BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig515

Length=1077
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602509.1|  PREDICTED: copper-transporting ATPase RAN1-l...    452   4e-147   Nicotiana tomentosiformis
ref|XP_004233259.1|  PREDICTED: copper-transporting ATPase RAN1         450   7e-146   Solanum lycopersicum
ref|XP_006364991.1|  PREDICTED: copper-transporting ATPase RAN1-like    443   2e-143   Solanum tuberosum [potatoes]
ref|XP_009758015.1|  PREDICTED: copper-transporting ATPase RAN1-like    434   2e-141   Nicotiana sylvestris
ref|XP_009597621.1|  PREDICTED: copper-transporting ATPase RAN1-like    432   3e-139   Nicotiana tomentosiformis
ref|XP_009757686.1|  PREDICTED: copper-transporting ATPase RAN1         432   3e-139   Nicotiana sylvestris
ref|XP_007041035.1|  Copper-exporting ATPase / responsive-to-anta...    407   7e-131   
ref|XP_007041034.1|  Copper-exporting ATPase / responsive-to-anta...    409   5e-130   
ref|XP_012084564.1|  PREDICTED: copper-transporting ATPase RAN1 i...    404   2e-128   Jatropha curcas
ref|XP_002276004.2|  PREDICTED: copper-transporting ATPase RAN1         397   9e-126   Vitis vinifera
ref|XP_006280099.1|  hypothetical protein CARUB_v10025986mg             389   2e-125   
ref|XP_010087932.1|  Copper-transporting ATPase RAN1                    394   1e-124   Morus notabilis
ref|XP_008225906.1|  PREDICTED: copper-transporting ATPase RAN1         394   1e-124   Prunus mume [ume]
ref|XP_002523662.1|  copper-transporting atpase p-type, putative        394   2e-124   
ref|XP_007213700.1|  hypothetical protein PRUPE_ppa000787mg             389   5e-124   
ref|XP_009363247.1|  PREDICTED: copper-transporting ATPase RAN1-like    393   5e-124   Pyrus x bretschneideri [bai li]
gb|KDO77287.1|  hypothetical protein CISIN_1g001896mg                   377   7e-123   Citrus sinensis [apfelsine]
ref|XP_009340295.1|  PREDICTED: copper-transporting ATPase RAN1-like    390   8e-123   Pyrus x bretschneideri [bai li]
ref|XP_009353995.1|  PREDICTED: copper-transporting ATPase RAN1-like    389   8e-123   Pyrus x bretschneideri [bai li]
ref|XP_007213701.1|  hypothetical protein PRUPE_ppa000787mg             389   1e-122   Prunus persica
ref|XP_004293784.1|  PREDICTED: copper-transporting ATPase RAN1         389   2e-122   Fragaria vesca subsp. vesca
emb|CDP18214.1|  unnamed protein product                                389   2e-122   Coffea canephora [robusta coffee]
gb|EYU43653.1|  hypothetical protein MIMGU_mgv1a000759mg                388   2e-122   Erythranthe guttata [common monkey flower]
ref|XP_006369037.1|  Copper-transporting ATPase RAN1 family protein     388   4e-122   
ref|XP_008383286.1|  PREDICTED: LOW QUALITY PROTEIN: copper-trans...    386   1e-121   
ref|XP_011032035.1|  PREDICTED: copper-transporting ATPase RAN1-like    382   6e-121   Populus euphratica
ref|XP_011035471.1|  PREDICTED: copper-transporting ATPase RAN1         384   1e-120   Populus euphratica
gb|KDO77286.1|  hypothetical protein CISIN_1g001896mg                   377   2e-120   Citrus sinensis [apfelsine]
ref|XP_002303349.2|  Copper-transporting ATPase RAN1 family protein     383   3e-120   
ref|XP_006398114.1|  hypothetical protein EUTSA_v10000758mg             382   5e-120   Eutrema salsugineum [saltwater cress]
ref|XP_010260635.1|  PREDICTED: copper-transporting ATPase RAN1         382   7e-120   Nelumbo nucifera [Indian lotus]
emb|CDY50771.1|  BnaC07g18200D                                          381   1e-119   Brassica napus [oilseed rape]
gb|KDO77285.1|  hypothetical protein CISIN_1g001896mg                   377   2e-119   Citrus sinensis [apfelsine]
ref|XP_009101635.1|  PREDICTED: copper-transporting ATPase RAN1         380   2e-119   Brassica rapa
ref|XP_008371911.1|  PREDICTED: copper-transporting ATPase RAN1-like    380   3e-119   
ref|XP_011096834.1|  PREDICTED: copper-transporting ATPase RAN1         378   2e-118   Sesamum indicum [beniseed]
gb|KJB47996.1|  hypothetical protein B456_008G049700                    374   2e-118   Gossypium raimondii
gb|KDO77284.1|  hypothetical protein CISIN_1g001896mg                   377   3e-118   Citrus sinensis [apfelsine]
gb|KDO77283.1|  hypothetical protein CISIN_1g001896mg                   377   4e-118   Citrus sinensis [apfelsine]
gb|KCW75666.1|  hypothetical protein EUGRSUZ_D00027                     371   6e-118   Eucalyptus grandis [rose gum]
gb|KJB47995.1|  hypothetical protein B456_008G049700                    374   6e-118   Gossypium raimondii
ref|XP_006468540.1|  PREDICTED: copper-transporting ATPase RAN1-l...    375   2e-117   Citrus sinensis [apfelsine]
ref|XP_006468539.1|  PREDICTED: copper-transporting ATPase RAN1-l...    375   2e-117   Citrus sinensis [apfelsine]
gb|KJB47994.1|  hypothetical protein B456_008G049700                    375   2e-117   Gossypium raimondii
ref|XP_003533704.1|  PREDICTED: copper-transporting ATPase RAN1-like    374   7e-117   
ref|XP_010536885.1|  PREDICTED: copper-transporting ATPase RAN1-like    372   5e-116   Tarenaya hassleriana [spider flower]
ref|XP_010481705.1|  PREDICTED: copper-transporting ATPase RAN1-l...    371   6e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006448635.1|  hypothetical protein CICLE_v10014141mg             371   8e-116   Citrus clementina [clementine]
ref|XP_003547418.1|  PREDICTED: copper-transporting ATPase RAN1-like    370   1e-115   Glycine max [soybeans]
ref|XP_010051840.1|  PREDICTED: copper-transporting ATPase RAN1         370   2e-115   Eucalyptus grandis [rose gum]
ref|XP_002863545.1|  responsive-to-antagonist1                          370   2e-115   Arabidopsis lyrata subsp. lyrata
ref|XP_010684278.1|  PREDICTED: copper-transporting ATPase RAN1         369   3e-115   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI27210.3|  unnamed protein product                                367   8e-115   Vitis vinifera
gb|AID81887.1|  heavy metal ATPase transporter 7                        367   2e-114   Camelina sativa [gold-of-pleasure]
emb|CDY67659.1|  BnaA09g53550D                                          357   2e-114   Brassica napus [oilseed rape]
ref|XP_008439483.1|  PREDICTED: copper-transporting ATPase RAN1         367   2e-114   Cucumis melo [Oriental melon]
ref|XP_010441824.1|  PREDICTED: copper-transporting ATPase RAN1         367   3e-114   Camelina sativa [gold-of-pleasure]
emb|CDY39400.1|  BnaAnng05310D                                          366   5e-114   Brassica napus [oilseed rape]
ref|XP_010494533.1|  PREDICTED: copper-transporting ATPase RAN1-l...    365   1e-113   Camelina sativa [gold-of-pleasure]
emb|CDY69037.1|  BnaCnng61530D                                          353   4e-113   Brassica napus [oilseed rape]
ref|XP_004134538.1|  PREDICTED: copper-transporting ATPase RAN1         364   4e-113   Cucumis sativus [cucumbers]
ref|XP_010529297.1|  PREDICTED: copper-transporting ATPase RAN1-like    364   7e-113   Tarenaya hassleriana [spider flower]
gb|AAL02122.1|  copper-transporting P-type ATPase                       362   2e-112   Brassica napus [oilseed rape]
ref|NP_199292.1|  copper-transporting ATPase RAN1                       361   4e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AAK56262.1|AF367273_1  AT5g44790/K23L20_14                           361   6e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AES65139.2|  heavy metal P-type ATPase                               360   1e-111   Medicago truncatula
ref|XP_003594888.1|  Copper-transporting ATPase RAN1                    360   2e-111   
gb|KFK31609.1|  hypothetical protein AALP_AA6G135300                    359   4e-111   Arabis alpina [alpine rockcress]
ref|XP_004504660.1|  PREDICTED: copper-transporting ATPase RAN1-l...    358   5e-111   
ref|XP_004504659.1|  PREDICTED: copper-transporting ATPase RAN1-l...    358   7e-111   Cicer arietinum [garbanzo]
ref|XP_009113893.1|  PREDICTED: copper-transporting ATPase RAN1-like    357   1e-110   Brassica rapa
gb|KEH31405.1|  heavy metal P-type ATPase                               355   1e-109   Medicago truncatula
ref|XP_008809603.1|  PREDICTED: copper-transporting ATPase RAN1-l...    353   2e-109   
ref|XP_009412056.1|  PREDICTED: copper-transporting ATPase RAN1-like    353   7e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008809602.1|  PREDICTED: copper-transporting ATPase RAN1-l...    352   1e-108   Phoenix dactylifera
ref|XP_007138840.1|  hypothetical protein PHAVU_009G241800g             351   2e-108   Phaseolus vulgaris [French bean]
ref|XP_003524125.1|  PREDICTED: copper-transporting ATPase RAN1-like    347   6e-107   Glycine max [soybeans]
gb|AGO68203.1|  heavy metal ATPase 7                                    347   6e-107   Silene latifolia
gb|KHN28939.1|  Copper-transporting ATPase RAN1                         348   7e-107   Glycine soja [wild soybean]
ref|XP_010941680.1|  PREDICTED: copper-transporting ATPase RAN1 i...    344   1e-106   Elaeis guineensis
gb|AGO68204.1|  heavy metal ATPase 7                                    345   6e-106   Silene vulgaris [maiden's-tears]
ref|XP_003532660.1|  PREDICTED: copper-transporting ATPase RAN1-like    345   7e-106   Glycine max [soybeans]
ref|XP_010941679.1|  PREDICTED: copper-transporting ATPase RAN1 i...    344   1e-105   Elaeis guineensis
gb|AGO68202.1|  heavy metal ATPase 7                                    344   1e-105   Silene vulgaris [maiden's-tears]
gb|KHN25921.1|  Copper-transporting ATPase RAN1                         343   1e-105   Glycine soja [wild soybean]
ref|XP_009402537.1|  PREDICTED: copper-transporting ATPase RAN1-like    344   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008798210.1|  PREDICTED: copper-transporting ATPase RAN1-l...    343   3e-105   Phoenix dactylifera
ref|XP_008798211.1|  PREDICTED: copper-transporting ATPase RAN1-l...    343   3e-105   Phoenix dactylifera
gb|AGO68201.1|  heavy metal ATPase 7                                    331   7e-101   Silene vulgaris [maiden's-tears]
ref|XP_007158884.1|  hypothetical protein PHAVU_002G190000g             330   3e-100   Phaseolus vulgaris [French bean]
ref|XP_004951760.1|  PREDICTED: copper-transporting ATPase RAN1-like    318   5e-96    Setaria italica
dbj|BAD25508.1|  putative copper-exporting ATPase                       315   1e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006853566.1|  PREDICTED: copper-transporting ATPase RAN1         308   2e-92    Amborella trichopoda
ref|XP_003570214.1|  PREDICTED: copper-transporting ATPase RAN1-like    308   3e-92    Brachypodium distachyon [annual false brome]
gb|EEC72585.1|  hypothetical protein OsI_06035                          308   3e-92    Oryza sativa Indica Group [Indian rice]
gb|EPS72268.1|  hypothetical protein M569_02482                         306   8e-92    Genlisea aurea
ref|NP_001182877.1|  hypothetical protein                               305   3e-91    Zea mays [maize]
dbj|BAK07450.1|  predicted protein                                      305   6e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96089.1|  predicted protein                                      305   6e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001046033.1|  Os02g0172600                                       304   1e-90    
gb|EMT19252.1|  Copper-transporting ATPase RAN1                         303   1e-90    
ref|XP_002453372.1|  hypothetical protein SORBIDRAFT_04g004820          300   4e-89    
dbj|BAD45393.1|  putative ATP dependent copper transporter              291   2e-86    Oryza sativa Japonica Group [Japonica rice]
gb|EEC81135.1|  hypothetical protein OsI_24030                          291   2e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_008661041.1|  PREDICTED: copper-transporting ATPase RAN1-like    292   4e-86    
ref|XP_004965620.1|  PREDICTED: copper-transporting ATPase RAN1-like    287   2e-84    Setaria italica
dbj|BAJ96159.1|  predicted protein                                      286   3e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563342.1|  PREDICTED: copper-transporting ATPase RAN1-l...    286   3e-84    Brachypodium distachyon [annual false brome]
ref|XP_012084565.1|  PREDICTED: copper-transporting ATPase RAN1 i...    285   6e-84    Jatropha curcas
gb|ABR17750.1|  unknown                                                 284   3e-83    Picea sitchensis
ref|XP_002438813.1|  hypothetical protein SORBIDRAFT_10g026600          281   2e-82    
gb|AFW87697.1|  hypothetical protein ZEAMMB73_336618                    272   8e-82    
ref|XP_006648354.1|  PREDICTED: copper-transporting ATPase RAN1-like    262   1e-75    Oryza brachyantha
ref|XP_009602510.1|  PREDICTED: copper-transporting ATPase RAN1-l...    258   1e-74    
gb|EEE56406.1|  hypothetical protein OsJ_05563                          244   3e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008676293.1|  PREDICTED: copper-transporting ATPase RAN1-like    227   1e-66    
gb|EMS46723.1|  Copper-transporting ATPase RAN1                         233   2e-65    Triticum urartu
dbj|BAJ86216.1|  predicted protein                                      232   4e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT21866.1|  Copper-transporting ATPase RAN1                         229   4e-64    
gb|EMS50583.1|  Copper-transporting ATPase RAN1                         228   1e-63    Triticum urartu
ref|XP_002985430.1|  hypothetical protein SELMODRAFT_122320             226   1e-62    
gb|EAZ37932.1|  hypothetical protein OsJ_22282                          224   3e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001767501.1|  predicted protein                                  218   5e-60    
ref|XP_001774995.1|  predicted protein                                  214   2e-58    
gb|KDO77282.1|  hypothetical protein CISIN_1g001896mg                   206   5e-56    Citrus sinensis [apfelsine]
ref|XP_010240462.1|  PREDICTED: copper-transporting ATPase RAN1-l...    201   3e-54    
ref|XP_011015891.1|  PREDICTED: copper-transporting ATPase RAN1-like    196   1e-52    Populus euphratica
ref|XP_008798213.1|  PREDICTED: copper-transporting ATPase RAN1-l...    189   8e-50    
ref|XP_002979765.1|  hypothetical protein SELMODRAFT_233397             172   5e-44    
ref|XP_002303580.1|  putative copper-transporting ATPase 3 family...    157   2e-38    Populus trichocarpa [western balsam poplar]
ref|XP_011022715.1|  PREDICTED: probable copper-transporting ATPa...    154   2e-37    Populus euphratica
ref|XP_006344024.1|  PREDICTED: probable copper-transporting ATPa...    151   2e-36    Solanum tuberosum [potatoes]
gb|EYU23491.1|  hypothetical protein MIMGU_mgv1a000768mg                151   2e-36    Erythranthe guttata [common monkey flower]
ref|XP_011080979.1|  PREDICTED: probable copper-transporting ATPa...    151   2e-36    Sesamum indicum [beniseed]
ref|XP_010533660.1|  PREDICTED: probable copper-transporting ATPa...    150   5e-36    Tarenaya hassleriana [spider flower]
ref|XP_001766223.1|  predicted protein                                  150   7e-36    
ref|XP_010325414.1|  PREDICTED: LOW QUALITY PROTEIN: probable cop...    149   8e-36    Solanum lycopersicum
ref|XP_010255417.1|  PREDICTED: probable copper-transporting ATPa...    149   8e-36    Nelumbo nucifera [Indian lotus]
ref|XP_002509783.1|  copper-transporting atpase p-type, putative        149   9e-36    Ricinus communis
ref|XP_011029249.1|  PREDICTED: probable copper-transporting ATPa...    148   2e-35    Populus euphratica
ref|XP_002269839.1|  PREDICTED: probable copper-transporting ATPa...    147   3e-35    Vitis vinifera
ref|XP_002299540.1|  hypothetical protein POPTR_0001s09210g             147   5e-35    
ref|XP_011080976.1|  PREDICTED: probable copper-transporting ATPa...    147   5e-35    Sesamum indicum [beniseed]
ref|XP_011016450.1|  PREDICTED: probable copper-transporting ATPa...    147   6e-35    Populus euphratica
gb|KDP25452.1|  hypothetical protein JCGZ_20608                         145   1e-34    Jatropha curcas
ref|XP_010676476.1|  PREDICTED: probable copper-transporting ATPa...    145   2e-34    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012086929.1|  PREDICTED: probable copper-transporting ATPa...    144   6e-34    
ref|XP_008392561.1|  PREDICTED: probable copper-transporting ATPa...    144   6e-34    Malus domestica [apple tree]
ref|XP_010089122.1|  Putative copper-transporting ATPase 3              143   1e-33    Morus notabilis
ref|XP_001699267.1|  heavy metal transporting ATPase                    143   2e-33    Chlamydomonas reinhardtii
ref|XP_003516697.1|  PREDICTED: probable copper-transporting ATPa...    142   3e-33    Glycine max [soybeans]
gb|KHN25708.1|  Putative copper-transporting ATPase 3                   142   3e-33    Glycine soja [wild soybean]
ref|XP_006850179.2|  PREDICTED: probable copper-transporting ATPa...    142   3e-33    Amborella trichopoda
gb|ERN11760.1|  hypothetical protein AMTR_s00022p00244650               142   3e-33    Amborella trichopoda
gb|KHN16831.1|  Putative copper-transporting ATPase 3                   140   7e-33    Glycine soja [wild soybean]
ref|XP_002981273.1|  hypothetical protein SELMODRAFT_114297             140   8e-33    
gb|KHN26317.1|  Putative copper-transporting ATPase 3                   140   8e-33    Glycine soja [wild soybean]
emb|CDP09758.1|  unnamed protein product                                140   8e-33    Coffea canephora [robusta coffee]
ref|XP_009590465.1|  PREDICTED: probable copper-transporting ATPa...    140   9e-33    Nicotiana tomentosiformis
ref|XP_002269802.1|  PREDICTED: probable copper-transporting ATPa...    140   1e-32    Vitis vinifera
ref|XP_007040200.1|  Heavy metal atpase 5                               140   1e-32    
ref|XP_003554176.1|  PREDICTED: probable copper-transporting ATPa...    140   2e-32    Glycine max [soybeans]
ref|XP_006476594.1|  PREDICTED: probable copper-transporting ATPa...    139   2e-32    
gb|KJB07829.1|  hypothetical protein B456_001G046800                    129   2e-32    Gossypium raimondii
ref|XP_002965761.1|  hypothetical protein SELMODRAFT_84115              139   2e-32    
ref|XP_006653660.1|  PREDICTED: probable copper-transporting ATPa...    139   3e-32    Oryza brachyantha
ref|XP_006439580.1|  hypothetical protein CICLE_v10018819mg             139   3e-32    
ref|XP_006476595.1|  PREDICTED: probable copper-transporting ATPa...    139   4e-32    Citrus sinensis [apfelsine]
ref|XP_004298728.1|  PREDICTED: probable copper-transporting ATPa...    138   5e-32    Fragaria vesca subsp. vesca
ref|XP_008669040.1|  PREDICTED: probable copper-transporting ATPa...    137   9e-32    Zea mays [maize]
ref|XP_008238887.1|  PREDICTED: probable copper-transporting ATPa...    137   1e-31    Prunus mume [ume]
ref|NP_001053522.2|  Os04g0556000                                       137   1e-31    
ref|XP_006300388.1|  hypothetical protein CARUB_v10019713mg             137   2e-31    
gb|EAY95120.1|  hypothetical protein OsI_16937                          137   2e-31    Oryza sativa Indica Group [Indian rice]
gb|EAZ31593.1|  hypothetical protein OsJ_15734                          137   2e-31    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007158491.1|  hypothetical protein PHAVU_002G156900g             136   2e-31    Phaseolus vulgaris [French bean]
ref|XP_009600811.1|  PREDICTED: probable copper-transporting ATPa...    136   2e-31    Nicotiana tomentosiformis
ref|XP_004976462.1|  PREDICTED: putative copper-transporting ATPa...    136   3e-31    Setaria italica
gb|KJB25813.1|  hypothetical protein B456_004G210800                    136   3e-31    Gossypium raimondii
gb|KJB25814.1|  hypothetical protein B456_004G210800                    135   4e-31    Gossypium raimondii
ref|XP_007158490.1|  hypothetical protein PHAVU_002G156800g             135   4e-31    Phaseolus vulgaris [French bean]
ref|XP_007210906.1|  hypothetical protein PRUPE_ppa000836mg             135   5e-31    Prunus persica
ref|XP_002969660.1|  hypothetical protein SELMODRAFT_231359             135   7e-31    
ref|XP_009400594.1|  PREDICTED: probable copper-transporting ATPa...    135   7e-31    
ref|XP_002446920.1|  hypothetical protein SORBIDRAFT_06g024910          135   8e-31    Sorghum bicolor [broomcorn]
ref|XP_001786130.1|  predicted protein                                  125   9e-31    
gb|KEH20505.1|  heavy metal P-type ATPase                               133   1e-30    Medicago truncatula
ref|XP_002446919.1|  hypothetical protein SORBIDRAFT_06g024900          134   1e-30    Sorghum bicolor [broomcorn]
emb|CDP19140.1|  unnamed protein product                                134   1e-30    Coffea canephora [robusta coffee]
ref|XP_002975836.1|  hypothetical protein SELMODRAFT_150817             134   1e-30    
gb|KEH20506.1|  heavy metal P-type ATPase                               134   1e-30    Medicago truncatula
ref|XP_006574305.1|  PREDICTED: probable copper-transporting ATPa...    134   1e-30    
ref|XP_010089121.1|  Putative copper-transporting ATPase 3              134   2e-30    Morus notabilis
gb|KHN25709.1|  Putative copper-transporting ATPase 3                   134   2e-30    Glycine soja [wild soybean]
ref|XP_004511584.1|  PREDICTED: putative copper-transporting ATPa...    133   2e-30    
ref|XP_009400268.1|  PREDICTED: probable copper-transporting ATPa...    133   2e-30    Musa acuminata subsp. malaccensis [pisang utan]
gb|AET04016.2|  heavy metal P-type ATPase                               133   2e-30    Medicago truncatula
ref|XP_010418362.1|  PREDICTED: probable copper-transporting ATPa...    133   2e-30    Camelina sativa [gold-of-pleasure]
ref|XP_009339920.1|  PREDICTED: probable copper-transporting ATPa...    133   2e-30    Pyrus x bretschneideri [bai li]
ref|XP_003629540.1|  Heavy metal P-type ATPase                          133   3e-30    
gb|AID81885.1|  heavy metal ATPase transporter 5                        133   3e-30    Camelina sativa [gold-of-pleasure]
ref|XP_006391745.1|  hypothetical protein EUTSA_v10023234mg             133   3e-30    Eutrema salsugineum [saltwater cress]
ref|XP_008667611.1|  PREDICTED: uncharacterized protein LOC100274...    133   3e-30    
ref|XP_009339921.1|  PREDICTED: probable copper-transporting ATPa...    133   3e-30    Pyrus x bretschneideri [bai li]
gb|AAT42153.1|  putative ATP dependent copper transporter               133   3e-30    Zea mays [maize]
ref|XP_004511582.1|  PREDICTED: putative copper-transporting ATPa...    133   3e-30    
ref|XP_008442022.1|  PREDICTED: probable copper-transporting ATPa...    133   3e-30    Cucumis melo [Oriental melon]
ref|XP_008442023.1|  PREDICTED: probable copper-transporting ATPa...    133   4e-30    Cucumis melo [Oriental melon]
ref|XP_007210396.1|  hypothetical protein PRUPE_ppa000896mg             132   4e-30    
ref|XP_008383979.1|  PREDICTED: probable copper-transporting ATPa...    132   5e-30    
ref|XP_003580298.1|  PREDICTED: probable copper-transporting ATPa...    132   7e-30    
ref|XP_010430438.1|  PREDICTED: probable copper-transporting ATPa...    132   7e-30    Camelina sativa [gold-of-pleasure]
ref|XP_010913948.1|  PREDICTED: probable copper-transporting ATPa...    132   7e-30    Elaeis guineensis
gb|EYU23488.1|  hypothetical protein MIMGU_mgv1a000951mg                132   7e-30    Erythranthe guttata [common monkey flower]
ref|XP_006586324.1|  PREDICTED: probable copper-transporting ATPa...    132   8e-30    
ref|XP_009339922.1|  PREDICTED: probable copper-transporting ATPa...    132   8e-30    
ref|XP_002269758.2|  PREDICTED: probable copper-transporting ATPa...    131   1e-29    Vitis vinifera
ref|XP_010676475.1|  PREDICTED: probable copper-transporting ATPa...    131   1e-29    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010473581.1|  PREDICTED: probable copper-transporting ATPa...    131   1e-29    Camelina sativa [gold-of-pleasure]
ref|XP_008238861.1|  PREDICTED: probable copper-transporting ATPa...    131   1e-29    Prunus mume [ume]
ref|XP_011653459.1|  PREDICTED: probable copper-transporting ATPa...    131   1e-29    Cucumis sativus [cucumbers]
gb|AGT16460.1|  ATP dependent copper transporter                        131   2e-29    Saccharum hybrid cultivar R570
gb|KFK40512.1|  hypothetical protein AALP_AA2G005400                    130   2e-29    Arabis alpina [alpine rockcress]
ref|XP_003571259.1|  PREDICTED: probable copper-transporting ATPa...    130   2e-29    Brachypodium distachyon [annual false brome]
ref|XP_010055623.1|  PREDICTED: probable copper-transporting ATPa...    130   2e-29    Eucalyptus grandis [rose gum]
ref|XP_008645432.1|  PREDICTED: probable copper-transporting ATPa...    130   2e-29    Zea mays [maize]
gb|AFW70752.1|  hypothetical protein ZEAMMB73_147775                    130   2e-29    
ref|XP_003611105.1|  Heavy metal P-type ATPase                          129   3e-29    
ref|XP_002887959.1|  hypothetical protein ARALYDRAFT_475008             130   3e-29    
ref|XP_009112946.1|  PREDICTED: probable copper-transporting ATPa...    129   4e-29    Brassica rapa
emb|CDY34353.1|  BnaA09g10950D                                          129   5e-29    Brassica napus [oilseed rape]
emb|CDY25498.1|  BnaC09g11230D                                          129   5e-29    Brassica napus [oilseed rape]
ref|XP_009766888.1|  PREDICTED: probable copper-transporting ATPa...    129   5e-29    Nicotiana sylvestris
gb|EUB56731.1|  Copper-transporting ATPase 2                            129   6e-29    Echinococcus granulosus
dbj|BAJ93251.1|  predicted protein                                      129   6e-29    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002451721.1|  hypothetical protein SORBIDRAFT_04g006600          129   7e-29    Sorghum bicolor [broomcorn]
emb|CDS22770.1|  copper transporting ATPase 1                           129   7e-29    Echinococcus granulosus
ref|XP_009624984.1|  PREDICTED: probable copper-transporting ATPa...    129   7e-29    Nicotiana tomentosiformis
emb|CDS35986.1|  copper transporting ATPase 1                           129   7e-29    Echinococcus multilocularis
ref|XP_007214551.1|  hypothetical protein PRUPE_ppa000897mg             129   9e-29    Prunus persica
ref|XP_002282923.1|  PREDICTED: probable copper-transporting ATPa...    128   1e-28    Vitis vinifera
ref|XP_002303665.2|  hypothetical protein POPTR_0003s12580g             128   1e-28    Populus trichocarpa [western balsam poplar]
gb|AES94063.2|  heavy metal P-type ATPase                               128   1e-28    Medicago truncatula
gb|ACF95872.1|  heavy metal P-type ATPase                               128   1e-28    Arabidopsis thaliana [mouse-ear cress]
gb|ACF95839.1|  heavy metal P-type ATPase                               128   1e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976463.1|  PREDICTED: putative copper-transporting ATPa...    128   1e-28    Setaria italica
ref|XP_008227189.1|  PREDICTED: probable copper-transporting ATPa...    128   1e-28    Prunus mume [ume]
emb|CAN64245.1|  hypothetical protein VITISV_035322                     128   2e-28    Vitis vinifera
ref|XP_010102321.1|  Putative copper-transporting ATPase 3              127   3e-28    
gb|ACF95835.1|  heavy metal P-type ATPase                               127   4e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006354252.1|  PREDICTED: probable copper-transporting ATPa...    126   4e-28    Solanum tuberosum [potatoes]
emb|CAN79386.1|  hypothetical protein VITISV_016015                     126   4e-28    Vitis vinifera
gb|ACF95842.1|  heavy metal P-type ATPase                               126   5e-28    Arabidopsis thaliana [mouse-ear cress]
emb|CDP09757.1|  unnamed protein product                                126   5e-28    Coffea canephora [robusta coffee]
gb|AAF19707.1|AC008047_14  F2K11.18                                     126   5e-28    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176533.1|  putative copper-transporting ATPase HMA5              126   5e-28    Arabidopsis thaliana [mouse-ear cress]
gb|ACF95863.1|  heavy metal P-type ATPase                               126   6e-28    Arabidopsis thaliana [mouse-ear cress]
gb|EYU46272.1|  hypothetical protein MIMGU_mgv1a000833mg                126   6e-28    Erythranthe guttata [common monkey flower]
ref|XP_002970029.1|  hypothetical protein SELMODRAFT_92276              126   6e-28    
ref|XP_004951567.1|  PREDICTED: putative copper-transporting ATPa...    126   6e-28    Setaria italica
gb|AIJ19559.1|  heavy metal ATPase 5B-1                                 125   7e-28    Cucumis sativus [cucumbers]
ref|XP_006439581.1|  hypothetical protein CICLE_v10023463mg             125   7e-28    
gb|ACF95836.1|  heavy metal P-type ATPase                               126   7e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540786.1|  PREDICTED: probable copper-transporting ATPa...    125   1e-27    Tarenaya hassleriana [spider flower]
ref|XP_004291807.1|  PREDICTED: probable copper-transporting ATPa...    125   1e-27    Fragaria vesca subsp. vesca
gb|AIJ19558.1|  heavy metal ATPase 5B-1                                 125   1e-27    Cucumis sativus [cucumbers]
ref|XP_004250875.1|  PREDICTED: probable copper-transporting ATPa...    124   2e-27    Solanum lycopersicum
ref|XP_011022716.1|  PREDICTED: probable copper-transporting ATPa...    124   2e-27    Populus euphratica
ref|XP_006446098.1|  hypothetical protein CICLE_v10014148mg             124   2e-27    Citrus clementina [clementine]
gb|EMS46494.1|  Putative copper-transporting ATPase 3                   123   5e-27    Triticum urartu
ref|XP_007014991.1|  Heavy metal atpase 5 isoform 1                     123   5e-27    
ref|XP_006470586.1|  PREDICTED: probable copper-transporting ATPa...    123   5e-27    Citrus sinensis [apfelsine]
gb|KDP22074.1|  hypothetical protein JCGZ_25905                         123   5e-27    Jatropha curcas
ref|XP_007014992.1|  Heavy metal atpase 5 isoform 2                     123   6e-27    
ref|XP_008798771.1|  PREDICTED: probable copper-transporting ATPa...    123   6e-27    Phoenix dactylifera
ref|XP_002303581.1|  putative copper-transporting ATPase 3 family...    123   6e-27    
ref|XP_012089974.1|  PREDICTED: probable copper-transporting ATPa...    123   7e-27    Jatropha curcas
ref|XP_012089975.1|  PREDICTED: probable copper-transporting ATPa...    123   7e-27    Jatropha curcas
ref|XP_006647022.1|  PREDICTED: probable copper-transporting ATPa...    122   8e-27    Oryza brachyantha
gb|KJB55365.1|  hypothetical protein B456_009G072500                    122   9e-27    
ref|XP_002513473.1|  copper-transporting atpase p-type, putative        122   9e-27    
gb|KJB55364.1|  hypothetical protein B456_009G072500                    122   9e-27    
pdb|2EW9|A  Chain A, Solution Structure Of Apowln5-6                    114   1e-26    
ref|XP_011080274.1|  PREDICTED: probable copper-transporting ATPa...    121   1e-26    
gb|KHG11091.1|  Putative copper-transporting ATPase 3 -like protein     122   2e-26    
gb|EEC72676.1|  hypothetical protein OsI_06234                          122   2e-26    
ref|NP_001046193.1|  Os02g0196600                                       122   2e-26    
ref|XP_011080273.1|  PREDICTED: probable copper-transporting ATPa...    122   2e-26    
ref|XP_008787478.1|  PREDICTED: probable copper-transporting ATPa...    121   2e-26    
ref|XP_008787477.1|  PREDICTED: probable copper-transporting ATPa...    121   3e-26    
dbj|BAJ93769.1|  predicted protein                                      120   4e-26    
gb|KCW51200.1|  hypothetical protein EUGRSUZ_J00786                     120   4e-26    
ref|XP_010031816.1|  PREDICTED: probable copper-transporting ATPa...    120   4e-26    
gb|ETE72446.1|  Copper-transporting ATPase 2                            120   5e-26    
ref|XP_002299234.1|  hypothetical protein POPTR_0001s05650g             120   6e-26    
gb|KEH18115.1|  heavy metal P-type ATPase                               120   6e-26    
ref|XP_003231925.1|  copper-transporting ATPase                         120   6e-26    
gb|EZF77853.1|  hypothetical protein H105_01131                         120   6e-26    
gb|AFM38007.1|  heavy metal ATPase 5                                    120   7e-26    
ref|XP_009119815.1|  PREDICTED: probable copper-transporting ATPa...    120   8e-26    
gb|AFM38009.1|  HMA5-2                                                  116   8e-26    
gb|KDO76167.1|  hypothetical protein CISIN_1g0397761mg                  118   8e-26    
ref|XP_011037825.1|  PREDICTED: probable copper-transporting ATPa...    119   8e-26    
ref|XP_009391888.1|  PREDICTED: probable copper-transporting ATPa...    119   9e-26    
ref|XP_008787562.1|  PREDICTED: probable copper-transporting ATPa...    118   9e-26    
ref|XP_006010895.1|  PREDICTED: copper-transporting ATPase 2            120   1e-25    
ref|XP_003626948.1|  Heavy metal ATPase                                 119   1e-25    
gb|EZF33906.1|  hypothetical protein H101_02545                         119   1e-25    
ref|XP_008711095.1|  hypothetical protein HMPREF1541_00567              119   1e-25    
gb|AAA16173.1|  Wilson disease-associated protein                       115   1e-25    
ref|XP_003177614.1|  copper-transporting ATPase 2                       119   1e-25    
ref|XP_006820395.1|  PREDICTED: LOW QUALITY PROTEIN: copper-trans...    119   1e-25    
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    119   2e-25    
gb|KIY99573.1|  Cu2+-exporting ATPase                                   116   2e-25    
ref|XP_004298734.1|  PREDICTED: probable copper-transporting ATPa...    118   3e-25    
ref|XP_010257289.1|  PREDICTED: probable copper-transporting ATPa...    117   4e-25    
gb|EMT26518.1|  Putative copper-transporting ATPase 3                   117   4e-25    
ref|XP_005647072.1|  copper-translocating P-t                           117   4e-25    
ref|XP_004054589.1|  PREDICTED: copper-transporting ATPase 2 isof...    118   4e-25    
ref|XP_004054590.1|  PREDICTED: copper-transporting ATPase 2 isof...    118   4e-25    
ref|XP_007134155.1|  hypothetical protein PHAVU_010G023900g             117   4e-25    
ref|XP_004054588.1|  PREDICTED: copper-transporting ATPase 2 isof...    118   4e-25    
ref|XP_004054587.1|  PREDICTED: copper-transporting ATPase 2 isof...    118   4e-25    
gb|EGE00321.1|  copper-transporting ATPase                              117   5e-25    
ref|XP_005633880.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   5e-25    
ref|XP_005633883.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   5e-25    
ref|XP_005633882.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   5e-25    
ref|XP_005633879.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   5e-25    
ref|XP_009425260.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   6e-25    
ref|XP_005633881.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   6e-25    
ref|XP_011240421.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   6e-25    
gb|ABM63504.1|  copper-transporting ATPase variant                      117   6e-25    
ref|NP_001020438.1|  copper-transporting ATPase 2                       117   6e-25    
ref|XP_005633885.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   6e-25    
ref|XP_005633884.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   6e-25    
emb|CDY49160.1|  BnaA10g06240D                                          117   6e-25    
ref|XP_005330277.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   7e-25    
ref|XP_010257290.1|  PREDICTED: probable copper-transporting ATPa...    117   7e-25    
ref|XP_005330275.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   7e-25    
ref|XP_005330276.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   8e-25    
ref|XP_005330274.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   8e-25    
ref|XP_004844187.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   8e-25    
ref|XP_006253408.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   8e-25    
ref|XP_009860869.1|  PREDICTED: copper-transporting ATPase 2            117   8e-25    
ref|NP_036643.2|  copper-transporting ATPase 2                          117   8e-25    
ref|XP_004900660.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   8e-25    
gb|EDM08982.1|  ATPase, Cu++ transporting, beta polypeptide, isof...    117   9e-25    
ref|XP_004844189.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   9e-25    
ref|XP_002564469.1|  Pc22g04310                                         117   9e-25    
ref|XP_004844191.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   9e-25    
ref|XP_004900662.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   9e-25    
dbj|BAA84774.1|  ATPase 7B                                              117   9e-25    
sp|Q64535.1|ATP7B_RAT  RecName: Full=Copper-transporting ATPase 2...    117   9e-25    
gb|EPS64278.1|  hypothetical protein M569_10504                         109   9e-25    
ref|XP_004844190.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   9e-25    
ref|XP_004900663.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   9e-25    
ref|XP_004900664.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   9e-25    
ref|XP_006509070.1|  PREDICTED: copper-transporting ATPase 2 isof...    117   1e-24    
ref|XP_009346547.1|  PREDICTED: probable copper-transporting ATPa...    116   1e-24    
ref|XP_009355182.1|  PREDICTED: probable copper-transporting ATPa...    116   1e-24    
gb|AAC52852.1|  copper-transporting P-type ATPase                       116   1e-24    
ref|XP_004577555.1|  PREDICTED: copper-transporting ATPase 2            116   1e-24    
ref|NP_031537.2|  copper-transporting ATPase 2                          116   1e-24    
ref|XP_004660097.1|  PREDICTED: copper-transporting ATPase 2            116   1e-24    
ref|XP_010336209.1|  PREDICTED: copper-transporting ATPase 2 isof...    116   1e-24    
ref|XP_003927227.1|  PREDICTED: copper-transporting ATPase 2 isof...    116   1e-24    
ref|XP_010336210.1|  PREDICTED: copper-transporting ATPase 2 isof...    116   2e-24    
emb|CDY50396.1|  BnaC09g28870D                                          115   2e-24    
ref|XP_008020547.1|  hypothetical protein SETTUDRAFT_162017             115   2e-24    
ref|XP_005387668.1|  PREDICTED: copper-transporting ATPase 2 isof...    116   2e-24    
ref|XP_008195005.1|  PREDICTED: copper-transporting ATPase 1 isof...    115   2e-24    
ref|XP_003809840.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   2e-24    
ref|XP_008195007.1|  PREDICTED: copper-transporting ATPase 1 isof...    115   2e-24    
ref|XP_968455.2|  PREDICTED: copper-transporting ATPase 1 isoform X3    115   2e-24    
ref|XP_008960332.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   2e-24    
gb|EFA05612.1|  hypothetical protein TcasGA2_TC015818                   115   2e-24    
ref|XP_008195009.1|  PREDICTED: copper-transporting ATPase 1 isof...    115   2e-24    
ref|XP_008195010.1|  PREDICTED: copper-transporting ATPase 1 isof...    115   2e-24    
emb|CDS31916.1|  copper transporting ATPase 1                           115   2e-24    
ref|XP_008960333.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   2e-24    
ref|XP_009880666.1|  PREDICTED: copper-transporting ATPase 2            115   2e-24    
emb|CDW57367.1|  copper transporting atpase                             115   2e-24    
ref|XP_008195008.1|  PREDICTED: copper-transporting ATPase 1 isof...    115   2e-24    
ref|XP_008195006.1|  PREDICTED: copper-transporting ATPase 1 isof...    115   2e-24    
ref|XP_001945540.1|  PREDICTED: copper-transporting ATPase 1 isof...    115   3e-24    
ref|XP_008180819.1|  PREDICTED: copper-transporting ATPase 1 isof...    115   3e-24    
ref|XP_008180818.1|  PREDICTED: copper-transporting ATPase 1 isof...    115   3e-24    
ref|XP_011533423.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   3e-24    
ref|XP_005387669.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   3e-24    
ref|XP_011589357.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   3e-24    
ref|XP_006822362.1|  PREDICTED: copper-transporting ATPase 1-like       115   3e-24    
ref|XP_005585951.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   3e-24    
ref|XP_011844136.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   3e-24    
ref|XP_011589356.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   3e-24    
ref|XP_001103242.2|  PREDICTED: copper-transporting ATPase 2            115   3e-24    
ref|NP_001230111.1|  copper-transporting ATPase 2 isoform c             115   4e-24    
ref|XP_005087693.1|  PREDICTED: copper-transporting ATPase 2            115   4e-24    
ref|XP_011844138.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_011794340.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_007943423.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_011589358.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
gb|AAI43974.1|  ATP7B protein                                           115   4e-24    
ref|XP_005585944.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_011754956.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
gb|AAY41166.1|  Wilson's disease protein                                115   4e-24    
ref|XP_005585952.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
gb|EYE92756.1|  putative copper-transporting ATPase                     115   4e-24    
ref|NP_000044.2|  copper-transporting ATPase 2 isoform a                115   4e-24    
ref|XP_011533421.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_011754959.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_011533424.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   4e-24    
gb|AAA92667.1|  copper transporting ATPase                              115   4e-24    
ref|XP_005585946.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_007943425.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_011844135.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_011589360.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_011754960.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_011754963.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
gb|AAB52902.1|  ATP7B                                                   115   4e-24    
ref|XP_004619601.1|  PREDICTED: copper-transporting ATPase 2-like       115   4e-24    
ref|XP_011844134.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_007943421.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_007943422.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_007943420.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_005266488.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   4e-24    
ref|XP_010351222.1|  PREDICTED: copper-transporting ATPase 2            115   4e-24    
ref|XP_005585949.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   5e-24    
ref|XP_005266480.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   5e-24    
gb|EHH29027.1|  hypothetical protein EGK_09337                          115   5e-24    
ref|XP_011533420.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   5e-24    
ref|XP_007943424.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   5e-24    
ref|XP_011794355.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   5e-24    
ref|XP_010184821.1|  PREDICTED: copper-transporting ATPase 2            115   5e-24    
ref|XP_011844137.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   5e-24    
ref|XP_005266484.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   5e-24    
gb|KFQ27468.1|  Copper-transporting ATPase 2                            114   5e-24    
ref|XP_011794322.1|  PREDICTED: copper-transporting ATPase 2 isof...    115   5e-24    
gb|AAI43977.1|  ATP7B protein                                           114   5e-24    
ref|XP_005585948.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   5e-24    
gb|KGL91128.1|  Copper-transporting ATPase 2                            114   5e-24    
gb|KFW00040.1|  Copper-transporting ATPase 2                            114   5e-24    
gb|EAX08893.1|  ATPase, Cu++ transporting, beta polypeptide, isof...    114   5e-24    
ref|XP_003270167.2|  PREDICTED: LOW QUALITY PROTEIN: copper-trans...    114   5e-24    
gb|AAI43976.1|  ATP7B protein                                           114   5e-24    
ref|XP_011794349.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   5e-24    
ref|XP_008272090.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   5e-24    
ref|XP_008272095.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   5e-24    
gb|EAX08892.1|  ATPase, Cu++ transporting, beta polypeptide, isof...    114   5e-24    
ref|XP_008272091.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   5e-24    
ref|XP_011920046.1|  PREDICTED: copper-transporting ATPase 2            114   5e-24    
ref|XP_006997836.1|  PREDICTED: copper-transporting ATPase 2            114   5e-24    
ref|XP_011794331.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   5e-24    
ref|WP_029765058.1|  hypothetical protein                               108   6e-24    
ref|XP_008989520.1|  PREDICTED: copper-transporting ATPase 2            114   6e-24    
gb|EMD85524.1|  hypothetical protein COCHEDRAFT_1148602                 114   6e-24    
gb|EPE03548.1|  heavy metal translocating p-type atpase                 114   6e-24    
ref|XP_007704467.1|  hypothetical protein COCSADRAFT_40711              114   6e-24    
ref|XP_011661047.1|  PREDICTED: copper-transporting ATPase 2            114   6e-24    
gb|KFO28058.1|  Copper-transporting ATPase 2                            114   6e-24    
ref|XP_008705112.1|  PREDICTED: copper-transporting ATPase 2            114   6e-24    
ref|XP_003018671.1|  hypothetical protein TRV_07303                     114   6e-24    
gb|EIE89269.1|  hypothetical protein RO3G_13980                         114   7e-24    
gb|KFP84549.1|  Copper-transporting ATPase 2                            114   7e-24    
ref|XP_010581656.1|  PREDICTED: copper-transporting ATPase 2            114   7e-24    
gb|EPB81020.1|  hypothetical protein HMPREF1544_12288                   114   7e-24    
ref|XP_008845578.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   7e-24    
ref|XP_009077135.1|  PREDICTED: copper-transporting ATPase 2            114   7e-24    
ref|XP_009190218.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   7e-24    
ref|XP_010634918.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   7e-24    
ref|XP_008845581.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   8e-24    
gb|EMC87699.1|  Copper-transporting ATPase 2                            114   8e-24    
ref|XP_003913955.2|  PREDICTED: copper-transporting ATPase 2 isof...    114   8e-24    
emb|CDS02998.1|  hypothetical protein LRAMOSA00400                      114   8e-24    
ref|XP_007926234.1|  hypothetical protein MYCFIDRAFT_153563             114   8e-24    
ref|XP_005501904.1|  PREDICTED: copper-transporting ATPase 2            114   8e-24    
ref|XP_009190219.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   8e-24    
ref|XP_004680291.1|  PREDICTED: copper-transporting ATPase 2            114   8e-24    
ref|XP_005387670.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   8e-24    
gb|KIX07826.1|  hypothetical protein Z518_02480                         114   8e-24    
ref|XP_006879581.1|  PREDICTED: copper-transporting ATPase 2            114   9e-24    
ref|XP_003013713.1|  hypothetical protein ARB_00164                     114   9e-24    
gb|KIW15032.1|  hypothetical protein PV08_07819                         114   9e-24    
ref|XP_001378265.3|  PREDICTED: copper-transporting ATPase 2 isof...    114   9e-24    
ref|XP_010634919.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   1e-23    
ref|XP_005802637.1|  PREDICTED: LOW QUALITY PROTEIN: copper-trans...    114   1e-23    
gb|KFQ62929.1|  Copper-transporting ATPase 2                            114   1e-23    
ref|XP_007495453.1|  PREDICTED: copper-transporting ATPase 2 isof...    114   1e-23    
ref|XP_002917723.2|  PREDICTED: copper-transporting ATPase 2            114   1e-23    
ref|XP_596258.3|  PREDICTED: copper-transporting ATPase 2 isoform X1    114   1e-23    
ref|XP_011478581.1|  PREDICTED: copper-transporting ATPase 1            113   1e-23    
ref|XP_008322771.1|  PREDICTED: copper-transporting ATPase 2-like       113   1e-23    
ref|XP_007495454.1|  PREDICTED: copper-transporting ATPase 2 isof...    113   1e-23    
ref|XP_002383265.1|  copper-transporting ATPase, putative               113   1e-23    
ref|XP_001816808.1|  copper-transporting ATPase                         113   1e-23    
ref|XP_010833968.1|  PREDICTED: copper-transporting ATPase 2            113   1e-23    
ref|XP_007193764.1|  PREDICTED: copper-transporting ATPase 2 isof...    113   1e-23    
ref|XP_007193765.1|  PREDICTED: copper-transporting ATPase 2 isof...    113   1e-23    
gb|KFQ04599.1|  Copper-transporting ATPase 2                            113   1e-23    
gb|ELR46693.1|  Copper-transporting ATPase 2                            113   1e-23    
gb|EFB21852.1|  hypothetical protein PANDA_006078                       113   1e-23    



