSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + ST Q  +    PN  + G F   LE SS  GTA     Q  F  S S
Sbjct  77   ERMLRLGGIPTITSTKQRRYPDREPNNCIDGSF---LEGSSYTGTAF----QEIFHGSPS  129

Query  573  NDDSVDAVSDTDESLNVNSPT-PSARPANHDLCEDSPSSENCQGHWEMGENMAIVFHPDF  749
             D+SV   SD DES +  S +  SA   N+D+  D P S +    W M EN  IVF PD+
Sbjct  130  KDESVGTDSDVDESRSDESASYSSATRDNYDIL-DGPLSNHQFDQWGMFENKPIVFCPDY  188

Query  750  IYYRET  767
            +YYR T
Sbjct  189  LYYRGT  194



>ref|XP_004250369.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X3 [Solanum lycopersicum]
Length=889

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 65/125 (52%), Gaps = 10/125 (8%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPNV-LSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + STN+  F    PN  + G F   LE SS  GT    D Q  F    S
Sbjct  74   ERMLRLGSTPNITSTNKRRFPDREPNNHVGGSF---LEGSSYRGT----DCQEIFSGPHS  126

Query  573  NDDSVDAVSDTDESLNVNSPTPSARPANHDLCEDSPSSENCQGHWEMGENMAIVFHPDFI  752
            ND+SV AVSD   S    S + SA P NHD+  D P S +   HW M EN +IVF PD++
Sbjct  127  NDESVGAVSDESPSEESASYS-SATPENHDIL-DGPLSNHHFDHWGMFENSSIVFCPDYL  184

Query  753  YYRET  767
            YY+ T
Sbjct  185  YYQGT  189



>ref|XP_009777670.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X4 [Nicotiana sylvestris]
Length=892

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 59/126 (47%), Gaps = 19/126 (15%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPN-VLSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + ST   L+    PN  + G F   LE SS  GTA              
Sbjct  77   ERMLRLGGIPTITSTKPRLYPDREPNNCIDGSF---LEGSSYTGTAF-------------  120

Query  573  NDDSVDAVSDTDESLNVNSPT-PSARPANHDLCEDSPSSENCQGHWEMGENMAIVFHPDF  749
             D+SV   SD DES +  S +  SA P NHD+  D P S +    W M EN  IVF PD+
Sbjct  121  QDESVGTDSDVDESRSDESASYSSATPDNHDIL-DGPLSNHQFDQWGMFENKPIVFCPDY  179

Query  750  IYYRET  767
            +YYR T
Sbjct  180  LYYRGT  185



>ref|XP_010312817.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X1 [Solanum lycopersicum]
Length=891

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 65/127 (51%), Gaps = 12/127 (9%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPNV-LSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + STN+  F    PN  + G F   LE SS  GT    D Q  F    S
Sbjct  74   ERMLRLGSTPNITSTNKRRFPDREPNNHVGGSF---LEGSSYRGT----DCQEIFSGPHS  126

Query  573  NDDSVDAVSDTDESLNVNSPTPSARPANHDLCEDSPSSENCQGHWEM--GENMAIVFHPD  746
            ND+SV AVSD   S    S + SA P NHD+  D P S +   HW M   EN +IVF PD
Sbjct  127  NDESVGAVSDESPSEESASYS-SATPENHDIL-DGPLSNHHFDHWGMVMFENSSIVFCPD  184

Query  747  FIYYRET  767
            ++YY+ T
Sbjct  185  YLYYQGT  191



>ref|XP_010312818.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X2 [Solanum lycopersicum]
Length=890

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 65/127 (51%), Gaps = 12/127 (9%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPNV-LSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + STN+  F    PN  + G F   LE SS  GT    D Q  F    S
Sbjct  74   ERMLRLGSTPNITSTNKRRFPDREPNNHVGGSF---LEGSSYRGT----DCQEIFSGPHS  126

Query  573  NDDSVDAVSDTDESLNVNSPTPSARPANHDLCEDSPSSENCQGHWEM--GENMAIVFHPD  746
            ND+SV AVSD   S    S + SA P NHD+  D P S +   HW M   EN +IVF PD
Sbjct  127  NDESVGAVSDESPSEESASYS-SATPENHDIL-DGPLSNHHFDHWGMVMFENSSIVFCPD  184