>ref|XP_009602509.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=990

 Score =   452 bits (1164),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 223/290 (77%), Positives = 249/290 (86%), Gaps = 8/290 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENS--GENLRRIQVRVTGMTCAAC  385
             M+PSMRDVQ+T   G+      G  EEVRLLDSYDEE    GENLRRIQVRVTGMTCAAC
Sbjct  1     MAPSMRDVQLTEVAGD------GAGEEVRLLDSYDEEEEKLGENLRRIQVRVTGMTCAAC  54

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVEGALMS+NGVVKA+VALLQNKADV+FDP +VKD +I NAIEDAGFEAE+L+EP AS
Sbjct  55    SNSVEGALMSINGVVKATVALLQNKADVIFDPSLVKDDEITNAIEDAGFEAELLSEPTAS  114

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
               N +GTV GQF+IGGMTCAACVNSVEGIL  LPGV++AVVALATS+GEV YDP++ISK+
Sbjct  115   RTNPHGTVVGQFIIGGMTCAACVNSVEGILKQLPGVRKAVVALATSLGEVGYDPSIISKD  174

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DI NAIEDAGFE S +QSS QDKI+LGVVGISG+MD QLLEGILSKLHGV+HF ++  S 
Sbjct  175   DIANAIEDAGFESSFVQSSEQDKIVLGVVGISGEMDAQLLEGILSKLHGVKHFLFDRVSS  234

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEVVFDPEVLGSRSVVDG+ GGS GKF L VKNPYTRMASRD+EESS M
Sbjct  235   ELEVVFDPEVLGSRSVVDGVEGGSSGKFKLLVKNPYTRMASRDLEESSKM  284



>ref|XP_004233259.1| PREDICTED: copper-transporting ATPase RAN1 [Solanum lycopersicum]
Length=1003

 Score =   450 bits (1157),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 253/295 (86%), Gaps = 7/295 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSS---EEDF-GDCEEVRLLDSYDEENSG---ENLRRIQVRVTGM  370
             M+PSMRDVQ+T T  +SS   E+D  G  EEVRLLDSYDE N     ENLRRIQVRVTGM
Sbjct  1     MAPSMRDVQLTVTGKSSSAAAEDDIDGSGEEVRLLDSYDEVNLDKLDENLRRIQVRVTGM  60

Query  371   TCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLA  550
             TCAACSTSVEGALM +NGVVKASVALLQNKADVVFDP +VKD+DI NAIEDAGFEAE+L+
Sbjct  61    TCAACSTSVEGALMGVNGVVKASVALLQNKADVVFDPTLVKDEDITNAIEDAGFEAELLS  120

Query  551   EPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPT  730
             EP ASH N +GTV GQF IGGMTCAACVNSVEGIL +LPGV++AVVALATS+GEVEYD T
Sbjct  121   EPAASHTNPHGTVVGQFTIGGMTCAACVNSVEGILKNLPGVRKAVVALATSLGEVEYDST  180

Query  731   VISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFY  910
             +ISK+DI NAIEDAGFE S +QSS QDKI+LGV+GISG+MD Q LEGILSKLHGV+ F +
Sbjct  181   IISKDDIANAIEDAGFEASFVQSSEQDKIVLGVIGISGEMDAQFLEGILSKLHGVKQFCF  240

Query  911   NPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             +  S ELEVVFDPEV+GSRS+VDGI GGS GKF L VKNPYTRMASRD+EESS M
Sbjct  241   DRVSSELEVVFDPEVIGSRSLVDGIEGGSSGKFKLVVKNPYTRMASRDLEESSRM  295



>ref|XP_006364991.1| PREDICTED: copper-transporting ATPase RAN1-like [Solanum tuberosum]
Length=1002

 Score =   443 bits (1140),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 224/294 (76%), Positives = 250/294 (85%), Gaps = 6/294 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDF---GDCEEVRLLDSYDEENS---GENLRRIQVRVTGMT  373
             M+PSMRDVQ+T T  +SS  D    G  EEVRLLDSYDE N    GENLRRIQVRVTGMT
Sbjct  1     MAPSMRDVQLTVTGKSSSAADDDIDGAGEEVRLLDSYDEVNLDKLGENLRRIQVRVTGMT  60

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACSTSVEGALM +NGVVKASVALLQNKADVVFDP +VKD++I NAIEDAGFEAE+L+E
Sbjct  61    CAACSTSVEGALMGVNGVVKASVALLQNKADVVFDPSLVKDEEIINAIEDAGFEAELLSE  120

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             P AS  N +GTV GQF IGGMTCAACVNSVEGIL +LPGV++AVVALATS+GEVEYD ++
Sbjct  121   PAASRTNPHGTVVGQFTIGGMTCAACVNSVEGILKNLPGVRKAVVALATSLGEVEYDSSI  180

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             ISK+DI NAIEDAGFE S +QSS QDKI+LGVVGISG+MD Q LEGILSKLHGV+ F ++
Sbjct  181   ISKDDIANAIEDAGFEASFVQSSEQDKIVLGVVGISGEMDAQFLEGILSKLHGVKQFCFD  240

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               S ELEVVFDPEV+GSRS+VDGI GGS GKF L VKNPYTRM SRD+EESS M
Sbjct  241   RVSSELEVVFDPEVIGSRSLVDGIEGGSSGKFKLLVKNPYTRMTSRDLEESSRM  294



>ref|XP_009758015.1| PREDICTED: copper-transporting ATPase RAN1-like, partial [Nicotiana 
sylvestris]
Length=865

 Score =   434 bits (1117),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 215/286 (75%), Positives = 243/286 (85%), Gaps = 8/286 (3%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENS--GENLRRIQVRVTGMTCAACSTSV  397
             MRDVQ+T   G+      G  EEVRLLDSYDEE    G+NLRRIQVRVTGMTCAACS SV
Sbjct  1     MRDVQLTEVAGD------GAGEEVRLLDSYDEEEQKLGDNLRRIQVRVTGMTCAACSNSV  54

Query  398   EGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANT  577
             EGALMS+NGVVKA+VALLQNKADV+F P +VKD +I NAIEDAGFEAE+L+EP AS  N 
Sbjct  55    EGALMSINGVVKATVALLQNKADVIFYPSLVKDDEITNAIEDAGFEAELLSEPTASRTNP  114

Query  578   NGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVN  757
             +GTV GQF+IGGMTCAACVNSVEGIL  LPGV++AVVALATS+GEVEYDP++ISK+DI +
Sbjct  115   HGTVVGQFIIGGMTCAACVNSVEGILKQLPGVRKAVVALATSLGEVEYDPSIISKDDIAS  174

Query  758   AIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEV  937
             AIEDAGFE S +QSS QDKI+LGVVGISG+MD QLLEGILSKLHGV+HF ++  S EL V
Sbjct  175   AIEDAGFEASFVQSSEQDKIVLGVVGISGEMDAQLLEGILSKLHGVKHFLFDRVSCELGV  234

Query  938   VFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             VFDPEVLG RS+VDG+ GGS GKF L VKNPYTRMASRD+EESS M
Sbjct  235   VFDPEVLGPRSLVDGVEGGSSGKFKLLVKNPYTRMASRDLEESSKM  280



>ref|XP_009597621.1| PREDICTED: copper-transporting ATPase RAN1-like [Nicotiana tomentosiformis]
Length=992

 Score =   432 bits (1112),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 247/291 (85%), Gaps = 10/291 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENS---GENLRRIQVRVTGMTCAA  382
             M+P+M DVQ+TA          G  EEVRLLD+YDEENS    +NLRRIQVRV+GMTCAA
Sbjct  1     MAPTMSDVQLTAAGD-------GAFEEVRLLDAYDEENSDKLNDNLRRIQVRVSGMTCAA  53

Query  383   CSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNA  562
             CS SVE ALM +NGV KASVALLQNKADV+FDP++VKD++I+ AIEDA FE E+L EP+A
Sbjct  54    CSNSVEQALMGINGVFKASVALLQNKADVIFDPNLVKDEEIKIAIEDARFETELLEEPSA  113

Query  563   SHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISK  742
             S  N +GTV GQFMIGGMTCAACVNSVEGIL  LPGV++AVVALATS+GEVEYDP++ISK
Sbjct  114   SCTNQHGTVVGQFMIGGMTCAACVNSVEGILRKLPGVRKAVVALATSLGEVEYDPSIISK  173

Query  743   NDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTS  922
             +DIVNA+EDAGFE S  QSS QDKI+LGVVG+S +MD QLLEGILSKLHGV+ F+++  S
Sbjct  174   DDIVNAVEDAGFEASFAQSSEQDKIVLGVVGVSAEMDTQLLEGILSKLHGVKQFYFDRIS  233

Query  923   RELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             RELEVVFDPEVLGSRS+VDGI GGSGGKF L VKNPYTR+AS D+EESSSM
Sbjct  234   RELEVVFDPEVLGSRSLVDGIEGGSGGKFKLLVKNPYTRIASGDLEESSSM  284



>ref|XP_009757686.1| PREDICTED: copper-transporting ATPase RAN1 [Nicotiana sylvestris]
Length=992

 Score =   432 bits (1111),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 250/291 (86%), Gaps = 10/291 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGE---NLRRIQVRVTGMTCAA  382
             M+P+MRDVQ+TA          G  EEVRLLD+YDEE+S +   NLRRIQVRV+GMTCAA
Sbjct  1     MAPTMRDVQLTAAGD-------GAFEEVRLLDAYDEEDSDKLNGNLRRIQVRVSGMTCAA  53

Query  383   CSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNA  562
             CS SVE ALM +NGV +ASVALLQNKADVVFDP++VKD++I+ AIEDAGF+AEVL EP+A
Sbjct  54    CSNSVEQALMGVNGVFRASVALLQNKADVVFDPNLVKDEEIKIAIEDAGFKAEVLEEPSA  113

Query  563   SHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISK  742
             S  + +GTV GQF IGGMTCAACVNSVEGIL  LPGV++AVVALATS+GEVEYDP++ISK
Sbjct  114   SCTSQHGTVLGQFTIGGMTCAACVNSVEGILRKLPGVRKAVVALATSLGEVEYDPSIISK  173

Query  743   NDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTS  922
             +DIVNA+EDAGFE S +QSS QDKI+LGVVG+S +MD QLLEGILSKLHGV+ F+++  S
Sbjct  174   DDIVNAVEDAGFEASFVQSSEQDKIVLGVVGVSAEMDTQLLEGILSKLHGVKQFYFDRIS  233

Query  923   RELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             RELEVVFDPEVLGSRS+VDGI GGSGGKF L VKNPYTR+AS D+EESSSM
Sbjct  234   RELEVVFDPEVLGSRSLVDGIEGGSGGKFKLLVKNPYTRIASGDLEESSSM  284



>ref|XP_007041035.1| Copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting 
ATPase (RAN1) isoform 2 [Theobroma cacao]
 gb|EOX96866.1| Copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting 
ATPase (RAN1) isoform 2 [Theobroma cacao]
Length=873

 Score =   407 bits (1047),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 207/298 (69%), Positives = 244/298 (82%), Gaps = 10/298 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN----SSEEDFGDCEE-VRLLDSYDE--ENSG---ENLRRIQVRV  361
             MSP+MRD+Q+T   G      S+ D  D EE  RLLDSYD+  +NSG   E +RRIQV V
Sbjct  1     MSPTMRDLQLTQVAGGRRSPPSDNDSVDMEEGTRLLDSYDDGDDNSGSIQEGMRRIQVSV  60

Query  362   TGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAE  541
             TGMTCAACS SVEGAL S+NGV +ASVALLQN+ADVVFDP +VKD+DI+NAIEDAGFEAE
Sbjct  61    TGMTCAACSNSVEGALKSINGVCRASVALLQNRADVVFDPILVKDEDIKNAIEDAGFEAE  120

Query  542   VLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEY  721
             +L EP+ +     GT+ GQF IGGMTCAACVNS+EGIL +LPGVKRAVVALATS+GEVEY
Sbjct  121   ILPEPSNAGTKPRGTLVGQFTIGGMTCAACVNSIEGILRNLPGVKRAVVALATSLGEVEY  180

Query  722   DPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRH  901
             DPTVISK+DIVNAIEDAGFE SL+QSS Q+KIILGV G+   +D+QLLEGILS L GVR 
Sbjct  181   DPTVISKDDIVNAIEDAGFEASLVQSSEQNKIILGVAGVINDLDLQLLEGILSSLKGVRQ  240

Query  902   FFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             + ++ TS ELEV+FDPEV+ SRS+VDGI GGSGGKF LHV NPY RM ++D+EE+S+M
Sbjct  241   YRFDRTSGELEVLFDPEVVSSRSLVDGIEGGSGGKFKLHVTNPYARMTTKDVEETSNM  298



>ref|XP_007041034.1| Copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting 
ATPase (RAN1) isoform 1 [Theobroma cacao]
 gb|EOX96865.1| Copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting 
ATPase (RAN1) isoform 1 [Theobroma cacao]
Length=1019

 Score =   409 bits (1051),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 207/298 (69%), Positives = 244/298 (82%), Gaps = 10/298 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN----SSEEDFGDCEE-VRLLDSYDE--ENSG---ENLRRIQVRV  361
             MSP+MRD+Q+T   G      S+ D  D EE  RLLDSYD+  +NSG   E +RRIQV V
Sbjct  1     MSPTMRDLQLTQVAGGRRSPPSDNDSVDMEEGTRLLDSYDDGDDNSGSIQEGMRRIQVSV  60

Query  362   TGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAE  541
             TGMTCAACS SVEGAL S+NGV +ASVALLQN+ADVVFDP +VKD+DI+NAIEDAGFEAE
Sbjct  61    TGMTCAACSNSVEGALKSINGVCRASVALLQNRADVVFDPILVKDEDIKNAIEDAGFEAE  120

Query  542   VLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEY  721
             +L EP+ +     GT+ GQF IGGMTCAACVNS+EGIL +LPGVKRAVVALATS+GEVEY
Sbjct  121   ILPEPSNAGTKPRGTLVGQFTIGGMTCAACVNSIEGILRNLPGVKRAVVALATSLGEVEY  180

Query  722   DPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRH  901
             DPTVISK+DIVNAIEDAGFE SL+QSS Q+KIILGV G+   +D+QLLEGILS L GVR 
Sbjct  181   DPTVISKDDIVNAIEDAGFEASLVQSSEQNKIILGVAGVINDLDLQLLEGILSSLKGVRQ  240

Query  902   FFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             + ++ TS ELEV+FDPEV+ SRS+VDGI GGSGGKF LHV NPY RM ++D+EE+S+M
Sbjct  241   YRFDRTSGELEVLFDPEVVSSRSLVDGIEGGSGGKFKLHVTNPYARMTTKDVEETSNM  298



>ref|XP_012084564.1| PREDICTED: copper-transporting ATPase RAN1 isoform X1 [Jatropha 
curcas]
 gb|KDP27411.1| hypothetical protein JCGZ_20239 [Jatropha curcas]
Length=1011

 Score =   404 bits (1039),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 202/303 (67%), Positives = 238/303 (79%), Gaps = 15/303 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNS-------SEEDFGDCEEVRLLDSYDEENSG--------ENLRR  346
             MSPS+RD+Q+T   G         +E+D GD E+VRLLDS+++ N          E +RR
Sbjct  1     MSPSLRDLQLTPVAGGRKSRPAIVAEDDAGDLEDVRLLDSFEDSNDSHTITIDDEEGMRR  60

Query  347   IQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDA  526
             IQVRVTGMTCAACS SVE AL S+NGV++ASVALLQNKADVVFDP +VKD DI+NAIEDA
Sbjct  61    IQVRVTGMTCAACSNSVESALQSVNGVLRASVALLQNKADVVFDPSLVKDDDIKNAIEDA  120

Query  527   GFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSV  706
             GFEAE+L+EP+      N T+ G F IGGMTCAACVNSVEGIL  LPGV+RAVVALATS+
Sbjct  121   GFEAEILSEPSTFKTKLNKTLLGHFTIGGMTCAACVNSVEGILRDLPGVRRAVVALATSL  180

Query  707   GEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKL  886
             GEVEYDPTVISK+DIVNAIEDAGF+ SL+QS+ QDKIILGV GI  +MD Q+LEGI+S L
Sbjct  181   GEVEYDPTVISKDDIVNAIEDAGFDASLVQSNQQDKIILGVAGIFTEMDAQVLEGIISTL  240

Query  887   HGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEES  1066
              GVR F YN  S ELEV FDPEV+ SRS+VDGI  GS G+F LHV +PY RM S+D+EE+
Sbjct  241   TGVRQFRYNRMSNELEVHFDPEVISSRSLVDGIEEGSSGRFKLHVMHPYARMTSKDVEET  300

Query  1067  SSM  1075
             S+M
Sbjct  301   STM  303



>ref|XP_002276004.2| PREDICTED: copper-transporting ATPase RAN1 [Vitis vinifera]
 emb|CAN69730.1| hypothetical protein VITISV_011925 [Vitis vinifera]
Length=1000

 Score =   397 bits (1021),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 198/294 (67%), Positives = 241/294 (82%), Gaps = 8/294 (3%)
 Frame = +2

Query  212   MSPSMRDVQMT--ATNGNSS--EEDFGDCEEVRLLDSYDEENSG--ENLRRIQVRVTGMT  373
             M+PS   +Q+T  ++ G  +  ++D GD E+VRLLD+Y E++SG  E +R IQVRVTGMT
Sbjct  1     MAPSFGGLQLTPFSSGGRKTLPDDDAGDLEDVRLLDAYKEDDSGLEEGMRGIQVRVTGMT  60

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACS SVEGAL  +NGV++ASVALLQN+ADVVFDP +V ++DI+NAIEDAGF+AE+++E
Sbjct  61    CAACSNSVEGALRDVNGVLRASVALLQNRADVVFDPKLVGEEDIKNAIEDAGFDAEIMSE  120

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             P  S    +GT+ GQF IGGMTCA CVNSVEGIL  LPGVKRAVVALATS+GEVEYDPT+
Sbjct  121   P--SRTKPHGTLLGQFTIGGMTCAVCVNSVEGILRKLPGVKRAVVALATSLGEVEYDPTI  178

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             ISK+DIVNAIEDAGFE S +QSS QDKIILGV GIS +MD  +LEGIL+ + GVR F ++
Sbjct  179   ISKDDIVNAIEDAGFEASFVQSSEQDKIILGVTGISNEMDALILEGILTSIRGVRQFLFD  238

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              T  ELEV+FDPEV+ SRS+VDGI GGS  KF LHVKNPYTRM S+D+EESS+M
Sbjct  239   RTLGELEVLFDPEVISSRSLVDGIEGGSNAKFKLHVKNPYTRMTSKDLEESSNM  292



>ref|XP_006280099.1| hypothetical protein CARUB_v10025986mg [Capsella rubella]
 gb|EOA12997.1| hypothetical protein CARUB_v10025986mg [Capsella rubella]
Length=704

 Score =   389 bits (998),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 236/297 (79%), Gaps = 10/297 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--------EENSGEN-LRRIQVRVT  364
             M+PS RD+Q+T   G S  E  GD EEVRLLDSYD        EE  GE+ LR+IQV +T
Sbjct  1     MAPSRRDLQLTPVTGGSPFE-IGDTEEVRLLDSYDDEDVWSKIEEGGGESGLRKIQVGIT  59

Query  365   GMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEV  544
             GMTCAACS SVEGALMS+NGV KASVALLQN+ADVVFDP +VK++DI+ AIEDAGFEAE+
Sbjct  60    GMTCAACSNSVEGALMSVNGVFKASVALLQNRADVVFDPTLVKEEDIKEAIEDAGFEAEI  119

Query  545   LAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYD  724
             LAEP  +   T GT+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYD
Sbjct  120   LAEPVTTGTKTQGTLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLGEVEYD  179

Query  725   PTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHF  904
             P VI+K++IV AIEDAGFEGSL+QS+ QDK+IL V GI G++D Q+LEGIL++L+GVR F
Sbjct  180   PNVINKDEIVTAIEDAGFEGSLVQSNQQDKLILRVEGILGELDAQVLEGILTRLNGVRSF  239

Query  905   FYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               +  S ELEVVFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+S+M
Sbjct  240   RLDKISGELEVVFDPEVVSSRSLVDGIEGEGYGKFKLRVMSPYERLTSKDTGEASNM  296



>ref|XP_010087932.1| Copper-transporting ATPase RAN1 [Morus notabilis]
 gb|EXC35838.1| Copper-transporting ATPase RAN1 [Morus notabilis]
Length=999

 Score =   394 bits (1012),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 238/295 (81%), Gaps = 10/295 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGE-------NLRRIQVRVTGM  370
             M+P+ R +Q+T  +  S   D GD EEVRLLD+Y  ENS E        ++RIQV VTGM
Sbjct  1     MAPNSRSLQLTQLS-VSGAGDSGDLEEVRLLDAY--ENSEEEGVIGEGTMKRIQVGVTGM  57

Query  371   TCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLA  550
             TCAACS SVE ALMS++GV++ASVALLQNKADVVFDP +VKD+DI++AIEDAGFEAE+L 
Sbjct  58    TCAACSNSVEAALMSVHGVLRASVALLQNKADVVFDPRLVKDEDIKSAIEDAGFEAEILP  117

Query  551   EPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPT  730
             E +A      GT+SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP 
Sbjct  118   ESSAVGTKPQGTLSGQFSIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLGEVEYDPA  177

Query  731   VISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFY  910
             +ISK DIVNAIEDAGFEG+ +QSS QDKI+LGV GI   +D+QLL GILS L G+R F++
Sbjct  178   IISKEDIVNAIEDAGFEGAFLQSSEQDKIVLGVAGIYSDVDVQLLGGILSNLKGMRQFYF  237

Query  911   NPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             +  +RELEV+FDPEV+ SRS+VDGI GGS G+F LHV NPY+RM S+D+EE+S+M
Sbjct  238   DRITRELEVLFDPEVVNSRSLVDGIEGGSSGRFKLHVANPYSRMTSKDVEEASNM  292



>ref|XP_008225906.1| PREDICTED: copper-transporting ATPase RAN1 [Prunus mume]
Length=987

 Score =   394 bits (1011),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/296 (67%), Positives = 236/296 (80%), Gaps = 8/296 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEE-------DFGDCEEVRLLDSYD-EENSGENLRRIQVRVTG  367
             M+PS RD+Q+T  +  + +        DFGD E+VRLLDSYD  E   + ++R+QVRV+G
Sbjct  1     MAPSPRDLQLTQVSLGARKLPEMVAGGDFGDLEDVRLLDSYDNSEGVEQGMQRVQVRVSG  60

Query  368   MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
             MTCAACS SVEGAL S+NGV+ ASVALLQN+ADVVFDP +VKD+DI+NAIEDAGFEAEV+
Sbjct  61    MTCAACSNSVEGALKSVNGVLTASVALLQNRADVVFDPRLVKDEDIKNAIEDAGFEAEVI  120

Query  548   AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
              E + +    +GT+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP
Sbjct  121   PEQSTNGIKQHGTLLGQFSIGGMTCAACVNSVEGILKGLPGVKRAVVALATSLGEVEYDP  180

Query  728   TVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFF  907
             TVISK+DIVNAIEDAGFE SL+QSS QDKIILGV G+  + D Q LE I+S L GVRHF 
Sbjct  181   TVISKDDIVNAIEDAGFEASLVQSSQQDKIILGVAGVFSETDAQTLEAIISNLKGVRHFR  240

Query  908   YNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ++  SRELE++FDPEV+ SRSVVDGI G S  KF L V NPYTRM S+D+ E+++M
Sbjct  241   FDRISRELEILFDPEVVTSRSVVDGIEGASNEKFKLQVANPYTRMTSKDVAEAANM  296



>ref|XP_002523662.1| copper-transporting atpase p-type, putative [Ricinus communis]
 gb|EEF38748.1| copper-transporting atpase p-type, putative [Ricinus communis]
Length=1001

 Score =   394 bits (1011),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 206/307 (67%), Positives = 232/307 (76%), Gaps = 19/307 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSS-----EEDFGDCEEVRLLDSYDEENSGE--------------  334
             MSPS+RD+Q+T     S      + D G  E+VRLLDSYD  +                 
Sbjct  1     MSPSIRDLQLTQVARQSRPSIDDDNDDGYLEDVRLLDSYDHYDDHRIVIGEEEEEGQVEQ  60

Query  335   NLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENA  514
              +RRIQVRV GMTCAACS SVE AL  +NGV++ASVALLQNKADVVFDP +VKD DI+NA
Sbjct  61    GMRRIQVRVGGMTCAACSNSVESALGCVNGVLRASVALLQNKADVVFDPSLVKDDDIKNA  120

Query  515   IEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
             IEDAGFEAE+LAEP+   A  + T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVAL
Sbjct  121   IEDAGFEAEILAEPSTLEAKPSKTLLGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVAL  180

Query  695   ATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGI  874
             ATS+GEVEYDPTVISK+DIVNAIEDAGFEGSL+QS+ QDKIIL VVGI  +MD QLLEGI
Sbjct  181   ATSLGEVEYDPTVISKDDIVNAIEDAGFEGSLVQSNQQDKIILRVVGIFSEMDAQLLEGI  240

Query  875   LSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRD  1054
             LS L GVR F YN  S ELEV FD EV+GSR +VDGI G S GKF L V NPY RM S+D
Sbjct  241   LSTLKGVRQFRYNRMSSELEVEFDTEVIGSRLLVDGIEGASNGKFKLRVMNPYARMTSKD  300

Query  1055  IEESSSM  1075
             +EESS+M
Sbjct  301   VEESSTM  307



>ref|XP_007213700.1| hypothetical protein PRUPE_ppa000787mg [Prunus persica]
 gb|EMJ14899.1| hypothetical protein PRUPE_ppa000787mg [Prunus persica]
Length=854

 Score =   389 bits (1000),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 234/296 (79%), Gaps = 8/296 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEE-------DFGDCEEVRLLDSYD-EENSGENLRRIQVRVTG  367
             M+PS R +Q+T  +  + +        DFGD E+VRLLDSYD  E   +  +R+QVRV+G
Sbjct  1     MAPSPRGLQLTQVSPRARKLPEMVAGGDFGDLEDVRLLDSYDNSEGVEQGTQRVQVRVSG  60

Query  368   MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
             MTCAACS SVEGAL S+NGV+ ASVALLQN+ADVVFDP +VKD+DI+NAIEDAGFEAEV+
Sbjct  61    MTCAACSNSVEGALKSVNGVLTASVALLQNRADVVFDPRLVKDEDIKNAIEDAGFEAEVI  120

Query  548   AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
              E + +    +GT+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP
Sbjct  121   PEQSTNGIKQHGTLLGQFSIGGMTCAACVNSVEGILKGLPGVKRAVVALATSLGEVEYDP  180

Query  728   TVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFF  907
             TVISK+DIVNAIEDAGFE SL+QSS QDKIILGV G+  + D Q LE I+S L GVRHF 
Sbjct  181   TVISKDDIVNAIEDAGFEASLVQSSQQDKIILGVAGVFSETDAQTLESIISNLKGVRHFR  240

Query  908   YNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ++  SRELE++FDPEV+ SRSVVDGI G S  KF L V NPY RM S+D+EE+++M
Sbjct  241   FDRISRELEILFDPEVVTSRSVVDGIEGASNEKFKLQVANPYIRMTSKDVEEAANM  296



>ref|XP_009363247.1| PREDICTED: copper-transporting ATPase RAN1-like [Pyrus x bretschneideri]
 ref|XP_009363248.1| PREDICTED: copper-transporting ATPase RAN1-like [Pyrus x bretschneideri]
Length=1002

 Score =   393 bits (1009),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 234/294 (80%), Gaps = 6/294 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEE-----DFGDCEEVRLLDSYDEENSGE-NLRRIQVRVTGMT  373
             M+PS RD+Q+T  +  +        DFGD E VRLLDSY+     E  ++R+QVRV+GMT
Sbjct  1     MAPSPRDLQLTQVSARAPTSMVAAGDFGDLENVRLLDSYENSEGVEAGMKRVQVRVSGMT  60

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACS SVEGAL S+NGV+ ASVALLQN+ADVVFDP +VKD+DI+NAIEDAGFEAEV+ E
Sbjct  61    CAACSNSVEGALQSVNGVLTASVALLQNRADVVFDPRLVKDEDIKNAIEDAGFEAEVIPE  120

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             P+AS    +GT+SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP V
Sbjct  121   PSASGTKPHGTLSGQFSIGGMTCAACVNSVEGILKGLPGVKRAVVALATSLGEVEYDPLV  180

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             ISK++IVNAIEDAGF+ SL+QSS QDKI+LGV G+  +MD Q LE I+S L GVRHF  +
Sbjct  181   ISKDEIVNAIEDAGFDASLVQSSQQDKIVLGVAGVFSEMDAQTLEAIISTLKGVRHFHVD  240

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               SRELE++FDPE++ SRS+VD I   S  KF L V NPYTRM S+DI+E+S+M
Sbjct  241   RISRELEILFDPEIVTSRSLVDEIQESSNEKFKLQVANPYTRMTSKDIDEASNM  294



>gb|KDO77287.1| hypothetical protein CISIN_1g001896mg [Citrus sinensis]
Length=560

 Score =   377 bits (969),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 225/290 (78%), Gaps = 3/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--EENSGENLRRIQVRVTGMTCAAC  385
             M+ S RD+Q+T  NG  S  D  D E+  LL++YD  +E  G+ +RRIQV VTGMTCAAC
Sbjct  2     MALSNRDLQLTELNGGGSS-DGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMTCAAC  60

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVEGALM L GV KASVALLQNKADVVFDP +VKD+DI+NAIEDAGFEAE+LAE + S
Sbjct  61    SNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTS  120

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                  GT+ GQ+ IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPTVISK+
Sbjct  121   GPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTVISKD  180

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DI NAIEDAGFE S +QSS QDKI+L V G+  ++D   LEGILS   GVR F ++  S 
Sbjct  181   DIANAIEDAGFEASFVQSSGQDKILLQVTGVLCELDAHFLEGILSNFKGVRQFRFDKISG  240

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEV+FDPE L SRS+VDGI G S GKF + V NP+ RM SRD EE+S+M
Sbjct  241   ELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM  290



>ref|XP_009340295.1| PREDICTED: copper-transporting ATPase RAN1-like [Pyrus x bretschneideri]
Length=1002

 Score =   390 bits (1001),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 235/294 (80%), Gaps = 6/294 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEE-----DFGDCEEVRLLDSYDEENSGE-NLRRIQVRVTGMT  373
             M+PS RD+Q+T  +    +      DFGD E+VRLLDSY+     E  ++R+QVRV+GMT
Sbjct  1     MAPSPRDLQLTQVSARDRKSMVAAGDFGDSEDVRLLDSYENSEGVEAGMKRVQVRVSGMT  60

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACS SVEGAL S+NGV+ ASVALLQN+ADVVFDP +VKD+DI NAIEDAGF+AEV+ E
Sbjct  61    CAACSNSVEGALQSVNGVLTASVALLQNRADVVFDPRLVKDEDIMNAIEDAGFDAEVIPE  120

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             P+AS    +GT+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPT+
Sbjct  121   PSASGTKPHGTLLGQFSIGGMTCAACVNSVEGILKGLPGVKRAVVALATSLGEVEYDPTL  180

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             ISK+DIVNAIEDAGF+ SL+QSS QDKIILGV G+  +MD Q+LE I+  L GVRHF ++
Sbjct  181   ISKDDIVNAIEDAGFDASLVQSSEQDKIILGVAGVFSEMDAQMLEAIIINLKGVRHFRFD  240

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               S ELE++FDPEV+ SRS+VDGI+  S  KF L V NPYTRM S+DI E+S++
Sbjct  241   RISSELEILFDPEVVTSRSLVDGIHEASNEKFKLQVANPYTRMTSKDIGEASNI  294



>ref|XP_009353995.1| PREDICTED: copper-transporting ATPase RAN1-like [Pyrus x bretschneideri]
Length=1002

 Score =   389 bits (1000),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 235/294 (80%), Gaps = 6/294 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEE-----DFGDCEEVRLLDSYDEENSGE-NLRRIQVRVTGMT  373
             M+PS RD+Q+T  +    +      DFGD E+VRLLDSY+     E  ++R+QVRV+GMT
Sbjct  1     MAPSPRDLQLTQVSARDRKSMVGAGDFGDSEDVRLLDSYENSEGVEAGMKRVQVRVSGMT  60

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACS SVEGAL S+NGV+ ASVALLQN+ADVVFDP +VKD+DI NAIEDAGF+AEV+ E
Sbjct  61    CAACSNSVEGALQSVNGVLTASVALLQNRADVVFDPRLVKDEDIMNAIEDAGFDAEVIPE  120

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             P+AS    +GT+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPT+
Sbjct  121   PSASGTKPHGTLLGQFSIGGMTCAACVNSVEGILKGLPGVKRAVVALATSLGEVEYDPTL  180

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             ISK+DIVNAIEDAGF+ SL+QSS QDKIILGV G+  +MD Q+LE I+  L GVRHF ++
Sbjct  181   ISKDDIVNAIEDAGFDASLVQSSEQDKIILGVAGVFSEMDAQMLEAIIINLKGVRHFRFD  240

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               S ELE++FDPEV+ SRS+VDGI+  S  KF L V NPYTRM S+DI E+S++
Sbjct  241   RISSELEILFDPEVVTSRSLVDGIHEASNEKFKLQVANPYTRMTSKDIGEASNI  294



>ref|XP_007213701.1| hypothetical protein PRUPE_ppa000787mg [Prunus persica]
 gb|EMJ14900.1| hypothetical protein PRUPE_ppa000787mg [Prunus persica]
Length=1004

 Score =   389 bits (1000),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 234/296 (79%), Gaps = 8/296 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEE-------DFGDCEEVRLLDSYD-EENSGENLRRIQVRVTG  367
             M+PS R +Q+T  +  + +        DFGD E+VRLLDSYD  E   +  +R+QVRV+G
Sbjct  1     MAPSPRGLQLTQVSPRARKLPEMVAGGDFGDLEDVRLLDSYDNSEGVEQGTQRVQVRVSG  60

Query  368   MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
             MTCAACS SVEGAL S+NGV+ ASVALLQN+ADVVFDP +VKD+DI+NAIEDAGFEAEV+
Sbjct  61    MTCAACSNSVEGALKSVNGVLTASVALLQNRADVVFDPRLVKDEDIKNAIEDAGFEAEVI  120

Query  548   AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
              E + +    +GT+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP
Sbjct  121   PEQSTNGIKQHGTLLGQFSIGGMTCAACVNSVEGILKGLPGVKRAVVALATSLGEVEYDP  180

Query  728   TVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFF  907
             TVISK+DIVNAIEDAGFE SL+QSS QDKIILGV G+  + D Q LE I+S L GVRHF 
Sbjct  181   TVISKDDIVNAIEDAGFEASLVQSSQQDKIILGVAGVFSETDAQTLESIISNLKGVRHFR  240

Query  908   YNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ++  SRELE++FDPEV+ SRSVVDGI G S  KF L V NPY RM S+D+EE+++M
Sbjct  241   FDRISRELEILFDPEVVTSRSVVDGIEGASNEKFKLQVANPYIRMTSKDVEEAANM  296



>ref|XP_004293784.1| PREDICTED: copper-transporting ATPase RAN1 [Fragaria vesca subsp. 
vesca]
Length=999

 Score =   389 bits (998),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/292 (66%), Positives = 235/292 (80%), Gaps = 4/292 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEE-VRLLDSYDEENSG---ENLRRIQVRVTGMTCA  379
             M+PS+RD+Q+T  + +S+ +      E VRLLDSY++   G   E  RR+QVRVTGMTCA
Sbjct  1     MAPSLRDLQLTQLSKSSAGDGDDGDHEGVRLLDSYEKSGEGVEEEGTRRVQVRVTGMTCA  60

Query  380   ACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPN  559
             ACS SVEGAL S+NGV+ ASVALLQN+ADVVFD  +VKD+DI+NAIEDAGFEAEV+ +P+
Sbjct  61    ACSNSVEGALRSVNGVLTASVALLQNRADVVFDLRLVKDEDIKNAIEDAGFEAEVIPDPS  120

Query  560   ASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVIS  739
              +     GT++GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPTVIS
Sbjct  121   TNGVKQQGTLTGQFSIGGMTCAACVNSVEGILKGLPGVKRAVVALATSLGEVEYDPTVIS  180

Query  740   KNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPT  919
             K+DIVNAIEDAGFEGSL+QSS QDKIILGV G+  ++D Q+LE I+  L GVRHF  +  
Sbjct  181   KDDIVNAIEDAGFEGSLVQSSQQDKIILGVAGMFNEIDAQVLEAIICNLKGVRHFRLDRI  240

Query  920   SRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             SRELE++FDPEV+ SRS+VDGI G S GKF L V NPYTRM  +D +E+++M
Sbjct  241   SRELEILFDPEVVTSRSLVDGIEGASNGKFKLQVANPYTRMTCKDADEAANM  292



>emb|CDP18214.1| unnamed protein product [Coffea canephora]
Length=1003

 Score =   389 bits (998),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/294 (69%), Positives = 241/294 (82%), Gaps = 6/294 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEE---NSGE---NLRRIQVRVTGMT  373
             M+P  R++Q+TA    S+E+D G  EEVRLL+ Y EE   NS +   NLRRIQVRVTGMT
Sbjct  1     MAPGTRNLQLTAVRAASTEDDAGTGEEVRLLEEYLEEEVINSSKIPANLRRIQVRVTGMT  60

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACS SVE AL  L+GVVKASVALLQNKADVVFDP +VKD+DI+NA+EDAGFEAE++ E
Sbjct  61    CAACSNSVEAALSGLDGVVKASVALLQNKADVVFDPSLVKDEDIKNAVEDAGFEAEIIPE  120

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             P+ SHA  NGT++GQF IGGMTCAACVNSVEGIL +LPGVKRAVVALATS+GEVEYDPT+
Sbjct  121   PSTSHAKPNGTLTGQFTIGGMTCAACVNSVEGILRTLPGVKRAVVALATSLGEVEYDPTI  180

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             +SK+DIVNAIEDAGFE S +QS  QDKIILGV+G+S ++D+Q LE IL  L GVR F ++
Sbjct  181   VSKDDIVNAIEDAGFEASFVQSYEQDKIILGVLGVSSELDVQQLEEILCNLKGVRQFHFD  240

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
                +E+E+VFDPEVLGSRS+VD I G S  K  L VKNPYTRMAS+D++ESS M
Sbjct  241   RILKEVEIVFDPEVLGSRSLVDAIEGESSAKLKLVVKNPYTRMASKDLQESSDM  294



>gb|EYU43653.1| hypothetical protein MIMGU_mgv1a000759mg [Erythranthe guttata]
Length=992

 Score =   388 bits (997),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 230/287 (80%), Gaps = 6/287 (2%)
 Frame = +2

Query  224   MRDVQMTATNGN---SSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTS  394
             M  +Q+TA  G    +S ED G  EE RLL +YDEE S + LRRI V VTGMTCAACS S
Sbjct  1     MTGLQLTAVAGKGSGASAEDAG--EEDRLLGAYDEEYSAD-LRRINVSVTGMTCAACSNS  57

Query  395   VEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHAN  574
             VE ALMSL+GVVKASVALLQNKADV FDP +VKD+DI+NAIEDAGF+AE+L EP+ SH+ 
Sbjct  58    VESALMSLSGVVKASVALLQNKADVTFDPALVKDEDIKNAIEDAGFDAEILPEPSTSHSK  117

Query  575   TNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIV  754
               GTV GQF IGGMTCAACVNSVEGIL +LPGV++AVVALATS+GEVEYDPT I+K+DIV
Sbjct  118   PGGTVIGQFTIGGMTCAACVNSVEGILRNLPGVRKAVVALATSLGEVEYDPTAINKDDIV  177

Query  755   NAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELE  934
              AIEDAGFE S +QSS QDK++LGV GIS +MD Q+LEG L    GVR F Y+ TS+EL 
Sbjct  178   TAIEDAGFEASFVQSSEQDKLVLGVTGISSEMDAQMLEGNLCTFKGVRQFHYDRTSKELA  237

Query  935   VVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             + FDPE+LGSR++VD I   S GK  LHVKNPYTRM S+D+EESS+M
Sbjct  238   IHFDPELLGSRALVDMIESSSYGKLKLHVKNPYTRMTSKDLEESSNM  284



>ref|XP_006369037.1| Copper-transporting ATPase RAN1 family protein [Populus trichocarpa]
 gb|ERP65606.1| Copper-transporting ATPase RAN1 family protein [Populus trichocarpa]
Length=1010

 Score =   388 bits (996),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 202/304 (66%), Positives = 234/304 (77%), Gaps = 20/304 (7%)
 Frame = +2

Query  224   MRDVQMTATNG---------NSSEEDFGDC-EEVRLLDSY----DEENSG------ENLR  343
             MRD+Q+T   G         ++ EED  D  E+VRLLDSY    D +NS       +  +
Sbjct  1     MRDLQLTQAAGTRKSPPAMISAGEEDADDMKEDVRLLDSYESLGDNDNSHRIVIEEDGFK  60

Query  344   RIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
             RIQVRVTGMTCAACS SVE AL S++GV +ASVALLQNKADVVFDP +VKD DI+NAIED
Sbjct  61    RIQVRVTGMTCAACSNSVESALKSVDGVFRASVALLQNKADVVFDPALVKDDDIKNAIED  120

Query  524   AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
             AGFEAE+L+EP       NGT+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS
Sbjct  121   AGFEAEILSEPIKLKTKPNGTLLGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATS  180

Query  704   VGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSK  883
             +GEVEYDP VISK+DIVNAIEDAGF+ SL+QSS  DKI+LGV GI  ++D+QLLEGILS 
Sbjct  181   LGEVEYDPIVISKDDIVNAIEDAGFDASLVQSSQHDKIVLGVAGIFSEVDVQLLEGILSM  240

Query  884   LHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEE  1063
             L GVR F Y+  S ELEV+FDPEVLGSRS+VDG+ GGS GKF LH  NPY+RM S+D+ E
Sbjct  241   LKGVRQFRYHWISSELEVLFDPEVLGSRSLVDGVEGGSNGKFKLHPINPYSRMTSKDVGE  300

Query  1064  SSSM  1075
             +S M
Sbjct  301   TSVM  304



>ref|XP_008383286.1| PREDICTED: LOW QUALITY PROTEIN: copper-transporting ATPase RAN1-like 
[Malus domestica]
Length=1002

 Score =   386 bits (992),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/294 (65%), Positives = 234/294 (80%), Gaps = 6/294 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEE-----DFGDCEEVRLLDSYDEENSGE-NLRRIQVRVTGMT  373
             M+PS R +Q+T  +    +      DFGD E+VRLLDSY+     E  ++R+QVRV+GMT
Sbjct  1     MAPSPRYLQLTQVSAGDRKSMVAAGDFGDSEDVRLLDSYENSEGVEAGMKRVQVRVSGMT  60

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACS SVEGAL S+NGV+ ASVALLQN+ADVVFDP ++KD+DI+ AIEDAGF+AEV+ E
Sbjct  61    CAACSNSVEGALQSVNGVLTASVALLQNRADVVFDPRLIKDEDIKKAIEDAGFDAEVILE  120

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             P+AS    +GT+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPT+
Sbjct  121   PSASGTKPHGTLLGQFSIGGMTCAACVNSVEGILKGLPGVKRAVVALATSLGEVEYDPTL  180

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             ISK+DIVNAIEDAGF+ SL+QSS QDKIILGV G+  +MD Q+LE I+  L GVRHF ++
Sbjct  181   ISKDDIVNAIEDAGFDASLVQSSEQDKIILGVAGVFSEMDAQMLEAIIINLKGVRHFRFD  240

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               S ELE++FDPEV+ SRS+VDGIN  S  KF L V NPYTRM S+DI E+S++
Sbjct  241   RISSELEILFDPEVVTSRSLVDGINEASNEKFKLQVANPYTRMTSKDIGEASNI  294



>ref|XP_011032035.1| PREDICTED: copper-transporting ATPase RAN1-like [Populus euphratica]
Length=888

 Score =   382 bits (981),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 201/300 (67%), Positives = 232/300 (77%), Gaps = 16/300 (5%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEE---DFGD--CEEVRLLDS---YDEENS-------GEN-LRRIQV  355
             MRD+Q+T   G         + D   E+VRLLDS    D+ N        GE+  +RIQV
Sbjct  1     MRDLQLTQVAGTRQSPLAMVYTDDMMEDVRLLDSCESRDDHNDASHAIVIGEDGFKRIQV  60

Query  356   RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFE  535
             RVTGMTCAACS SVE AL S++GV +ASVALLQNKADVVFDP +VKD DI+NAIEDAGFE
Sbjct  61    RVTGMTCAACSNSVESALKSVHGVFRASVALLQNKADVVFDPALVKDDDIKNAIEDAGFE  120

Query  536   AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
             AE+L+EP+      NGT+ GQF IGGMTCAACVNSVEGIL + PGVKRAVVALATS+GEV
Sbjct  121   AEILSEPSILKKKPNGTLLGQFTIGGMTCAACVNSVEGILRNCPGVKRAVVALATSLGEV  180

Query  716   EYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             EYDPTVISK+DIVNAIEDAGF+ SL+QSS QDKI+LGV GI  +MD+QLLEGIL  L GV
Sbjct  181   EYDPTVISKDDIVNAIEDAGFDASLVQSSQQDKILLGVAGIFSEMDVQLLEGILIMLKGV  240

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             R F YN  S ELEV+FDPEV+GSRS+VDG+ GGS GKF LHV NPY+RM S+D+ E S M
Sbjct  241   RQFRYNQLSSELEVLFDPEVVGSRSLVDGVEGGSNGKFKLHVINPYSRMTSKDVGEISVM  300



>ref|XP_011035471.1| PREDICTED: copper-transporting ATPase RAN1 [Populus euphratica]
Length=1010

 Score =   384 bits (986),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 202/304 (66%), Positives = 232/304 (76%), Gaps = 20/304 (7%)
 Frame = +2

Query  224   MRDVQMTATNG---------NSSEEDFGDC-EEVRLLDSY----DEENSG------ENLR  343
             MRD+Q+    G         ++ E D  D  E+VRLLDSY    D +NS       + L+
Sbjct  1     MRDLQLAQVAGTLKSPPAMISAGEGDADDMKEDVRLLDSYESLGDNDNSHRIVIDEDGLK  60

Query  344   RIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
             RIQVRVTGMTCAACS SVE AL S+NGV +ASVALLQNKADVVFDP +VKD DI+NAIED
Sbjct  61    RIQVRVTGMTCAACSNSVESALKSVNGVFRASVALLQNKADVVFDPALVKDDDIKNAIED  120

Query  524   AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
             AGFEAE+L+EP       NGT+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS
Sbjct  121   AGFEAEILSEPIKLKTKPNGTLLGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATS  180

Query  704   VGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSK  883
             +GEVEYDP VISK+DIVNAIEDAGF+ SL+QSS  DKI+LGV GI  ++D+QLLEGILS 
Sbjct  181   LGEVEYDPIVISKDDIVNAIEDAGFDASLVQSSQHDKIVLGVSGIFSEVDVQLLEGILSM  240

Query  884   LHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEE  1063
             L GVR F Y   S ELEV+FDPEVLGSRS+VDG+ GGS GKF LH  NPY+RM S+D+ E
Sbjct  241   LKGVRQFRYIWISSELEVLFDPEVLGSRSLVDGVEGGSNGKFKLHPINPYSRMTSKDVGE  300

Query  1064  SSSM  1075
             +S M
Sbjct  301   TSVM  304



>gb|KDO77286.1| hypothetical protein CISIN_1g001896mg [Citrus sinensis]
Length=765

 Score =   377 bits (969),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 225/290 (78%), Gaps = 3/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--EENSGENLRRIQVRVTGMTCAAC  385
             M+ S RD+Q+T  NG  S  D  D E+  LL++YD  +E  G+ +RRIQV VTGMTCAAC
Sbjct  2     MALSNRDLQLTELNGGGSS-DGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMTCAAC  60

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVEGALM L GV KASVALLQNKADVVFDP +VKD+DI+NAIEDAGFEAE+LAE + S
Sbjct  61    SNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTS  120

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                  GT+ GQ+ IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPTVISK+
Sbjct  121   GPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTVISKD  180

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DI NAIEDAGFE S +QSS QDKI+L V G+  ++D   LEGILS   GVR F ++  S 
Sbjct  181   DIANAIEDAGFEASFVQSSGQDKILLQVTGVLCELDAHFLEGILSNFKGVRQFRFDKISG  240

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEV+FDPE L SRS+VDGI G S GKF + V NP+ RM SRD EE+S+M
Sbjct  241   ELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM  290



>ref|XP_002303349.2| Copper-transporting ATPase RAN1 family protein [Populus trichocarpa]
 gb|EEE78328.2| Copper-transporting ATPase RAN1 family protein [Populus trichocarpa]
Length=1008

 Score =   383 bits (984),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 200/300 (67%), Positives = 231/300 (77%), Gaps = 16/300 (5%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEE---DFGD--CEEVRLLDS---YDEENSGENL--------RRIQV  355
             MRD+Q+T   G         + D   E+VRLLDS    D+ N G +         +RIQV
Sbjct  1     MRDLQLTQVAGTRQSPLAMVYTDDMMEDVRLLDSCESRDDHNDGSHAIVIGEVGSKRIQV  60

Query  356   RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFE  535
             RVTGMTCAACS SVE AL S++GV +ASVALLQNKADVVFDP +VKD DI+NAIEDAGFE
Sbjct  61    RVTGMTCAACSNSVESALKSVHGVFRASVALLQNKADVVFDPALVKDDDIKNAIEDAGFE  120

Query  536   AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
             AE+L+EP+      NGT+ GQF IGGMTCAACVNSVEGIL + PGVKRAVVALATS+GEV
Sbjct  121   AEILSEPSILKTKPNGTLLGQFTIGGMTCAACVNSVEGILRNRPGVKRAVVALATSLGEV  180

Query  716   EYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             EYDPTVISK+DIVNAIEDAGF+ SL+QSS QDKI+LGV GI  +MD+QLLEGIL  L GV
Sbjct  181   EYDPTVISKDDIVNAIEDAGFDASLVQSSQQDKILLGVAGIFSEMDVQLLEGILIMLKGV  240

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             R F YN  S ELEV+FDPEV+GSRS+VDG+ GGS GKF LHV NPY+RM S+D+ E S M
Sbjct  241   RQFRYNQLSSELEVLFDPEVVGSRSLVDGVEGGSNGKFKLHVINPYSRMTSKDVGEISVM  300



>ref|XP_006398114.1| hypothetical protein EUTSA_v10000758mg [Eutrema salsugineum]
 gb|ESQ39567.1| hypothetical protein EUTSA_v10000758mg [Eutrema salsugineum]
Length=1012

 Score =   382 bits (982),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 235/306 (77%), Gaps = 18/306 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN---SSEEDFGDCEEVRLLDSYDE--ENS-------------GEN  337
             M+PS RD+Q+T   G+   SS  + G  EEVRLLDSYDE  EN+                
Sbjct  1     MAPSRRDLQLTPITGDGLGSSAAEIGAMEEVRLLDSYDEGEENADFLSRIEEGGGSVNSG  60

Query  338   LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
             LR+IQV VTGMTCAACS SVEGALMS+NGVVKASVALLQN+ADV+FDP++VK++DI+ AI
Sbjct  61    LRKIQVGVTGMTCAACSNSVEGALMSVNGVVKASVALLQNRADVIFDPNLVKEEDIKEAI  120

Query  518   EDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALA  697
             EDAGFEAE+LAEP  S   T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALA
Sbjct  121   EDAGFEAEILAEPVTSGTKTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALA  180

Query  698   TSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGIL  877
             TS+GEVEYDP VISK+DIVNAIEDAGFEGSL+QS+ QDK++L V GI  ++D Q+LEGIL
Sbjct  181   TSLGEVEYDPNVISKDDIVNAIEDAGFEGSLVQSNQQDKLLLRVDGILNELDAQVLEGIL  240

Query  878   SKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDI  1057
             S+L+GVR F  +  S ELEVVFDPEV+ SR +VDGI G   GKF L V +PY R+ S+D 
Sbjct  241   SRLNGVRQFRLDRISGELEVVFDPEVVSSRLLVDGIEGEGYGKFKLRVMSPYERLTSKDT  300

Query  1058  EESSSM  1075
              E+S M
Sbjct  301   GEASQM  306



>ref|XP_010260635.1| PREDICTED: copper-transporting ATPase RAN1 [Nelumbo nucifera]
Length=1008

 Score =   382 bits (981),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 193/300 (64%), Positives = 238/300 (79%), Gaps = 12/300 (4%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEE------DFGDCEEVRLLDSYDEENSG------ENLRRIQV  355
             M+PS+RD+Q+TA +G+   E      DF D E+VRLLDSY+EE         E ++RIQV
Sbjct  1     MAPSLRDLQLTAVSGDRRPETVAAANDFPDLEDVRLLDSYEEEEREKMESIEEGMKRIQV  60

Query  356   RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFE  535
             RVTGMTCAACS SVE AL  ++GVV+ASVALLQNKADVVFDP+ VKD+DI+NAIEDAGFE
Sbjct  61    RVTGMTCAACSNSVESALTGIHGVVRASVALLQNKADVVFDPNFVKDEDIKNAIEDAGFE  120

Query  536   AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
             AE+L + N S   +  T+ GQF IGGMTCAACVNSVEGIL +LPGVKRAVVALATS+GEV
Sbjct  121   AEILLDSNISQIKSQKTLVGQFRIGGMTCAACVNSVEGILRNLPGVKRAVVALATSLGEV  180

Query  716   EYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             EYDP VISK++IVNAIEDAGFEG+L+QS+AQDKI+LGV+G+S +MD  +L  IL  L GV
Sbjct  181   EYDPNVISKDEIVNAIEDAGFEGALVQSNAQDKILLGVIGLSNEMDANILNDILRNLKGV  240

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             R F ++ T  ++EV+FDPEV+ SRS+VD I  GS GKF ++V+NPYT  +S  I+ESS+M
Sbjct  241   RQFEFDKTLPQIEVLFDPEVISSRSIVDAIEKGSNGKFKINVQNPYTARSSNGIDESSNM  300



>emb|CDY50771.1| BnaC07g18200D [Brassica napus]
Length=994

 Score =   381 bits (979),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 236/294 (80%), Gaps = 7/294 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD-----EENSGEN-LRRIQVRVTGMT  373
             M+PS RD+Q+T  +G+S+ E  G  EEVRLLDSYD     EE SG + LR+IQV VTGMT
Sbjct  1     MAPSRRDLQLTPLSGDSAAE-IGAMEEVRLLDSYDSLSKIEEGSGHSGLRKIQVGVTGMT  59

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACS SVEGALMS+NGV KASVALLQN+ADV+FDP++VK++DI+ AIEDAGFEAE+LAE
Sbjct  60    CAACSNSVEGALMSVNGVFKASVALLQNRADVLFDPNLVKEEDIKEAIEDAGFEAEILAE  119

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             P  S   T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP V
Sbjct  120   PVTSGTKTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLGEVEYDPNV  179

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             ISK+DIV AI DAGFEGSL+QS+ QDK++L V G+  ++D Q+LEGIL++L+GVR F  +
Sbjct  180   ISKDDIVTAIVDAGFEGSLVQSNQQDKLLLRVEGVLNELDAQVLEGILTRLNGVRQFRLD  239

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               + ELE+VFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+S+M
Sbjct  240   RITGELELVFDPEVVSSRSLVDGIEGEGYGKFKLRVMSPYERLTSKDTGEASNM  293



>gb|KDO77285.1| hypothetical protein CISIN_1g001896mg [Citrus sinensis]
Length=845

 Score =   377 bits (968),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 225/290 (78%), Gaps = 3/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--EENSGENLRRIQVRVTGMTCAAC  385
             M+ S RD+Q+T  NG  S  D  D E+  LL++YD  +E  G+ +RRIQV VTGMTCAAC
Sbjct  2     MALSNRDLQLTELNGGGSS-DGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMTCAAC  60

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVEGALM L GV KASVALLQNKADVVFDP +VKD+DI+NAIEDAGFEAE+LAE + S
Sbjct  61    SNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTS  120

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                  GT+ GQ+ IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPTVISK+
Sbjct  121   GPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTVISKD  180

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DI NAIEDAGFE S +QSS QDKI+L V G+  ++D   LEGILS   GVR F ++  S 
Sbjct  181   DIANAIEDAGFEASFVQSSGQDKILLQVTGVLCELDAHFLEGILSNFKGVRQFRFDKISG  240

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEV+FDPE L SRS+VDGI G S GKF + V NP+ RM SRD EE+S+M
Sbjct  241   ELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM  290



>ref|XP_009101635.1| PREDICTED: copper-transporting ATPase RAN1 [Brassica rapa]
Length=997

 Score =   380 bits (977),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/298 (65%), Positives = 235/298 (79%), Gaps = 11/298 (4%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD---------EENSG-ENLRRIQVRV  361
             M+PS RD+Q+T  +G+++ E  G  EEVRLLDSYD         EE SG   LR+IQV +
Sbjct  1     MAPSRRDLQLTPLSGDTAAE-IGAMEEVRLLDSYDDNDDSLSKIEEGSGGSGLRKIQVGI  59

Query  362   TGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAE  541
             TGMTCAACS SVEGALMS+NGV KASVALLQN+ADV+FDP++VK+ DI+ AIEDAGFEAE
Sbjct  60    TGMTCAACSNSVEGALMSVNGVFKASVALLQNRADVLFDPNLVKEDDIKEAIEDAGFEAE  119

Query  542   VLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEY  721
             +LAEP  S   T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEY
Sbjct  120   ILAEPVTSGTKTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLGEVEY  179

Query  722   DPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRH  901
             DP VISK+DIV AIEDAGFEGSL+QS+ QDK++L V G+  ++D Q+LEGIL++L+GVR 
Sbjct  180   DPNVISKDDIVTAIEDAGFEGSLVQSNQQDKLLLRVDGVLNELDAQVLEGILTRLNGVRQ  239

Query  902   FFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             F  +  + ELEVVFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+S+M
Sbjct  240   FRLDRITGELEVVFDPEVVSSRSLVDGIEGEGYGKFKLRVMSPYERLTSKDTGEASNM  297



>ref|XP_008371911.1| PREDICTED: copper-transporting ATPase RAN1-like [Malus domestica]
Length=1002

 Score =   380 bits (976),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/294 (65%), Positives = 231/294 (79%), Gaps = 6/294 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEE-----DFGDCEEVRLLDSYD-EENSGENLRRIQVRVTGMT  373
             M+PS RD+Q++  +  +        DFGD E+VRLLDSY+  E   E ++R+QVRV+GMT
Sbjct  1     MAPSPRDLQLSQISARAPTSMVAAGDFGDLEDVRLLDSYENSEGVXEGMKRVQVRVSGMT  60

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACS SVE AL S+ GV+ ASVALLQ+ ADVV DP +VKD+DI+NAIEDAGFEAEV+  
Sbjct  61    CAACSNSVEXALQSVKGVLTASVALLQSXADVVXDPRLVKDEDIKNAIEDAGFEAEVIPX  120

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             P+AS    +GT+SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP V
Sbjct  121   PSASGTKPHGTLSGQFSIGGMTCAACVNSVEGILKGLPGVKRAVVALATSLGEVEYDPLV  180

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             ISK++IVNAIEDAGF+ SL+QSS QDKI+LGV G+  +MD Q LE I+S L GVRHF  +
Sbjct  181   ISKDEIVNAIEDAGFDASLVQSSQQDKIVLGVAGVFSEMDAQTLEAIISNLKGVRHFRVD  240

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               SRELE++FDPEV+ SRS+VD I   S  KF L V NPYTRM S+DI+E+S+M
Sbjct  241   RISRELEILFDPEVVTSRSLVDEIQEASNEKFKLQVANPYTRMTSKDIDEASNM  294



>ref|XP_011096834.1| PREDICTED: copper-transporting ATPase RAN1 [Sesamum indicum]
Length=994

 Score =   378 bits (971),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 232/292 (79%), Gaps = 12/292 (4%)
 Frame = +2

Query  212   MSPSMRDVQMTA----TNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCA  379
             M+ SMR +Q+TA     +G+SSEE+       RLL +  + NSG NLRRIQV VTGMTCA
Sbjct  1     MALSMRALQLTAPARKASGHSSEEE-------RLLTANHQHNSG-NLRRIQVGVTGMTCA  52

Query  380   ACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPN  559
             ACS SVE AL +LNGVVKASVALLQNKADV FDP +VKD+DI NAIED GFEAE+L+EP+
Sbjct  53    ACSNSVESALRALNGVVKASVALLQNKADVTFDPTLVKDEDIRNAIEDIGFEAELLSEPS  112

Query  560   ASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVIS  739
               H+   GT+ GQF IGGMTCAACVNSVEGIL  LPGV++AVV LATS+GEVEYDPTVIS
Sbjct  113   TFHSKPTGTLIGQFTIGGMTCAACVNSVEGILRKLPGVRKAVVGLATSLGEVEYDPTVIS  172

Query  740   KNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPT  919
             K+ I+NAIEDAGFE S +QS+ QDK++LGV GI+ +MD+Q+LEG L  L GVR F+++  
Sbjct  173   KDGIINAIEDAGFEASFVQSNEQDKLVLGVTGIASEMDIQMLEGSLCILKGVRQFYFDRA  232

Query  920   SRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             S+ELE+ FDPE+L SR++V+ I   S GK  L VKNPYTRMAS+D+EESS+M
Sbjct  233   SKELEIHFDPELLSSRALVEEIESSSYGKLKLLVKNPYTRMASKDLEESSNM  284



>gb|KJB47996.1| hypothetical protein B456_008G049700 [Gossypium raimondii]
Length=860

 Score =   374 bits (961),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 231/307 (75%), Gaps = 23/307 (7%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFG---------DCEE-VRLLDSYD---------EENSGE  334
             MSP  RD+Q+T+         +          D EE  RLLDSY+         EE S  
Sbjct  1     MSPGSRDLQLTSQAAGVWRSTYPSSVRAVDPDDMEEGTRLLDSYETGDYKLESIEEGS--  58

Query  335   NLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENA  514
              +RRIQV VTGMTCAACS SVE AL ++NGV++ASVALLQN+ADVVFDP +VKD+DI+NA
Sbjct  59    -MRRIQVTVTGMTCAACSNSVEAALKNINGVLRASVALLQNRADVVFDPTLVKDEDIKNA  117

Query  515   IEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
             IEDAGFEAE+L EP+       G + GQF IGGMTCAACVNSVEGIL  LPGV RAVVAL
Sbjct  118   IEDAGFEAEILPEPSNVGTKPRGVLVGQFTIGGMTCAACVNSVEGILRDLPGVSRAVVAL  177

Query  695   ATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGI  874
             ATS+GEVEYDPTVISK+DIVNAIEDAGFE SL+QSS QDKIILGV G+  ++D+QL+EGI
Sbjct  178   ATSLGEVEYDPTVISKDDIVNAIEDAGFEASLVQSSEQDKIILGVAGVFNELDVQLIEGI  237

Query  875   LSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRD  1054
             LS L GVR F ++ +S ELEV+FDPEV+ SRS+VDGI GGS GKF LHV NPY RM ++D
Sbjct  238   LSSLKGVRQFRFDRSSGELEVLFDPEVVSSRSLVDGIEGGSKGKFRLHVMNPYARMTTKD  297

Query  1055  IEESSSM  1075
              EE+S M
Sbjct  298   -EETSIM  303



>gb|KDO77284.1| hypothetical protein CISIN_1g001896mg [Citrus sinensis]
Length=998

 Score =   377 bits (969),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 225/290 (78%), Gaps = 3/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--EENSGENLRRIQVRVTGMTCAAC  385
             M+ S RD+Q+T  NG  S  D  D E+  LL++YD  +E  G+ +RRIQV VTGMTCAAC
Sbjct  2     MALSNRDLQLTELNGGGSS-DGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMTCAAC  60

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVEGALM L GV KASVALLQNKADVVFDP +VKD+DI+NAIEDAGFEAE+LAE + S
Sbjct  61    SNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTS  120

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                  GT+ GQ+ IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPTVISK+
Sbjct  121   GPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTVISKD  180

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DI NAIEDAGFE S +QSS QDKI+L V G+  ++D   LEGILS   GVR F ++  S 
Sbjct  181   DIANAIEDAGFEASFVQSSGQDKILLQVTGVLCELDAHFLEGILSNFKGVRQFRFDKISG  240

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEV+FDPE L SRS+VDGI G S GKF + V NP+ RM SRD EE+S+M
Sbjct  241   ELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM  290



>gb|KDO77283.1| hypothetical protein CISIN_1g001896mg [Citrus sinensis]
Length=997

 Score =   377 bits (968),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 225/290 (78%), Gaps = 3/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--EENSGENLRRIQVRVTGMTCAAC  385
             M+ S RD+Q+T  NG  S  D  D E+  LL++YD  +E  G+ +RRIQV VTGMTCAAC
Sbjct  2     MALSNRDLQLTELNGGGSS-DGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMTCAAC  60

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVEGALM L GV KASVALLQNKADVVFDP +VKD+DI+NAIEDAGFEAE+LAE + S
Sbjct  61    SNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTS  120

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                  GT+ GQ+ IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPTVISK+
Sbjct  121   GPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTVISKD  180

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DI NAIEDAGFE S +QSS QDKI+L V G+  ++D   LEGILS   GVR F ++  S 
Sbjct  181   DIANAIEDAGFEASFVQSSGQDKILLQVTGVLCELDAHFLEGILSNFKGVRQFRFDKISG  240

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEV+FDPE L SRS+VDGI G S GKF + V NP+ RM SRD EE+S+M
Sbjct  241   ELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM  290



>gb|KCW75666.1| hypothetical protein EUGRSUZ_D00027 [Eucalyptus grandis]
Length=773

 Score =   371 bits (952),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 191/305 (63%), Positives = 235/305 (77%), Gaps = 17/305 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEE------------VRLLDSYDEE---NSGE--NL  340
             M+P+  D+Q++  +G +  +   D EE            VRLLDSY++    ++GE   +
Sbjct  1     MAPNFVDLQLSRLSGAAGRKTGDDLEEGGGGGGGADLEDVRLLDSYEDNAPASAGEAAGM  60

Query  341   RRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE  520
             RR+QVRVTGMTCAACS SVE AL +++GV++ASVALLQNKADVV+DP +VK+ DI+NAIE
Sbjct  61    RRVQVRVTGMTCAACSNSVEEALRAVDGVLRASVALLQNKADVVYDPSLVKEVDIKNAIE  120

Query  521   DAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
             DAGFEAE+L EPN+S      T+ GQF IGGMTCAACVNSVEGIL SLPGVK AVVALAT
Sbjct  121   DAGFEAEILPEPNSSKTKQQTTLLGQFTIGGMTCAACVNSVEGILRSLPGVKGAVVALAT  180

Query  701   SVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILS  880
             S+GEVEYDP VISK+DIVNAIEDAGFE SL+QSS QDKIILGV G+   MD+  LEGILS
Sbjct  181   SLGEVEYDPAVISKDDIVNAIEDAGFEASLVQSSQQDKIILGVAGVFSVMDVHFLEGILS  240

Query  881   KLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIE  1060
              L GVR F ++ TS EL+++FDPEV+ SRS+VD I G S G+F LHV NPY+RM S+D+E
Sbjct  241   SLKGVRQFRFDRTSGELDILFDPEVVTSRSLVDSIEGASSGQFKLHVMNPYSRMTSKDVE  300

Query  1061  ESSSM  1075
             E++ M
Sbjct  301   ETTKM  305



>gb|KJB47995.1| hypothetical protein B456_008G049700 [Gossypium raimondii]
Length=883

 Score =   374 bits (960),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 231/307 (75%), Gaps = 23/307 (7%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFG---------DCEE-VRLLDSYD---------EENSGE  334
             MSP  RD+Q+T+         +          D EE  RLLDSY+         EE S  
Sbjct  1     MSPGSRDLQLTSQAAGVWRSTYPSSVRAVDPDDMEEGTRLLDSYETGDYKLESIEEGS--  58

Query  335   NLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENA  514
              +RRIQV VTGMTCAACS SVE AL ++NGV++ASVALLQN+ADVVFDP +VKD+DI+NA
Sbjct  59    -MRRIQVTVTGMTCAACSNSVEAALKNINGVLRASVALLQNRADVVFDPTLVKDEDIKNA  117

Query  515   IEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
             IEDAGFEAE+L EP+       G + GQF IGGMTCAACVNSVEGIL  LPGV RAVVAL
Sbjct  118   IEDAGFEAEILPEPSNVGTKPRGVLVGQFTIGGMTCAACVNSVEGILRDLPGVSRAVVAL  177

Query  695   ATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGI  874
             ATS+GEVEYDPTVISK+DIVNAIEDAGFE SL+QSS QDKIILGV G+  ++D+QL+EGI
Sbjct  178   ATSLGEVEYDPTVISKDDIVNAIEDAGFEASLVQSSEQDKIILGVAGVFNELDVQLIEGI  237

Query  875   LSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRD  1054
             LS L GVR F ++ +S ELEV+FDPEV+ SRS+VDGI GGS GKF LHV NPY RM ++D
Sbjct  238   LSSLKGVRQFRFDRSSGELEVLFDPEVVSSRSLVDGIEGGSKGKFRLHVMNPYARMTTKD  297

Query  1055  IEESSSM  1075
              EE+S M
Sbjct  298   -EETSIM  303



>ref|XP_006468540.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X2 [Citrus 
sinensis]
Length=997

 Score =   375 bits (964),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/290 (67%), Positives = 224/290 (77%), Gaps = 3/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--EENSGENLRRIQVRVTGMTCAAC  385
             M+ S RD+Q+T  NG     D  D E+  LL++YD  +E  G+ +RRIQV VTGMTCAAC
Sbjct  2     MALSNRDLQLTELNGGGCS-DGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMTCAAC  60

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVEGALM L GV KASVALLQNKADVVFDP +VKD+DI+NAIEDAGFEAE+LAE + S
Sbjct  61    SNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTS  120

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                  GT+ GQ+ IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPTVISK+
Sbjct  121   GPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTVISKD  180

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DI NAIEDAGFE S +QSS QDKI+L V G+  ++D   LEGILS   GVR F ++  S 
Sbjct  181   DIANAIEDAGFEASFVQSSGQDKILLQVTGVLCELDAHFLEGILSNFKGVRQFRFDKISG  240

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEV+FDPE L SRS+VDGI G S GKF + V NP+ RM SRD EE+S+M
Sbjct  241   ELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM  290



>ref|XP_006468539.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X1 [Citrus 
sinensis]
Length=998

 Score =   375 bits (964),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/290 (67%), Positives = 224/290 (77%), Gaps = 3/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--EENSGENLRRIQVRVTGMTCAAC  385
             M+ S RD+Q+T  NG     D  D E+  LL++YD  +E  G+ +RRIQV VTGMTCAAC
Sbjct  2     MALSNRDLQLTELNGGGCS-DGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMTCAAC  60

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVEGALM L GV KASVALLQNKADVVFDP +VKD+DI+NAIEDAGFEAE+LAE + S
Sbjct  61    SNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTS  120

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                  GT+ GQ+ IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPTVISK+
Sbjct  121   GPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTVISKD  180

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DI NAIEDAGFE S +QSS QDKI+L V G+  ++D   LEGILS   GVR F ++  S 
Sbjct  181   DIANAIEDAGFEASFVQSSGQDKILLQVTGVLCELDAHFLEGILSNFKGVRQFRFDKISG  240

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEV+FDPE L SRS+VDGI G S GKF + V NP+ RM SRD EE+S+M
Sbjct  241   ELEVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM  290



>gb|KJB47994.1| hypothetical protein B456_008G049700 [Gossypium raimondii]
Length=1011

 Score =   375 bits (964),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 231/307 (75%), Gaps = 23/307 (7%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFG---------DCEE-VRLLDSYD---------EENSGE  334
             MSP  RD+Q+T+         +          D EE  RLLDSY+         EE S  
Sbjct  1     MSPGSRDLQLTSQAAGVWRSTYPSSVRAVDPDDMEEGTRLLDSYETGDYKLESIEEGS--  58

Query  335   NLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENA  514
              +RRIQV VTGMTCAACS SVE AL ++NGV++ASVALLQN+ADVVFDP +VKD+DI+NA
Sbjct  59    -MRRIQVTVTGMTCAACSNSVEAALKNINGVLRASVALLQNRADVVFDPTLVKDEDIKNA  117

Query  515   IEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
             IEDAGFEAE+L EP+       G + GQF IGGMTCAACVNSVEGIL  LPGV RAVVAL
Sbjct  118   IEDAGFEAEILPEPSNVGTKPRGVLVGQFTIGGMTCAACVNSVEGILRDLPGVSRAVVAL  177

Query  695   ATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGI  874
             ATS+GEVEYDPTVISK+DIVNAIEDAGFE SL+QSS QDKIILGV G+  ++D+QL+EGI
Sbjct  178   ATSLGEVEYDPTVISKDDIVNAIEDAGFEASLVQSSEQDKIILGVAGVFNELDVQLIEGI  237

Query  875   LSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRD  1054
             LS L GVR F ++ +S ELEV+FDPEV+ SRS+VDGI GGS GKF LHV NPY RM ++D
Sbjct  238   LSSLKGVRQFRFDRSSGELEVLFDPEVVSSRSLVDGIEGGSKGKFRLHVMNPYARMTTKD  297

Query  1055  IEESSSM  1075
              EE+S M
Sbjct  298   -EETSIM  303



>ref|XP_003533704.1| PREDICTED: copper-transporting ATPase RAN1-like [Glycine max]
Length=986

 Score =   374 bits (959),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 192/288 (67%), Positives = 232/288 (81%), Gaps = 10/288 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACST  391
             M+P +R +Q+T+  G+S E      E+VRLLDSYDE + G   RRIQV VTGMTCAACS 
Sbjct  1     MAPGIRGLQLTSLAGDSDE-----LEDVRLLDSYDEIDGGA--RRIQVSVTGMTCAACSN  53

Query  392   SVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHA  571
             SVE AL SL+GV+ ASVALLQNKADVVF+  ++KD+DI+NAIEDAGFEA++L E   S  
Sbjct  54    SVESALKSLDGVISASVALLQNKADVVFNSALLKDEDIKNAIEDAGFEADILPE---SST  110

Query  572   NTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDI  751
               + T+ GQF IGGMTCAACVNSVEGIL +LPGVKRAVVALATS GEVEYDP+VISK+DI
Sbjct  111   VAHETLVGQFTIGGMTCAACVNSVEGILRNLPGVKRAVVALATSSGEVEYDPSVISKDDI  170

Query  752   VNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSREL  931
             VNAIED+GF+GSL++S+ QDKIILGVVG+   +D Q+LEGILS   GVR F ++  S EL
Sbjct  171   VNAIEDSGFDGSLIESNEQDKIILGVVGVYSLIDTQVLEGILSSTKGVRKFHFDKVSGEL  230

Query  932   EVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             +V+FDPEVL SRSVVD I  GS GKF LHV++PYTRMAS+D+EE S++
Sbjct  231   DVLFDPEVLSSRSVVDAIQEGSNGKFKLHVRSPYTRMASKDVEEISTI  278



>ref|XP_010536885.1| PREDICTED: copper-transporting ATPase RAN1-like [Tarenaya hassleriana]
Length=1012

 Score =   372 bits (955),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 232/310 (75%), Gaps = 22/310 (7%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNS---------SEEDFGDCEEVRLLDSYDEENSGE----------  334
             M+PS RDVQ+   +  +          + D G  EEVRLLD+YD+ N+ +          
Sbjct  1     MAPSGRDVQLIPVSSPAMAAEASIGGRDSDIGAMEEVRLLDAYDDGNAADLSRIEEGGGS  60

Query  335   -NLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIEN  511
               +RRIQVRVTGMTCAACS SVEGAL S+NGV++ASVALLQN+ADVVFDP +VK++DI+ 
Sbjct  61    GGVRRIQVRVTGMTCAACSNSVEGALRSVNGVLQASVALLQNRADVVFDPDLVKEEDIKE  120

Query  512   AIEDAGFEAEVLAEPNASHANTNG--TVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAV  685
             AIEDAGFEAE+L+EP      T    T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAV
Sbjct  121   AIEDAGFEAEILSEPMTKGKGTKAQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAV  180

Query  686   VALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLL  865
             VALATS+GEVEYDPTVISK+DIVNAIEDAGFE SL+QSS QD I+L V GI  + D  +L
Sbjct  181   VALATSLGEVEYDPTVISKDDIVNAIEDAGFEASLVQSSQQDNIVLRVDGIFNEFDAHIL  240

Query  866   EGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMA  1045
             EGIL++L+GVR F  +  S ELEVVFDPEV+ SRS+VDGI GGS GKF L V NPY R+ 
Sbjct  241   EGILARLNGVRQFRLDRISGELEVVFDPEVVTSRSLVDGIEGGSNGKFKLRVINPYERLT  300

Query  1046  SRDIEESSSM  1075
             S+D  E+++M
Sbjct  301   SKDTGEAANM  310



>ref|XP_010481705.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X1 [Camelina 
sativa]
 ref|XP_010481707.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X2 [Camelina 
sativa]
Length=1004

 Score =   371 bits (953),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 233/300 (78%), Gaps = 14/300 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDE--------ENSGEN--LRRIQVRV  361
             M+PS RD+Q+T   G+ S     D EEVRLLDSYD+        E  G +  LR+IQV V
Sbjct  1     MAPSRRDLQLTLVTGDFSSSS--DMEEVRLLDSYDDGEDVLSKIEEGGNDSGLRKIQVGV  58

Query  362   TGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAE  541
             TGMTCAACS SVEGALMS+NGV KASVALLQN+ADVVFDP++VK++DI+ AIEDAGFEAE
Sbjct  59    TGMTCAACSNSVEGALMSVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDAGFEAE  118

Query  542   VLAEPNASHA--NTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
             +LAEP  S     T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEV
Sbjct  119   ILAEPVTSTGTKKTEATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLGEV  178

Query  716   EYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             EYDP VI+K++IV AIEDAGFEG+L+QS+ QDK++L V GI  ++D Q+LEGIL++L+GV
Sbjct  179   EYDPNVINKDEIVTAIEDAGFEGALVQSNQQDKLVLRVEGILNELDAQVLEGILTRLNGV  238

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             R F  +  S ELEVVFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+S+M
Sbjct  239   RQFRLDRISGELEVVFDPEVVSSRSLVDGIEGEGYGKFKLRVMSPYERLTSKDTGEASNM  298



>ref|XP_006448635.1| hypothetical protein CICLE_v10014141mg [Citrus clementina]
 gb|ESR61875.1| hypothetical protein CICLE_v10014141mg [Citrus clementina]
Length=998

 Score =   371 bits (952),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 191/290 (66%), Positives = 223/290 (77%), Gaps = 3/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--EENSGENLRRIQVRVTGMTCAAC  385
             M+ S  D+Q+T  NG  S  D  D E+  LL++YD  +E  G+ +RRIQV VTGMTCAAC
Sbjct  2     MALSNGDLQLTELNGGGSS-DGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMTCAAC  60

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVEGALM L GV KASVALLQNKADVVFDP +VKD+DI+NAIEDAGFEAE+LAE + S
Sbjct  61    SNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTS  120

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                  GT+ GQ+ IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDPTVISK+
Sbjct  121   GPKPQGTIVGQYTIGGMTCAACVNSVEGILRGLPGVKRAVVALATSLGEVEYDPTVISKD  180

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DI NAIEDAGFE S +QSS QDK++L V G+  ++D   LEGILS   GVR F ++  S 
Sbjct  181   DIANAIEDAGFEASFVQSSGQDKVLLQVTGVLCELDAHFLEGILSNFKGVRQFRFDKISG  240

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEV+FDPE L SR +VDGI G S GKF + V NP+ RM SRD EE+S+M
Sbjct  241   ELEVLFDPEALSSRFLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM  290



>ref|XP_003547418.1| PREDICTED: copper-transporting ATPase RAN1-like [Glycine max]
Length=996

 Score =   370 bits (951),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 187/290 (64%), Positives = 231/290 (80%), Gaps = 4/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN--SSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAAC  385
             M+P +  +Q+T+  G+  ++  D  + E++RLLDSYDE N G   RRIQV VTGMTCAAC
Sbjct  1     MAPGIGGLQLTSLAGDRRTAAADSDELEDMRLLDSYDEINGGA--RRIQVEVTGMTCAAC  58

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVE AL SL+GV+ ASVALLQNKADVVF+  ++KD+DI+NAIEDAGFEA++L E +  
Sbjct  59    SNSVESALKSLDGVISASVALLQNKADVVFNTALLKDEDIKNAIEDAGFEADILPESSTV  118

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                  GT+ GQF IGGMTCAACVNSVEGIL +LPGV+RAVVALATS GEVEYDP+VISK+
Sbjct  119   GKVPQGTLVGQFTIGGMTCAACVNSVEGILRNLPGVRRAVVALATSSGEVEYDPSVISKD  178

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DIVNAIED+GF+GS +QS+ QDKIIL VVG+   +D Q+LEGILS   GVR F ++  S 
Sbjct  179   DIVNAIEDSGFDGSFIQSNEQDKIILRVVGVYSLIDAQVLEGILSSTKGVRQFHFDQVSG  238

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             EL+V+FDPEVL SRSVVD I  GS GKF LHV++PYTRMAS+D+ E+S++
Sbjct  239   ELDVLFDPEVLSSRSVVDAIQEGSNGKFKLHVRSPYTRMASKDVAETSTI  288



>ref|XP_010051840.1| PREDICTED: copper-transporting ATPase RAN1 [Eucalyptus grandis]
 gb|KCW75665.1| hypothetical protein EUGRSUZ_D00027 [Eucalyptus grandis]
Length=1012

 Score =   370 bits (951),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/305 (63%), Positives = 235/305 (77%), Gaps = 17/305 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEE------------VRLLDSYDEE---NSGE--NL  340
             M+P+  D+Q++  +G +  +   D EE            VRLLDSY++    ++GE   +
Sbjct  1     MAPNFVDLQLSRLSGAAGRKTGDDLEEGGGGGGGADLEDVRLLDSYEDNAPASAGEAAGM  60

Query  341   RRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE  520
             RR+QVRVTGMTCAACS SVE AL +++GV++ASVALLQNKADVV+DP +VK+ DI+NAIE
Sbjct  61    RRVQVRVTGMTCAACSNSVEEALRAVDGVLRASVALLQNKADVVYDPSLVKEVDIKNAIE  120

Query  521   DAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
             DAGFEAE+L EPN+S      T+ GQF IGGMTCAACVNSVEGIL SLPGVK AVVALAT
Sbjct  121   DAGFEAEILPEPNSSKTKQQTTLLGQFTIGGMTCAACVNSVEGILRSLPGVKGAVVALAT  180

Query  701   SVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILS  880
             S+GEVEYDP VISK+DIVNAIEDAGFE SL+QSS QDKIILGV G+   MD+  LEGILS
Sbjct  181   SLGEVEYDPAVISKDDIVNAIEDAGFEASLVQSSQQDKIILGVAGVFSVMDVHFLEGILS  240

Query  881   KLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIE  1060
              L GVR F ++ TS EL+++FDPEV+ SRS+VD I G S G+F LHV NPY+RM S+D+E
Sbjct  241   SLKGVRQFRFDRTSGELDILFDPEVVTSRSLVDSIEGASSGQFKLHVMNPYSRMTSKDVE  300

Query  1061  ESSSM  1075
             E++ M
Sbjct  301   ETTKM  305



>ref|XP_002863545.1| responsive-to-antagonist1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39804.1| responsive-to-antagonist1 [Arabidopsis lyrata subsp. lyrata]
Length=1004

 Score =   370 bits (951),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 235/303 (78%), Gaps = 20/303 (7%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSY-DEENSGE--------------NLRR  346
             M+PS RD+Q+T   G SS E  GD EEVRLLDSY +EEN+ +               LR+
Sbjct  1     MAPSRRDLQLTPVTGESSSE-VGDMEEVRLLDSYYNEENADDILSKIEEGGGGDDSGLRK  59

Query  347   IQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDA  526
             IQV +TGMTCAACS SVEGALM++NGV KASVALLQN+ADVVFDP++VK++DI+ AIEDA
Sbjct  60    IQVGITGMTCAACSNSVEGALMNVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDA  119

Query  527   GFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSV  706
             GFEAE+LAE  A    T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVAL+TS+
Sbjct  120   GFEAEILAEVVA----TGTTLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALSTSL  175

Query  707   GEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKL  886
             GEVEYDP VI+K+DIV AIEDAGFEGSL+QS+ QDK++L V GI  ++D Q+LEGIL++L
Sbjct  176   GEVEYDPNVINKDDIVTAIEDAGFEGSLVQSNQQDKLVLRVEGIMNELDAQVLEGILTRL  235