Query  747  FIYYRET  767
            ++YY+ T
Sbjct  185  YLYYQGT  191



>ref|XP_009629818.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X4 [Nicotiana tomentosiformis]
Length=897

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 60/126 (48%), Gaps = 14/126 (11%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPN-VLSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + ST Q  +    PN  + G F   LE SS  GTA        F+    
Sbjct  77   ERMLRLGGIPTITSTKQRRYPDREPNNCIDGSF---LEGSSYTGTA--------FQMEYV  125

Query  573  NDDSVDAVSDTDESLNVNSPT-PSARPANHDLCEDSPSSENCQGHWEMGENMAIVFHPDF  749
             D+SV   SD DES +  S +  SA   N+D+  D P S +    W M EN  IVF PD+
Sbjct  126  QDESVGTDSDVDESRSDESASYSSATRDNYDIL-DGPLSNHQFDQWGMFENKPIVFCPDY  184

Query  750  IYYRET  767
            +YYR T
Sbjct  185  LYYRGT  190



>ref|XP_009629815.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X1 [Nicotiana tomentosiformis]
Length=906

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 62/131 (47%), Gaps = 15/131 (11%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPN-VLSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + ST Q  +    PN  + G F   LE SS  GTA     Q  F  S S
Sbjct  77   ERMLRLGGIPTITSTKQRRYPDREPNNCIDGSF---LEGSSYTGTAF----QEIFHGSPS  129

Query  573  N-----DDSVDAVSDTDESLNVNSPT-PSARPANHDLCEDSPSSENCQGHWEMGENMAIV  734
                  D+SV   SD DES +  S +  SA   N+D+  D P S +    W M EN  IV
Sbjct  130  KMEYVQDESVGTDSDVDESRSDESASYSSATRDNYDIL-DGPLSNHQFDQWGMFENKPIV  188

Query  735  FHPDFIYYRET  767
            F PD++YYR T
Sbjct  189  FCPDYLYYRGT  199



>ref|XP_009629816.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X2 [Nicotiana tomentosiformis]
Length=901

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 62/131 (47%), Gaps = 15/131 (11%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPN-VLSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + ST Q  +    PN  + G F   LE SS  GTA     Q  F  S S
Sbjct  77   ERMLRLGGIPTITSTKQRRYPDREPNNCIDGSF---LEGSSYTGTAF----QEIFHGSPS  129

Query  573  N-----DDSVDAVSDTDESLNVNSPT-PSARPANHDLCEDSPSSENCQGHWEMGENMAIV  734
                  D+SV   SD DES +  S +  SA   N+D+  D P S +    W M EN  IV
Sbjct  130  KMEYVQDESVGTDSDVDESRSDESASYSSATRDNYDIL-DGPLSNHQFDQWGMFENKPIV  188

Query  735  FHPDFIYYRET  767
            F PD++YYR T
Sbjct  189  FCPDYLYYRGT  199



>ref|XP_009629819.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform 
X5 [Nicotiana tomentosiformis]
Length=892

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 58/126 (46%), Gaps = 19/126 (15%)
 Frame = +3

Query  396  EGMSRLDDAKQMNSTNQELFHHVRPN-VLSGRFNPSLESSSSPGTASPEDNQHAFRESQS  572
            E M RL     + ST Q  +    PN  + G F   LE SS  GTA              
Sbjct  77   ERMLRLGGIPTITSTKQRRYPDREPNNCIDGSF---LEGSSYTGTAF-------------  120

Query  573  NDDSVDAVSDTDESLNVNSPT-PSARPANHDLCEDSPSSENCQGHWEMGENMAIVFHPDF  749
             D+SV   SD DES +  S +  SA   N+D+  D P S +    W M EN  IVF PD+
Sbjct  121  QDESVGTDSDVDESRSDESASYSSATRDNYDIL-DGPLSNHQFDQWGMFENKPIVFCPDY  179

Query  750  IYYRET  767
            +YYR T
Sbjct  180  LYYRGT  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1538697559425