Query  887   HGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEES  1066
             +GVR F  +  S ELEVVFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+
Sbjct  236   NGVRQFRLDRISGELEVVFDPEVVSSRSLVDGIEGDGYGKFKLRVMSPYERLTSKDTGEA  295

Query  1067  SSM  1075
             S+M
Sbjct  296   SNM  298



>ref|XP_010684278.1| PREDICTED: copper-transporting ATPase RAN1 [Beta vulgaris subsp. 
vulgaris]
Length=999

 Score =   369 bits (948),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 185/293 (63%), Positives = 233/293 (80%), Gaps = 5/293 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATN-GNSSEEDFG--DCEEVRLLDSYDEENSGE--NLRRIQVRVTGMTC  376
             M+PS +DVQ+T++   +  ++DF   D E+VRLLD Y E  +G+  N RRIQV V GMTC
Sbjct  1     MAPSTKDVQLTSSRVADDDDDDFNGVDLEDVRLLDDYQEIKAGDHRNTRRIQVSVGGMTC  60

Query  377   AACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEP  556
             +ACS SVE AL+++NGV  ASVALLQNKA+++FDPH++KD+D+ +AIEDAGF+AE+L E 
Sbjct  61    SACSNSVESALLAVNGVFNASVALLQNKAEIIFDPHLLKDEDVVSAIEDAGFDAEILPES  120

Query  557   NASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVI  736
             N+S    N T+ GQF IGGMTCAACVNSVEGIL  LPGV RAVV+L TSVGEVEYDP+++
Sbjct  121   NSSQKGPNRTLLGQFSIGGMTCAACVNSVEGILRELPGVTRAVVSLTTSVGEVEYDPSIV  180

Query  737   SKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNP  916
             SK+DIVNAIEDAGFEGSL+QSS Q KIIL V GISG++D Q LEG+L  ++GV+ F ++ 
Sbjct  181   SKDDIVNAIEDAGFEGSLVQSSEQGKIILEVAGISGELDAQFLEGLLCHINGVQKFRFDR  240

Query  917   TSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              S +LEV FD E++GSRSVVDGI    GG+F LHVKNP +RM S+D+EESS M
Sbjct  241   ISGQLEVCFDSEIIGSRSVVDGIEEAGGGRFKLHVKNPLSRMTSKDLEESSKM  293



>emb|CBI27210.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   367 bits (943),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 178/246 (72%), Positives = 209/246 (85%), Gaps = 2/246 (1%)
 Frame = +2

Query  338   LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
             +R IQVRVTGMTCAACS SVEGAL  +NGV++ASVALLQN+ADVVFDP +V ++DI+NAI
Sbjct  1     MRGIQVRVTGMTCAACSNSVEGALRDVNGVLRASVALLQNRADVVFDPKLVGEEDIKNAI  60

Query  518   EDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALA  697
             EDAGF+AE+++EP  S    +GT+ GQF IGGMTCA CVNSVEGIL  LPGVKRAVVALA
Sbjct  61    EDAGFDAEIMSEP--SRTKPHGTLLGQFTIGGMTCAVCVNSVEGILRKLPGVKRAVVALA  118

Query  698   TSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGIL  877
             TS+GEVEYDPT+ISK+DIVNAIEDAGFE S +QSS QDKIILGV GIS +MD  +LEGIL
Sbjct  119   TSLGEVEYDPTIISKDDIVNAIEDAGFEASFVQSSEQDKIILGVTGISNEMDALILEGIL  178

Query  878   SKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDI  1057
             + + GVR F ++ T  ELEV+FDPEV+ SRS+VDGI GGS  KF LHVKNPYTRM S+D+
Sbjct  179   TSIRGVRQFLFDRTLGELEVLFDPEVISSRSLVDGIEGGSNAKFKLHVKNPYTRMTSKDL  238

Query  1058  EESSSM  1075
             EESS+M
Sbjct  239   EESSNM  244



>gb|AID81887.1| heavy metal ATPase transporter 7 [Camelina sativa]
Length=982

 Score =   367 bits (942),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 233/302 (77%), Gaps = 16/302 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSG-------------ENLRRIQ  352
             M+PS RD+Q+T   G+SS     D EEVRLLDSYD+E                  LR+IQ
Sbjct  1     MAPSRRDLQLTPVTGDSSSSS--DMEEVRLLDSYDDEEDALSKIEEGGGGGNDSGLRKIQ  58

Query  353   VRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGF  532
             V VTGMTCAACS SVEGALMS+NGV KASVALLQN+ADVVFDP++VK++DI+ AIEDAGF
Sbjct  59    VGVTGMTCAACSNSVEGALMSVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDAGF  118

Query  533   EAEVLAEP-NASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
             EAE+LAEP  ++   T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+G
Sbjct  119   EAEILAEPLTSTGTKTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLG  178

Query  710   EVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLH  889
             EVEYDP VI+K++IV AIEDAGFEG+L+QS+ QDK++L V GI  ++D Q+LEGIL++L+
Sbjct  179   EVEYDPNVINKDEIVTAIEDAGFEGALVQSNQQDKLVLRVEGILNELDAQVLEGILTRLN  238

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESS  1069
             GVR F  +  S ELEVVFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+S
Sbjct  239   GVRQFRLDRISGELEVVFDPEVVSSRSLVDGIEGEGYGKFKLRVMSPYERLTSKDTGEAS  298

Query  1070  SM  1075
             +M
Sbjct  299   NM  300



>emb|CDY67659.1| BnaA09g53550D, partial [Brassica napus]
Length=595

 Score =   357 bits (915),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 236/304 (78%), Gaps = 18/304 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNS---SEEDFGDCEEVRLLDSYD--EEN----------SGEN-LR  343
             M+PS RD+Q+T   G+S   S+ +  + E VRLLDSYD  EEN          SG++ L+
Sbjct  1     MAPSRRDIQLTRITGHSLGSSDAENVEMEGVRLLDSYDDDEENAHFLSKIEGGSGDSGLK  60

Query  344   RIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
             +IQV +TGMTCAACS +VEGALMS+NGV KASVALLQN+ADVVFDP+++K++DI+ AIED
Sbjct  61    KIQVGITGMTCAACSNAVEGALMSVNGVFKASVALLQNRADVVFDPNLIKEEDIKEAIED  120

Query  524   AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
             AGFEAE+LA+P    A T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS
Sbjct  121   AGFEAEILADP--VTAGTKTTLVGQFTIGGMTCAACVNSVEGILKDLPGVKRAVVALATS  178

Query  704   VGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSK  883
             +GEVEYDP +I+K+DI+ AIEDAGFEGSL+QS+ QDK++L V G+  ++D Q+LEGIL++
Sbjct  179   LGEVEYDPNLINKDDIITAIEDAGFEGSLVQSNQQDKLLLRVDGVLNELDAQVLEGILTR  238

Query  884   LHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEE  1063
             L+GVR F  +  S EL+VVFDPEV+ SR++VD I G   GKF L V +PY R+ S+D  E
Sbjct  239   LNGVRQFRVDSLSGELDVVFDPEVVNSRTLVDDIEGEGYGKFKLRVMSPYERLTSKDTGE  298

Query  1064  SSSM  1075
             +S M
Sbjct  299   ASKM  302



>ref|XP_008439483.1| PREDICTED: copper-transporting ATPase RAN1 [Cucumis melo]
 gb|ADN34216.1| heavy metal ATPase [Cucumis melo subsp. melo]
Length=1007

 Score =   367 bits (943),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 233/301 (77%), Gaps = 13/301 (4%)
 Frame = +2

Query  212   MSPSMRDVQMTATNG--------NSSEEDFGDCEEVRLLDSYD--EENSGE---NLRRIQ  352
             M+P +RD+Q+             ++++E   D E+VRLLDSY+  EEN G+    ++R+Q
Sbjct  1     MAPGLRDLQLAHVAAADRRLPDISAADEIPDDLEDVRLLDSYERHEENFGQIGDGMKRVQ  60

Query  353   VRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGF  532
             V V+GMTCAACS SVE AL  +NGV+ ASVALLQN+ADVVFDP +VK+KDI+ AIEDAGF
Sbjct  61    VTVSGMTCAACSNSVEAALRGVNGVLMASVALLQNRADVVFDPSLVKEKDIKEAIEDAGF  120

Query  533   EAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGE  712
             EAE++ E  +     +GT+ GQF IGGMTCAACVNSVEGIL  LPGV+RAVVALATS+GE
Sbjct  121   EAEIIPETTSVGKKLHGTLVGQFTIGGMTCAACVNSVEGILKDLPGVRRAVVALATSLGE  180

Query  713   VEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHG  892
             VEYDPT+ SK+DIVNAIEDAGFE S +QSS QDKI+L V GI+G++D+Q LE ILS L G
Sbjct  181   VEYDPTITSKDDIVNAIEDAGFEASFVQSSEQDKILLTVAGIAGEVDVQFLEAILSNLKG  240

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSS  1072
             V+ F ++ TS +LE++FDPEV+G RS+VD I G S  KF LHV +PYTR+ S+D+EE+++
Sbjct  241   VKRFLFDSTSGKLEIIFDPEVVGPRSLVDEIEGRSNRKFKLHVTSPYTRLTSKDVEEANN  300

Query  1073  M  1075
             M
Sbjct  301   M  301



>ref|XP_010441824.1| PREDICTED: copper-transporting ATPase RAN1 [Camelina sativa]
Length=1006

 Score =   367 bits (942),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 234/302 (77%), Gaps = 16/302 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEEN-------------SGENLRRIQ  352
             M+PS RD+Q+T   G+SS     D EEVRLLDSYD+E              +   LR+IQ
Sbjct  1     MAPSRRDLQLTPVTGDSSSSS--DMEEVRLLDSYDDEEDVLSKIEEGGGGGNDSGLRKIQ  58

Query  353   VRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGF  532
             V VTGMTCAACS SVEGALMS+NGV KASVALLQN+ADVVFDP++VK++DI+ AIEDAGF
Sbjct  59    VGVTGMTCAACSNSVEGALMSVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDAGF  118

Query  533   EAEVLAEP-NASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
             EAE+LAEP  ++   T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+G
Sbjct  119   EAEILAEPVTSTGTKTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLG  178

Query  710   EVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLH  889
             EVEYDP VI+K++IV AIEDAGFEG+L+QS+ QDK++L V GI  ++D Q+LEGIL++L+
Sbjct  179   EVEYDPNVINKDEIVTAIEDAGFEGALVQSNQQDKLVLRVEGILNELDAQVLEGILTRLN  238

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESS  1069
             GVR F  +  S ELEVVFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+S
Sbjct  239   GVRQFRLDRISGELEVVFDPEVVSSRSLVDGIEGDGYGKFKLRVMSPYERLTSKDTGEAS  298

Query  1070  SM  1075
             +M
Sbjct  299   NM  300



>emb|CDY39400.1| BnaAnng05310D [Brassica napus]
Length=999

 Score =   366 bits (940),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 233/300 (78%), Gaps = 13/300 (4%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLD------------SYDEENSGENLRRIQV  355
             M+PS RD+Q+T  +G+++ E  G  EEVRLLD              +E + G  LR+IQV
Sbjct  1     MAPSRRDLQLTPLSGDTAAE-IGAMEEVRLLDSYDDDDNDDSLSKIEEGSGGSGLRKIQV  59

Query  356   RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFE  535
              +TGMTCAACS SVEGALMS+NGV KASVALLQN+ADV+FDP++VK++DI+ AIEDAGFE
Sbjct  60    GITGMTCAACSNSVEGALMSVNGVFKASVALLQNRADVLFDPNLVKEEDIKEAIEDAGFE  119

Query  536   AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
             AE+LAEP  S   T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEV
Sbjct  120   AEILAEPVTSGTKTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLGEV  179

Query  716   EYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             EYDP VISK+DIV AIEDAGFEGSL+QS+ QDK++L V G+  ++D Q+LEGIL++L+GV
Sbjct  180   EYDPNVISKDDIVTAIEDAGFEGSLVQSNQQDKLLLRVDGVLNELDAQVLEGILTRLNGV  239

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             R F  +  + ELEVVFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+S+M
Sbjct  240   RQFRLDRITGELEVVFDPEVVSSRSLVDGIEGEGYGKFKLRVMSPYERLTSKDTGEASNM  299



>ref|XP_010494533.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X1 [Camelina 
sativa]
 ref|XP_010494534.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X2 [Camelina 
sativa]
Length=1006

 Score =   365 bits (938),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 192/302 (64%), Positives = 233/302 (77%), Gaps = 16/302 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSG-------------ENLRRIQ  352
             M+PS +D+Q+T   G+SS     D EEVRLLDSYD+E                  LR+IQ
Sbjct  1     MAPSRQDLQLTPVTGDSSSSS--DMEEVRLLDSYDDEEDALSKIEEGGGGGNDSGLRKIQ  58

Query  353   VRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGF  532
             V VTGMTCAACS SVEGALMS+NGV KASVALLQN+ADVVFDP++VK++DI+ AIEDAGF
Sbjct  59    VGVTGMTCAACSNSVEGALMSVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDAGF  118

Query  533   EAEVLAEP-NASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
             EAE+LAEP  ++   T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+G
Sbjct  119   EAEILAEPLTSTGTKTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLG  178

Query  710   EVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLH  889
             EVEYDP VI+K++IV AIEDAGFEG+L+QS+ QDK++L V GI  ++D Q+LEGIL++L+
Sbjct  179   EVEYDPNVINKDEIVTAIEDAGFEGALVQSNQQDKLVLRVEGILNELDAQVLEGILTRLN  238

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESS  1069
             GVR F  +  S ELEVVFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+S
Sbjct  239   GVRQFRLDRISGELEVVFDPEVVSSRSLVDGIEGEGYGKFKLRVMSPYERLTSKDTGEAS  298

Query  1070  SM  1075
             +M
Sbjct  299   NM  300



>emb|CDY69037.1| BnaCnng61530D, partial [Brassica napus]
Length=584

 Score =   353 bits (906),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 184/304 (61%), Positives = 234/304 (77%), Gaps = 18/304 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNS---SEEDFGDCEEVRLLDSYD--EEN----------SGEN-LR  343
             M+PS RD+Q+T   G+S   S+ +  + E VRLLDSYD  EEN          SG++ L+
Sbjct  1     MAPSRRDIQLTRITGHSLGSSDAENEEMEGVRLLDSYDDDEENAHFLSKIEGGSGDSGLK  60

Query  344   RIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
             +IQV +TGMTCAACS +VEGALMS++GV KASVALLQN+ADVVFDP ++K++DI+ AIED
Sbjct  61    KIQVGITGMTCAACSNAVEGALMSVSGVFKASVALLQNRADVVFDPKLIKEEDIKEAIED  120

Query  524   AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
             AGFEAE+LA+P    A T  T+ GQF +GGMTCAACVNSVEGIL  LPGVKRAVVALATS
Sbjct  121   AGFEAEILADP--VTAGTKTTLVGQFTVGGMTCAACVNSVEGILKDLPGVKRAVVALATS  178

Query  704   VGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSK  883
             +GEVEYDP +I+K+DI+ AIEDAGFEGSL+QS+ QDK++L V G+  ++D Q+LEGIL++
Sbjct  179   LGEVEYDPNIINKDDIITAIEDAGFEGSLVQSNQQDKLLLRVDGVLNELDAQVLEGILTR  238

Query  884   LHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEE  1063
             L+GVR F  +  S EL+VVFDPEV+ SR++VD I G   GKF L   +PY R+ S+D  E
Sbjct  239   LNGVRQFRVDSLSGELDVVFDPEVVNSRTLVDDIEGEGYGKFKLRAMSPYERLTSKDTGE  298

Query  1064  SSSM  1075
             +S M
Sbjct  299   ASKM  302



>ref|XP_004134538.1| PREDICTED: copper-transporting ATPase RAN1 [Cucumis sativus]
 gb|KGN49511.1| hypothetical protein Csa_6G526450 [Cucumis sativus]
Length=1007

 Score =   364 bits (935),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 232/301 (77%), Gaps = 13/301 (4%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN-------SSEEDFG-DCEEVRLLDSYD--EENSGE---NLRRIQ  352
             M+P +RD+Q+     +       S+ +D   D E+VRLLDSY+  EEN G+    + R+Q
Sbjct  1     MAPGLRDLQLAHVAADDRRLPAISAADDIPEDLEDVRLLDSYERQEENLGQIRDGMNRVQ  60

Query  353   VRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGF  532
             V V+GMTCAACS SVE AL  +NGV+ ASVALLQN+ADVVFDP +VK++DI+ AIEDAGF
Sbjct  61    VTVSGMTCAACSNSVEAALRGVNGVLMASVALLQNRADVVFDPSLVKEEDIKEAIEDAGF  120

Query  533   EAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGE  712
             EAE++ E  +    ++GT+ GQF IGGMTCAACVNSVEGIL  LPGV+RAVVALATS+GE
Sbjct  121   EAEIIPETTSVGKKSHGTLVGQFTIGGMTCAACVNSVEGILKDLPGVRRAVVALATSLGE  180

Query  713   VEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHG  892
             VEYDPT+ SK+DIVNAIEDAGFE S +QSS QDKI+L V GI+G++D+Q LE ILS L G
Sbjct  181   VEYDPTITSKDDIVNAIEDAGFEASFVQSSEQDKILLTVAGIAGEVDVQFLEAILSNLKG  240

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSS  1072
             V+ F ++ TS  LE+VFDPEV+G RS+VD I G S  KF LHV +PYTR+ S+D+EE+++
Sbjct  241   VKRFLFDSTSGRLEIVFDPEVVGPRSLVDEIEGRSNRKFKLHVTSPYTRLTSKDVEEANN  300

Query  1073  M  1075
             M
Sbjct  301   M  301



>ref|XP_010529297.1| PREDICTED: copper-transporting ATPase RAN1-like [Tarenaya hassleriana]
Length=1031

 Score =   364 bits (934),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 233/309 (75%), Gaps = 21/309 (7%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSS---------EEDFGDCEEVRLLDSYDEENSGE----------  334
             M+PS R VQ+   + +++         + DFG  EEVRLLD+YD+  +G+          
Sbjct  1     MAPSGRGVQLIPVSSSAAAAEAAIGIRDSDFGAMEEVRLLDAYDDGTTGDLSRVEEGGGS  60

Query  335   -NLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIEN  511
               +RRIQVRVTGMTCAACS SVEGAL S+NGV+ ASVALLQN+ADVVFDP +VK++DI+ 
Sbjct  61    GGVRRIQVRVTGMTCAACSNSVEGALRSVNGVLSASVALLQNRADVVFDPDLVKEEDIKE  120

Query  512   AIEDAGFEAEVLAEPNASHANTNGT-VSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVV  688
             AIEDAGFEAE+L+EPN +      T + GQF IGGMTCAACVNSVEGIL  LPGVKRAVV
Sbjct  121   AIEDAGFEAEILSEPNTTGTKAQATTLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVV  180

Query  689   ALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLE  868
             ALATS+GEVEYDP + SK+DIVNAIEDAGFE SL+QSS QD+I+L V GI  + D Q+LE
Sbjct  181   ALATSLGEVEYDPAITSKDDIVNAIEDAGFEASLVQSSQQDQIVLSVNGIFSEFDAQILE  240

Query  869   GILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMAS  1048
             GIL++L GVR F  +  S ELE+VFDPEV+ SRS+VDGI GGS GKF L V NPY R+ S
Sbjct  241   GILTRLSGVRQFCLDRISGELEMVFDPEVVSSRSLVDGIEGGSNGKFKLRVMNPYERLNS  300

Query  1049  RDIEESSSM  1075
             +D  E++SM
Sbjct  301   KDTGEAASM  309



>gb|AAL02122.1| copper-transporting P-type ATPase [Brassica napus]
Length=999

 Score =   362 bits (929),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/300 (63%), Positives = 232/300 (77%), Gaps = 13/300 (4%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLD------------SYDEENSGENLRRIQV  355
             M+PS RD+Q+T  +G+++ E  G  EEVRLLD              +E + G  LR+IQV
Sbjct  1     MAPSRRDLQLTPLSGDTAAE-IGAMEEVRLLDSYDDDDNDDSLSKIEEGSGGSGLRKIQV  59

Query  356   RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFE  535
              +TGMTCAACS SVEGAL+S+NGV KASVALLQN+ADV+FDP++VK++DI+ AIEDAGFE
Sbjct  60    GITGMTCAACSNSVEGALISVNGVFKASVALLQNRADVLFDPNLVKEEDIKEAIEDAGFE  119

Query  536   AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
             AE+LAEP  S   T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEV
Sbjct  120   AEILAEPVTSGTKTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATSLGEV  179

Query  716   EYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             EYDP VISK+DIV AIEDAGFE SL+QS+ QDK++L V G+  ++D Q+LEGIL++L+GV
Sbjct  180   EYDPNVISKDDIVTAIEDAGFESSLVQSNQQDKLLLRVDGVLNELDAQVLEGILTRLNGV  239

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             R F  +  + ELEVVFDPEV+ SRS+VDGI G   GKF L V +PY R+ S+D  E+S+M
Sbjct  240   RQFRLDRITGELEVVFDPEVVSSRSLVDGIEGEGYGKFKLRVMSPYERLTSKDTGEASNM  299



>ref|NP_199292.1| copper-transporting ATPase RAN1 [Arabidopsis thaliana]
 sp|Q9S7J8.1|HMA7_ARATH RecName: Full=Copper-transporting ATPase RAN1; AltName: Full=Protein 
HEAVY METAL ATPASE 7; AltName: Full=Protein RESPONSIVE 
TO ANTAGONIST 1 [Arabidopsis thaliana]
 gb|AAD29109.1|AF082565_1 ATP dependent copper transporter [Arabidopsis thaliana]
 gb|AAD29115.1| ATP dependent copper transporter [Arabidopsis thaliana]
 gb|AAC79141.2| ATP dependent copper transporter (RAN1) [Arabidopsis thaliana]
 dbj|BAB08832.1| ATP dependent copper transporter [Arabidopsis thaliana]
 gb|AED95163.1| copper-transporting ATPase RAN1 [Arabidopsis thaliana]
Length=1001

 Score =   361 bits (927),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 230/301 (76%), Gaps = 19/301 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGEN-------------LRRIQ  352
             M+PS RD+Q+T   G SS +   D EEV LLDSY  E + ++             LR+IQ
Sbjct  1     MAPSRRDLQLTPVTGGSSSQ-ISDMEEVGLLDSYHNEANADDILTKIEEGRDVSGLRKIQ  59

Query  353   VRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGF  532
             V VTGMTCAACS SVE ALM++NGV KASVALLQN+ADVVFDP++VK++DI+ AIEDAGF
Sbjct  60    VGVTGMTCAACSNSVEAALMNVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDAGF  119

Query  533   EAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGE  712
             EAE+LAE       T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVAL+TS+GE
Sbjct  120   EAEILAE-----EQTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALSTSLGE  174

Query  713   VEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHG  892
             VEYDP VI+K+DIVNAIEDAGFEGSL+QS+ QDK++L V GI  ++D Q+LEGIL++L+G
Sbjct  175   VEYDPNVINKDDIVNAIEDAGFEGSLVQSNQQDKLVLRVDGILNELDAQVLEGILTRLNG  234

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSS  1072
             VR F  +  S ELEVVFDPEV+ SRS+VDGI     GKF L V +PY R++S+D  E+S+
Sbjct  235   VRQFRLDRISGELEVVFDPEVVSSRSLVDGIEEDGFGKFKLRVMSPYERLSSKDTGEASN  294

Query  1073  M  1075
             M
Sbjct  295   M  295



>gb|AAK56262.1|AF367273_1 AT5g44790/K23L20_14 [Arabidopsis thaliana]
Length=1001

 Score =   361 bits (926),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 229/301 (76%), Gaps = 19/301 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGEN-------------LRRIQ  352
             M+PS RD+Q+T   G SS +   D EEV LLDSY  E + ++             LR+IQ
Sbjct  1     MAPSRRDLQLTPVTGGSSSQ-ISDMEEVGLLDSYHNEANADDILTKIEEGRDVSGLRKIQ  59

Query  353   VRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGF  532
             V VTGMTCAACS SVE ALM +NGV KASVALLQN+ADVVFDP++VK++DI+ AIEDAGF
Sbjct  60    VGVTGMTCAACSNSVEAALMDVNGVFKASVALLQNRADVVFDPNLVKEEDIKEAIEDAGF  119

Query  533   EAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGE  712
             EAE+LAE       T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVAL+TS+GE
Sbjct  120   EAEILAE-----EQTQATLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALSTSLGE  174

Query  713   VEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHG  892
             VEYDP VI+K+DIVNAIEDAGFEGSL+QS+ QDK++L V GI  ++D Q+LEGIL++L+G
Sbjct  175   VEYDPNVINKDDIVNAIEDAGFEGSLVQSNQQDKLVLRVDGILNELDAQVLEGILTRLNG  234

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSS  1072
             VR F  +  S ELEVVFDPEV+ SRS+VDGI     GKF L V +PY R++S+D  E+S+
Sbjct  235   VRQFRLDRISGELEVVFDPEVVSSRSLVDGIEEDGFGKFKLRVMSPYERLSSKDTGEASN  294

Query  1073  M  1075
             M
Sbjct  295   M  295



>gb|AES65139.2| heavy metal P-type ATPase [Medicago truncatula]
Length=998

 Score =   360 bits (924),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +2

Query  212   MSPSMRDVQMT---ATNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAA  382
             M+ ++RD+Q+T   A    ++ ++  D E VRLLDS D  +  + +RRIQVRV+GMTC A
Sbjct  1     MASAVRDLQLTNLPAGRKIAAVDNSDDLENVRLLDSDDGVD--DEMRRIQVRVSGMTCTA  58

Query  383   CSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNA  562
             CS S+E AL +++GV+ ASVALLQNKADVVF+P +VKD+DI+NAIEDAGFEA++L E + 
Sbjct  59    CSNSIESALKAVDGVLTASVALLQNKADVVFNPALVKDEDIKNAIEDAGFEADILPESSG  118

Query  563   SHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISK  742
                  + T+ GQF IGGMTCAACVNSVEGIL +LPGVKRAVVALATS+GEVEYDP+VISK
Sbjct  119   PGKVPHETLVGQFTIGGMTCAACVNSVEGILRNLPGVKRAVVALATSLGEVEYDPSVISK  178

Query  743   NDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTS  922
             +DIVNAIED+GFE S +QS+ QDKII GVVG+    D Q+LEG+LS + GVR F ++  S
Sbjct  179   DDIVNAIEDSGFEASFVQSNEQDKIIFGVVGVYSLTDTQVLEGMLSNMKGVRQFRFDQLS  238

Query  923   RELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              EL+V+FDP+VL  RS+VDGI+G S GKF LHV++PYTRMAS+D+EE+S++
Sbjct  239   SELDVLFDPQVLSPRSLVDGIHGESNGKFELHVRSPYTRMASKDVEETSTI  289



>ref|XP_003594888.1| Copper-transporting ATPase RAN1 [Medicago truncatula]
Length=1025

 Score =   360 bits (924),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 233/291 (80%), Gaps = 5/291 (2%)
 Frame = +2

Query  212   MSPSMRDVQMT---ATNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAA  382
             M+ ++RD+Q+T   A    ++ ++  D E VRLLDS D  +  + +RRIQVRV+GMTC A
Sbjct  1     MASAVRDLQLTNLPAGRKIAAVDNSDDLENVRLLDSDDGVD--DEMRRIQVRVSGMTCTA  58

Query  383   CSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNA  562
             CS S+E AL +++GV+ ASVALLQNKADVVF+P +VKD+DI+NAIEDAGFEA++L E + 
Sbjct  59    CSNSIESALKAVDGVLTASVALLQNKADVVFNPALVKDEDIKNAIEDAGFEADILPESSG  118

Query  563   SHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISK  742
                  + T+ GQF IGGMTCAACVNSVEGIL +LPGVKRAVVALATS+GEVEYDP+VISK
Sbjct  119   PGKVPHETLVGQFTIGGMTCAACVNSVEGILRNLPGVKRAVVALATSLGEVEYDPSVISK  178

Query  743   NDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTS  922
             +DIVNAIED+GFE S +QS+ QDKII GVVG+    D Q+LEG+LS + GVR F ++  S
Sbjct  179   DDIVNAIEDSGFEASFVQSNEQDKIIFGVVGVYSLTDTQVLEGMLSNMKGVRQFRFDQLS  238

Query  923   RELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              EL+V+FDP+VL  RS+VDGI+G S GKF LHV++PYTRMAS+D+EE+S++
Sbjct  239   SELDVLFDPQVLSPRSLVDGIHGESNGKFELHVRSPYTRMASKDVEETSTI  289



>gb|KFK31609.1| hypothetical protein AALP_AA6G135300 [Arabis alpina]
Length=1010

 Score =   359 bits (921),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 185/304 (61%), Positives = 230/304 (76%), Gaps = 16/304 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN-SSEEDFGDCEEVRLLDSYD--------------EENSGENLRR  346
             M+PS RD+Q+T   G+ SS  + G  EEVRLLDSYD              EE  G  L++
Sbjct  1     MAPSRRDLQLTPITGDGSSATEIGAMEEVRLLDSYDDDDNEEFSDVLSKIEEGGGSGLKK  60

Query  347   IQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDA  526
             IQV VTGMTCAACS SVEGALM+++GV KASVALLQN+ADVVFDP++V++++I+ AIEDA
Sbjct  61    IQVGVTGMTCAACSNSVEGALMNVHGVFKASVALLQNRADVVFDPNLVQEEEIKEAIEDA  120

Query  527   GFEAEVLAE-PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
             GFEAE++ E  + +   T G + GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS
Sbjct  121   GFEAEIMEELVDTTGGKTQGNLVGQFTIGGMTCAACVNSVEGILRDLPGVKRAVVALATS  180

Query  704   VGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSK  883
             +GEVEYDP VI+K+DIV AIEDAGFEG+L+QS+ QDK++L V G+  ++D Q+LEGIL++
Sbjct  181   LGEVEYDPNVINKDDIVTAIEDAGFEGALVQSNQQDKLLLRVDGVLNELDAQVLEGILTR  240

Query  884   LHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEE  1063
             L GVR F  +    ELEVVFDPEV+ SR++VDGI G   GKF L V +PY R+ S+D  E
Sbjct  241   LKGVRQFRLDRILGELEVVFDPEVVSSRTLVDGIEGDGYGKFKLRVMSPYERLTSKDTGE  300

Query  1064  SSSM  1075
             +S M
Sbjct  301   ASVM  304



>ref|XP_004504660.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X2 [Cicer 
arietinum]
Length=998

 Score =   358 bits (919),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 179/290 (62%), Positives = 229/290 (79%), Gaps = 6/290 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACST  391
             M+PS   +Q+T+  G    +D GD E+VRLLDSYD+ +  + ++RIQVR++GMTCAACS 
Sbjct  1     MAPS---IQLTSV-GAGDNDDSGDLEDVRLLDSYDKHDVDDGIKRIQVRISGMTCAACSN  56

Query  392   SVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHA  571
             SVE AL S++GV++ASVALLQNKADVVF+ ++VKD+DI+NAIEDAGFEAE+L EP +   
Sbjct  57    SVEAALKSVDGVIEASVALLQNKADVVFNRNLVKDEDIKNAIEDAGFEAEILHEPGSLGP  116

Query  572   NTNG--TVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                G   V GQF IGGMTCAACVNSVEGIL ++ GVK+AVVALATS+GEVEYDP VISK 
Sbjct  117   KPVGESAVVGQFTIGGMTCAACVNSVEGILKNISGVKKAVVALATSLGEVEYDPNVISKE  176

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DIV AIEDAGFE + +QS++QD+I+LGV+G+   +D ++LE +LS + GVR F ++P   
Sbjct  177   DIVTAIEDAGFEATFVQSTSQDEIVLGVIGVCSLVDARVLENMLSGMKGVRQFRFDPLMS  236

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             EL VVFDP VL SRS+VDGI   S GKF LHV++PY RMAS+D+ +SS+M
Sbjct  237   ELNVVFDPHVLSSRSLVDGIRVVSNGKFKLHVRSPYARMASKDVSDSSTM  286



>ref|XP_004504659.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X1 [Cicer 
arietinum]
Length=995

 Score =   358 bits (919),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 179/290 (62%), Positives = 229/290 (79%), Gaps = 6/290 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACST  391
             M+PS   +Q+T+  G    +D GD E+VRLLDSYD+ +  + ++RIQVR++GMTCAACS 
Sbjct  1     MAPS---IQLTSV-GAGDNDDSGDLEDVRLLDSYDKHDVDDGIKRIQVRISGMTCAACSN  56

Query  392   SVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHA  571
             SVE AL S++GV++ASVALLQNKADVVF+ ++VKD+DI+NAIEDAGFEAE+L EP +   
Sbjct  57    SVEAALKSVDGVIEASVALLQNKADVVFNRNLVKDEDIKNAIEDAGFEAEILHEPGSLGP  116

Query  572   NTNG--TVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                G   V GQF IGGMTCAACVNSVEGIL ++ GVK+AVVALATS+GEVEYDP VISK 
Sbjct  117   KPVGESAVVGQFTIGGMTCAACVNSVEGILKNISGVKKAVVALATSLGEVEYDPNVISKE  176

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DIV AIEDAGFE + +QS++QD+I+LGV+G+   +D ++LE +LS + GVR F ++P   
Sbjct  177   DIVTAIEDAGFEATFVQSTSQDEIVLGVIGVCSLVDARVLENMLSGMKGVRQFRFDPLMS  236

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             EL VVFDP VL SRS+VDGI   S GKF LHV++PY RMAS+D+ +SS+M
Sbjct  237   ELNVVFDPHVLSSRSLVDGIRVVSNGKFKLHVRSPYARMASKDVSDSSTM  286



>ref|XP_009113893.1| PREDICTED: copper-transporting ATPase RAN1-like [Brassica rapa]
Length=1002

 Score =   357 bits (917),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 236/304 (78%), Gaps = 18/304 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNS---SEEDFGDCEEVRLLDSYD--EEN----------SGEN-LR  343
             M+PS RD+Q+T   G+S   S+ +  + E VRLLDSYD  EEN          SG++ L+
Sbjct  1     MAPSRRDIQLTRITGHSLGSSDAENEEMEGVRLLDSYDDDEENAHFLSKIEGGSGDSVLK  60

Query  344   RIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
             +IQV +TGMTCAACS +VEGALMS+NGV KASVALLQN+ADVVFDP+++K++DI+ AIED
Sbjct  61    KIQVGITGMTCAACSNAVEGALMSVNGVFKASVALLQNRADVVFDPNLIKEEDIKEAIED  120

Query  524   AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
             AGFEAE+LA+P    A T  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS
Sbjct  121   AGFEAEILADP--VTAGTKTTLVGQFTIGGMTCAACVNSVEGILKDLPGVKRAVVALATS  178

Query  704   VGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSK  883
             +GEVEYDP +I+K+DI+ AIEDAGFEGSL+QS+ QDK++L V G+  ++D Q+LEGIL++
Sbjct  179   LGEVEYDPNLINKDDIITAIEDAGFEGSLVQSNQQDKLLLRVDGVLNELDAQVLEGILTR  238

Query  884   LHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEE  1063
             L+GVR F  +  S EL+VVFDPEV+ SR++VD I G   GKF L V +PY R+ S+D  E
Sbjct  239   LNGVRQFRVDSLSGELDVVFDPEVVNSRTLVDDIEGEGYGKFKLRVMSPYERLTSKDTGE  298

Query  1064  SSSM  1075
             +S M
Sbjct  299   ASKM  302



>gb|KEH31405.1| heavy metal P-type ATPase [Medicago truncatula]
Length=992

 Score =   355 bits (910),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 184/291 (63%), Positives = 229/291 (79%), Gaps = 9/291 (3%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGEN-LRRIQVRVTGMTCAACS  388
             M+PS   +Q+T+       ED GD E+VRLLDSYD+ +  ++   RIQVR+TGMTCAACS
Sbjct  1     MAPS---IQLTSAGAG---EDSGDLEDVRLLDSYDKNDVNDDGTNRIQVRITGMTCAACS  54

Query  389   TSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASH  568
              SVE ALMS++GV++ASVALLQNKADVVF+ ++VKD+DI+NAIEDAGFEAE+L EP ++ 
Sbjct  55    NSVEAALMSVDGVIQASVALLQNKADVVFNRNLVKDEDIKNAIEDAGFEAEILHEPVSTG  114

Query  569   ANTNG--TVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISK  742
                 G  TV GQF IGGMTCAACVNSVEGIL+ + GVK+AVVALATS+GEVEYDP VISK
Sbjct  115   PKPVGDSTVVGQFTIGGMTCAACVNSVEGILNDITGVKKAVVALATSLGEVEYDPIVISK  174

Query  743   NDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTS  922
              DIV AIEDAGFE S +QS++QD+I+LGVVG+   +D ++LE +LS + GVR F ++P  
Sbjct  175   EDIVTAIEDAGFEASFVQSTSQDEIVLGVVGVCSLVDARVLESMLSGMKGVRQFRFDPLL  234

Query  923   RELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              EL VVFDP+VL SRS+VD I   S  K+TLHV++PY RMAS+D  ESSSM
Sbjct  235   SELNVVFDPQVLSSRSLVDEIRVVSNDKYTLHVRSPYARMASKDGSESSSM  285



>ref|XP_008809603.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X2 [Phoenix 
dactylifera]
Length=938

 Score =   353 bits (905),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/305 (58%), Positives = 228/305 (75%), Gaps = 17/305 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN------SSEEDFGDCEEVRLLDSYDEENSGENL-----------  340
             M+PS+RD+Q+T  +G       S  ED GD E+VRLLDSYD E     +           
Sbjct  1     MAPSLRDLQLTPLSGRRRPEAISVREDSGDLEDVRLLDSYDLEEPPPPVADARGGDEKEA  60

Query  341   RRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE  520
             +RIQVRV+GMTC+AC+ SVE A+ +L GV +ASV+LLQNKA VVFDP++VKD+DI++AI+
Sbjct  61    KRIQVRVSGMTCSACTNSVEAAITALGGVTRASVSLLQNKAHVVFDPNLVKDEDIKDAID  120

Query  521   DAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
             DAGFEAE+L + N + + +   +SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVALAT
Sbjct  121   DAGFEAEILPDSNNTMSRSQKVLSGQFRIGGMTCAACVNSVEGILRKLPGVKRAVVALAT  180

Query  701   SVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILS  880
             S+GEVEYDP+VISK++IV+AIEDAGF+ + +QSS QDKI+LGV G+S + D+ +L+GIL 
Sbjct  181   SLGEVEYDPSVISKDEIVHAIEDAGFDAAFLQSSDQDKILLGVDGLSSEKDVHVLQGILR  240

Query  881   KLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIE  1060
              + GVR F  N +  E+EV+FDPE +G R +VD I  GSGG+  +HV+NPY   AS D +
Sbjct  241   NMTGVRQFEVNISLLEVEVIFDPEAIGLRLIVDSIERGSGGRLKMHVRNPYALAASSDAQ  300

Query  1061  ESSSM  1075
             E+S M
Sbjct  301   EASKM  305



>ref|XP_009412056.1| PREDICTED: copper-transporting ATPase RAN1-like [Musa acuminata 
subsp. malaccensis]
Length=1014

 Score =   353 bits (906),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 226/306 (74%), Gaps = 18/306 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN---SSEEDFGDCEEVRLLDSYDEENSGEN---------------  337
             M+ + RD+Q+T+  G    S+ ED G+ E+VRLLDSYDEE+  E                
Sbjct  1     MARNPRDIQLTSATGRRAISAREDDGNLEDVRLLDSYDEESVAEEGSGREGEEEEEEEKG  60

Query  338   LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
             +RRIQVRVTGMTC+AC+ SVEGA+ +L GV +ASV+LLQNKA VVFDP +VKD+DI +AI
Sbjct  61    MRRIQVRVTGMTCSACTASVEGAISTLPGVARASVSLLQNKAHVVFDPSLVKDEDIRDAI  120

Query  518   EDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALA  697
             EDAGFEAEVL E N S   +  T+SGQF IGGMTC+ACVNS+EGILS LPGVKRAVVALA
Sbjct  121   EDAGFEAEVLPESNNSQTRSQKTLSGQFRIGGMTCSACVNSIEGILSKLPGVKRAVVALA  180

Query  698   TSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGIL  877
             TS+GEVEYDP+VI K +IVNAIEDAGF+ + +QSS QDK +L V G+S ++D+ +++GIL
Sbjct  181   TSLGEVEYDPSVIRKEEIVNAIEDAGFDAAFLQSSEQDKALLSVAGLSSEIDVHVIQGIL  240

Query  878   SKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDI  1057
               L GVR F  + +  E+EV+FDPE +G RS+VD I  GS GK    V++PYT  AS  +
Sbjct  241   RDLKGVRQFAMSSSLSEVEVIFDPEAIGLRSIVDSIEQGSNGKLKASVQSPYTLAASNHV  300

Query  1058  EESSSM  1075
             EE+S M
Sbjct  301   EEASKM  306



>ref|XP_008809602.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X1 [Phoenix 
dactylifera]
Length=1012

 Score =   352 bits (904),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 176/305 (58%), Positives = 228/305 (75%), Gaps = 17/305 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN------SSEEDFGDCEEVRLLDSYDEENSGENL-----------  340
             M+PS+RD+Q+T  +G       S  ED GD E+VRLLDSYD E     +           
Sbjct  1     MAPSLRDLQLTPLSGRRRPEAISVREDSGDLEDVRLLDSYDLEEPPPPVADARGGDEKEA  60

Query  341   RRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE  520
             +RIQVRV+GMTC+AC+ SVE A+ +L GV +ASV+LLQNKA VVFDP++VKD+DI++AI+
Sbjct  61    KRIQVRVSGMTCSACTNSVEAAITALGGVTRASVSLLQNKAHVVFDPNLVKDEDIKDAID  120

Query  521   DAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
             DAGFEAE+L + N + + +   +SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVALAT
Sbjct  121   DAGFEAEILPDSNNTMSRSQKVLSGQFRIGGMTCAACVNSVEGILRKLPGVKRAVVALAT  180

Query  701   SVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILS  880
             S+GEVEYDP+VISK++IV+AIEDAGF+ + +QSS QDKI+LGV G+S + D+ +L+GIL 
Sbjct  181   SLGEVEYDPSVISKDEIVHAIEDAGFDAAFLQSSDQDKILLGVDGLSSEKDVHVLQGILR  240

Query  881   KLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIE  1060
              + GVR F  N +  E+EV+FDPE +G R +VD I  GSGG+  +HV+NPY   AS D +
Sbjct  241   NMTGVRQFEVNISLLEVEVIFDPEAIGLRLIVDSIERGSGGRLKMHVRNPYALAASSDAQ  300

Query  1061  ESSSM  1075
             E+S M
Sbjct  301   EASKM  305



>ref|XP_007138840.1| hypothetical protein PHAVU_009G241800g [Phaseolus vulgaris]
 gb|ESW10834.1| hypothetical protein PHAVU_009G241800g [Phaseolus vulgaris]
Length=989

 Score =   351 bits (901),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 177/263 (67%), Positives = 214/263 (81%), Gaps = 2/263 (1%)
 Frame = +2

Query  287   EEVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKAD  466
             E+VRLLDSYDE ++G   RRIQV VTGMTCAACS SVE AL SL+GV+ ASVALLQNKAD
Sbjct  25    EDVRLLDSYDEIDAGA--RRIQVTVTGMTCAACSNSVESALKSLDGVISASVALLQNKAD  82

Query  467   VVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVE  646
             VVF+  ++KD+DI+NAIEDAGFEA++L E +      +GT+ GQF IGGMTCAACVNSVE
Sbjct  83    VVFNSALLKDEDIKNAIEDAGFEADILPESSTVGKMPHGTLVGQFTIGGMTCAACVNSVE  142

Query  647   GILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILG  826
             GIL  LPGVKRAVVALATS GEVEYD +VISK+DIVNAIED+GF+ S +QS+ QDKIILG
Sbjct  143   GILRKLPGVKRAVVALATSSGEVEYDSSVISKDDIVNAIEDSGFDASFLQSNEQDKIILG  202

Query  827   VVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGK  1006
             VVG+   +D Q+LEGI+S + GVR F ++  S EL+V+FDPEVL SRS+VD I GGS GK
Sbjct  203   VVGVYSVIDGQVLEGIISSIKGVRQFHFDQISGELDVLFDPEVLSSRSLVDAIQGGSNGK  262

Query  1007  FTLHVKNPYTRMASRDIEESSSM  1075
             F LHV++P+ RM S+  EE S++
Sbjct  263   FKLHVRSPHMRMTSKGAEEISTI  285



>ref|XP_003524125.1| PREDICTED: copper-transporting ATPase RAN1-like [Glycine max]
Length=994

 Score =   347 bits (891),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 182/290 (63%), Positives = 222/290 (77%), Gaps = 5/290 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENS-GENLRRIQVRVTGMTCAACS  388
             M+PS  DVQ+T+    +S ED  D E+VRLLDSYD+ +   +  +RIQVR+TGMTCAACS
Sbjct  1     MAPSTGDVQLTSP---ASGEDSDDLEDVRLLDSYDKNDVVHDETKRIQVRITGMTCAACS  57

Query  389   TSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASH  568
              SVE AL S++G+ +ASVALLQNKADVVF P +VKD+DI+NAIEDAGFEAE+L +  A  
Sbjct  58    NSVETALRSVHGITEASVALLQNKADVVFVPGLVKDEDIKNAIEDAGFEAEILPDSGAVA  117

Query  569   ANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                       QF IGGMTCAACVNS+EGIL +L GVKRAVVALATS+GEVEYDP VISK+
Sbjct  118   HGGAAAAVVGQFTIGGMTCAACVNSIEGILRNLNGVKRAVVALATSLGEVEYDPNVISKD  177

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DIV AIEDAGFEG+ +QS+ QD+I+LGV G+    D Q+LE +LS   GVR F ++    
Sbjct  178   DIVAAIEDAGFEGTFVQSNGQDQIVLGVSGVYSLGDAQVLEAMLSGTKGVRQFRFDTAVN  237

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             EL+VVFDPEV+ SRS+VDGI  GS G+F LHV+NPY RMAS+D  ESS+M
Sbjct  238   ELDVVFDPEVISSRSLVDGIQLGSNGRFKLHVRNPYARMASKDGSESSTM  287



>gb|AGO68203.1| heavy metal ATPase 7 [Silene latifolia]
Length=996

 Score =   347 bits (891),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 179/290 (62%), Positives = 222/290 (77%), Gaps = 2/290 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGE--NLRRIQVRVTGMTCAAC  385
             M+ S+RDVQ+T       + + G  E+VRLLD +D +N G   N R+I+V V GMTCAAC
Sbjct  1     MALSVRDVQLTPAYSGGDDLESGHLEDVRLLDDFDIQNRGGGGNSRKIKVNVGGMTCAAC  60

Query  386   STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
             S SVE AL S++GV +ASVALLQN+A VVFDP ++KD+DI+ AIEDAGFEAE+L E  +S
Sbjct  61    SNSVESALRSVHGVHEASVALLQNQASVVFDPDLLKDEDIKAAIEDAGFEAEILPEAKSS  120

Query  566   HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                 N  ++GQF IGGMTCAACV SVEG+L  LPGV RAVV+L T++GEVEYDPTVI+K+
Sbjct  121   QTAPNKILTGQFNIGGMTCAACVMSVEGVLKELPGVVRAVVSLTTNLGEVEYDPTVINKD  180

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
              IVNAIEDAGF+GSL+QSS Q KIIL VVGIS ++D Q LEG+L  + GVR F +  TS+
Sbjct  181   GIVNAIEDAGFDGSLVQSSEQGKIILEVVGISSEVDPQYLEGLLCHIKGVRKFSFERTSK  240

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             ELEV FD EV+GSRS+VD I+  SGG F + VKNP TRM S+++EESS M
Sbjct  241   ELEVCFDSEVIGSRSLVDAIDEASGGLFKIRVKNPLTRMTSKNLEESSKM  290



>gb|KHN28939.1| Copper-transporting ATPase RAN1 [Glycine soja]
Length=1010

 Score =   348 bits (892),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 225/289 (78%), Gaps = 4/289 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENS-GENLRRIQVRVTGMTCAACS  388
             M+PS  DVQ+T+       +DF D E++RLLDSYD+ +   +  +RIQVR++GMTCAACS
Sbjct  1     MAPSTGDVQLTSPGAG---QDFDDLEDIRLLDSYDKNDVVHDETKRIQVRISGMTCAACS  57

Query  389   TSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASH  568
              SV+ AL S++GV +ASVALLQNKA+VVF P +VKD+DI+NAIEDAGFEAE+L +  A  
Sbjct  58    NSVQTALRSVHGVTEASVALLQNKAEVVFIPGLVKDEDIKNAIEDAGFEAEILPDSGAVA  117

Query  569   ANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKND  748
                + +V GQF I GMTCAACVNSVEGIL +L GVKRAVVALATS+GEVEYDP VISK+D
Sbjct  118   HAASASVLGQFTIVGMTCAACVNSVEGILRNLNGVKRAVVALATSLGEVEYDPHVISKHD  177

Query  749   IVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRE  928
             IV+AIEDAGFEG+ +QS+ +D+I+LGV G+    D Q+LE +LS   GVR F ++    E
Sbjct  178   IVSAIEDAGFEGAFVQSNGRDQIVLGVSGVYSLGDAQVLEAMLSGTKGVRQFRFDTAVNE  237

Query  929   LEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             L+VVFDPEV+ SRS+VDGI  GS GKF LHV+NPY RMAS+D  ESS+M
Sbjct  238   LDVVFDPEVISSRSLVDGIQLGSNGKFKLHVRNPYARMASKDGSESSAM  286



>ref|XP_010941680.1| PREDICTED: copper-transporting ATPase RAN1 isoform X2 [Elaeis 
guineensis]
Length=856

 Score =   344 bits (882),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 228/302 (75%), Gaps = 14/302 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN------SSEEDFGDCEEVRLLDSYDEENSG--------ENLRRI  349
             M+PS+RD+Q+TA +G+      S+ ED GD E+VRLLDSYDE  +         +  RRI
Sbjct  1     MAPSLRDLQLTALSGHRRPEAISAREDSGDLEDVRLLDSYDEAAAAAEGRGGDEKGARRI  60

Query  350   QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
             QVRVTGMTC+AC+ SVE A+ +L GV +ASV+LLQNKA VVFDP++VKD+DI++AIEDAG
Sbjct  61    QVRVTGMTCSACTNSVEAAINALPGVARASVSLLQNKAHVVFDPNLVKDEDIKDAIEDAG  120

Query  530   FEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
             FEA++L + N + +     +SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+G
Sbjct  121   FEADILPDSNNTMSRPQKVLSGQFRIGGMTCAACVNSVEGILRKLPGVKRAVVALATSLG  180

Query  710   EVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLH  889
             EVEYDP+VISK++I +AIEDAGF+ + +QSS QD+I+LGV  ++ + D+ +L+GILS + 
Sbjct  181   EVEYDPSVISKDEIAHAIEDAGFDATFLQSSDQDRILLGVDSLTTETDVHVLQGILSNMK  240

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESS  1069
             GVR F  N +  E+E++FDP+ +G R +VD +   S G+   HV+NPY R AS D +E+S
Sbjct  241   GVRQFEVNISLSEVEIIFDPQAVGLRHMVDTVERESIGRLKAHVRNPYARAASSDAQEAS  300

Query  1070  SM  1075
              M
Sbjct  301   KM  302



>gb|AGO68204.1| heavy metal ATPase 7 [Silene vulgaris]
Length=998

 Score =   345 bits (885),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 222/292 (76%), Gaps = 4/292 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSG----ENLRRIQVRVTGMTCA  379
             M+ S++DVQ+T       + + G  E+VRLLD +D ++ G     N R+I+V V GMTCA
Sbjct  1     MALSVKDVQLTPAYSGGDDLESGHLEDVRLLDDFDIQSGGGGGGRNTRKIKVSVGGMTCA  60

Query  380   ACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPN  559
             ACS SVE AL S++GV +ASVALLQN+A VVFDP ++KD+DI+ AIEDAGFEAE+L E  
Sbjct  61    ACSNSVESALRSVHGVHEASVALLQNQASVVFDPDLLKDEDIKAAIEDAGFEAEILPEAT  120

Query  560   ASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVIS  739
             +S    N  ++GQF IGGMTCAACV SVEG+L  LPGV RAVV+L T++GEVEYDPTVI+
Sbjct  121   SSQPAPNKILTGQFNIGGMTCAACVMSVEGVLKELPGVVRAVVSLTTNLGEVEYDPTVIN  180

Query  740   KNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPT  919
             K+DIVNAIEDAGFEGSL+QSS Q KIIL VVGIS ++D Q LE +L  + GVR F +  T
Sbjct  181   KDDIVNAIEDAGFEGSLVQSSEQGKIILEVVGISSEVDPQYLESLLCHIKGVRQFSFERT  240

Query  920   SRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             S+ELEV FD EV+GSRS+VD I+  SGG F + VKNP TRM S+++EESS M
Sbjct  241   SKELEVCFDSEVIGSRSLVDAIDEASGGLFKIRVKNPLTRMTSKNLEESSKM  292



>ref|XP_003532660.1| PREDICTED: copper-transporting ATPase RAN1-like [Glycine max]
Length=994

 Score =   345 bits (884),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 180/290 (62%), Positives = 224/290 (77%), Gaps = 5/290 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENS-GENLRRIQVRVTGMTCAACS  388
             M+PS  DVQ+T+       +DF D E++RLLDSYD+ +   +  +RIQVR++GMTCAACS
Sbjct  1     MAPSTGDVQLTSPGAG---QDFDDLEDIRLLDSYDKNDVVHDETKRIQVRISGMTCAACS  57

Query  389   TSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASH  568
              SV+ AL S++GV +ASVALLQNKA+VVF P +VKD+DI+NAIEDAGFEAE+L +  A+ 
Sbjct  58    NSVQTALRSVHGVTEASVALLQNKAEVVFIPGLVKDEDIKNAIEDAGFEAEILPDSGAAA  117

Query  569   ANTNGT-VSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                    V GQF I GMTCAACVNSVEGIL +L GVKRAVVALATS+GEVEYDP VISK+
Sbjct  118   HAAASAAVLGQFTIVGMTCAACVNSVEGILRNLNGVKRAVVALATSLGEVEYDPHVISKD  177

Query  746   DIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSR  925
             DIV+AIEDAGFEG+ +QS+ +D+I+LGV G+    D Q+LE +LS   GVR F ++    
Sbjct  178   DIVSAIEDAGFEGAFVQSNGRDQIVLGVSGVYSLGDAQVLEAMLSGTKGVRQFRFDTAVN  237

Query  926   ELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             EL+VVFDPEV+ SRS+VDGI  GS GKF LHV+NPY RMAS+D  ESS+M
Sbjct  238   ELDVVFDPEVISSRSLVDGIQLGSNGKFKLHVRNPYARMASKDGSESSAM  287



>ref|XP_010941679.1| PREDICTED: copper-transporting ATPase RAN1 isoform X1 [Elaeis 
guineensis]
Length=1009

 Score =   344 bits (883),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 228/302 (75%), Gaps = 14/302 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN------SSEEDFGDCEEVRLLDSYDEENSG--------ENLRRI  349
             M+PS+RD+Q+TA +G+      S+ ED GD E+VRLLDSYDE  +         +  RRI
Sbjct  1     MAPSLRDLQLTALSGHRRPEAISAREDSGDLEDVRLLDSYDEAAAAAEGRGGDEKGARRI  60

Query  350   QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
             QVRVTGMTC+AC+ SVE A+ +L GV +ASV+LLQNKA VVFDP++VKD+DI++AIEDAG
Sbjct  61    QVRVTGMTCSACTNSVEAAINALPGVARASVSLLQNKAHVVFDPNLVKDEDIKDAIEDAG  120

Query  530   FEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
             FEA++L + N + +     +SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+G
Sbjct  121   FEADILPDSNNTMSRPQKVLSGQFRIGGMTCAACVNSVEGILRKLPGVKRAVVALATSLG  180

Query  710   EVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLH  889
             EVEYDP+VISK++I +AIEDAGF+ + +QSS QD+I+LGV  ++ + D+ +L+GILS + 
Sbjct  181   EVEYDPSVISKDEIAHAIEDAGFDATFLQSSDQDRILLGVDSLTTETDVHVLQGILSNMK  240

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESS  1069
             GVR F  N +  E+E++FDP+ +G R +VD +   S G+   HV+NPY R AS D +E+S
Sbjct  241   GVRQFEVNISLSEVEIIFDPQAVGLRHMVDTVERESIGRLKAHVRNPYARAASSDAQEAS  300

Query  1070  SM  1075
              M
Sbjct  301   KM  302



>gb|AGO68202.1| heavy metal ATPase 7 [Silene vulgaris]
Length=1000

 Score =   344 bits (882),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 222/294 (76%), Gaps = 6/294 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSG------ENLRRIQVRVTGMT  373
             M+ S++DVQ+T       + + G  E+VRLLD +D ++ G       N R+I+V V GMT
Sbjct  1     MALSVKDVQLTPAYSGGDDLESGHLEDVRLLDDFDIQSGGGGGGGGRNTRKIKVSVGGMT  60

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             CAACS SVE AL S++GV +ASVALLQN+A VVFDP ++KD+DI+ AIEDAGFEAE+L E
Sbjct  61    CAACSNSVESALRSVHGVHEASVALLQNQASVVFDPDLLKDEDIKAAIEDAGFEAEILPE  120

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
               +S    N  ++GQF IGGMTCAACV SVEG+L  LPGV RAVV+L T++GEVEYDPTV
Sbjct  121   AKSSQPAPNKILTGQFNIGGMTCAACVMSVEGVLKELPGVVRAVVSLTTNLGEVEYDPTV  180

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             I+K+DIVNAIEDAGFEGSL+QSS Q KIIL VVGIS ++D Q LE +L  + GVR F + 
Sbjct  181   INKDDIVNAIEDAGFEGSLVQSSEQGKIILEVVGISSEVDPQYLESLLCHIKGVRQFSFE  240

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              TS+ELEV FD EV+GSRS+VD I+  SGG F + VKNP TRM S+++EESS M
Sbjct  241   RTSKELEVCFDSEVIGSRSLVDAIDEASGGLFKIRVKNPLTRMTSKNLEESSKM  294



>gb|KHN25921.1| Copper-transporting ATPase RAN1 [Glycine soja]
Length=980

 Score =   343 bits (881),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/289 (63%), Positives = 221/289 (76%), Gaps = 17/289 (6%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENS-GENLRRIQVRVTGMTCAACS  388
             M+PS  DVQ+T+    +S ED  D E+VRLLDSYD+ +   +  +RIQVR+TGMTCAACS
Sbjct  1     MAPSTGDVQLTSP---ASGEDSDDLEDVRLLDSYDKNDVVHDETKRIQVRITGMTCAACS  57

Query  389   TSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASH  568
              SVE AL  ++G+ +ASVALLQNKADVVF P +VKD+DI+NAIEDAGFEAE+L +     
Sbjct  58    NSVETAL-PVHGITEASVALLQNKADVVFVPGLVKDEDIKNAIEDAGFEAEILPD-----  111

Query  569   ANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKND  748
                    SG F IGGMTCAACVNS+EGIL +L GVKRAVVALATS+GEVEYDP VISK+D
Sbjct  112   -------SGAFTIGGMTCAACVNSIEGILRNLNGVKRAVVALATSLGEVEYDPNVISKDD  164

Query  749   IVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRE  928
             IV AIEDAGFEG+ +QS+ QD+I+LGV G+    D Q+LE +LS   GVR F ++    E
Sbjct  165   IVAAIEDAGFEGTFVQSNGQDQIVLGVSGVYSLGDAQVLEAMLSGTKGVRQFRFDTAVNE  224

Query  929   LEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             L+VVFDPEV+ SRS+VDGI  GS G+F LHV+NPY RMAS+D  ESS+M
Sbjct  225   LDVVFDPEVISSRSLVDGIQLGSNGRFKLHVRNPYARMASKDGSESSTM  273



>ref|XP_009402537.1| PREDICTED: copper-transporting ATPase RAN1-like [Musa acuminata 
subsp. malaccensis]
Length=1011

 Score =   344 bits (882),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 227/303 (75%), Gaps = 15/303 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGN---SSEEDFGDCEEVRLLDSYDEENSG------------ENLRR  346
             M+P++RD+Q+++  G    S+  D GD E+VRLLDSYDEE +             + +RR
Sbjct  1     MAPNLRDIQLSSAAGRRGISARGDDGDLEDVRLLDSYDEEEAAALPEWTGREEADKGVRR  60

Query  347   IQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDA  526
             IQVRVTGMTC+AC+ +VEGA+ +L GV +ASV+LLQNKA VVFDP++V+D DI +AIEDA
Sbjct  61    IQVRVTGMTCSACTGAVEGAISALPGVARASVSLLQNKAHVVFDPNLVEDVDIRDAIEDA  120

Query  527   GFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSV  706
             GFEAEVL + + S   +  T+SGQF IGGMTC+ACVNS+EGILS LPGVKRAVVALATS+
Sbjct  121   GFEAEVLPDSSNSQMRSQKTLSGQFTIGGMTCSACVNSIEGILSKLPGVKRAVVALATSL  180

Query  707   GEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKL  886
             GEVEYDP+VI+K++IV+AIEDAGF+ + +QS+ QDK++L V G S   D+ +++GIL  L
Sbjct  181   GEVEYDPSVITKDEIVHAIEDAGFDAAFLQSNEQDKVLLTVAGFSSISDVHVIQGILRNL  240

Query  887   HGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEES  1066
              GV+ F  N +  E+EV+FDPE +G RS+VD I  GS GK    V++PYT + S  +EE+
Sbjct  241   KGVKQFEANISLSEVEVIFDPEAIGLRSIVDAIEKGSNGKLKASVQSPYTLVTSNHVEEA  300

Query  1067  SSM  1075
             S M
Sbjct  301   SKM  303



>ref|XP_008798210.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X1 [Phoenix 
dactylifera]
Length=1010

 Score =   343 bits (881),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/303 (57%), Positives = 223/303 (74%), Gaps = 15/303 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNS------SEEDFGDCEEVRLLDSYDEENSG---------ENLRR  346
             M+ S+RD+Q+T  +G+       + ED GD E+VRLLDSYDEE +          +  RR
Sbjct  1     MAASLRDLQLTPLSGHRRPEAILAREDSGDLEDVRLLDSYDEETAAAAEGRGGDEKGARR  60

Query  347   IQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDA  526
             IQVRVTGMTC+AC+ SVE A+ +L GV +ASV+LLQNKA VVFDP +VKD+DI++AIEDA
Sbjct  61    IQVRVTGMTCSACTNSVEAAITALPGVARASVSLLQNKAHVVFDPSLVKDEDIKDAIEDA  120

Query  527   GFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSV  706
             GFEAE+L + N + +     +SGQF IGGMTCAACVNSVEGIL  LPGVKRA VALATS+
Sbjct  121   GFEAEILPDSNNTLSRPQKVLSGQFRIGGMTCAACVNSVEGILRKLPGVKRAAVALATSL  180

Query  707   GEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKL  886
             GEVEYDP+VISK+ I +AIEDAGF+ + +QS+ QDKI+LGV  +S + D+ +L+GILSK+
Sbjct  181   GEVEYDPSVISKDAIAHAIEDAGFDAAFLQSNDQDKILLGVARLSSETDVHVLQGILSKM  240

Query  887   HGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEES  1066
              GVR F  N    E+E++FDP+ +G R +VD I   S G+   HV+NPY + AS D +E+
Sbjct  241   SGVRQFEVNIGLSEVEIIFDPQAVGLRHIVDTIERESIGRLKAHVRNPYAQAASSDAQEA  300

Query  1067  SSM  1075
             S M
Sbjct  301   SKM  303



>ref|XP_008798211.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X2 [Phoenix 
dactylifera]
Length=1009

 Score =   343 bits (880),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/303 (57%), Positives = 223/303 (74%), Gaps = 15/303 (5%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNS------SEEDFGDCEEVRLLDSYDEENSG---------ENLRR  346
             M+ S+RD+Q+T  +G+       + ED GD E+VRLLDSYDEE +          +  RR
Sbjct  1     MAASLRDLQLTPLSGHRRPEAILAREDSGDLEDVRLLDSYDEETAAAAEGRGGDEKGARR  60

Query  347   IQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDA  526
             IQVRVTGMTC+AC+ SVE A+ +L GV +ASV+LLQNKA VVFDP +VKD+DI++AIEDA
Sbjct  61    IQVRVTGMTCSACTNSVEAAITALPGVARASVSLLQNKAHVVFDPSLVKDEDIKDAIEDA  120

Query  527   GFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSV  706
             GFEAE+L + N + +     +SGQF IGGMTCAACVNSVEGIL  LPGVKRA VALATS+
Sbjct  121   GFEAEILPDSNNTLSRPQKVLSGQFRIGGMTCAACVNSVEGILRKLPGVKRAAVALATSL  180

Query  707   GEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKL  886
             GEVEYDP+VISK+ I +AIEDAGF+ + +QS+ QDKI+LGV  +S + D+ +L+GILSK+
Sbjct  181   GEVEYDPSVISKDAIAHAIEDAGFDAAFLQSNDQDKILLGVARLSSETDVHVLQGILSKM  240

Query  887   HGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEES  1066
              GVR F  N    E+E++FDP+ +G R +VD I   S G+   HV+NPY + AS D +E+
Sbjct  241   SGVRQFEVNIGLSEVEIIFDPQAVGLRHIVDTIERESIGRLKAHVRNPYAQAASSDAQEA  300

Query  1067  SSM  1075
             S M
Sbjct  301   SKM  303



>gb|AGO68201.1| heavy metal ATPase 7 [Silene vulgaris]
Length=998

 Score =   331 bits (849),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 173/292 (59%), Positives = 218/292 (75%), Gaps = 4/292 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSG----ENLRRIQVRVTGMTCA  379
             M+ S++DVQ+T       + + G  E+VRLLD +D ++ G     N R+I+V V GMTCA
Sbjct  1     MALSVKDVQLTPAYSGGDDLESGHLEDVRLLDDFDIQSGGGGGGRNTRKIKVSVGGMTCA  60

Query  380   ACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPN  559
             ACS SVE AL S++GV +ASVALLQN+A VVFDP ++KD+DI+ AIEDAGF+AE+L E  
Sbjct  61    ACSNSVESALRSVHGVHEASVALLQNQACVVFDPDLLKDEDIKAAIEDAGFDAEILPEAK  120

Query  560   ASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVIS  739
             +S    N  ++ QF IGGMTCAACV SVEG+L  LPGV RAVV+L T++GEVEYDPTVI+
Sbjct  121   SSQPAPNKILTRQFNIGGMTCAACVMSVEGVLKELPGVVRAVVSLTTNLGEVEYDPTVIN  180

Query  740   KNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPT  919
             K+ IVNAIEDAGFEGSL+QSS Q KIIL VVGIS ++D Q LE +L  + GVR F +  T
Sbjct  181   KDGIVNAIEDAGFEGSLVQSSEQGKIILEVVGISSEVDPQYLESLLCHIKGVRQFSFERT  240

Query  920   SRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             S+EL V FD EV+G RS+VD I+  SGG F + VKNP TRM S+++EESS M
Sbjct  241   SKELGVCFDSEVIGPRSLVDAIDEASGGLFKIRVKNPLTRMTSKNLEESSKM  292



>ref|XP_007158884.1| hypothetical protein PHAVU_002G190000g [Phaseolus vulgaris]
 gb|ESW30878.1| hypothetical protein PHAVU_002G190000g [Phaseolus vulgaris]
Length=993

 Score =   330 bits (845),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/289 (62%), Positives = 218/289 (75%), Gaps = 4/289 (1%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEEN-SGENLRRIQVRVTGMTCAACS  388
             M+P+  D+Q+T+       +D    E+VRLLDSYD      +  +RIQVR+TGMTCAACS
Sbjct  1     MAPTTGDLQLTSPGAGEHSDDL---EDVRLLDSYDTHYIHHDETKRIQVRITGMTCAACS  57

Query  389   TSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASH  568
              SVE AL S++GV  ASVALLQNKADV+F+P +VKD DI+NAIEDAGFEAE+L E   + 
Sbjct  58    NSVETALRSVDGVTHASVALLQNKADVIFNPSLVKDDDIKNAIEDAGFEAEILRESGPAD  117

Query  569   ANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKND  748
                   V GQF IGGMTCAACVNSVEGIL  L GVK AVVALATS+GEVEYDP VISK+D
Sbjct  118   RGGGAAVVGQFTIGGMTCAACVNSVEGILKRLNGVKIAVVALATSLGEVEYDPNVISKDD  177

Query  749   IVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRE  928
             IV AIEDAGFEGS +QS+ Q +++LGV G+    D ++LEG+LS L GVR F ++P   E
Sbjct  178   IVAAIEDAGFEGSFVQSNGQGQVVLGVGGVYSLGDAKVLEGMLSGLKGVRQFRFDPVLNE  237

Query  929   LEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             L+VV+D EV+ SRS+VDGI+ GS GKF LHV+NPY RMAS+D  E+S+M
Sbjct  238   LDVVYDLEVISSRSLVDGIHLGSNGKFRLHVRNPYARMASKDGSETSNM  286



>ref|XP_004951760.1| PREDICTED: copper-transporting ATPase RAN1-like [Setaria italica]
Length=993

 Score =   318 bits (815),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 164/289 (57%), Positives = 210/289 (73%), Gaps = 9/289 (3%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEEN---SGEN--LRRIQVRVTGMTCAACS  388
             M  +Q+TA  G + +E     EEV LL SYDEE    +G++  +RR+QVRV GMTC+AC+
Sbjct  1     MAHLQLTALAGGADDE----MEEVALLGSYDEEAGVAAGDDAGMRRVQVRVAGMTCSACT  56

Query  389   TSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASH  568
              +VE AL +  GV +A+V+LLQN+ADVVFDP + KD+DI  AIEDAGFEAE+L +   S 
Sbjct  57    GAVEAALSARRGVRRAAVSLLQNRADVVFDPALAKDEDIVEAIEDAGFEAEILPDSTVSQ  116

Query  569   ANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKND  748
               +  T+SGQF IGGMTCAACVNSVEGIL  LPGVK AVVALATS+GEVEYDP+ ISKN+
Sbjct  117   PKSQKTLSGQFRIGGMTCAACVNSVEGILKKLPGVKGAVVALATSLGEVEYDPSAISKNE  176

Query  749   IVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRE  928
             IV AIEDAGF+  L+QSS Q+K++L V G+  + D+ +L  IL K+ G+R F  N  + E
Sbjct  177   IVQAIEDAGFDAVLLQSSEQNKVLLSVTGLHTEGDVDVLHDILKKIEGLRQFGVNFANSE  236

Query  929   LEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             +E+VFDPEV+G R +VD I   S G+   HV+NPY R AS D +E+S M
Sbjct  237   VEIVFDPEVVGLRQIVDTIEMESNGRLKAHVQNPYLRAASNDAQEASKM  285



>dbj|BAD25508.1| putative copper-exporting ATPase [Oryza sativa Japonica Group]
Length=1012

 Score =   315 bits (806),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 207/293 (71%), Gaps = 9/293 (3%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLL--DSYDEENSG-------ENLRRIQVRVTGMTC  376
             M  +Q+T            + EEV LL  +SYDEE +        E +RR+QVRVTGMTC
Sbjct  1     MAHLQLTPLAAGGGRGGADEMEEVALLGPESYDEEAAAAPGPEEEEGMRRVQVRVTGMTC  60

Query  377   AACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEP  556
             +AC+ +VE A+ +  GV   +V+LLQ++A VVFDP + K++DI  AIEDAGFEAE+L + 
Sbjct  61    SACTAAVEAAVSARRGVGGVAVSLLQSRARVVFDPALAKEEDIIEAIEDAGFEAELLPDS  120

Query  557   NASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVI  736
               S      T+SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP+VI
Sbjct  121   TVSQPKLQNTLSGQFRIGGMTCAACVNSVEGILKKLPGVKRAVVALATSLGEVEYDPSVI  180

Query  737   SKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNP  916
             SK++IV AIEDAGFE +L+QSS QDK++LG++G+  ++D+ +L  IL K+ G+R F  N 
Sbjct  181   SKDEIVQAIEDAGFEAALLQSSEQDKVLLGLMGLHTEVDVDILHDILKKMEGLRQFNVNL  240

Query  917   TSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
                E E+VFDPEV+G RS+VD I   S G+   HV+NPY R AS D +E+S M
Sbjct  241   VLSEAEIVFDPEVVGLRSIVDTIEMESSGRLKAHVQNPYIRAASNDAQEASKM  293



>ref|XP_006853566.1| PREDICTED: copper-transporting ATPase RAN1 [Amborella trichopoda]
 gb|ERN15033.1| hypothetical protein AMTR_s00032p00241570 [Amborella trichopoda]
Length=999

 Score =   308 bits (790),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 211/293 (72%), Gaps = 7/293 (2%)
 Frame = +2

Query  212   MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGENL-----RRIQVRVTGMTC  376
             M+PSMRD+Q+T+      + + GD EEVRLLD  DE    E L     + +Q+RV GMTC
Sbjct  1     MAPSMRDLQLTSLG--RLKRNSGDMEEVRLLDDEDEREIDEELGIKREKNVQLRVIGMTC  58

Query  377   AACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEP  556
             AACS SVE A+ +L GV +ASVALLQNKADV+FDP  +K +DI+ AIEDAGF+AEVL   
Sbjct  59    AACSNSVESAISNLPGVSRASVALLQNKADVIFDPSRIKVEDIKVAIEDAGFDAEVLPPV  118

Query  557   NASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVI  736
             +     +  T+ GQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS GEVEYDP  I
Sbjct  119   HLKVPKSQATLVGQFRIGGMTCAACVNSVEGILRKLPGVKRAVVALATSSGEVEYDPNDI  178

Query  737   SKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNP  916
             +K++IV AIEDAGF+   +QS+ +DK+   V G+  ++D+Q ++G+L  + GV+ F  N 
Sbjct  179   TKDEIVEAIEDAGFDALYIQSNEEDKVSFRVAGLFSEVDVQHIDGMLKSIKGVKQFLVNR  238

Query  917   TSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             +  ELE++FDP+++  RS+VD +  GS G+F   + NPYTR+AS D+EES SM
Sbjct  239   SLAELEILFDPQIIHLRSIVDALQKGSNGRFKAILHNPYTRLASNDMEESISM  291



>ref|XP_003570214.1| PREDICTED: copper-transporting ATPase RAN1-like [Brachypodium 
distachyon]
Length=996

 Score =   308 bits (790),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 205/291 (70%), Gaps = 10/291 (3%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGEN-------LRRIQVRVTGMTCAA  382
             M  +Q+TA  G   +++    EEV LL  Y  +            +RR+QVRVTGMTC+A
Sbjct  1     MAHLQLTAVAGGGRDDEM---EEVALLGPYGGDEGAAAEEEGEAGMRRVQVRVTGMTCSA  57

Query  383   CSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNA  562
             C+ +VE A+ +  GV  A+V+LLQ++A VVFDP + KD+DI  AIEDAGFEAE+L + + 
Sbjct  58    CTGAVEAAVSARRGVRSAAVSLLQSRAHVVFDPALAKDEDIIEAIEDAGFEAEILPDSSV  117

Query  563   SHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISK  742
             S   +  T+SGQF IGGMTCAACVNSVEGIL+ LPGVKRAVVALATS+GEVEYDPT ISK
Sbjct  118   SQPKSQKTLSGQFRIGGMTCAACVNSVEGILNKLPGVKRAVVALATSLGEVEYDPTAISK  177

Query  743   NDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTS  922
             ++IV AIEDAGFE +L+QSS QDK +LGV+G+  + D+ +L  IL K+ G+R F  N   
Sbjct  178   DEIVEAIEDAGFEAALLQSSEQDKALLGVIGLHTERDVDVLYDILKKMEGLRQFDVNSAQ  237

Query  923   RELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              E+EV+FD EV+G RS+VD I   S G+   HV+NPY R AS D  E+S M
Sbjct  238   TEVEVIFDTEVVGLRSIVDFIEMESSGRLKAHVQNPYVRSASNDAHEASKM  288



>gb|EEC72585.1| hypothetical protein OsI_06035 [Oryza sativa Indica Group]
Length=1001

 Score =   308 bits (789),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 206/293 (70%), Gaps = 9/293 (3%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLL--DSYDEENSGEN-------LRRIQVRVTGMTC  376
             M  +Q+T            + EEV LL  DSYDEE +          +RR+QVRVTGMTC
Sbjct  1     MAHLQLTPLAAGGGRGGADEMEEVALLGPDSYDEEAAAAAGPEEEEGMRRVQVRVTGMTC  60

Query  377   AACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEP  556
             +AC+ +VE A+ +  GV   +V+LLQ++A VVFDP + K++DI  AIEDAGFEAE+L + 
Sbjct  61    SACTAAVEAAVSARRGVGGVAVSLLQSRARVVFDPALAKEEDIIEAIEDAGFEAELLPDS  120

Query  557   NASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVI  736
               S      T+SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP+VI
Sbjct  121   TVSQPKLQNTLSGQFRIGGMTCAACVNSVEGILKKLPGVKRAVVALATSLGEVEYDPSVI  180

Query  737   SKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNP  916
             SK++IV AIEDAGFE +L+QSS QDK++LG++G+  ++D+ +L  IL K+ G+R F  N 
Sbjct  181   SKDEIVQAIEDAGFEAALLQSSEQDKVLLGLMGLHTEVDVDILHDILKKMEGLRQFNVNL  240

Query  917   TSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
                E E+VFDPEV+G RS+VD I   S G+   HV+NPY R AS D +E+S M
Sbjct  241   VLSEAEIVFDPEVVGLRSIVDTIEMESSGRLKAHVQNPYIRAASNDAQEASKM  293



>gb|EPS72268.1| hypothetical protein M569_02482, partial [Genlisea aurea]
Length=976

 Score =   306 bits (785),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 200/267 (75%), Gaps = 2/267 (1%)
 Frame = +2

Query  278   GDCEE-VRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQ  454
             GD +E  RLL +YD E++  NLRRIQ RVTGMTCAACS SVE AL SL+GVVKASVALLQ
Sbjct  14    GDSDEGERLLGAYDREDA-SNLRRIQARVTGMTCAACSNSVESALRSLDGVVKASVALLQ  72

Query  455   NKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACV  634
             NKADV F+  ++ D+DI+N IE AGFEAE+L E     +N + T+ GQF IGGMTCAACV
Sbjct  73    NKADVSFNAALLTDEDIKNTIEAAGFEAEILPEHTIPRSNPHRTLVGQFTIGGMTCAACV  132

Query  635   NSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDK  814
             NSVE IL  LPGVK+AVV+L TS+GEVEYDP  I+K+ ++NAI+DAGFE S +QS+ +DK
Sbjct  133   NSVEEILRKLPGVKKAVVSLPTSLGEVEYDPASITKDHLLNAIQDAGFEASFVQSNERDK  192

Query  815   IILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGG  994
             ++  V GI+ ++D+Q+LE  L    G++ F ++  S+EL + +DPEV G R+ VD I   
Sbjct  193   VVFQVAGIATEIDVQMLETTLCISTGLKQFHFDLPSQELVIHYDPEVTGPRAFVDLIENS  252

Query  995   SGGKFTLHVKNPYTRMASRDIEESSSM  1075
               GK  L VKNPY R++S+D EESS+M
Sbjct  253   CYGKLKLMVKNPYARISSKDSEESSNM  279



>ref|NP_001182877.1| hypothetical protein [Zea mays]
 gb|ACR34997.1| unknown [Zea mays]
 gb|AFW66347.1| hypothetical protein ZEAMMB73_879875 [Zea mays]
Length=998

 Score =   305 bits (782),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/292 (54%), Positives = 205/292 (70%), Gaps = 14/292 (5%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEE----------NSGENLRRIQVRVTGMT  373
             M  +Q+TA  G + +E     EEV LL SYDEE           +   +RR+QVRVTGMT
Sbjct  1     MAHLQLTALAGGADDE----MEEVALLGSYDEEAGVGPEAEGDRAEAGMRRVQVRVTGMT  56

Query  374   CAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAE  553
             C+AC+ +VE AL +  GV +A+V+LLQN+A VVFDP + K+ DI  AIEDAGFEAE+L +
Sbjct  57    CSACTGAVEAALSARRGVRRAAVSLLQNRAHVVFDPALAKEDDIVEAIEDAGFEAEILPD  116

Query  554   PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
                S    + T+SGQF IGGMTCAACVNSVEGIL  LPGVK AVVALATS+GEVEYDP+ 
Sbjct  117   STVSQPKPHKTLSGQFRIGGMTCAACVNSVEGILKKLPGVKGAVVALATSLGEVEYDPSA  176

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             ISK++IV AIEDAGF+ +L+QSS QDK++L V G+  + D+ +L  IL K+ G+R F  N
Sbjct  177   ISKDEIVQAIEDAGFDAALLQSSDQDKVLLNVQGLHFEEDVDVLHDILKKMEGLRQFGVN  236

Query  914   PTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESS  1069
               + E+++VFDPEV+G R +VD I   S  +   HV++PY R AS D +E+S
Sbjct  237   FANSEVDIVFDPEVVGLRQIVDTIETESNNRLKAHVQDPYIRAASNDAQEAS  288



>dbj|BAK07450.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1001

 Score =   305 bits (780),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 202/297 (68%), Gaps = 17/297 (6%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLLDSYDE-----ENSGE--------NLRRIQVRVT  364
             M  +Q+TA  G   +E     EEV LL SY E       +G+         +RR QVRVT
Sbjct  1     MAHLQLTAVAGGRDDE----MEEVALLGSYGEPEGLSSRTGQEEEEEEDAGMRRAQVRVT  56

Query  365   GMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEV  544
             GMTC+AC+ +VE AL +  GV  A+V+LLQN+A VVFDP + K++DI  AIEDAGFEAE+
Sbjct  57    GMTCSACTGAVEAALSARRGVRSAAVSLLQNRAHVVFDPALAKEEDIVEAIEDAGFEAEI  116

Query  545   LAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYD  724
             L +   S   +   +SGQF IGGMTCAACVNSVEGIL  LPGV RAVVALATS+GEVEYD
Sbjct  117   LPDSAVSQPKSQKALSGQFRIGGMTCAACVNSVEGILKKLPGVNRAVVALATSLGEVEYD  176

Query  725   PTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHF  904
             P  ISK++IV AIEDAGFE +L+QSS QDK +LG++G+  + D+ LL  IL K  G+R F
Sbjct  177   PAAISKDEIVQAIEDAGFEAALLQSSEQDKALLGLIGLHTERDVNLLYDILRKTEGLRQF  236

Query  905   FYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               N    E+E+ FDPEV+G RS+VD I   S G+   HV+NPY R +S D +E+S M
Sbjct  237   DVNSVRAEVEITFDPEVVGLRSIVDIIEIESSGRLKAHVQNPYVRSSSNDAQEASKM  293



>dbj|BAJ96089.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1001

 Score =   305 bits (780),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 202/297 (68%), Gaps = 17/297 (6%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLLDSYDE-----ENSGE--------NLRRIQVRVT  364
             M  +Q+TA  G   +E     EEV LL SY E       +G+         +RR QVRVT
Sbjct  1     MAHLQLTAVAGGRDDE----MEEVALLGSYGEPEGLSSRTGQEEEEEEDAGMRRAQVRVT  56

Query  365   GMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEV  544
             GMTC+AC+ +VE AL +  GV  A+V+LLQN+A VVFDP + K++DI  AIEDAGFEAE+
Sbjct  57    GMTCSACTGAVEAALSARRGVRSAAVSLLQNRAHVVFDPALAKEEDIVEAIEDAGFEAEI  116

Query  545   LAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYD  724
             L +   S   +   +SGQF IGGMTCAACVNSVEGIL  LPGV RAVVALATS+GEVEYD
Sbjct  117   LPDSAVSQPKSQKALSGQFRIGGMTCAACVNSVEGILKKLPGVNRAVVALATSLGEVEYD  176

Query  725   PTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHF  904
             P  ISK++IV AIEDAGFE +L+QSS QDK +LG++G+  + D+ LL  IL K  G+R F
Sbjct  177   PAAISKDEIVQAIEDAGFEAALLQSSEQDKALLGLIGLHTERDVNLLYDILRKTEGLRQF  236

Query  905   FYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
               N    E+E+ FDPEV+G RS+VD I   S G+   HV+NPY R +S D +E+S M
Sbjct  237   DVNSVRAEVEITFDPEVVGLRSIVDIIEIESSGRLKAHVQNPYVRSSSNDAQEASKM  293



>ref|NP_001046033.1| Os02g0172600 [Oryza sativa Japonica Group]
 dbj|BAF07947.1| Os02g0172600 [Oryza sativa Japonica Group]
Length=1030

 Score =   304 bits (779),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 207/308 (67%), Gaps = 24/308 (8%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLL--DSYDEENSG-------ENLRRIQVRVTGMTC  376
             M  +Q+T            + EEV LL  +SYDEE +        E +RR+QVRVTGMTC
Sbjct  1     MAHLQLTPLAAGGGRGGADEMEEVALLGPESYDEEAAAAPGPEEEEGMRRVQVRVTGMTC  60

Query  377   AACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK---------------DKDIEN  511
             +AC+ +VE A+ +  GV   +V+LLQ++A VVFDP + K               ++DI  
Sbjct  61    SACTAAVEAAVSARRGVGGVAVSLLQSRARVVFDPALAKCCNLETCNCKQSPYNEEDIIE  120

Query  512   AIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVA  691
             AIEDAGFEAE+L +   S      T+SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVA
Sbjct  121   AIEDAGFEAELLPDSTVSQPKLQNTLSGQFRIGGMTCAACVNSVEGILKKLPGVKRAVVA  180

Query  692   LATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEG  871
             LATS+GEVEYDP+VISK++IV AIEDAGFE +L+QSS QDK++LG++G+  ++D+ +L  
Sbjct  181   LATSLGEVEYDPSVISKDEIVQAIEDAGFEAALLQSSEQDKVLLGLMGLHTEVDVDILHD  240

Query  872   ILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASR  1051
             IL K+ G+R F  N    E E+VFDPEV+G RS+VD I   S G+   HV+NPY R AS 
Sbjct  241   ILKKMEGLRQFNVNLVLSEAEIVFDPEVVGLRSIVDTIEMESSGRLKAHVQNPYIRAASN  300

Query  1052  DIEESSSM  1075
             D +E+S M
Sbjct  301   DAQEASKM  308



>gb|EMT19252.1| Copper-transporting ATPase RAN1 [Aegilops tauschii]
Length=988

 Score =   303 bits (777),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/273 (58%), Positives = 193/273 (71%), Gaps = 10/273 (4%)
 Frame = +2

Query  287   EEVRLLDSYDE----------ENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKA  436
             EEV LL SY E          E     +RR QVRVTGMTC+AC+ +VE AL +  GV  A
Sbjct  2     EEVALLGSYGEAEGPSSRKGQEEEEAGMRRAQVRVTGMTCSACTGAVEAALSARRGVRSA  61

Query  437   SVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGM  616
             +V+LLQN+A VVFDP + K++DI  AIEDAGFEAE+L +   S   +   +SGQF IGGM
Sbjct  62    AVSLLQNRAHVVFDPALAKEEDIVEAIEDAGFEAEILPDSAVSQPKSQKALSGQFRIGGM  121

Query  617   TCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQ  796
             TCAACVNSVEGIL  LPGV RAVVALATS+GEVEYDPT ISK++IV AIEDAGFE +L+Q
Sbjct  122   TCAACVNSVEGILKKLPGVNRAVVALATSLGEVEYDPTAISKDEIVQAIEDAGFEAALVQ  181

Query  797   SSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVV  976
             SS QDK +LG++G+  + D+ LL  IL K  G+R F  N    E+E+ FDPEV+G RSVV
Sbjct  182   SSEQDKALLGLIGLHTERDVNLLYDILRKTEGLRQFDVNSVRAEVEITFDPEVVGLRSVV  241

Query  977   DGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             D I+  S G+   HV+NPY R +S D +E+S M
Sbjct  242   DIIDMESSGRLKAHVQNPYVRSSSNDAQEASKM  274



>ref|XP_002453372.1| hypothetical protein SORBIDRAFT_04g004820 [Sorghum bicolor]
 gb|EES06348.1| hypothetical protein SORBIDRAFT_04g004820 [Sorghum bicolor]
Length=1011

 Score =   300 bits (768),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 206/305 (68%), Gaps = 27/305 (9%)
 Frame = +2

Query  224   MRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEE----NSGEN-----LRRIQVRVTGMTC  376
             M  +Q+TA  G + +E     EEV LL SYDEE      GE+     +RR+QVRVTGMTC
Sbjct  1     MAHLQLTALAGGADDE----MEEVALLGSYDEEAGVGPEGEDQAEAGMRRVQVRVTGMTC  56

Query  377   AACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK--------------DKDIENA  514
             +AC+ +VE AL +  GV +A+V+LLQN+A VVFDP + K              D DI  A
Sbjct  57    SACTGAVEAALSARRGVRRAAVSLLQNRAHVVFDPALAKVPLSVGSIEWKQSPDDDIVEA  116

Query  515   IEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
             IEDAGFEAE+L +   S   +  T+SGQF IGGMTCAACVNSVEGIL  LPGVKRAVVAL
Sbjct  117   IEDAGFEAEILPDSTVSQPKSQKTLSGQFRIGGMTCAACVNSVEGILKKLPGVKRAVVAL  176

Query  695   ATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGI  874
             ATS+GEVEYDP+ ISK++IV AIEDAGF+ +L+QSS QDK +L V G+  + D+ +L  I
Sbjct  177   ATSLGEVEYDPSAISKDEIVQAIEDAGFDAALLQSSEQDKALLTVTGLHFEGDVDVLHDI  236

Query  875   LSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRD  1054
             L K+ G+R F  +    E+++VFDPEV+G R +VD I   S  +   HV+NPY R AS D
Sbjct  237   LKKMEGLRQFGVDFAKSEVDIVFDPEVVGLRQIVDTIEMESNNRLKAHVQNPYIRAASND  296

Query  1055  IEESS  1069
              +E++
Sbjct  297   AQEAN  301



>dbj|BAD45393.1| putative ATP dependent copper transporter [Oryza sativa Japonica 
Group]
Length=926

 Score =   291 bits (746),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 194/272 (71%), Gaps = 7/272 (3%)
 Frame = +2

Query  281   DCEEVRLLDSYDEENSGENLRRI-------QVRVTGMTCAACSTSVEGALMSLNGVVKAS  439
             + E+VRLLDSYDEE  G              VRVTGMTC+AC+++VEGA+ +  GV + +
Sbjct  24    EMEDVRLLDSYDEEMGGGAAAAAAGEEEEAHVRVTGMTCSACTSAVEGAVSARRGVRRVA  83

Query  440   VALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMT  619
             V+LLQN+A VVFDP ++K +DI  AIEDAGF+AE++ +   S      T+S QF IGGMT
Sbjct  84    VSLLQNRAHVVFDPALLKVEDIIEAIEDAGFDAEIIPDTAISQPKAQKTLSAQFRIGGMT  143

Query  620   CAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQS  799
             CA CVNSVEGIL  L GVK AVVALATS+GEVEYDP+VI+K++IV AIEDAGFE + +QS
Sbjct  144   CANCVNSVEGILKRLSGVKGAVVALATSLGEVEYDPSVINKDEIVEAIEDAGFEAAFLQS  203

Query  800   SAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVD  979
             S QDKI+LG+ G+  + D+ +L  IL K+ G+R F  N T  E+E++FDPE +G RS+VD
Sbjct  204   SEQDKILLGLTGLHTERDVNVLHDILKKMIGLRQFDVNATVSEVEIIFDPEAVGLRSIVD  263

Query  980   GINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              I  GS G+   HV+NPY R AS D  E++ M
Sbjct  264   AIETGSNGRLKAHVQNPYARGASNDAHEAAKM  295



>gb|EEC81135.1| hypothetical protein OsI_24030 [Oryza sativa Indica Group]
Length=929

 Score =   291 bits (746),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 194/272 (71%), Gaps = 7/272 (3%)
 Frame = +2

Query  281   DCEEVRLLDSYDEENSGENLRRI-------QVRVTGMTCAACSTSVEGALMSLNGVVKAS  439
             + E+VRLLDSYDEE  G              VRVTGMTC+AC+++VEGA+ +  GV + +
Sbjct  24    EMEDVRLLDSYDEEMGGGAAAAAAGEEEEAHVRVTGMTCSACTSAVEGAVSARRGVRRVA  83

Query  440   VALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMT  619
             V+LLQN+A VVFDP ++K +DI  AIEDAGF+AE++ +   S      T+S QF IGGMT
Sbjct  84    VSLLQNRAHVVFDPALLKVEDIIEAIEDAGFDAEIIPDTAISQPKAQKTLSAQFRIGGMT  143

Query  620   CAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQS  799
             CA CVNSVEGIL  L GVK AVVALATS+GEVEYDP+VI+K++IV AIEDAGFE + +QS
Sbjct  144   CANCVNSVEGILKKLSGVKGAVVALATSLGEVEYDPSVINKDEIVEAIEDAGFEAAFLQS  203

Query  800   SAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVD  979
             S QDKI+LG+ G+  + D+ +L  IL K+ G+R F  N T  E+E++FDPE +G RS+VD
Sbjct  204   SEQDKILLGLTGLHTERDVNVLHDILKKMIGLRQFDVNATVSEVEIIFDPEAVGLRSIVD  263

Query  980   GINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              I  GS G+   HV+NPY R AS D  E++ M
Sbjct  264   AIETGSNGRLKAHVQNPYARGASNDAHEAAKM  295



>ref|XP_008661041.1| PREDICTED: copper-transporting ATPase RAN1-like [Zea mays]
Length=1010

 Score =   292 bits (747),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 193/272 (71%), Gaps = 7/272 (3%)
 Frame = +2

Query  281   DCEEVRLLDSYDEE-------NSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKAS  439
             + E+V LLDSYDEE        SG       VRVTGMTC+AC+++VE A+ +  GV + +
Sbjct  23    EMEDVALLDSYDEEMGLPLPGASGAEAAEAHVRVTGMTCSACTSAVEAAVSARRGVRRVA  82

Query  440   VALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMT  619
             V+LLQN+A V+FDP + K +DI  AIEDAGFEAE++ E   S   +  T+S QF IGGMT
Sbjct  83    VSLLQNRAHVMFDPALAKVEDIIEAIEDAGFEAEIIPESAVSQPKSQKTLSAQFRIGGMT  142

Query  620   CAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQS  799
             CA CVNSVEGIL  LPGVK AVVALATS+GEVEY P+ ISK++IV AIEDAGFE + +QS
Sbjct  143   CANCVNSVEGILKKLPGVKGAVVALATSLGEVEYIPSAISKDEIVQAIEDAGFEAAFLQS  202

Query  800   SAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVD  979
             + QDK++LG++G+  + D++LL  IL K+ G+R F  N    E+E+VFDPE +G RS+VD
Sbjct  203   TEQDKVLLGLIGLHTERDVELLSDILKKIDGLRQFGVNSVLSEVEIVFDPEAVGLRSIVD  262

Query  980   GINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
              I   S G    HV+NPYTR AS D +E+S M
Sbjct  263   TIEMTSNGSLKAHVQNPYTRGASNDAQEASKM  294



>ref|XP_004965620.1| PREDICTED: copper-transporting ATPase RAN1-like [Setaria italica]
Length=1007

 Score =   287 bits (735),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 192/277 (69%), Gaps = 12/277 (4%)
 Frame = +2

Query  281   DCEEVRLLDSYDEE------------NSGENLRRIQVRVTGMTCAACSTSVEGALMSLNG  424
             + E+V LLDSYDEE               E      VRVTGMTC+AC+++VE A+ +  G
Sbjct  23    EMEDVALLDSYDEEMGVPPPGGAGAEGEEEAAAEAHVRVTGMTCSACTSAVEAAVSARRG  82

Query  425   VVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFM  604
             V + +V+LLQN+A VVFDP + K +DI  +IEDAGFEAE++ +   S   +  T+S QF 
Sbjct  83    VRRVAVSLLQNRAHVVFDPALAKVEDIIESIEDAGFEAEIIPDSAVSQPKSQKTLSAQFR  142

Query  605   IGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEG  784
             IGGMTCA CVNSVEGIL  LPGVK AVVALATS+GEVEY P++ISK++IV AIEDAGFE 
Sbjct  143   IGGMTCANCVNSVEGILKKLPGVKGAVVALATSLGEVEYVPSLISKDEIVQAIEDAGFEA  202

Query  785   SLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGS  964
             + +QSS QDKI+LG++G+  + D+++L  IL K+ G+R F  N    E+E+VFDPE +G 
Sbjct  203   AFLQSSEQDKILLGLIGLHTERDVEVLHDILKKMDGLRQFDVNTVLSEVEIVFDPEAVGL  262

Query  965   RSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             RS+VD I  G  G+    V+NPYTR AS D  E+S M
Sbjct  263   RSIVDTIEMGGNGRLKAQVQNPYTRGASNDAHEASKM  299



>dbj|BAJ96159.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93314.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1002

 Score =   286 bits (733),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 190/277 (69%), Gaps = 12/277 (4%)
 Frame = +2

Query  281   DCEEVRLLDSYDEENSGENLRRI------------QVRVTGMTCAACSTSVEGALMSLNG  424
             D E+V LL SYDEE  G                   VRVTGMTC+AC+++VE A+ +  G
Sbjct  18    DMEDVALLGSYDEETGGAAPAGGGGGAEDEEEAEAHVRVTGMTCSACTSAVEAAVSARRG  77

Query  425   VVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFM  604
             V + +V+LLQN+A VVFDP + K +DI  AIEDAGF+AE+L +     + +  T+S QF 
Sbjct  78    VRRVAVSLLQNRARVVFDPALAKVEDIIEAIEDAGFDAEILPDSAVPQSKSQKTLSAQFR  137

Query  605   IGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEG  784
             IGGMTCA CVNSVEGIL   PG+K AVVALATS+GEVEYDP+ ISK++IV AIEDAGF+ 
Sbjct  138   IGGMTCANCVNSVEGILKKQPGIKGAVVALATSLGEVEYDPSTISKDEIVQAIEDAGFDA  197

Query  785   SLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGS  964
             + +QSS QDK++LG+ G+  + D  +L  IL K+ G+R F  N    E+E+VFDPE +G 
Sbjct  198   AFLQSSEQDKVLLGLTGVHAERDADILHDILKKMDGLRQFGVNTALSEVEIVFDPEAVGL  257

Query  965   RSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             RS+VD I  GS G+F  HV+NPY+R AS D  E+S M
Sbjct  258   RSIVDAIEMGSNGRFKAHVQNPYSRGASNDAHEASKM  294



>ref|XP_003563342.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X1 [Brachypodium 
distachyon]
Length=1012

 Score =   286 bits (733),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/280 (54%), Positives = 191/280 (68%), Gaps = 15/280 (5%)
 Frame = +2

Query  281   DCEEVRLLDSYDEE---------------NSGENLRRIQVRVTGMTCAACSTSVEGALMS  415
             D E+V LL SYDEE                  E     QVRVTGMTC+AC+++VE A+ +
Sbjct  25    DMEDVALLGSYDEEMGAPPAGGGAGEEEEEEEEEEEEAQVRVTGMTCSACTSAVEAAVSA  84

Query  416   LNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSG  595
               GV + +V+LLQN+A VVFDP  +K +DI  AIEDAGFEAE+L +   S   T+ T+S 
Sbjct  85    RRGVRRVAVSLLQNRARVVFDPAQLKVEDIIEAIEDAGFEAEMLPDSAVSQPKTHKTLSA  144

Query  596   QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
             QF IGGMTCA CVNSVEGIL  LPG+K AVVALATS+GEVEY P+ ISK++IV AIEDAG
Sbjct  145   QFRIGGMTCANCVNSVEGILKKLPGIKGAVVALATSLGEVEYVPSAISKDEIVQAIEDAG  204

Query  776   FEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEV  955
             FE + +QSS QDKI LG+ G+  + D+ +L  IL K+ G+R F  N    E+E+VFDPE 
Sbjct  205   FEAAFLQSSEQDKIFLGLTGLHTESDVDILHDILKKMAGLRQFSVNTALSEVEIVFDPEA  264

Query  956   LGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             +  R++VD I  GS G+   HV+NPYT+ AS D +E+S M
Sbjct  265   VSLRAIVDTIEMGSNGRLQAHVQNPYTQGASNDAQEASKM  304



>ref|XP_012084565.1| PREDICTED: copper-transporting ATPase RAN1 isoform X2 [Jatropha 
curcas]
Length=915

 Score =   285 bits (728),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +2

Query  482   HVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSS  661
              +V D DI+NAIEDAGFEAE+L+EP+      N T+ G F IGGMTCAACVNSVEGIL  
Sbjct  10    RLVMDDDIKNAIEDAGFEAEILSEPSTFKTKLNKTLLGHFTIGGMTCAACVNSVEGILRD  69

Query  662   LPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGIS  841
             LPGV+RAVVALATS+GEVEYDPTVISK+DIVNAIEDAGF+ SL+QS+ QDKIILGV GI 
Sbjct  70    LPGVRRAVVALATSLGEVEYDPTVISKDDIVNAIEDAGFDASLVQSNQQDKIILGVAGIF  129

Query  842   GQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
              +MD Q+LEGI+S L GVR F YN  S ELEV FDPEV+ SRS+VDGI  GS G+F LHV
Sbjct  130   TEMDAQVLEGIISTLTGVRQFRYNRMSNELEVHFDPEVISSRSLVDGIEEGSSGRFKLHV  189

Query  1022  KNPYTRMASRDIEESSSM  1075
              +PY RM S+D+EE+S+M
Sbjct  190   MHPYARMTSKDVEETSTM  207


 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 76/137 (55%), Gaps = 8/137 (6%)
 Frame = +2

Query  359  VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
            + GMTCAAC  SVEG L  L GV +A VAL  +  +V +DP V+   DI NAIEDAGF+A
Sbjct  51   IGGMTCAACVNSVEGILRDLPGVRRAVVALATSLGEVEYDPTVISKDDIVNAIEDAGFDA  110

Query  539  EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              L + N       G       + G+        +EGI+S+L GV++      ++  EV 
Sbjct  111  S-LVQSNQQDKIILG-------VAGIFTEMDAQVLEGIISTLTGVRQFRYNRMSNELEVH  162

Query  719  YDPTVISKNDIVNAIED  769
            +DP VIS   +V+ IE+
Sbjct  163  FDPEVISSRSLVDGIEE  179



>gb|ABR17750.1| unknown [Picea sitchensis]
Length=998

 Score =   284 bits (726),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 197/276 (71%), Gaps = 2/276 (1%)
 Frame = +2

Query  251   NGNSSEEDFGDCEEVRLLDSYDEE-NSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGV  427
             +G S+E++  D EE  LL   DE   + + L +++V+V GMTCAACS SVE AL++L GV
Sbjct  18    SGLSAEDESRDLEEAPLLGERDERLENRKGLEKLEVKVIGMTCAACSNSVEKALLNLAGV  77

Query  428   VKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMI  607
               ASVALLQNKADV +DP  VK++DI+ AIEDAGF+AEVL +  +S +   GTV+G+F I
Sbjct  78    CTASVALLQNKADVTYDPSKVKEEDIKEAIEDAGFDAEVLPK-ISSRSKDQGTVTGKFRI  136

Query  608   GGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGS  787
             GGMTCAACVNSVEGIL +LPGV RAVVALATS+GEVEYDP  + K +I+NAIEDAGF+  
Sbjct  137   GGMTCAACVNSVEGILRNLPGVTRAVVALATSMGEVEYDPNQMGKVEIINAIEDAGFDAE  196

Query  788   LMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSR  967
             L+QS  QD + + + G+  + D + +E +L  + GVR F  +P   + +++FDPEV+G R
Sbjct  197   LIQSGQQDILSIMIEGLFSEEDAKFVEDMLHNMKGVRDFVVDPLLAKYDILFDPEVIGLR  256

Query  968   SVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             S++D I     G+F + + NPYT   S  ++ESS M
Sbjct  257   SIIDAIESEGDGRFKVMLHNPYTTYFSSRMDESSQM  292



>ref|XP_002438813.1| hypothetical protein SORBIDRAFT_10g026600 [Sorghum bicolor]
 gb|EER90180.1| hypothetical protein SORBIDRAFT_10g026600 [Sorghum bicolor]
Length=996

 Score =   281 bits (720),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 192/287 (67%), Gaps = 24/287 (8%)
 Frame = +2

Query  287   EEVRLLDSYDEENSGENLRRI----------QVRVTGMTCAACSTSVEGALMSLNGVVKA  436
             E+V LLDSYDEE     L              VRVTGMTC+AC+++VE A+ + +GV + 
Sbjct  2     EDVALLDSYDEEMGLPPLGASGAEEGAAAEAHVRVTGMTCSACTSAVEAAVSARSGVRRV  61

Query  437   SVALLQNKADVVFDPHVVKD--------------KDIENAIEDAGFEAEVLAEPNASHAN  574
             +V+LLQN+A VVFDP + K               +DI  AIEDAGFEAE++ E   S   
Sbjct  62    AVSLLQNRAHVVFDPALSKVLLSSPRCGVLCFQVEDIIEAIEDAGFEAEIIPESAVSQPK  121

Query  575   TNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIV  754
             +  T+S QF IGGMTCA CVNSVEGIL  LPGVK AVVALATS+GEVEY P+ ISK++IV
Sbjct  122   SQKTLSAQFRIGGMTCANCVNSVEGILKKLPGVKGAVVALATSLGEVEYVPSAISKDEIV  181

Query  755   NAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELE  934
              AIEDAGFE + +QSS QDK++LG+ G+  + D+++L  IL KL G+R F  N    E+E
Sbjct  182   QAIEDAGFEAAFLQSSEQDKVLLGLTGLHTERDVEVLNDILKKLDGLRQFGVNIVLSEVE  241

Query  935   VVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             +VFDPE +G RS+VD I   S G+F   V+NPYTR AS D +E+S M
Sbjct  242   IVFDPEAVGLRSIVDTIEMASNGRFKADVQNPYTRGASNDAQEASKM  288



>gb|AFW87697.1| hypothetical protein ZEAMMB73_336618, partial [Zea mays]
Length=597

 Score =   272 bits (696),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 193/315 (61%), Gaps = 50/315 (16%)
 Frame = +2

Query  281   DCEEVRLLDSYDEE-------NSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKAS  439
             + E+V LLDSYDEE        SG       VRVTGMTC+AC+++VE A+ +  GV + +
Sbjct  23    EMEDVALLDSYDEEMGLPLPGASGAEAAEAHVRVTGMTCSACTSAVEAAVSARRGVRRVA  82

Query  440   VALLQNKADVVFDPHVVKD-----------------------------------------  496
             V+LLQN+A V+FDP + K                                          
Sbjct  83    VSLLQNRAHVMFDPALAKVLTGAPLLALVWRISTGDAILAYSQPLSGREARAVPWEVGSS  142

Query  497   --KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPG  670
               +DI  AIEDAGFEAE++ E   S   +  T+S QF IGGMTCA CVNSVEGIL  LPG
Sbjct  143   PVEDIIEAIEDAGFEAEIIPESAVSQPKSQKTLSAQFRIGGMTCANCVNSVEGILKKLPG  202

Query  671   VKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQM  850
             VK AVVALATS+GEVEY P+ ISK++IV AIEDAGFE + +QS+ QDK++LG++G+  + 
Sbjct  203   VKGAVVALATSLGEVEYIPSAISKDEIVQAIEDAGFEAAFLQSTEQDKVLLGLIGLHTER  262

Query  851   DMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNP  1030
             D++LL  IL K+ G+R F  N    E+E+VFDPE +G RS+VD I   S G    HV+NP
Sbjct  263   DVELLSDILKKIDGLRQFGVNSVLSEVEIVFDPEAVGLRSIVDTIEMTSNGSLKAHVQNP  322

Query  1031  YTRMASRDIEESSSM  1075
             YTR AS D +E+S M
Sbjct  323   YTRGASNDAQEASKM  337



>ref|XP_006648354.1| PREDICTED: copper-transporting ATPase RAN1-like, partial [Oryza 
brachyantha]
Length=930

 Score =   262 bits (670),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 164/219 (75%), Gaps = 0/219 (0%)
 Frame = +2

Query  419   NGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQ  598
              GV   +V+LLQ++A VVFDP + K++DI  AIEDAGFEAE+L + + S   +  T+SGQ
Sbjct  4     RGVAGVAVSLLQSRARVVFDPALAKEEDIIEAIEDAGFEAELLPDSSVSQPKSQSTLSGQ  63

Query  599   FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
             F IGGMTCAACVNSVEGIL  LPGVKRAVVALATS+GEVEYDP+VISK++IV AIEDAGF
Sbjct  64    FRIGGMTCAACVNSVEGILKKLPGVKRAVVALATSLGEVEYDPSVISKDEIVQAIEDAGF  123

Query  779   EGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVL  958
             E + +QSS QDK++LG+ G+  ++D+ +L  I +++ G+R F  N    E E++FDPEV+
Sbjct  124   EAAFLQSSEQDKVLLGLTGLHTEIDVDILHDIFNRMEGLRQFSVNLALSEAEIIFDPEVV  183

Query  959   GSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             G R +VD I   S G+   HV+NPY R AS D +E+S M
Sbjct  184   GLRLIVDTIKMESNGRLKAHVQNPYIRAASNDAQEASKM  222


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 76/139 (55%), Gaps = 8/139 (6%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            Q R+ GMTCAAC  SVEG L  L GV +A VAL  +  +V +DP V+   +I  AIEDAG
Sbjct  63   QFRIGGMTCAACVNSVEGILKKLPGVKRAVVALATSLGEVEYDPSVISKDEIVQAIEDAG  122

Query  530  FEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
            FEA  L       +  +  + G   + G+     V+ +  I + + G+++  V LA S  
Sbjct  123  FEAAFL-----QSSEQDKVLLG---LTGLHTEIDVDILHDIFNRMEGLRQFSVNLALSEA  174

Query  710  EVEYDPTVISKNDIVNAIE  766
            E+ +DP V+    IV+ I+
Sbjct  175  EIIFDPEVVGLRLIVDTIK  193



>ref|XP_009602510.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=860

 Score =   258 bits (660),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +2

Query  614   MTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLM  793
             MTCAACVNSVEGIL  LPGV++AVVALATS+GEV YDP++ISK+DI NAIEDAGFE S +
Sbjct  1     MTCAACVNSVEGILKQLPGVRKAVVALATSLGEVGYDPSIISKDDIANAIEDAGFESSFV  60

Query  794   QSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSV  973
             QSS QDKI+LGVVGISG+MD QLLEGILSKLHGV+HF ++  S ELEVVFDPEVLGSRSV
Sbjct  61    QSSEQDKIVLGVVGISGEMDAQLLEGILSKLHGVKHFLFDRVSSELEVVFDPEVLGSRSV  120

Query  974   VDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             VDG+ GGS GKF L VKNPYTRMASRD+EESS M
Sbjct  121   VDGVEGGSSGKFKLLVKNPYTRMASRDLEESSKM  154


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 72/133 (54%), Gaps = 8/133 (6%)
 Frame = +2

Query  368  MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
            MTCAAC  SVEG L  L GV KA VAL  +  +V +DP ++   DI NAIEDAGFE+  +
Sbjct  1    MTCAACVNSVEGILKQLPGVRKAVVALATSLGEVGYDPSIISKDDIANAIEDAGFESSFV  60

Query  548  AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
                   +  +  V G   I G   A     +EGILS L GVK  +    +S  EV +DP
Sbjct  61   -----QSSEQDKIVLGVVGISGEMDAQL---LEGILSKLHGVKHFLFDRVSSELEVVFDP  112

Query  728  TVISKNDIVNAIE  766
             V+    +V+ +E
Sbjct  113  EVLGSRSVVDGVE  125



>gb|EEE56406.1| hypothetical protein OsJ_05563 [Oryza sativa Japonica Group]
Length=934

 Score =   244 bits (623),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 149/196 (76%), Gaps = 0/196 (0%)
 Frame = +2

Query  488   VKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLP  667
             V+++DI  AIEDAGFEAE+L +   S      T+SGQF IGGMTCAACVNSVEGIL  LP
Sbjct  31    VQEEDIIEAIEDAGFEAELLPDSTVSQPKLQNTLSGQFRIGGMTCAACVNSVEGILKKLP  90

Query  668   GVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQ  847
             GVKRAVVALATS+GEVEYDP+VISK++IV AIEDAGFE +L+QSS QDK++LG++G+  +
Sbjct  91    GVKRAVVALATSLGEVEYDPSVISKDEIVQAIEDAGFEAALLQSSEQDKVLLGLMGLHTE  150

Query  848   MDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKN  1027
             +D+ +L  IL K+ G+R F  N    E E+VFDPEV+G RS+VD I   S G+   HV+N
Sbjct  151   VDVDILHDILKKMEGLRQFNVNLVLSEAEIVFDPEVVGLRSIVDTIEMESSGRLKAHVQN  210

Query  1028  PYTRMASRDIEESSSM  1075
             PY R AS D +E+S M
Sbjct  211   PYIRAASNDAQEASKM  226


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 87/166 (52%), Gaps = 9/166 (5%)
 Frame = +2

Query  269  EDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVAL  448
            ED G   E+ L DS   +   +N    Q R+ GMTCAAC  SVEG L  L GV +A VAL
Sbjct  41   EDAGFEAEL-LPDSTVSQPKLQNTLSGQFRIGGMTCAACVNSVEGILKKLPGVKRAVVAL  99

Query  449  LQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAA  628
              +  +V +DP V+   +I  AIEDAGFEA +L       +  +  + G   + G+    
Sbjct  100  ATSLGEVEYDPSVISKDEIVQAIEDAGFEAALL-----QSSEQDKVLLG---LMGLHTEV  151

Query  629  CVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIE  766
             V+ +  IL  + G+++  V L  S  E+ +DP V+    IV+ IE
Sbjct  152  DVDILHDILKKMEGLRQFNVNLVLSEAEIVFDPEVVGLRSIVDTIE  197



>ref|XP_008676293.1| PREDICTED: copper-transporting ATPase RAN1-like [Zea mays]
Length=402

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 141/193 (73%), Gaps = 0/193 (0%)
 Frame = +2

Query  497   KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
             +DI  AIEDAGFEAE++ E   S   +  T+S QF IGGMTCA CVNSVEGIL  LPGVK
Sbjct  53    EDIIEAIEDAGFEAEIIPESAVSQPKSQKTLSAQFRIGGMTCANCVNSVEGILKKLPGVK  112

Query  677   RAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDM  856
              AVVALATS+GEVEY P+ ISK++IV AIEDAGFE + +QS+ QDK++LG++G+  + D+
Sbjct  113   GAVVALATSLGEVEYIPSAISKDEIVQAIEDAGFEAAFLQSTEQDKVLLGLIGLHTERDV  172

Query  857   QLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYT  1036
             +LL  IL K+ G+R F  N    E+E+VFDPE +G RS+VD I   S G    HV+NPYT
Sbjct  173   ELLSDILKKIDGLRQFGVNSVLSEVEIVFDPEAVGLRSIVDTIEMTSNGSLKAHVQNPYT  232

Query  1037  RMASRDIEESSSM  1075
             R AS D +E+S M
Sbjct  233   RGASNDAQEASKM  245


 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 68/141 (48%), Gaps = 12/141 (9%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            Q R+ GMTCA C  SVEG L  L GV  A VAL  +  +V + P  +   +I  AIEDAG
Sbjct  86   QFRIGGMTCANCVNSVEGILKKLPGVKGAVVALATSLGEVEYIPSAISKDEIVQAIEDAG  145

Query  530  FEAEVLAEPNASHANTNGTVSGQFMIG--GMTCAACVNSVEGILSSLPGVKRAVVALATS  703
            FEA  L            T   + ++G  G+     V  +  IL  + G+++  V    S
Sbjct  146  FEAAFL----------QSTEQDKVLLGLIGLHTERDVELLSDILKKIDGLRQFGVNSVLS  195

Query  704  VGEVEYDPTVISKNDIVNAIE  766
              E+ +DP  +    IV+ IE
Sbjct  196  EVEIVFDPEAVGLRSIVDTIE  216



>gb|EMS46723.1| Copper-transporting ATPase RAN1 [Triticum urartu]
Length=950

 Score =   233 bits (595),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 142/194 (73%), Gaps = 0/194 (0%)
 Frame = +2

Query  494   DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
             ++DI  AIEDAGFEAE+L +   S   +   +SGQF IGGMTCAACVNSVEGIL  LPGV
Sbjct  77    EEDIVEAIEDAGFEAEILPDSAVSQPKSQKVLSGQFRIGGMTCAACVNSVEGILKKLPGV  136

Query  674   KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMD  853
              RAVVALATS+GEVEYDPT ISK+ IV AIEDAGFE +L+QSS QDK +LG++G+  + D
Sbjct  137   NRAVVALATSLGEVEYDPTAISKDKIVQAIEDAGFEAALVQSSEQDKALLGLIGLHTERD  196

Query  854   MQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPY  1033
             + LL  IL K  G+R F  N    E+E+ FDPEV+G RSVVD I+  S G+   HV+NPY
Sbjct  197   VNLLYDILRKTEGLRQFDVNSVRAEVEITFDPEVVGLRSVVDIIDMESSGRLKAHVQNPY  256

Query  1034  TRMASRDIEESSSM  1075
              R +S D +E+S M
Sbjct  257   VRSSSNDAQEASKM  270


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 82/168 (49%), Gaps = 13/168 (8%)
 Frame = +2

Query  269  EDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVAL  448
            ED G   E+ L DS   +   + +   Q R+ GMTCAAC  SVEG L  L GV +A VAL
Sbjct  85   EDAGFEAEI-LPDSAVSQPKSQKVLSGQFRIGGMTCAACVNSVEGILKKLPGVNRAVVAL  143

Query  449  LQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIG--GMTC  622
              +  +V +DP  +    I  AIEDAGFEA ++       A          ++G  G+  
Sbjct  144  ATSLGEVEYDPTAISKDKIVQAIEDAGFEAALVQSSEQDKA----------LLGLIGLHT  193

Query  623  AACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIE  766
               VN +  IL    G+++  V    +  E+ +DP V+    +V+ I+
Sbjct  194  ERDVNLLYDILRKTEGLRQFDVNSVRAEVEITFDPEVVGLRSVVDIID  241



>dbj|BAJ86216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=912

 Score =   232 bits (592),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 143/196 (73%), Gaps = 0/196 (0%)
 Frame = +2

Query  488   VKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLP  667
             ++++DI  AIEDAGFEAE+L +   S   +   +SGQF IGGMTCAACVNSVEGIL  LP
Sbjct  9     IQEEDIVEAIEDAGFEAEILPDSAVSQPKSQKALSGQFRIGGMTCAACVNSVEGILKKLP  68

Query  668   GVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQ  847
             GV RAVVALATS+GEVEYDP  ISK++IV AIEDAGFE +L+QSS QDK +LG++G+  +
Sbjct  69    GVNRAVVALATSLGEVEYDPAAISKDEIVQAIEDAGFEAALLQSSEQDKALLGLIGLHTE  128

Query  848   MDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKN  1027
              D+ LL  IL K  G+R F  N    E+E+ FDPEV+G RS+VD I   S G+   HV+N
Sbjct  129   RDVNLLYDILRKTEGLRQFDVNSVRAEVEITFDPEVVGLRSIVDIIEIESSGRLKAHVQN  188

Query  1028  PYTRMASRDIEESSSM  1075
             PY R +S D +E+S M
Sbjct  189   PYVRSSSNDAQEASKM  204


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 82/168 (49%), Gaps = 13/168 (8%)
 Frame = +2

Query  269  EDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVAL  448
            ED G   E+ L DS   +   +     Q R+ GMTCAAC  SVEG L  L GV +A VAL
Sbjct  19   EDAGFEAEI-LPDSAVSQPKSQKALSGQFRIGGMTCAACVNSVEGILKKLPGVNRAVVAL  77

Query  449  LQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIG--GMTC  622
              +  +V +DP  +   +I  AIEDAGFEA +L       A          ++G  G+  
Sbjct  78   ATSLGEVEYDPAAISKDEIVQAIEDAGFEAALLQSSEQDKA----------LLGLIGLHT  127

Query  623  AACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIE  766
               VN +  IL    G+++  V    +  E+ +DP V+    IV+ IE
Sbjct  128  ERDVNLLYDILRKTEGLRQFDVNSVRAEVEITFDPEVVGLRSIVDIIE  175



>gb|EMT21866.1| Copper-transporting ATPase RAN1 [Aegilops tauschii]
Length=912

 Score =   229 bits (585),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 141/193 (73%), Gaps = 0/193 (0%)
 Frame = +2

Query  497   KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
             +DI  AIEDAGF+AE+L +       +  T+S QF IGGMTCA CVNSVEGIL   PG+K
Sbjct  12    EDIIEAIEDAGFDAEILPDSAVPQPKSQKTLSAQFRIGGMTCANCVNSVEGILKKQPGIK  71

Query  677   RAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDM  856
              AVVALATS+GEVEYDP+ ISK++IV AIEDAGFE + +QSS QDKI+LG+ GI  + D 
Sbjct  72    GAVVALATSLGEVEYDPSTISKDEIVQAIEDAGFEAAFLQSSEQDKILLGLTGIHTERDA  131

Query  857   QLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYT  1036
              +L  IL K++G+R F  N T  E+E+VFDPE +G RS+VD I  GS G+F  HV+NPY+
Sbjct  132   DILHDILKKMNGLREFAVNTTLSEVEIVFDPEAVGLRSIVDTIEMGSNGRFKAHVQNPYS  191

Query  1037  RMASRDIEESSSM  1075
             R AS D  E+S M
Sbjct  192   RGASNDAHEASKM  204


 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 77/168 (46%), Gaps = 13/168 (8%)
 Frame = +2

Query  269  EDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVAL  448
            ED G   E+ L DS   +   +     Q R+ GMTCA C  SVEG L    G+  A VAL
Sbjct  19   EDAGFDAEI-LPDSAVPQPKSQKTLSAQFRIGGMTCANCVNSVEGILKKQPGIKGAVVAL  77

Query  449  LQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIG--GMTC  622
              +  +V +DP  +   +I  AIEDAGFEA  L            +   + ++G  G+  
Sbjct  78   ATSLGEVEYDPSTISKDEIVQAIEDAGFEAAFL----------QSSEQDKILLGLTGIHT  127

Query  623  AACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIE  766
                + +  IL  + G++   V    S  E+ +DP  +    IV+ IE
Sbjct  128  ERDADILHDILKKMNGLREFAVNTTLSEVEIVFDPEAVGLRSIVDTIE  175



>gb|EMS50583.1| Copper-transporting ATPase RAN1 [Triticum urartu]
Length=945

 Score =   228 bits (582),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 142/198 (72%), Gaps = 0/198 (0%)
 Frame = +2

Query  482   HVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSS  661
             H+   +DI  AIEDAGF+AE+L +       +  T+S QF IGGMTCA CVNSVEGIL  
Sbjct  22    HLGAVEDIIEAIEDAGFDAEILPDSAVPQPKSQKTLSAQFRIGGMTCANCVNSVEGILRK  81

Query  662   LPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGIS  841
              PG+K AVVALATS+GEVEYDP+ ISK++IV AIEDAGFE + +QSS QDKI+LG+ G+ 
Sbjct  82    QPGIKGAVVALATSLGEVEYDPSTISKDEIVQAIEDAGFEAAFLQSSEQDKILLGLTGVH  141

Query  842   GQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
              + D  +L  IL K+ G+R F  N T  E+E+VFDPE +G RS+VD I  GS G+F  HV
Sbjct  142   TERDADVLHDILKKMDGLRQFAVNTTLSEVEIVFDPEAVGLRSIVDTIEMGSNGRFKSHV  201

Query  1022  KNPYTRMASRDIEESSSM  1075
             +NPY+R AS D  E+S M
Sbjct  202   QNPYSRGASNDAHEASKM  219


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 78/168 (46%), Gaps = 13/168 (8%)
 Frame = +2

Query  269  EDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVAL  448
            ED G   E+ L DS   +   +     Q R+ GMTCA C  SVEG L    G+  A VAL
Sbjct  34   EDAGFDAEI-LPDSAVPQPKSQKTLSAQFRIGGMTCANCVNSVEGILRKQPGIKGAVVAL  92

Query  449  LQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIG--GMTC  622
              +  +V +DP  +   +I  AIEDAGFEA  L            +   + ++G  G+  
Sbjct  93   ATSLGEVEYDPSTISKDEIVQAIEDAGFEAAFL----------QSSEQDKILLGLTGVHT  142

Query  623  AACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIE  766
                + +  IL  + G+++  V    S  E+ +DP  +    IV+ IE
Sbjct  143  ERDADVLHDILKKMDGLRQFAVNTTLSEVEIVFDPEAVGLRSIVDTIE  190



>ref|XP_002985430.1| hypothetical protein SELMODRAFT_122320 [Selaginella moellendorffii]
 gb|EFJ13560.1| hypothetical protein SELMODRAFT_122320 [Selaginella moellendorffii]
Length=1018

 Score =   226 bits (576),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 161/253 (64%), Gaps = 9/253 (4%)
 Frame = +2

Query  338   LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
             L R++V + GMTC ACSTSVE A++ ++GV  A+VALLQNKADV FDP   K+  I+ AI
Sbjct  57    LCRLEVAIGGMTCTACSTSVEKAVLRIDGVSSATVALLQNKADVKFDPRTCKEDAIKEAI  116

Query  518   EDAGFEAEVLAEPNASHANTNG--------TVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
             EDAGF+AE+L+         NG        T +  F +GGMTC ACVNSVEG+L+ LPGV
Sbjct  117   EDAGFDAEILSRTFMIDLVGNGNAAPPSKLTTTEMFKVGGMTCTACVNSVEGVLAKLPGV  176

Query  674   KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMD  853
             KR  VALAT +GEVE+DP  + +  I+  IEDAGFE  L++S  +DK+IL + GI     
Sbjct  177   KRVTVALATEMGEVEFDPKAVQRRQIIETIEDAGFEAELIESEERDKVILTIGGIFEDDG  236

Query  854   MQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPY  1033
              Q+ E +LSKL GVR F  +       V++DPEVL  R +V GI     G++ + + NPY
Sbjct  237   TQVGE-LLSKLKGVRDFTLDVLLERAVVMYDPEVLKLRDIVHGIENAGAGRYKVVLPNPY  295

Query  1034  TRMASRDIEESSS  1072
             T  +    +E SS
Sbjct  296   TSYSPDKSKEVSS  308



>gb|EAZ37932.1| hypothetical protein OsJ_22282 [Oryza sativa Japonica Group]
Length=882

 Score =   224 bits (571),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 140/193 (73%), Gaps = 0/193 (0%)
 Frame = +2

Query  497   KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
             +DI  AIEDAGF+AE++ +   S      T+S QF IGGMTCA CVNSVEGIL  L GVK
Sbjct  56    EDIIEAIEDAGFDAEIIPDTAISQPKAQKTLSAQFRIGGMTCANCVNSVEGILKRLSGVK  115

Query  677   RAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDM  856
              AVVALATS+GEVEYDP+VI+K++IV AIEDAGFE + +QSS QDKI+LG+ G+  + D+
Sbjct  116   GAVVALATSLGEVEYDPSVINKDEIVEAIEDAGFEAAFLQSSEQDKILLGLTGLHTERDV  175

Query  857   QLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYT  1036
              +L  IL K+ G+R F  N T  E+E++FDPE +G RS+VD I  GS G+   HV+NPY 
Sbjct  176   NVLHDILKKMIGLRQFDVNATVSEVEIIFDPEAVGLRSIVDAIETGSNGRLKAHVQNPYA  235

Query  1037  RMASRDIEESSSM  1075
             R AS D  E++ M
Sbjct  236   RGASNDAHEAAKM  248


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 91/206 (44%), Gaps = 54/206 (26%)
 Frame = +2

Query  281  DCEEVRLLDSYDEE--------------------------NSGENLRRI-----------  349
            + E+VRLLDSYDEE                          ++G +   I           
Sbjct  24   EMEDVRLLDSYDEEMGGGAPAAAAGEEEEAHVEDIIEAIEDAGFDAEIIPDTAISQPKAQ  83

Query  350  -----QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENA  514
                 Q R+ GMTCA C  SVEG L  L+GV  A VAL  +  +V +DP V+   +I  A
Sbjct  84   KTLSAQFRIGGMTCANCVNSVEGILKRLSGVKGAVVALATSLGEVEYDPSVINKDEIVEA  143

Query  515  IEDAGFEAEVLAEPNASHANTNGTVSGQFMIG--GMTCAACVNSVEGILSSLPGVKRAVV  688
            IEDAGFEA  L            +   + ++G  G+     VN +  IL  + G+++  V
Sbjct  144  IEDAGFEAAFL----------QSSEQDKILLGLTGLHTERDVNVLHDILKKMIGLRQFDV  193

Query  689  ALATSVGEVEYDPTVISKNDIVNAIE  766
                S  E+ +DP  +    IV+AIE
Sbjct  194  NATVSEVEIIFDPEAVGLRSIVDAIE  219



>ref|XP_001767501.1| predicted protein [Physcomitrella patens]
 gb|EDQ67636.1| predicted protein [Physcomitrella patens]
Length=1009

 Score =   218 bits (556),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 121/258 (47%), Positives = 165/258 (64%), Gaps = 15/258 (6%)
 Frame = +2

Query  329   GENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIE  508
              E  +R++V V GMTCAACS+SVE AL  L GV  A+VALLQN+A VV+D  +V + DI+
Sbjct  49    AETKKRLEVSVIGMTCAACSSSVENALGLLKGVESATVALLQNRAVVVYDSAIVNEDDIK  108

Query  509   NAIEDAGFEAEVL---------AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSS  661
              AIEDAGF+AE+L         ++ +A  AN    + GQF I GMTCA CVNSVE +L+ 
Sbjct  109   EAIEDAGFDAEILTSTPIFSIQSKADAPVAN----IVGQFRIQGMTCANCVNSVESVLTG  164

Query  662   LPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGIS  841
             L GV RA VAL T  GEVEYDP +I++ DI+ AIEDAGF+ +LM+S  +D I   VVG+ 
Sbjct  165   LKGVVRASVALVTETGEVEYDPRLINREDIIEAIEDAGFDATLMESGQRDTIKFDVVGMF  224

Query  842   GQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
               M+   +E IL  L G++    +P +  +EV  DPEV+G R++V  +   + G + + +
Sbjct  225   SAMEKASVESILRSLEGIKEIKVDPLTENVEVSIDPEVIGLRAIVGAVE--ATGDYKVIL  282

Query  1022  KNPYTRMASRDIEESSSM  1075
              N YT  +S +I E   M
Sbjct  283   SNQYTTQSSENINEVGRM  300



>ref|XP_001774995.1| predicted protein [Physcomitrella patens]
 gb|EDQ60261.1| predicted protein [Physcomitrella patens]
Length=1004

 Score =   214 bits (545),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 166/249 (67%), Gaps = 6/249 (2%)
 Frame = +2

Query  341   RRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE  520
             +R+++ V GM CAACS+SVE AL  LNGV  A+VALLQN+A VV++  +V + DI  AI+
Sbjct  51    KRLELNVIGMRCAACSSSVENALGKLNGVESATVALLQNRAVVVYNADLVSEDDIIEAID  110

Query  521   DAGFEAEVLAE-PNASHANTNGTVS---GQFMIGGMTCAACVNSVEGILSSLPGVKRAVV  688
             +AGF+A +++  P +S AN +  VS   GQF I GMTCAACVNSVE +L+SL GV RA V
Sbjct  111   NAGFDAIIVSSTPVSSEANGDAAVSNIVGQFRIQGMTCAACVNSVESVLNSLNGVIRASV  170

Query  689   ALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLE  868
             AL T  GE+EYDP  I++ DI+ AI+DAGF+ +LM SS +DKI   V G+S   +   +E
Sbjct  171   ALVTESGEIEYDPKTINQQDIIEAIDDAGFDATLMDSSQRDKIRFVVAGMSSVQEKANVE  230

Query  869   GILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMAS  1048
              IL  L GV+    +P + ++EV+ DPE +G R++VD +   + G + + + N YT  + 
Sbjct  231   SILCSLTGVKEITVDPLTSKVEVLIDPEAIGLRAIVDAVE--ASGDYKVVISNQYTNKSP  288

Query  1049  RDIEESSSM  1075
              + +E   M
Sbjct  289   EECDEVGHM  297



>gb|KDO77282.1| hypothetical protein CISIN_1g001896mg [Citrus sinensis]
Length=924

 Score =   206 bits (525),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +2

Query  212  MSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYD--EENSGENLRRIQVRVTGMTCAAC  385
            M+ S RD+Q+T  NG  S  D  D E+  LL++YD  +E  G+ +RRIQV VTGMTCAAC
Sbjct  2    MALSNRDLQLTELNGGGSS-DGDDREDEWLLNNYDGKKERIGDGMRRIQVGVTGMTCAAC  60

Query  386  STSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNAS  565
            S SVEGALM L GV KASVALLQNKADVVFDP +VKD+DI+NAIEDAGFEAE+LAE + S
Sbjct  61   SNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAGFEAEILAESSTS  120

Query  566  HANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKN  745
                 GT+ GQ+ IGGMTCAACVNSVEGILS+  GV++      +   EV +DP  +S  
Sbjct  121  GPKPQGTIVGQYTIGGMTCAACVNSVEGILSNFKGVRQFRFDKISGELEVLFDPEALSSR  180

Query  746  DIVNAI  763
             +V+ I
Sbjct  181  SLVDGI  186


 Score =   147 bits (371),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 106/168 (63%), Gaps = 8/168 (5%)
 Frame = +2

Query  596   QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
             Q  + GMTCAAC NSVEG L  L GV +A VAL  +  +V +DP ++   DI NAIEDAG
Sbjct  49    QVGVTGMTCAACSNSVEGALMGLKGVAKASVALLQNKADVVFDPDLVKDEDIKNAIEDAG  108

Query  776   FEGSLMQSSA------QDKII--LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSREL  931
             FE  ++  S+      Q  I+    + G++    +  +EGILS   GVR F ++  S EL
Sbjct  109   FEAEILAESSTSGPKPQGTIVGQYTIGGMTCAACVNSVEGILSNFKGVRQFRFDKISGEL  168

Query  932   EVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             EV+FDPE L SRS+VDGI G S GKF + V NP+ RM SRD EE+S+M
Sbjct  169   EVLFDPEALSSRSLVDGIAGRSNGKFQIRVMNPFARMTSRDSEETSNM  216



>ref|XP_010240462.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X2 [Brachypodium 
distachyon]
Length=886

 Score =   201 bits (512),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 127/178 (71%), Gaps = 0/178 (0%)
 Frame = +2

Query  542   VLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEY  721
             +L +   S   T+ T+S QF IGGMTCA CVNSVEGIL  LPG+K AVVALATS+GEVEY
Sbjct  1     MLPDSAVSQPKTHKTLSAQFRIGGMTCANCVNSVEGILKKLPGIKGAVVALATSLGEVEY  60

Query  722   DPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRH  901
              P+ ISK++IV AIEDAGFE + +QSS QDKI LG+ G+  + D+ +L  IL K+ G+R 
Sbjct  61    VPSAISKDEIVQAIEDAGFEAAFLQSSEQDKIFLGLTGLHTESDVDILHDILKKMAGLRQ  120

Query  902   FFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             F  N    E+E+VFDPE +  R++VD I  GS G+   HV+NPYT+ AS D +E+S M
Sbjct  121   FSVNTALSEVEIVFDPEAVSLRAIVDTIEMGSNGRLQAHVQNPYTQGASNDAQEASKM  178


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 68/139 (49%), Gaps = 8/139 (6%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            Q R+ GMTCA C  SVEG L  L G+  A VAL  +  +V + P  +   +I  AIEDAG
Sbjct  19   QFRIGGMTCANCVNSVEGILKKLPGIKGAVVALATSLGEVEYVPSAISKDEIVQAIEDAG  78

Query  530  FEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
            FEA  L            T        G+   + V+ +  IL  + G+++  V  A S  
Sbjct  79   FEAAFLQSSEQDKIFLGLT--------GLHTESDVDILHDILKKMAGLRQFSVNTALSEV  130

Query  710  EVEYDPTVISKNDIVNAIE  766
            E+ +DP  +S   IV+ IE
Sbjct  131  EIVFDPEAVSLRAIVDTIE  149



>ref|XP_011015891.1| PREDICTED: copper-transporting ATPase RAN1-like [Populus euphratica]
Length=709

 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 127/177 (72%), Gaps = 16/177 (9%)
 Frame = +2

Query  224  MRDVQMTATNGNSSEE---DFGD--CEEVRLLDS---YDEENSGEN--------LRRIQV  355
            MRD+Q+T   G         + D   E+VRLLDS    D+ + G +         +RIQV
Sbjct  1    MRDLQLTQVAGTRQSPLAVVYTDDMMEDVRLLDSCESRDDHDDGSHAIVIGEDGFKRIQV  60

Query  356  RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFE  535
            RVTGMTCAACS SVE AL S++GV +ASVALLQNKADVVFDP +VKD DI+NAIEDAGFE
Sbjct  61   RVTGMTCAACSNSVESALKSVHGVFRASVALLQNKADVVFDPALVKDDDIKNAIEDAGFE  120

Query  536  AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSV  706
            AE+L+EP+      NGT+ GQF IGGMTCAACVNSVEGIL + PGVKRAVV+L+  V
Sbjct  121  AEILSEPSTLKKKPNGTLLGQFTIGGMTCAACVNSVEGILRNCPGVKRAVVSLSLFV  177


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +2

Query  596  QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            Q  + GMTCAAC NSVE  L S+ GV RA VAL  +  +V +DP ++  +DI NAIEDAG
Sbjct  59   QVRVTGMTCAACSNSVESALKSVHGVFRASVALLQNKADVVFDPALVKDDDIKNAIEDAG  118

Query  776  FEGSLMQSSAQDK-----IILGVVGISGQM---DMQLLEGILSKLHGVRH  901
            FE  ++   +  K      +LG   I G      +  +EGIL    GV+ 
Sbjct  119  FEAEILSEPSTLKKKPNGTLLGQFTIGGMTCAACVNSVEGILRNCPGVKR  168



>ref|XP_008798213.1| PREDICTED: copper-transporting ATPase RAN1-like isoform X3 [Phoenix 
dactylifera]
Length=861

 Score =   189 bits (479),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = +2

Query  614   MTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLM  793
             MTCAACVNSVEGIL  LPGVKRA VALATS+GEVEYDP+VISK+ I +AIEDAGF+ + +
Sbjct  1     MTCAACVNSVEGILRKLPGVKRAAVALATSLGEVEYDPSVISKDAIAHAIEDAGFDAAFL  60

Query  794   QSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSV  973
             QS+ QDKI+LGV  +S + D+ +L+GILSK+ GVR F  N    E+E++FDP+ +G R +
Sbjct  61    QSNDQDKILLGVARLSSETDVHVLQGILSKMSGVRQFEVNIGLSEVEIIFDPQAVGLRHI  120

Query  974   VDGINGGSGGKFTLHVKNPYTRMASRDIEESSSM  1075
             VD I   S G+   HV+NPY + AS D +E+S M
Sbjct  121   VDTIERESIGRLKAHVRNPYAQAASSDAQEASKM  154


 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 72/133 (54%), Gaps = 8/133 (6%)
 Frame = +2

Query  368  MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
            MTCAAC  SVEG L  L GV +A+VAL  +  +V +DP V+    I +AIEDAGF+A  L
Sbjct  1    MTCAACVNSVEGILRKLPGVKRAAVALATSLGEVEYDPSVISKDAIAHAIEDAGFDAAFL  60

Query  548  AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
                     +N        +  ++    V+ ++GILS + GV++  V +  S  E+ +DP
Sbjct  61   --------QSNDQDKILLGVARLSSETDVHVLQGILSKMSGVRQFEVNIGLSEVEIIFDP  112

Query  728  TVISKNDIVNAIE  766
              +    IV+ IE
Sbjct  113  QAVGLRHIVDTIE  125



>ref|XP_002979765.1| hypothetical protein SELMODRAFT_233397 [Selaginella moellendorffii]
 gb|EFJ19167.1| hypothetical protein SELMODRAFT_233397 [Selaginella moellendorffii]
Length=817

 Score =   172 bits (436),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 109/157 (69%), Gaps = 17/157 (11%)
 Frame = +2

Query  368  MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
            MTC ACSTSVE A++ ++GV  A+VALLQNKADV FDP   K+  I+ AIEDAGF+AE+L
Sbjct  1    MTCTACSTSVEKAVLRIDGVSSATVALLQNKADVKFDPRTCKEDAIKEAIEDAGFDAEIL  60

Query  548  AEPNASHANTNGTVSGQFMI---GGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
                          S  FMI   GGMTC ACVNSVEG+L+ LPGVKR  VALAT +GEVE
Sbjct  61   --------------SRTFMIDLVGGMTCTACVNSVEGVLAKLPGVKRVAVALATEMGEVE  106

Query  719  YDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGV  829
            +DP  + +  I+  IEDAGFE  L++S  +DK+IL +
Sbjct  107  FDPKAVQRRQIIETIEDAGFEAELIESEERDKVILTI  143


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 67/124 (54%), Gaps = 3/124 (2%)
 Frame = +2

Query  614  MTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLM  793
            MTC AC  SVE  +  + GV  A VAL  +  +V++DP    ++ I  AIEDAGF+  ++
Sbjct  1    MTCTACSTSVEKAVLRIDGVSSATVALLQNKADVKFDPRTCKEDAIKEAIEDAGFDAEIL  60

Query  794  QSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSV  973
              +    +   V G++    +  +EG+L+KL GV+       +   EV FDP+ +  R +
Sbjct  61   SRTFMIDL---VGGMTCTACVNSVEGVLAKLPGVKRVAVALATEMGEVEFDPKAVQRRQI  117

Query  974  VDGI  985
            ++ I
Sbjct  118  IETI  121


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  359  VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
            V GMTC AC  SVEG L  L GV + +VAL     +V FDP  V+ + I   IEDAGFEA
Sbjct  69   VGGMTCTACVNSVEGVLAKLPGVKRVAVALATEMGEVEFDPKAVQRRQIIETIEDAGFEA  128

Query  539  EVL  547
            E++
Sbjct  129  ELI  131



>ref|XP_002303580.1| putative copper-transporting ATPase 3 family protein [Populus 
trichocarpa]
 gb|EEE78559.1| putative copper-transporting ATPase 3 family protein [Populus 
trichocarpa]
Length=987

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 143/259 (55%), Gaps = 15/259 (6%)
 Frame = +2

Query  266   EEDFGDCEEVRLLDSYDEENSGENLRRIQVR---------VTGMTCAACSTSVEGALMSL  418
             E  +GD        S  +   G ++R   V          V GMTC+AC+ SVE A+  L
Sbjct  14    ESTYGDLSPRPRYPSMPKYPKGVSVRETNVEGSEAKAVFSVMGMTCSACAGSVEKAVKRL  73

Query  419   NGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQ  598
              G+ +A V +L NKA V+F P  V ++ I   IEDAGFEA ++ E  +  +    T   +
Sbjct  74    PGIREAVVDVLNNKAQVLFYPSFVNEETIRETIEDAGFEATLIQEGTSDRS----TQVCR  129

Query  599   FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
               I GMTC +C ++VE  L ++PGV++A VALAT   EV YDP ++S N I+ AI D GF
Sbjct  130   IRINGMTCTSCSSTVEQALQAIPGVQKAQVALATEEAEVHYDPNILSYNQILEAINDTGF  189

Query  779   EGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEV  955
             E  L+ +     KI L +VG+  Q  M+++E  L  L GV+    +P   ++ + + P+V
Sbjct  190   EAILLSTGVDMSKIGLKIVGVRTQNSMRIIENSLQALPGVQSVDIDPEVNKISLSYKPDV  249

Query  956   LGSRSVVDGI-NGGSGGKF  1009
              G R+ ++ I + G+ G+F
Sbjct  250   TGPRNFINVIESTGTSGRF  268



>ref|XP_011022715.1| PREDICTED: probable copper-transporting ATPase HMA5 [Populus 
euphratica]
Length=987

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 131/219 (60%), Gaps = 6/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L NKA V+F P  V ++ I   IEDAGFEA
Sbjct  54    VMGMTCSACAGSVEKAVKRLPGIKEAVVDVLNNKAQVLFYPSFVNEETIRETIEDAGFEA  113

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ E N+  +    T + +  I GMTC +C +++E  L ++PGV++A  ALAT   EV 
Sbjct  114   ALIQEGNSDRS----TQACRIRINGMTCTSCSSTIEQALQAIPGVQKAQAALATEEAEVH  169

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP V+S N I+ AI D GFE  L+ +     KI L + G+  Q  ++++E  L  L GV
Sbjct  170   YDPNVLSYNQILEAITDTGFEAILLSTGVDMSKIGLKIDGVRTQNSLRIIENSLQALPGV  229

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGING-GSGGKF  1009
             +    +P   ++ + + P+V G R+ ++ I   G+ G+F
Sbjct  230   QSIDMDPEVNKISLSYKPDVTGPRNFINVIESTGTSGRF  268



>ref|XP_006344024.1| PREDICTED: probable copper-transporting ATPase HMA5-like [Solanum 
tuberosum]
Length=984

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 134/231 (58%), Gaps = 8/231 (3%)
 Frame = +2

Query  323   NSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKD  502
             +SGE  + I   V GM+C+AC+ SVE A+  L+G+ +A V +L NKA V+F P  V ++ 
Sbjct  40    SSGEEKKAI-FSVNGMSCSACAGSVEKAIKRLSGIKEAVVDVLNNKAQVIFYPTFVNEET  98

Query  503   IENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRA  682
             I   IED GF+A ++ E      N   +   +  I GMTC +C  +VE  L  +PG+++A
Sbjct  99    IRETIEDVGFQATLITE----ETNEKTSQVCRIRIKGMTCTSCSATVESALQLIPGIQKA  154

Query  683   VVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDM  856
              VALAT   E++YDP +++ N+++ AIED GFE  L+ S+ +D  KI+L V G+  +  M
Sbjct  155   QVALATEEAEIQYDPQILTHNELLEAIEDTGFEAILI-STGEDRSKILLKVDGVHTENSM  213

Query  857   QLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
              ++E  L  L GV     +P  ++L V +  + +G R  +  I     G+F
Sbjct  214   SIIESSLRALPGVEDVDIDPELKKLSVSYKSDTIGPRDFIQVIESTDSGRF  264


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 85/176 (48%), Gaps = 16/176 (9%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            EE + +  +  ++R+ GMTC +CS +VE AL  + G+ KA VAL   +A++ +DP ++  
Sbjct  115  EETNEKTSQVCRIRIKGMTCTSCSATVESALQLIPGIQKAQVALATEEAEIQYDPQILTH  174

Query  497  KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
             ++  AIED GFEA +L       +     V G      M+       +E  L +LPGV+
Sbjct  175  NELLEAIEDTGFEA-ILISTGEDRSKILLKVDGVHTENSMSI------IESSLRALPGVE  227

Query  677  RAVVALATSVGEVEYDPTVISKNDIVNAIE--DAG-FEGSLM------QSSAQDKI  817
               +        V Y    I   D +  IE  D+G F+ ++       QS  Q++I
Sbjct  228  DVDIDPELKKLSVSYKSDTIGPRDFIQVIESTDSGRFKATIFPEGDGEQSHRQEEI  283



>gb|EYU23491.1| hypothetical protein MIMGU_mgv1a000768mg [Erythranthe guttata]
Length=991

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 131/223 (59%), Gaps = 6/223 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+AC+ SVE A+  L G+ +A+V +L N+A V+F P  V ++ I   IED GFEA
Sbjct  58    VTGMTCSACAGSVEKAVKRLPGIKEAAVDVLNNRAQVMFYPAFVNEETIRETIEDVGFEA  117

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ E  +   +    +     I GMTC +C  +VE  L SLPGV+RA VALAT   E+ 
Sbjct  118   TLVQEETSEKTSQVCRIR----IKGMTCTSCSTTVESALQSLPGVERAQVALATEEAEIR  173

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP ++S   I+ A+ED+GFE +L+ +  +D  KI L V G+  +  M+++   L  L G
Sbjct  174   YDPNILSSIQILEAVEDSGFEATLISTGEEDRCKIHLQVDGVRTESSMRIIGDSLQALPG  233

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
             V+   +N    ++ + + P++ G R+ ++ I     G++   +
Sbjct  234   VQDMDFNLELNKVSLSYQPDLTGPRNFIEVIESTGSGRYKAKI  276


 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 79/154 (51%), Gaps = 6/154 (4%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             EE S +  +  ++R+ GMTC +CST+VE AL SL GV +A VAL   +A++ +DP+++ 
Sbjct  121  QEETSEKTSQVCRIRIKGMTCTSCSTTVESALQSLPGVERAQVALATEEAEIRYDPNILS  180

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               I  A+ED+GFEA +++         +        + G+   + +  +   L +LPGV
Sbjct  181  SIQILEAVEDSGFEATLISTGEEDRCKIH------LQVDGVRTESSMRIIGDSLQALPGV  234

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +     L  +   + Y P +    + +  IE  G
Sbjct  235  QDMDFNLELNKVSLSYQPDLTGPRNFIEVIESTG  268


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 67/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG+K A V +  +  +V + P  +++  I   IED GF
Sbjct  56   FSVTGMTCSACAGSVEKAVKRLPGIKEAAVDVLNNRAQVMFYPAFVNEETIRETIEDVGF  115

Query  779  EGSLMQSSAQDKI----ILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E +L+Q    +K      + + G++       +E  L  L GV        + E E+ +D
Sbjct  116  EATLVQEETSEKTSQVCRIRIKGMTCTSCSTTVESALQSLPGVERAQVALATEEAEIRYD  175

Query  947  PEVLGSRSVVDGI  985
            P +L S  +++ +
Sbjct  176  PNILSSIQILEAV  188



>ref|XP_011080979.1| PREDICTED: probable copper-transporting ATPase HMA5 [Sesamum 
indicum]
Length=988

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 129/219 (59%), Gaps = 7/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+AC+ SVE A+  L G+ +A V +L N+A V F P  V ++ I   IED GFEA
Sbjct  56    VTGMTCSACAGSVEKAVKRLPGIKEAVVDVLNNRAQVTFYPAFVNEETIRETIEDVGFEA  115

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ E      N   +   +  I GMTC +C  +VE  L +LPGV+RA VALAT   EV 
Sbjct  116   SLIKE----EMNEKSSGICRIRIKGMTCTSCSTTVESSLQTLPGVQRAQVALATEEAEVR  171

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP +++ + IV AIED GFE  L+ S+ +D  KI L V G+  +  ++++   L  L G
Sbjct  172   YDPKILTYSHIVQAIEDTGFEAILI-STGEDRSKIHLQVDGMHRESSIRIVGNSLQALPG  230

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V+   ++P   +L V + P++ G R+ ++ I     G++
Sbjct  231   VQDMSFDPELNKLSVSYQPDLTGPRNFIEVIESTGSGRY  269


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 72/142 (51%), Gaps = 7/142 (5%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            ++R+ GMTC +CST+VE +L +L GV +A VAL   +A+V +DP ++    I  AIED G
Sbjct  131  RIRIKGMTCTSCSTTVESSLQTLPGVQRAQVALATEEAEVRYDPKILTYSHIVQAIEDTG  190

Query  530  FEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
            FEA ++     S       +  Q  + GM   + +  V   L +LPGV+        +  
Sbjct  191  FEAILI-----STGEDRSKIHLQ--VDGMHRESSIRIVGNSLQALPGVQDMSFDPELNKL  243

Query  710  EVEYDPTVISKNDIVNAIEDAG  775
             V Y P +    + +  IE  G
Sbjct  244  SVSYQPDLTGPRNFIEVIESTG  265


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG+K AVV +  +  +V + P  +++  I   IED GF
Sbjct  54   FSVTGMTCSACAGSVEKAVKRLPGIKEAVVDVLNNRAQVTFYPAFVNEETIRETIEDVGF  113

Query  779  EGSLMQSSAQDK----IILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E SL++    +K      + + G++       +E  L  L GV+       + E EV +D
Sbjct  114  EASLIKEEMNEKSSGICRIRIKGMTCTSCSTTVESSLQTLPGVQRAQVALATEEAEVRYD  173

Query  947  PEVLGSRSVVDGI  985
            P++L    +V  I
Sbjct  174  PKILTYSHIVQAI  186



>ref|XP_010533660.1| PREDICTED: probable copper-transporting ATPase HMA5 [Tarenaya 
hassleriana]
Length=992

 Score =   150 bits (379),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 138/235 (59%), Gaps = 10/235 (4%)
 Frame = +2

Query  305   DSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
             ++Y E N      R   RV GMTC+AC+ SVE A+  L G+ +A +  L N+A V+F P+
Sbjct  41    EAYREGNVAA---RAVFRVVGMTCSACAGSVEKAIKRLPGIREAVIDALNNRAQVLFYPN  97

Query  485   VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
              V ++ I   IEDAGFEA ++     +  N   T   +  I GMTC +C +++EG+L SL
Sbjct  98    SVNEETIRETIEDAGFEASLIE----NEVNEKSTQVCRIRINGMTCTSCSSTIEGVLQSL  153

Query  665   PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGI  838
              GV++A VALAT   E++YDP+V+S   ++ AIEDAGFE  LM S+ +D  KI L V G 
Sbjct  154   NGVQKARVALATEEAEIQYDPSVLSYERLLEAIEDAGFEAILM-STGEDVSKIALKVEGE  212

Query  839   SGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
                  M+++E  L  L GV+    +  + ++ +++ P++ G R+ +  I   + G
Sbjct  213   YTDESMRMVERSLEALPGVQEVEIHYGTDKISILYKPDMTGPRNFIRVIESTASG  267



>ref|XP_001766223.1| predicted protein [Physcomitrella patens]
 gb|EDQ68855.1| predicted protein [Physcomitrella patens]
Length=1125

 Score =   150 bits (378),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 138/228 (61%), Gaps = 7/228 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGM CAAC+ S+E A+  L G+ +A+V++LQN+A VV+ P  V+++ I  AIEDAGFEA
Sbjct  318   VTGMECAACAGSIEKAVKRLPGIEEATVSVLQNRAQVVYRPAFVQEESIREAIEDAGFEA  377

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             E + +        +G++S +F I GMTC +C NS+E  L  L GV+ AVVALAT   EV 
Sbjct  378   EAIVD---DAGQRSGSIS-RFRIKGMTCTSCSNSIESSLKKLDGVQNAVVALATEECEVR  433

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGILSKLHGV  895
             +D  VIS   +  AI+D G+E  L+ +  + ++I L + G++   D QL++ +L  L GV
Sbjct  434   HDAGVISHVQLAAAIDDLGYEAELLITGEETNRIRLQLEGVTAAADFQLVKEMLVALSGV  493

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTR  1039
                  + ++  + V ++P+  G R+ ++ I     G FT  ++ P  R
Sbjct  494   TSVDLDFSNAMVTVSYEPDRAGPRTFIETIE--QAGVFTAKLEAPRGR  539


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 72/142 (51%), Gaps = 7/142 (5%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            + R+ GMTC +CS S+E +L  L+GV  A VAL   + +V  D  V+    +  AI+D G
Sbjct  393  RFRIKGMTCTSCSNSIESSLKKLDGVQNAVVALATEECEVRHDAGVISHVQLAAAIDDLG  452

Query  530  FEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
            +EAE+L     +   TN     +  + G+T AA    V+ +L +L GV    +  + ++ 
Sbjct  453  YEAELL----ITGEETNRI---RLQLEGVTAAADFQLVKEMLVALSGVTSVDLDFSNAMV  505

Query  710  EVEYDPTVISKNDIVNAIEDAG  775
             V Y+P        +  IE AG
Sbjct  506  TVSYEPDRAGPRTFIETIEQAG  527


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 61/123 (50%), Gaps = 4/123 (3%)
 Frame = +2

Query  602  MIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFE  781
            ++ GM CAAC  S+E  +  LPG++ A V++  +  +V Y P  + +  I  AIEDAGFE
Sbjct  317  VVTGMECAACAGSIEKAVKRLPGIEEATVSVLQNRAQVVYRPAFVQEESIREAIEDAGFE  376

Query  782  G-SLMQSSAQDKIILGVVGISGQMDMQL---LEGILSKLHGVRHFFYNPTSRELEVVFDP  949
              +++  + Q    +    I G         +E  L KL GV++      + E EV  D 
Sbjct  377  AEAIVDDAGQRSGSISRFRIKGMTCTSCSNSIESSLKKLDGVQNAVVALATEECEVRHDA  436

Query  950  EVL  958
             V+
Sbjct  437  GVI  439



>ref|XP_010325414.1| PREDICTED: LOW QUALITY PROTEIN: probable copper-transporting 
ATPase HMA5 [Solanum lycopersicum]
Length=984

 Score =   149 bits (377),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 133/231 (58%), Gaps = 8/231 (3%)
 Frame = +2

Query  323   NSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKD  502
             +SGE  + I   V GM+C+AC+ SVE A+  L+G+ +A V +L NKA V+F P  V ++ 
Sbjct  40    SSGEEKKAI-FSVNGMSCSACAGSVEKAIKRLSGIKEAVVDVLNNKAQVIFYPTFVNEET  98

Query  503   IENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRA  682
             I   IED GFEA ++ E      N   +   +  I GMTC +C  +V   L  +PGV++A
Sbjct  99    ILETIEDVGFEATLVTE----ETNEKTSQVCRIRIKGMTCTSCSATVVSALXLIPGVQKA  154

Query  683   VVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDM  856
              VALAT V E++YDP +++ N ++ AIED GFE  L+ S+ +D  KI+L V G+  +  M
Sbjct  155   QVALATEVAEIQYDPRILTHNQLLEAIEDTGFEAILI-STGEDRSKILLKVDGVHTENSM  213

Query  857   QLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
              ++E  L  L GV     +P  ++L V +  + +G R  +  I     G+F
Sbjct  214   SIIESSLRALPGVEDVDIDPELKKLSVSYKSDTIGPRDFIQVIESTGSGRF  264


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 80/176 (45%), Gaps = 16/176 (9%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            EE + +  +  ++R+ GMTC +CS +V  AL  + GV KA VAL    A++ +DP ++  
Sbjct  115  EETNEKTSQVCRIRIKGMTCTSCSATVVSALXLIPGVQKAQVALATEVAEIQYDPRILTH  174

Query  497  KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
              +  AIED GFEA +L       +     V G      M+       +E  L +LPGV+
Sbjct  175  NQLLEAIEDTGFEA-ILISTGEDRSKILLKVDGVHTENSMSI------IESSLRALPGVE  227

Query  677  RAVVALATSVGEVEYDPTVISKNDIVNAIEDAG---FEGSLM------QSSAQDKI  817
               +        V Y    I   D +  IE  G   F+ ++       QS  Q++I
Sbjct  228  DVDIDPELKKLSVSYKSDTIGPRDFIQVIESTGSGRFKATIFPEGGGKQSHRQEEI  283



>ref|XP_010255417.1| PREDICTED: probable copper-transporting ATPase HMA5 [Nelumbo 
nucifera]
Length=984

 Score =   149 bits (377),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 126/218 (58%), Gaps = 5/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+  A+V +L NKA V+F P+ V ++ I  AIEDAGFEA
Sbjct  52    VLGMTCSACAGSVEKAIKRLPGIRDAAVDVLNNKAQVLFFPNFVNEETIREAIEDAGFEA  111

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      +     + +F I GMTC +C  +VE  L  + GV+ A VALAT   E+ 
Sbjct  112   ALIKD----DVDNKSVQTCRFHIKGMTCTSCSRAVESALQGINGVQNAQVALATEEAEIR  167

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  ++S N ++ AIEDAGFE  L+ +   + KI L V G+     M+++E  L  L GV
Sbjct  168   YDSKIVSHNQLLEAIEDAGFEAILISTGEDKSKIQLKVDGVRTNYSMRIIEESLQALPGV  227

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             +   Y+P   ++ + + P+  G R+ +  I     G+F
Sbjct  228   QDIEYDPLLNKVSLSYKPDETGPRNFIQVIESTGSGRF  265



>ref|XP_002509783.1| copper-transporting atpase p-type, putative [Ricinus communis]
 gb|EEF51170.1| copper-transporting atpase p-type, putative [Ricinus communis]
Length=987

 Score =   149 bits (377),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 125/218 (57%), Gaps = 5/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTCAAC+ SVE A+  L G+ +A+V +L N+A V+F P  V ++ I   IEDAGFEA
Sbjct  54    VIGMTCAACAGSVEKAVKRLPGIKEAAVDVLNNRAQVLFYPTFVNEETIRETIEDAGFEA  113

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      N       +  I GMTC +C ++VE  L S+ GV+ A VALAT   E+ 
Sbjct  114   TLIQD----ETNDKSAQVCRIQINGMTCTSCSSAVEQALQSIQGVQTAQVALATEEAEIH  169

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP ++S N ++ AI++ GFE  L+ +    DKI L V GI     M+++E  L  L GV
Sbjct  170   YDPKMLSYNQLLEAIDNTGFEAILISTGEYIDKIQLKVDGIWTYNSMRMIENSLQALPGV  229

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             +    +P  R+  + + PE+ G R+ +  I     G+F
Sbjct  230   QSIDIDPELRKFSLSYKPEMTGPRNFIKVIESTGTGRF  267


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 78/155 (50%), Gaps = 9/155 (6%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             +E + ++ +  ++++ GMTC +CS++VE AL S+ GV  A VAL   +A++ +DP ++ 
Sbjct  117  QDETNDKSAQVCRIQINGMTCTSCSSAVEQALQSIQGVQTAQVALATEEAEIHYDPKMLS  176

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPG  670
               +  AI++ GFEA ++        +T   +   Q  + G+     +  +E  L +LPG
Sbjct  177  YNQLLEAIDNTGFEAILI--------STGEYIDKIQLKVDGIWTYNSMRMIENSLQALPG  228

Query  671  VKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            V+   +        + Y P +    + +  IE  G
Sbjct  229  VQSIDIDPELRKFSLSYKPEMTGPRNFIKVIESTG  263



>ref|XP_011029249.1| PREDICTED: probable copper-transporting ATPase HMA5 [Populus 
euphratica]
Length=985

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 126/219 (58%), Gaps = 7/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTCAAC+ SVE A+  L G+ +A V +L NKA V+F P  V ++ I   IED GFEA
Sbjct  53    VLGMTCAACAGSVEKAVKRLPGIREAVVDVLNNKAQVLFYPSFVNEETIRETIEDVGFEA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ E  +  +    T   +  I GMTC +C  +VE  L ++PGV++A VALAT   EV 
Sbjct  113   TLIQEETSDKS----TQVCRIRINGMTCTSCSTTVEQALQAIPGVQKAQVALATEEAEVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP ++S N I+ AI D GFE  L+ S+ +D  KI L V G+     M+++E  L  L G
Sbjct  169   YDPKILSYNQILEAINDTGFEAVLL-STGEDMGKIGLKVDGVRTHNSMRMIENSLQALPG  227

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V+    +    ++ + + P+V G R+ +  I     G+F
Sbjct  228   VQSIDIDSEVNKISLSYKPDVTGPRNFIKVIESTGTGRF  266


 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 78/154 (51%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             EE S ++ +  ++R+ GMTC +CST+VE AL ++ GV KA VAL   +A+V +DP ++ 
Sbjct  116  QEETSDKSTQVCRIRINGMTCTSCSTTVEQALQAIPGVQKAQVALATEEAEVHYDPKILS  175

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               I  AI D GFEA +L     S     G +     + G+     +  +E  L +LPGV
Sbjct  176  YNQILEAINDTGFEAVLL-----STGEDMGKIG--LKVDGVRTHNSMRMIENSLQALPGV  228

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +   +    +   + Y P V    + +  IE  G
Sbjct  229  QSIDIDSEVNKISLSYKPDVTGPRNFIKVIESTG  262


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 87/186 (47%), Gaps = 16/186 (9%)
 Frame = +2

Query  557   NASHANTNGT-VSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             +A   N  G+     F + GMTCAAC  SVE  +  LPG++ AVV +  +  +V + P+ 
Sbjct  36    SAQETNVEGSEAKAVFCVLGMTCAACAGSVEKAVKRLPGIREAVVDVLNNKAQVLFYPSF  95

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRH  901
             +++  I   IED GFE +L+Q    DK      + + G++       +E  L  + GV+ 
Sbjct  96    VNEETIRETIEDVGFEATLIQEETSDKSTQVCRIRINGMTCTSCSTTVEQALQAIPGVQK  155

Query  902   FFYNPTSRELEVVFDPEVLGSRSVVDGIN-----------GGSGGKFTLHVKNPYTRMAS  1048
                   + E EV +DP++L    +++ IN           G   GK  L V    T  + 
Sbjct  156   AQVALATEEAEVHYDPKILSYNQILEAINDTGFEAVLLSTGEDMGKIGLKVDGVRTHNSM  215

Query  1049  RDIEES  1066
             R IE S
Sbjct  216   RMIENS  221



>ref|XP_002269839.1| PREDICTED: probable copper-transporting ATPase HMA5 [Vitis vinifera]
Length=984

 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 129/219 (59%), Gaps = 7/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L ++A V+F P  V ++ I   IED GF+A
Sbjct  53    VIGMTCSACAGSVEKAVKRLPGIREAVVDVLNSRAQVMFYPSFVNEETIRETIEDVGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      N       +  I GMTC +C ++VE  L +L GV++A VALAT    V 
Sbjct  113   TLIQD----ETNEKSIQVCRIRINGMTCTSCTSTVESSLQALHGVQKAQVALATEEARVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP +I+ N ++ AIEDAGFE  L+ S+ +D  KI + V G+     M++LE  L  L G
Sbjct  169   YDPKIINHNQLLEAIEDAGFEAILI-SAGEDMSKIQIKVDGVGTDNSMRILENSLRALPG  227

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V+    +PT R+  + + P+V G R++++ I     G++
Sbjct  228   VQDIDVDPTVRKFSLSYKPDVTGPRNLINVIESTGTGRY  266


 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 81/153 (53%), Gaps = 7/153 (5%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            +E + ++++  ++R+ GMTC +C+++VE +L +L+GV KA VAL   +A V +DP ++  
Sbjct  117  DETNEKSIQVCRIRINGMTCTSCTSTVESSLQALHGVQKAQVALATEEARVHYDPKIINH  176

Query  497  KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
              +  AIEDAGFEA +L       +        Q  + G+     +  +E  L +LPGV+
Sbjct  177  NQLLEAIEDAGFEA-ILISAGEDMSKI------QIKVDGVGTDNSMRILENSLRALPGVQ  229

Query  677  RAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
               V        + Y P V    +++N IE  G
Sbjct  230  DIDVDPTVRKFSLSYKPDVTGPRNLINVIESTG  262


 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 71/133 (53%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  S  +V + P+ +++  I   IED GF
Sbjct  51   FSVIGMTCSACAGSVEKAVKRLPGIREAVVDVLNSRAQVMFYPSFVNEETIRETIEDVGF  110

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + +L+Q    +K I    + + G++       +E  L  LHGV+       + E  V +D
Sbjct  111  QATLIQDETNEKSIQVCRIRINGMTCTSCTSTVESSLQALHGVQKAQVALATEEARVHYD  170

Query  947  PEVLGSRSVVDGI  985
            P+++    +++ I
Sbjct  171  PKIINHNQLLEAI  183



>ref|XP_002299540.1| hypothetical protein POPTR_0001s09210g [Populus trichocarpa]
 gb|EEE84345.1| hypothetical protein POPTR_0001s09210g [Populus trichocarpa]
Length=965

 Score =   147 bits (371),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 127/219 (58%), Gaps = 7/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTCAAC+ SVE A+  L G+ +A V +L NKA V+F P  V ++ I   IEDAGFEA
Sbjct  53    VLGMTCAACAGSVEKAVKRLPGIREAVVDVLNNKAQVLFYPSFVNEETIRETIEDAGFEA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ E  +  +    T   +  I GMTC +C ++VE  L ++PGV++A VALAT   EV 
Sbjct  113   TLIQEETSDKS----TQVCRIRINGMTCTSCSSTVEQALQAIPGVQKAQVALATEEAEVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP ++  N I+ AI D GFE  L+ S+ +D  KI L V G+     M+++E  L  L G
Sbjct  169   YDPKILGCNQILEAINDTGFEAVLL-STGEDMGKIGLKVDGVRTHNSMRMIEKSLQALPG  227

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V+    +    ++ + + P+V G R+ +  I     G+F
Sbjct  228   VQSIDIDSEVNKISLSYKPDVTGPRNFIKVIESTGTGRF  266


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 90/186 (48%), Gaps = 16/186 (9%)
 Frame = +2

Query  557   NASHANTNGT-VSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             +A   N  G+     F + GMTCAAC  SVE  +  LPG++ AVV +  +  +V + P+ 
Sbjct  36    SAQETNVEGSEAKAVFCVLGMTCAACAGSVEKAVKRLPGIREAVVDVLNNKAQVLFYPSF  95

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRH  901
             +++  I   IEDAGFE +L+Q    DK      + + G++       +E  L  + GV+ 
Sbjct  96    VNEETIRETIEDAGFEATLIQEETSDKSTQVCRIRINGMTCTSCSSTVEQALQAIPGVQK  155

Query  902   FFYNPTSRELEVVFDPEVLGSRSVVDGIN-----------GGSGGKFTLHVKNPYTRMAS  1048
                   + E EV +DP++LG   +++ IN           G   GK  L V    T  + 
Sbjct  156   AQVALATEEAEVHYDPKILGCNQILEAINDTGFEAVLLSTGEDMGKIGLKVDGVRTHNSM  215

Query  1049  RDIEES  1066
             R IE+S
Sbjct  216   RMIEKS  221


 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 78/154 (51%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             EE S ++ +  ++R+ GMTC +CS++VE AL ++ GV KA VAL   +A+V +DP ++ 
Sbjct  116  QEETSDKSTQVCRIRINGMTCTSCSSTVEQALQAIPGVQKAQVALATEEAEVHYDPKILG  175

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               I  AI D GFEA +L     S     G +     + G+     +  +E  L +LPGV
Sbjct  176  CNQILEAINDTGFEAVLL-----STGEDMGKIG--LKVDGVRTHNSMRMIEKSLQALPGV  228

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +   +    +   + Y P V    + +  IE  G
Sbjct  229  QSIDIDSEVNKISLSYKPDVTGPRNFIKVIESTG  262



>ref|XP_011080976.1| PREDICTED: probable copper-transporting ATPase HMA5 [Sesamum 
indicum]
Length=971

 Score =   147 bits (371),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 127/217 (59%), Gaps = 6/217 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+ACS +VE A+  L G+ +A+V +L ++A VVF P    ++ I  AIEDAGF+A
Sbjct  36    VTGMTCSACSAAVEKAVKRLPGIKEAAVDVLNHRAQVVFCPAFANEEIIRKAIEDAGFQA  95

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ E      N   T   Q  I G+ C +C  ++E  LS++ GV++A+VAL +   EV 
Sbjct  96    RLITE----EINERYTQVCQIRIQGLNCISCSMTLEYYLSAMHGVQKALVALPSEQLEVH  151

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP +++ + I+  IED GFEG+L+ +  +D  K+ L V G+     M ++E  L  L G
Sbjct  152   YDPKILTYDQILEYIEDVGFEGTLISNGEEDRCKVRLQVDGLQTDGSMTMIESSLRALPG  211

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
             V+   + P  ++L + ++P++ G R  +  I     G
Sbjct  212   VQEIHFEPELKKLSISYEPDLTGPRDFIKTIQASGLG  248


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 84/181 (46%), Gaps = 32/181 (18%)
 Frame = +2

Query  473  FDPH---VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSV  643
            + PH    V   D E  I+D+  EA+ L                 F + GMTC+AC  +V
Sbjct  8    YHPHKGITVSSSDEEKCIQDS--EAKAL-----------------FSVTGMTCSACSAAV  48

Query  644  EGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKI--  817
            E  +  LPG+K A V +     +V + P   ++  I  AIEDAGF+  L+     ++   
Sbjct  49   EKAVKRLPGIKEAAVDVLNHRAQVVFCPAFANEEIIRKAIEDAGFQARLITEEINERYTQ  108

Query  818  -----ILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDG  982
                 I G+  IS  M    LE  LS +HGV+       S +LEV +DP++L    +++ 
Sbjct  109  VCQIRIQGLNCISCSMT---LEYYLSAMHGVQKALVALPSEQLEVHYDPKILTYDQILEY  165

Query  983  I  985
            I
Sbjct  166  I  166


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 67/143 (47%), Gaps = 6/143 (4%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            Q+R+ G+ C +CS ++E  L +++GV KA VAL   + +V +DP ++    I   IED G
Sbjct  111  QIRIQGLNCISCSMTLEYYLSAMHGVQKALVALPSEQLEVHYDPKILTYDQILEYIEDVG  170

Query  530  FEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVG  709
            FE  +++            V G    G MT       +E  L +LPGV+           
Sbjct  171  FEGTLISNGEEDRCKVRLQVDGLQTDGSMTM------IESSLRALPGVQEIHFEPELKKL  224

Query  710  EVEYDPTVISKNDIVNAIEDAGF  778
             + Y+P +    D +  I+ +G 
Sbjct  225  SISYEPDLTGPRDFIKTIQASGL  247



>ref|XP_011016450.1| PREDICTED: probable copper-transporting ATPase HMA5 [Populus 
euphratica]
Length=985

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 126/219 (58%), Gaps = 7/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTCAAC+ SVE A+  L G+ +A V +L NKA V+F P  V ++ I   IED GFEA
Sbjct  53    VLGMTCAACAGSVEKAVKRLPGIREAVVDVLNNKAQVLFYPSFVNEETIRETIEDVGFEA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ E  +  +    T   +  I GMTC +C  +VE  L ++PGV++A VALAT   EV 
Sbjct  113   TLIQEETSDKS----TQVCRIRINGMTCTSCSTTVEQALQAIPGVQKAQVALATEEAEVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP ++S N I+ AI D GFE  L+ S+ +D  KI L V G+     M+++E  L  L G
Sbjct  169   YDPKILSCNQILEAINDTGFEAVLL-STGEDMGKIGLKVDGVRTHNSMRMIENSLQALPG  227

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V+    +    ++ + + P+V G R+ +  I     G+F
Sbjct  228   VQSVDIDSEVNKISLSYKPDVTGPRNFIKVIESTGTGRF  266


 Score = 79.7 bits (195),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 78/154 (51%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             EE S ++ +  ++R+ GMTC +CST+VE AL ++ GV KA VAL   +A+V +DP ++ 
Sbjct  116  QEETSDKSTQVCRIRINGMTCTSCSTTVEQALQAIPGVQKAQVALATEEAEVHYDPKILS  175

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               I  AI D GFEA +L     S     G +     + G+     +  +E  L +LPGV
Sbjct  176  CNQILEAINDTGFEAVLL-----STGEDMGKIG--LKVDGVRTHNSMRMIENSLQALPGV  228

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +   +    +   + Y P V    + +  IE  G
Sbjct  229  QSVDIDSEVNKISLSYKPDVTGPRNFIKVIESTG  262


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 87/186 (47%), Gaps = 16/186 (9%)
 Frame = +2

Query  557   NASHANTNGT-VSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
             +A   N  G+     F + GMTCAAC  SVE  +  LPG++ AVV +  +  +V + P+ 
Sbjct  36    SAQETNVEGSEAKAVFCVLGMTCAACAGSVEKAVKRLPGIREAVVDVLNNKAQVLFYPSF  95

Query  734   ISKNDIVNAIEDAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRH  901
             +++  I   IED GFE +L+Q    DK      + + G++       +E  L  + GV+ 
Sbjct  96    VNEETIRETIEDVGFEATLIQEETSDKSTQVCRIRINGMTCTSCSTTVEQALQAIPGVQK  155

Query  902   FFYNPTSRELEVVFDPEVLGSRSVVDGIN-----------GGSGGKFTLHVKNPYTRMAS  1048
                   + E EV +DP++L    +++ IN           G   GK  L V    T  + 
Sbjct  156   AQVALATEEAEVHYDPKILSCNQILEAINDTGFEAVLLSTGEDMGKIGLKVDGVRTHNSM  215

Query  1049  RDIEES  1066
             R IE S
Sbjct  216   RMIENS  221



>gb|KDP25452.1| hypothetical protein JCGZ_20608 [Jatropha curcas]
Length=958

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 128/219 (58%), Gaps = 6/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE-DAGFE  535
             V GMTCAAC+ SVE A+  L G+ +A+V +L ++A V+F P  V ++ I   IE DAGFE
Sbjct  55    VIGMTCAACAGSVEKAVKRLPGIREAAVDVLNSRAQVLFYPSFVNEETIRKTIEDDAGFE  114

Query  536   AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
             A ++ +      +   T   +  I GMTC +C ++VE  L ++ GV++A VALAT   EV
Sbjct  115   ATLIQD----EISDKSTQVCRIRINGMTCTSCSSTVEQALQAIHGVQKAQVALATEEAEV  170

Query  716   EYDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHG  892
              YDP ++S N ++ AIED GFE  L+ +    DKI L V GI  +  M+++E  L  L G
Sbjct  171   HYDPNILSYNQLLQAIEDTGFEAILISTGEDMDKIQLKVDGIRTEDSMRMIENSLRALPG  230

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V+    +P   ++ + + PE+ G R+ +  I     G+F
Sbjct  231   VQTINIDPELNKISLSYKPEMTGPRNFIKVIESTGTGRF  269


 Score = 76.6 bits (187),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 85/166 (51%), Gaps = 10/166 (6%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            +E S ++ +  ++R+ GMTC +CS++VE AL +++GV KA VAL   +A+V +DP+++  
Sbjct  120  DEISDKSTQVCRIRINGMTCTSCSSTVEQALQAIHGVQKAQVALATEEAEVHYDPNILSY  179

Query  497  KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
              +  AIED GFEA ++       +        Q  + G+     +  +E  L +LPGV+
Sbjct  180  NQLLQAIEDTGFEAILI-------STGEDMDKIQLKVDGIRTEDSMRMIENSLRALPGVQ  232

Query  677  RAVVALATSVGEVEYDPTVISKNDIVNAIEDAG---FEGSLMQSSA  805
               +    +   + Y P +    + +  IE  G   F+  +   SA
Sbjct  233  TINIDPELNKISLSYKPEMTGPRNFIKVIESTGTGRFKAMIFPESA  278


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 69/134 (51%), Gaps = 5/134 (4%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIE-DAG  775
            F + GMTCAAC  SVE  +  LPG++ A V +  S  +V + P+ +++  I   IE DAG
Sbjct  53   FSVIGMTCAACAGSVEKAVKRLPGIREAAVDVLNSRAQVLFYPSFVNEETIRKTIEDDAG  112

Query  776  FEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVF  943
            FE +L+Q    DK      + + G++       +E  L  +HGV+       + E EV +
Sbjct  113  FEATLIQDEISDKSTQVCRIRINGMTCTSCSSTVEQALQAIHGVQKAQVALATEEAEVHY  172

Query  944  DPEVLGSRSVVDGI  985
            DP +L    ++  I
Sbjct  173  DPNILSYNQLLQAI  186



>ref|XP_010676476.1| PREDICTED: probable copper-transporting ATPase HMA5 [Beta vulgaris 
subsp. vulgaris]
Length=998

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 145/260 (56%), Gaps = 12/260 (5%)
 Frame = +2

Query  251   NGNSSEEDFGDCEEVRLLDSYDEENSGENLR----RIQVRVTGMTCAACSTSVEGALMSL  418
             N +SS  D         +  Y +  S E +     +    V GMTC+AC+ SVE A+  L
Sbjct  17    NESSSRSDLSARPHYPSMPKYPKGVSKEKIEGSESKALFSVIGMTCSACAGSVEKAIKRL  76

Query  419   NGVVKASVALLQNKADVVFDPHVVKDKDI-ENAIEDAGFEAEVLAEPNASHANTNGTVSG  595
              G+ +A V +L N+  V+F P  V ++ I E  IED GFEA ++ + ++  +N    V  
Sbjct  77    PGIREAVVDVLNNRVQVIFYPSFVNEEKICETIIEDVGFEAALIEDESSEGSNQVVRVH-  135

Query  596   QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
                I GMTC  C NS+E  L  + G+K+A VALAT   E+ YDP ++S N+++ A+ED+G
Sbjct  136   ---IKGMTCTTCANSIEVSLHGVQGIKKAQVALATEEAEIHYDPKLVSYNEVLKAVEDSG  192

Query  776   FEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDP  949
             FE  L+ S+ +D  K+ L V G+S +   +++E  L +L GV+    +PT +++ + + P
Sbjct  193   FEAVLI-STGEDRSKVQLKVDGLSSEDSWEIIESSLRELPGVQAMDIDPTLQKISLFYKP  251

Query  950   EVLGSRSVVDGINGGSGGKF  1009
             ++ G R+ ++ I     G F
Sbjct  252   DMTGPRNFIEVIESTGLGGF  271



>ref|XP_012086929.1| PREDICTED: probable copper-transporting ATPase HMA5 [Jatropha 
curcas]
Length=979

 Score =   144 bits (363),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 126/219 (58%), Gaps = 6/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI-EDAGFE  535
             V GMTCAAC+ SVE A+  L G+ +A+V +L ++A V+F P  V  K I   I EDAGFE
Sbjct  45    VIGMTCAACAGSVEKAVKRLPGIREAAVDVLNSRAQVLFYPSFVNVKTIRKTIEEDAGFE  104

Query  536   AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
             A ++ +      +   T   +  I GMTC +C ++VE  L ++ GV++A +ALAT   EV
Sbjct  105   ATLIQD----EISDKSTQVCRIRINGMTCTSCSSTVEQALQAIHGVQKAQMALATEEAEV  160

Query  716   EYDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHG  892
              YDP ++S N ++ AIED GFE  L+ +    DKI L V GI  +  M+++E  L  L G
Sbjct  161   HYDPNILSYNQLLQAIEDTGFEAILISTGEDMDKIQLKVDGIRTEDSMRMIENSLRALPG  220

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V+    +P   +  + + PE+ G R+ +  I     G+F
Sbjct  221   VQTINIDPELSKFSLSYKPEMTGPRNFIKVIESTGTGRF  259


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/217 (26%), Positives = 99/217 (46%), Gaps = 22/217 (10%)
 Frame = +2

Query  200  KFIEMSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQ---------  352
            K ++  P +R+  +   N  +    +     V+ +    EE++G     IQ         
Sbjct  59   KAVKRLPGIREAAVDVLNSRAQVLFYPSFVNVKTIRKTIEEDAGFEATLIQDEISDKSTQ  118

Query  353  ---VRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
               +R+ GMTC +CS++VE AL +++GV KA +AL   +A+V +DP+++    +  AIED
Sbjct  119  VCRIRINGMTCTSCSSTVEQALQAIHGVQKAQMALATEEAEVHYDPNILSYNQLLQAIED  178

Query  524  AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
             GFEA ++       +        Q  + G+     +  +E  L +LPGV+   +    S
Sbjct  179  TGFEAILI-------STGEDMDKIQLKVDGIRTEDSMRMIENSLRALPGVQTINIDPELS  231

Query  704  VGEVEYDPTVISKNDIVNAIEDAG---FEGSLMQSSA  805
               + Y P +    + +  IE  G   F+  +   SA
Sbjct  232  KFSLSYKPEMTGPRNFIKVIESTGTGRFKAMIFPESA  268


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 5/134 (4%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAI-EDAG  775
            F + GMTCAAC  SVE  +  LPG++ A V +  S  +V + P+ ++   I   I EDAG
Sbjct  43   FSVIGMTCAACAGSVEKAVKRLPGIREAAVDVLNSRAQVLFYPSFVNVKTIRKTIEEDAG  102

Query  776  FEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVF  943
            FE +L+Q    DK      + + G++       +E  L  +HGV+       + E EV +
Sbjct  103  FEATLIQDEISDKSTQVCRIRINGMTCTSCSSTVEQALQAIHGVQKAQMALATEEAEVHY  162

Query  944  DPEVLGSRSVVDGI  985
            DP +L    ++  I
Sbjct  163  DPNILSYNQLLQAI  176



>ref|XP_008392561.1| PREDICTED: probable copper-transporting ATPase HMA5 [Malus domestica]
Length=987

 Score =   144 bits (363),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 127/222 (57%), Gaps = 4/222 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P+ V  + I   IED GF+A
Sbjct  53    VTGMTCSACAGSVEKAVKRLPGIREAIVDVLNNRAQVMFFPNYVNAETIRETIEDVGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++   N    N   T+  + +I GMTC +C  +VE  L ++ GV++A VALAT   +V 
Sbjct  113   TLI---NDEEGNEKSTLICRILIKGMTCTSCSTTVESALQAVDGVQKAQVALATEEADVH  169

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP ++S N ++  IED GFEG L+ +     +I L V G+     M++LE  L  L GV
Sbjct  170   YDPKIVSYNQLLQTIEDTGFEGKLITAGEHMSRIELEVDGVRTDRSMRILEQSLQALPGV  229

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
             +   ++   +++ + +  ++ G RS ++ I      +F   +
Sbjct  230   QAVDFDSEIKKISLYYKSDITGPRSFINVIETTGSRRFKARI  271


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 79/156 (51%), Gaps = 11/156 (7%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DEE + ++    ++ + GMTC +CST+VE AL +++GV KA VAL   +ADV +DP +V 
Sbjct  117  DEEGNEKSTLICRILIKGMTCTSCSTTVESALQAVDGVQKAQVALATEEADVHYDPKIVS  176

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +   IED GFE +++      H +       +  + G+     +  +E  L +LPGV
Sbjct  177  YNQLLQTIEDTGFEGKLITA--GEHMSRI-----ELEVDGVRTDRSMRILEQSLQALPGV  229

Query  674  KRAVVALATSVGEVE--YDPTVISKNDIVNAIEDAG  775
            +   V   + + ++   Y   +      +N IE  G
Sbjct  230  Q--AVDFDSEIKKISLYYKSDITGPRSFINVIETTG  263


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/143 (27%), Positives = 73/143 (51%), Gaps = 6/143 (4%)
 Frame = +2

Query  599   FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
             F + GMTC+AC  SVE  +  LPG++ A+V +  +  +V + P  ++   I   IED GF
Sbjct  51    FSVTGMTCSACAGSVEKAVKRLPGIREAIVDVLNNRAQVMFFPNYVNAETIRETIEDVGF  110

Query  779   EGSLM---QSSAQDKIILGVV--GISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVF  943
             + +L+   + + +  +I  ++  G++       +E  L  + GV+       + E +V +
Sbjct  111   QATLINDEEGNEKSTLICRILIKGMTCTSCSTTVESALQAVDGVQKAQVALATEEADVHY  170

Query  944   DPEVLGSRSVVDGI-NGGSGGKF  1009
             DP+++    ++  I + G  GK 
Sbjct  171   DPKIVSYNQLLQTIEDTGFEGKL  193



>ref|XP_010089122.1| Putative copper-transporting ATPase 3 [Morus notabilis]
 gb|EXB37369.1| Putative copper-transporting ATPase 3 [Morus notabilis]
Length=989

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 128/219 (58%), Gaps = 7/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+ +A V +L  +A V+F P+ V ++ I   IED GFEA
Sbjct  55    VSGMTCAACAGSVEKAVKRLPGIREAVVDVLNGRAQVLFYPNFVNEETIRETIEDVGFEA  114

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++        +   T   +  I GMTC +C ++VE  L ++ GV+RA VALAT   EV 
Sbjct  115   TLIQ----GETSERSTQVCRIRIKGMTCTSCSSTVESALQAVHGVQRAQVALATEEAEVL  170

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP V++ N ++ AIED GFE  L+ SS +D  KI L V G+  +  M+++E  L  L G
Sbjct  171   YDPKVLTHNQLLQAIEDTGFEAILI-SSGEDITKIDLQVEGVRTERSMRIIEESLEALPG  229

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V+    +P  ++  + + P++ G R+ ++ I      +F
Sbjct  230   VQAIDSSPDVKKFSISYKPDMTGPRTFINVIETTGSRRF  268


 Score = 76.6 bits (187),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 7/152 (5%)
 Frame = +2

Query  320  ENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDK  499
            E S  + +  ++R+ GMTC +CS++VE AL +++GV +A VAL   +A+V++DP V+   
Sbjct  120  ETSERSTQVCRIRIKGMTCTSCSSTVESALQAVHGVQRAQVALATEEAEVLYDPKVLTHN  179

Query  500  DIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKR  679
             +  AIED GFEA ++       ++          + G+     +  +E  L +LPGV+ 
Sbjct  180  QLLQAIEDTGFEAILI-------SSGEDITKIDLQVEGVRTERSMRIIEESLEALPGVQA  232

Query  680  AVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
               +       + Y P +      +N IE  G
Sbjct  233  IDSSPDVKKFSISYKPDMTGPRTFINVIETTG  264



>ref|XP_001699267.1| heavy metal transporting ATPase [Chlamydomonas reinhardtii]
 gb|EDO98907.1| heavy metal transporting ATPase [Chlamydomonas reinhardtii]
Length=1097

 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 128/232 (55%), Gaps = 6/232 (3%)
 Frame = +2

Query  317   EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
             +E +   +  +Q+ V GMTCAACS +VEGAL S+ GV + SVALLQ  A+V +D   V  
Sbjct  43    DEKARWPVALLQLSVKGMTCAACSKAVEGALSSVAGVKRVSVALLQESAEVHYDEAAVGP  102

Query  497   KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
             + +  A+EDAGFE  +++      A        +  + GM CAAC  +VE  L S  GV 
Sbjct  103   EALVGAVEDAGFEGGLISVRQPKPAALEAL---RMRVSGMVCAACSTAVENALLSCSGVS  159

Query  677   RAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDM  856
             RA VALA+   EV +D  V++   +V A+EDAGFE +L+     + + L V G+S   D 
Sbjct  160   RAAVALASGEVEVTFDSAVVAAEALVEAVEDAGFEATLLSQGGLESLTLAVSGMSVSGDA  219

Query  857   QLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI---NGGSGG  1003
               +E  L ++ GV     +  +   EV +DP   G R ++  I   +GG+GG
Sbjct  220   TAVEVALRRVPGVAKAAVSLLTGHAEVWYDPNTAGPRDMIGAIERCDGGAGG  271



>ref|XP_003516697.1| PREDICTED: probable copper-transporting ATPase HMA5-like [Glycine 
max]
Length=977

 Score =   142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 131/233 (56%), Gaps = 5/233 (2%)
 Frame = +2

Query  314   DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             +EE      +++ + V GM+CAAC+ S+E A+  L G+ +A V +L +KA V++ P ++ 
Sbjct  30    EEEGRDSEGKKVVLSVMGMSCAACAGSIEKAIKRLPGIREAVVDVLNHKAQVLYYPQMLH  89

Query  494   DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
             ++ I  AIEDAGFEA+V+ E     +    T   +  + GMTC +C +++E  L SL GV
Sbjct  90    EQRIREAIEDAGFEAKVMEE----DSKDTSTQICRIHVRGMTCTSCSSTIESALQSLHGV  145

Query  674   KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQM  850
              +A VAL T   EV YDP +++ N  ++AIE+ GFE  L+ +     KI L + GI  + 
Sbjct  146   HKARVALTTEEAEVCYDPKIVTHNHFMSAIEETGFEAVLISTGEHITKIELQIDGIKNEQ  205

Query  851   DMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
              + ++E  L +L GV      P   ++ + + P + G R+ ++ I     G F
Sbjct  206   SLNVIERSLHELPGVETIDIYPDINKISITYKPYMTGPRTFIEVIESTGSGCF  258



>gb|KHN25708.1| Putative copper-transporting ATPase 3 [Glycine soja]
Length=959

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 131/233 (56%), Gaps = 5/233 (2%)
 Frame = +2

Query  314   DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             +EE      +++ + V GM+CAAC+ S+E A+  L G+ +A V +L +KA V++ P ++ 
Sbjct  5     EEEGRDSEGKKVVLSVMGMSCAACAGSIEKAIKRLPGIREAVVDVLNHKAQVLYYPQMLH  64

Query  494   DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
             ++ I  AIEDAGFEA+V+ E     +    T   +  + GMTC +C +++E  L SL GV
Sbjct  65    EQRIREAIEDAGFEAKVMEE----DSKDTSTQICRIHVRGMTCTSCSSTIESALQSLHGV  120

Query  674   KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQM  850
              +A VAL T   EV YDP +++ N  ++AIE+ GFE  L+ +     KI L + GI  + 
Sbjct  121   HKARVALTTEEAEVCYDPKIVTHNHFMSAIEETGFEAVLISTGEHITKIELQIDGIKNEQ  180

Query  851   DMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
              + ++E  L +L GV      P   ++ + + P + G R+ ++ I     G F
Sbjct  181   SLNVIERSLHELPGVETIDIYPDINKISITYKPYMTGPRTFIEVIESTGSGCF  233



>ref|XP_006850179.2| PREDICTED: probable copper-transporting ATPase HMA5 [Amborella 
trichopoda]
Length=989

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 135/252 (54%), Gaps = 10/252 (4%)
 Frame = +2

Query  323   NSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKD  502
             N  ++ R +  RV G+ CA+C+ S+E A   L GV   SV+LLQ K  + + P  V    
Sbjct  43    NKNDDTRTLVFRVRGIECASCAVSIESAAKILRGVHNVSVSLLQGKVLINYAPKFVNVNA  102

Query  503   IENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRA  682
             I  AIE++GFE E  AE +A+          +  I GMTC +C  S+E  L  + GVK+A
Sbjct  103   IREAIEESGFELEEFAEQDAAVC--------RIQIKGMTCTSCAESIERALHKVDGVKKA  154

Query  683   VVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQ  859
             VV+ A    +V +DP  I  + I  AIEDAGFE  L+ S  + +K+ L + G++   +  
Sbjct  155   VVSFALEEAKVHFDPYTIDSDHIAQAIEDAGFEADLIISGDETNKVHLRLEGLTSPQEAT  214

Query  860   LLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTR  1039
             L++  L  + GV     +P+  ++ V++DP++ G RS++  +     G +  +  + YT 
Sbjct  215   LIQSALEYVIGVNQVEMDPSGNKVAVIYDPDLTGPRSLIQCVQEAGHGPY-FYKASLYTP  273

Query  1040  MASRDIEESSSM  1075
                R+IE  + +
Sbjct  274   PRRREIERQNEI  285


 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 86/173 (50%), Gaps = 23/173 (13%)
 Frame = +2

Query  302  LDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDP  481
            L+ + E+++   + RIQ++  GMTC +C+ S+E AL  ++GV KA V+    +A V FDP
Sbjct  114  LEEFAEQDAA--VCRIQIK--GMTCTSCAESIERALHKVDGVKKAVVSFALEEAKVHFDP  169

Query  482  HVVKDKDIENAIEDAGFEAEVLA---EPNASHANTNGTVSGQ---FMIGGMTCAACVNSV  643
            + +    I  AIEDAGFEA+++    E N  H    G  S Q    +   +     VN V
Sbjct  170  YTIDSDHIAQAIEDAGFEADLIISGDETNKVHLRLEGLTSPQEATLIQSALEYVIGVNQV  229

Query  644  EGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSS  802
            E   S   G K AV+          YDP +     ++  +++AG      ++S
Sbjct  230  EMDPS---GNKVAVI----------YDPDLTGPRSLIQCVQEAGHGPYFYKAS  269



>gb|ERN11760.1| hypothetical protein AMTR_s00022p00244650 [Amborella trichopoda]
Length=975

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 135/252 (54%), Gaps = 10/252 (4%)
 Frame = +2

Query  323   NSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKD  502
             N  ++ R +  RV G+ CA+C+ S+E A   L GV   SV+LLQ K  + + P  V    
Sbjct  29    NKNDDTRTLVFRVRGIECASCAVSIESAAKILRGVHNVSVSLLQGKVLINYAPKFVNVNA  88

Query  503   IENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRA  682
             I  AIE++GFE E  AE +A+          +  I GMTC +C  S+E  L  + GVK+A
Sbjct  89    IREAIEESGFELEEFAEQDAAVC--------RIQIKGMTCTSCAESIERALHKVDGVKKA  140

Query  683   VVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQ  859
             VV+ A    +V +DP  I  + I  AIEDAGFE  L+ S  + +K+ L + G++   +  
Sbjct  141   VVSFALEEAKVHFDPYTIDSDHIAQAIEDAGFEADLIISGDETNKVHLRLEGLTSPQEAT  200

Query  860   LLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYTR  1039
             L++  L  + GV     +P+  ++ V++DP++ G RS++  +     G +  +  + YT 
Sbjct  201   LIQSALEYVIGVNQVEMDPSGNKVAVIYDPDLTGPRSLIQCVQEAGHGPY-FYKASLYTP  259

Query  1040  MASRDIEESSSM  1075
                R+IE  + +
Sbjct  260   PRRREIERQNEI  271


 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 86/173 (50%), Gaps = 23/173 (13%)
 Frame = +2

Query  302  LDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDP  481
            L+ + E+++   + RIQ++  GMTC +C+ S+E AL  ++GV KA V+    +A V FDP
Sbjct  100  LEEFAEQDAA--VCRIQIK--GMTCTSCAESIERALHKVDGVKKAVVSFALEEAKVHFDP  155

Query  482  HVVKDKDIENAIEDAGFEAEVLA---EPNASHANTNGTVSGQ---FMIGGMTCAACVNSV  643
            + +    I  AIEDAGFEA+++    E N  H    G  S Q    +   +     VN V
Sbjct  156  YTIDSDHIAQAIEDAGFEADLIISGDETNKVHLRLEGLTSPQEATLIQSALEYVIGVNQV  215

Query  644  EGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSS  802
            E   S   G K AV+          YDP +     ++  +++AG      ++S
Sbjct  216  EMDPS---GNKVAVI----------YDPDLTGPRSLIQCVQEAGHGPYFYKAS  255



>gb|KHN16831.1| Putative copper-transporting ATPase 3 [Glycine soja]
Length=966

 Score =   140 bits (354),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 131/234 (56%), Gaps = 8/234 (3%)
 Frame = +2

Query  314   DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             +EE S     +    V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P  V 
Sbjct  10    EEEGSSNVSSKALFSVVGMTCSACAASVEKAVKRLPGIRQAVVDVLNNRAQVLFYPSFVN  69

Query  494   DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
             ++ I   IEDAGF+A  + + N +          +  I GMTC +C ++VE  L S+ GV
Sbjct  70    EETIREVIEDAGFQATFIRDDNETSVQI-----CRIRIQGMTCTSCSSTVESALQSIQGV  124

Query  674   KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQ  847
              +A VALAT   EV Y P V++ N I+ A+ED GF+ +L+ S+ +D  +I L V GI   
Sbjct  125   VKAQVALATEEAEVHYTPNVVTYNQILEAVEDTGFQATLI-STGEDMSRIDLQVEGIRTG  183

Query  848   MDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
               M+L+E  L  L GV+    +P   ++ + + P++ G R+ ++ I      +F
Sbjct  184   RSMRLIENSLQALPGVQGVETHPEFNKVSLSYKPDLTGPRNFINVIEETGSRRF  237



>ref|XP_002981273.1| hypothetical protein SELMODRAFT_114297 [Selaginella moellendorffii]
 gb|EFJ17461.1| hypothetical protein SELMODRAFT_114297 [Selaginella moellendorffii]
Length=952

 Score =   140 bits (354),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 130/217 (60%), Gaps = 5/217 (2%)
 Frame = +2

Query  338  LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
            +R +  +V GM CAAC+ S+E A+  L G+  A+VA L  +A V++ P  V ++ I  AI
Sbjct  18   VRDVTFKVEGMECAACAGSIEKAIKRLPGIKNAAVAALHARAQVIYHPAFVAEEAIREAI  77

Query  518  EDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALA  697
            +DAGF+A V+ +    H++ N +   +  I GMTC AC  S+E  L  + GVKRAVVALA
Sbjct  78   QDAGFQASVIED----HSHQNESNICRVRIKGMTCTACSTSIESALRKMAGVKRAVVALA  133

Query  698  TSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGI  874
            T   E+ YDP V+S   ++ AI+DAGFE  L+ +   ++++ L + G+  Q  ++++E  
Sbjct  134  TEESEIHYDPKVVSHGLLMAAIDDAGFETELISAGEDRNRVYLRLQGVHSQEALKVIEIS  193

Query  875  LSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            L  L GV+   +N     L + +DP++ G R  ++ I
Sbjct  194  LMALPGVKSVEFNAIEERLMISYDPDLTGPRCFIEVI  230



>gb|KHN26317.1| Putative copper-transporting ATPase 3 [Glycine soja]
Length=956

 Score =   140 bits (354),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 132/238 (55%), Gaps = 8/238 (3%)
 Frame = +2

Query  314   DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             +EE S     +    V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P  V 
Sbjct  10    EEEGSSNVSSKALFSVVGMTCSACAASVEKAVKRLPGIRQAVVDVLNNRAQVLFYPSFVN  69

Query  494   DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
             ++ I   IEDAGF+A  + + N +          +  I GMTC +C ++VE  L S+ GV
Sbjct  70    EETIREVIEDAGFQATFIRDDNETSVQI-----CRIRIQGMTCTSCSSTVESALQSIQGV  124

Query  674   KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQ  847
              +A VALAT   EV Y P V++ N I+ A+ED GF+ +L+ S+ +D  +I L V GI   
Sbjct  125   VKAQVALATEEAEVHYTPNVVTYNQILEAVEDTGFQATLI-STGEDMSRIDLQVEGIRTG  183

Query  848   MDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
               M+L+E  L  L GV+    +P   ++ + + P++ G R+ ++ I      +F   +
Sbjct  184   RSMRLIENSLQALPGVQGVETHPEFNKVSLSYKPDLTGPRNFINVIEETGSRRFKAKI  241



>emb|CDP09758.1| unnamed protein product [Coffea canephora]
Length=985

 Score =   140 bits (354),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 123/218 (56%), Gaps = 5/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GM C+AC+ SVE A+  L G+ +A V +L NKA V+F P  V ++ I   IED GF+A
Sbjct  53    VIGMNCSACAGSVEKAIKRLPGIKEAVVDVLNNKAQVMFYPSFVNEETIRETIEDVGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ E     AN   T   +  I GMTC +C ++VE  L  +PGV +A VALAT   EV 
Sbjct  113   TLIEE----DANEKSTQVCRISIRGMTCTSCSSTVESALQVIPGVLKARVALATEEAEVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             +DP ++S ND++ AIED GFE  L+ +   ++KI L V GI  +  M+++   L  L GV
Sbjct  169   FDPKILSCNDLLQAIEDTGFEAVLVSTGEDRNKIQLKVDGIRSENSMRIIVNSLQALPGV  228

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                      ++L + +  +V G R+ +  I     G++
Sbjct  229   EDINIESELQKLSLSYKADVTGPRNFMKVIESTGSGRY  266



>ref|XP_009590465.1| PREDICTED: probable copper-transporting ATPase HMA5 [Nicotiana 
tomentosiformis]
Length=992

 Score =   140 bits (354),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 85/237 (36%), Positives = 132/237 (56%), Gaps = 8/237 (3%)
 Frame = +2

Query  308   SYDEENSGENLRRIQV-RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
             S DEE S        V  V GM+C+AC+ SVE A+  L G+ +A V +L NKA V+F P 
Sbjct  41    SSDEEKSIHGTESKAVFSVNGMSCSACAGSVEKAIKRLPGIKEAVVDVLNNKAQVIFYPS  100

Query  485   VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
              V ++ I   IED GF+A ++ E      N   +   +  I GMTC +C  +VE     +
Sbjct  101   FVNEEMIRETIEDVGFQATLIIE----ETNEKTSQVCRIRIKGMTCTSCSTTVESAFLLI  156

Query  665   PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGI  838
             PG+++A VALAT   E++YDP +++ + ++ AIED GFE  L+ S+ +D  KI+L V G+
Sbjct  157   PGIQKAQVALATEEAEIQYDPRILTYSRLLEAIEDTGFEAILI-STGEDRSKILLKVDGV  215

Query  839   SGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
               +  M+++E  L  L GV     +   ++L V +  +++G R  +  I     G+F
Sbjct  216   YTEDSMRIIESSLRALPGVEDIDIDLELKKLSVSYKSDIIGPRDFIQVIESTGSGRF  272



>ref|XP_002269802.1| PREDICTED: probable copper-transporting ATPase HMA5 [Vitis vinifera]
Length=987

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 121/211 (57%), Gaps = 7/211 (3%)
 Frame = +2

Query  359  VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
            V GMTCAAC+ SVE A+  L G+ +A V +L N+  V+F    V ++ I   IED GF+A
Sbjct  53   VIGMTCAACAGSVEKAVKRLPGIREAVVDVLNNRVQVMFYTSFVNEETIRETIEDVGFQA  112

Query  539  EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             ++ +     AN   T   Q  I GMTC +C  +VE  L +L GV++A VALAT   +V 
Sbjct  113  TLMPD----EANEKSTQVCQIHINGMTCTSCSTTVESALQALQGVQKAQVALATEEAQVH  168

Query  719  YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
            YDP +I+ N ++ AIED GFE  L+ S+ +D  KI L V G+     M+L+E  L  L G
Sbjct  169  YDPKIINYNQLLEAIEDTGFEAILI-STGEDMSKIQLKVDGVCTDHSMRLIENSLRALPG  227

Query  893  VRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            V+    +PT  +  + +   V G R+ ++ I
Sbjct  228  VQDIDIDPTLNKFSLSYKSNVTGPRNFINVI  258


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 79/155 (51%), Gaps = 10/155 (6%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DE N  ++ +  Q+ + GMTC +CST+VE AL +L GV KA VAL   +A V +DP ++ 
Sbjct  117  DEANE-KSTQVCQIHINGMTCTSCSTTVESALQALQGVQKAQVALATEEAQVHYDPKIIN  175

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPG  670
               +  AIED GFEA ++        +T   +S  Q  + G+     +  +E  L +LPG
Sbjct  176  YNQLLEAIEDTGFEAILI--------STGEDMSKIQLKVDGVCTDHSMRLIENSLRALPG  227

Query  671  VKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            V+   +    +   + Y   V    + +N IE  G
Sbjct  228  VQDIDIDPTLNKFSLSYKSNVTGPRNFINVIESTG  262


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 69/133 (52%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            + + GMTCAAC  SVE  +  LPG++ AVV +  +  +V +  + +++  I   IED GF
Sbjct  51   YSVIGMTCAACAGSVEKAVKRLPGIREAVVDVLNNRVQVMFYTSFVNEETIRETIEDVGF  110

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + +LM   A +K      + + G++       +E  L  L GV+       + E +V +D
Sbjct  111  QATLMPDEANEKSTQVCQIHINGMTCTSCSTTVESALQALQGVQKAQVALATEEAQVHYD  170

Query  947  PEVLGSRSVVDGI  985
            P+++    +++ I
Sbjct  171  PKIINYNQLLEAI  183



>ref|XP_007040200.1| Heavy metal atpase 5 [Theobroma cacao]
 gb|EOY24701.1| Heavy metal atpase 5 [Theobroma cacao]
Length=988

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 129/220 (59%), Gaps = 8/220 (4%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P  V ++ I  AIED GF+A
Sbjct  53    VIGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFYPSFVNEETIREAIEDVGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      N       +  I GMTC +C ++VE  L ++ GV++A VALAT   E+ 
Sbjct  113   SLIKD----ETNEKSIQVCRIHINGMTCTSCSSTVEQALQAIRGVQKAQVALATEEAEIH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP  +S N ++ AIEDAGFE +++ S+ +D  KI L V G+     M++LE  L  L G
Sbjct  169   YDPKAVSHNQLMKAIEDAGFE-AILVSTGEDISKIDLQVDGVKTGNSMRMLENSLQALPG  227

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGING-GSGGKF  1009
             V+    +   +++ V + P++ G R+ +  I   GS  +F
Sbjct  228   VQAVDVSTEIKKISVSYKPDITGPRNFIRVIESTGSSRRF  267


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 80/155 (52%), Gaps = 10/155 (6%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DE N  ++++  ++ + GMTC +CS++VE AL ++ GV KA VAL   +A++ +DP  V 
Sbjct  117  DETNE-KSIQVCRIHINGMTCTSCSSTVEQALQAIRGVQKAQVALATEEAEIHYDPKAVS  175

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPG  670
               +  AIEDAGFEA ++        +T   +S     + G+     +  +E  L +LPG
Sbjct  176  HNQLMKAIEDAGFEAILV--------STGEDISKIDLQVDGVKTGNSMRMLENSLQALPG  227

Query  671  VKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            V+   V+       V Y P +    + +  IE  G
Sbjct  228  VQAVDVSTEIKKISVSYKPDITGPRNFIRVIESTG  262


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 70/133 (53%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  +  +V + P+ +++  I  AIED GF
Sbjct  51   FSVIGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFYPSFVNEETIREAIEDVGF  110

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + SL++    +K I    + + G++       +E  L  + GV+       + E E+ +D
Sbjct  111  QASLIKDETNEKSIQVCRIHINGMTCTSCSSTVEQALQAIRGVQKAQVALATEEAEIHYD  170

Query  947  PEVLGSRSVVDGI  985
            P+ +    ++  I
Sbjct  171  PKAVSHNQLMKAI  183



>ref|XP_003554176.1| PREDICTED: probable copper-transporting ATPase HMA5-like [Glycine 
max]
Length=984

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 132/238 (55%), Gaps = 8/238 (3%)
 Frame = +2

Query  314   DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             +EE S     +    V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P  V 
Sbjct  38    EEEGSSNVSSKALFSVVGMTCSACAASVEKAVKRLPGIRQAVVDVLNNRAQVLFYPSFVN  97

Query  494   DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
             ++ I   IEDAGF+A  + + N +          +  I GMTC +C ++VE  L S+ GV
Sbjct  98    EETIREVIEDAGFQATFIRDDNETSVQI-----CRIRIQGMTCTSCSSTVESALQSIQGV  152

Query  674   KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQ  847
              +A VALAT   EV Y P V++ N I+ A+ED GF+ +L+ S+ +D  +I + V GI   
Sbjct  153   VKAQVALATEEAEVHYTPNVVTYNQILEAVEDTGFQATLI-STGEDMSRIDIQVEGIRTG  211

Query  848   MDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
               M+L+E  L  L GV+    +P   ++ + + P++ G R+ ++ I      +F   +
Sbjct  212   RSMRLIENSLQALPGVQGVETHPEFNKVSLSYKPDLTGPRNFINVIEETGSRRFKAKI  269



>ref|XP_006476594.1| PREDICTED: probable copper-transporting ATPase HMA5-like [Citrus 
sinensis]
Length=1001

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 123/223 (55%), Gaps = 7/223 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+  A V +L N+A V F P  V ++ I   IED GF+A
Sbjct  56    VMGMTCSACAGSVEKAIKRLPGIHDAVVDVLNNRALVFFYPSFVNEETIRETIEDVGFQA  115

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +  +  +    T   +  I GMTC  C  +VE  L ++PGV+   VALAT   EV 
Sbjct  116   TLIQDETSDKS----TQLCRIGINGMTCTTCSTTVEKALQAIPGVQNVRVALATEAAEVH  171

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP +++ N I+ AIED GFE +L+ S+ +D  KI L V GI     M+++E  L  L G
Sbjct  172   YDPKILNYNQILAAIEDTGFEATLI-STGEDMSKIHLQVDGIRTDHSMRMIENSLQALPG  230

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
             V     +    ++ + + P++ G R+ +  I     G+F   +
Sbjct  231   VHGIGVDSGVHKIAISYKPDMTGPRNFMKAIESTGSGRFKARI  273


 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 74/156 (47%), Gaps = 13/156 (8%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            +E S ++ +  ++ + GMTC  CST+VE AL ++ GV    VAL    A+V +DP ++  
Sbjct  120  DETSDKSTQLCRIGINGMTCTTCSTTVEKALQAIPGVQNVRVALATEAAEVHYDPKILNY  179

Query  497  KDIENAIEDAGFEAEVLA---EPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLP  667
              I  AIED GFEA +++   + +  H   +G  +   M            +E  L +LP
Sbjct  180  NQILAAIEDTGFEATLISTGEDMSKIHLQVDGIRTDHSM----------RMIENSLQALP  229

Query  668  GVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            GV    V        + Y P +    + + AIE  G
Sbjct  230  GVHGIGVDSGVHKIAISYKPDMTGPRNFMKAIESTG  265


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 75/152 (49%), Gaps = 4/152 (3%)
 Frame = +2

Query  542  VLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEY  721
            V AE  A+  ++       + + GMTC+AC  SVE  +  LPG+  AVV +  +   V +
Sbjct  35   VSAEETANVESSMSKAKAAYSVMGMTCSACAGSVEKAIKRLPGIHDAVVDVLNNRALVFF  94

Query  722  DPTVISKNDIVNAIEDAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLH  889
             P+ +++  I   IED GF+ +L+Q    DK      +G+ G++       +E  L  + 
Sbjct  95   YPSFVNEETIRETIEDVGFQATLIQDETSDKSTQLCRIGINGMTCTTCSTTVEKALQAIP  154

Query  890  GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            GV++      +   EV +DP++L    ++  I
Sbjct  155  GVQNVRVALATEAAEVHYDPKILNYNQILAAI  186



>gb|KJB07829.1| hypothetical protein B456_001G046800 [Gossypium raimondii]
Length=132

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -1

Query  828  TPSMILSCALLCINEPSKPASSIALTMSFLLITVGSYSTSPTDVAKATTALFTPGRLLRI  649
            TPSMILSC+L C +E SKPAS IALT+S LLIT+G YSTSP +VAKATTAL TPGR L++
Sbjct  16   TPSMILSCSLPCTSEASKPASLIALTISSLLITMGLYSTSPNEVAKATTALLTPGRSLKM  75

Query  648  PSTEFTHAAHVIPPIMNCPDTVPFVLA*DALGSARTSASNP  526
            PSTE T AA VIPPI+NCP + P       LGS R SASNP
Sbjct  76   PSTELTQAAQVIPPIVNCPTSTPRGFVPTLLGSGRISASNP  116



>ref|XP_002965761.1| hypothetical protein SELMODRAFT_84115 [Selaginella moellendorffii]
 gb|EFJ33181.1| hypothetical protein SELMODRAFT_84115 [Selaginella moellendorffii]
Length=960

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 122/218 (56%), Gaps = 6/218 (3%)
 Frame = +2

Query  335  NLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENA  514
             ++ +  +VTGM C AC+ S+E AL  L G+ +A+VA++Q KA VVF P  V  + I  A
Sbjct  17   QIQSVSFKVTGMECTACAGSIEKALKRLPGIKEAAVAVIQEKAQVVFHPAFVDVETIREA  76

Query  515  IEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
            I DAGF+A +L +P         T   +  + GMTC +C  S+E  L  + GVK AVVAL
Sbjct  77   IVDAGFDAALLEDP-----VEQSTTVCRLRVRGMTCTSCSGSIEAALRKIQGVKTAVVAL  131

Query  695  ATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMDMQLLEG  871
            AT   E+ +DP V+S   ++ A+ED GFE  L+ +   ++K+ L + G+  Q   + +  
Sbjct  132  ATEQAEILHDPRVVSCAKLMEAVEDVGFEAELISAGEERNKVHLQLEGVHSQEGFRNIVT  191

Query  872  ILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
             L  L GV      PT   + V +DP++ G R  ++ I
Sbjct  192  SLEALAGVTEVELFPTEERVVVSYDPDLTGPRCFIEII  229



>ref|XP_006653660.1| PREDICTED: probable copper-transporting ATPase HMA5-like [Oryza 
brachyantha]
Length=999

 Score =   139 bits (350),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 128/232 (55%), Gaps = 5/232 (2%)
 Frame = +2

Query  329   GENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIE  508
             GE  +     V+GMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V ++ I 
Sbjct  68    GEEEKVAVFSVSGMTCAACAGSVEKAVKRLAGIHDAAVDVLGGRAQVVFYPAFVSEEKIR  127

Query  509   NAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVV  688
               IED GFEA+++ E           +  +  I GMTC +C ++VE IL  +PGV+RA V
Sbjct  128   ETIEDVGFEAKLIDE----EVKEKNILVCRLHIKGMTCTSCASTVESILQVIPGVQRASV  183

Query  689   ALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMDMQLL  865
             ALAT   E+ YD  +I+ + + +A+E+ GFE  L+ +   Q +I L V G   +  + ++
Sbjct  184   ALATEEAEIRYDRRIITASQLTDAVEETGFEAILITTGDDQSRIDLKVDGTLDERSIMIM  243

Query  866   EGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
             +  +  L GV     +P   ++ + + P+  G R +++ I   + G  T+ +
Sbjct  244   KSSVEALPGVEDIKVDPELHKITIAYKPDQTGPRDLIEVIESAASGDLTVSI  295



>ref|XP_006439580.1| hypothetical protein CICLE_v10018819mg [Citrus clementina]
 gb|ESR52820.1| hypothetical protein CICLE_v10018819mg [Citrus clementina]
Length=868

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 124/223 (56%), Gaps = 7/223 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+  A V +L N+A V+F P  V ++ I   IED GF+A
Sbjct  56    VMGMTCSACAGSVEKAIKRLPGIHDAVVDVLNNRALVLFYPSFVNEETIRETIEDVGFQA  115

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +  +  +    T   +  I GMTC  C  +VE  L ++PGV+   VALAT   EV 
Sbjct  116   TLIQDETSDKS----TQLCRIGINGMTCTTCSTTVEKALQAIPGVQNVRVALATEAAEVH  171

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP +++ N I+ AIED GFE +L+ S+ +D  KI L V GI     M+++E  L  L G
Sbjct  172   YDPKILNYNQILAAIEDTGFEATLI-STGEDMSKIHLQVDGIRTDHSMRMIENSLQALPG  230

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
             V     +    ++ + + P++ G R+ +  I     G+F   +
Sbjct  231   VHGIGVDSGVHKIAISYKPDMTGPRNFMKVIESTGSGRFKARI  273


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 73/155 (47%), Gaps = 9/155 (6%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             +E S ++ +  ++ + GMTC  CST+VE AL ++ GV    VAL    A+V +DP ++ 
Sbjct  119  QDETSDKSTQLCRIGINGMTCTTCSTTVEKALQAIPGVQNVRVALATEAAEVHYDPKILN  178

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPG  670
               I  AIED GFEA +++        T   +S     + G+     +  +E  L +LPG
Sbjct  179  YNQILAAIEDTGFEATLIS--------TGEDMSKIHLQVDGIRTDHSMRMIENSLQALPG  230

Query  671  VKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            V    V        + Y P +    + +  IE  G
Sbjct  231  VHGIGVDSGVHKIAISYKPDMTGPRNFMKVIESTG  265


 Score = 67.8 bits (164),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 75/152 (49%), Gaps = 4/152 (3%)
 Frame = +2

Query  542  VLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEY  721
            V AE  A+  ++       + + GMTC+AC  SVE  +  LPG+  AVV +  +   V +
Sbjct  35   VSAEETANVESSMSKAKAVYAVMGMTCSACAGSVEKAIKRLPGIHDAVVDVLNNRALVLF  94

Query  722  DPTVISKNDIVNAIEDAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLH  889
             P+ +++  I   IED GF+ +L+Q    DK      +G+ G++       +E  L  + 
Sbjct  95   YPSFVNEETIRETIEDVGFQATLIQDETSDKSTQLCRIGINGMTCTTCSTTVEKALQAIP  154

Query  890  GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            GV++      +   EV +DP++L    ++  I
Sbjct  155  GVQNVRVALATEAAEVHYDPKILNYNQILAAI  186



>ref|XP_006476595.1| PREDICTED: probable copper-transporting ATPase HMA5-like [Citrus 
sinensis]
Length=989

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 124/223 (56%), Gaps = 7/223 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+  A V +L N+A V+F P  V ++ I   IED GF+A
Sbjct  56    VMGMTCSACAGSVEKAIKRLPGIHDAVVDVLNNRALVLFYPSFVNEETIRETIEDVGFQA  115

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +  +  +    T   +  I GMTC  C  +VE  L ++PGV+   VALAT   EV 
Sbjct  116   TLIQDETSDKS----TQLCRIGINGMTCTTCSTTVEKALQAIPGVQNVRVALATEAAEVH  171

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP +++ N I+ AIED GFE +L+ S+ +D  KI L V GI     M+++E  L  L G
Sbjct  172   YDPKILNYNQILAAIEDTGFEATLI-STGEDMSKIHLQVDGIRTDHSMRMIENSLQALPG  230

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
             V     +    ++ + + P++ G R+ +  I     G+F   +
Sbjct  231   VHGIGVDSGVHKIAISYKPDMTGPRNFMKVIESTGSGRFKARI  273


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 73/156 (47%), Gaps = 13/156 (8%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            +E S ++ +  ++ + GMTC  CST+VE AL ++ GV    VAL    A+V +DP ++  
Sbjct  120  DETSDKSTQLCRIGINGMTCTTCSTTVEKALQAIPGVQNVRVALATEAAEVHYDPKILNY  179

Query  497  KDIENAIEDAGFEAEVLA---EPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLP  667
              I  AIED GFEA +++   + +  H   +G  +   M            +E  L +LP
Sbjct  180  NQILAAIEDTGFEATLISTGEDMSKIHLQVDGIRTDHSM----------RMIENSLQALP  229

Query  668  GVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            GV    V        + Y P +    + +  IE  G
Sbjct  230  GVHGIGVDSGVHKIAISYKPDMTGPRNFMKVIESTG  265


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 75/152 (49%), Gaps = 4/152 (3%)
 Frame = +2

Query  542  VLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEY  721
            V AE  A+  ++       + + GMTC+AC  SVE  +  LPG+  AVV +  +   V +
Sbjct  35   VSAEETANVESSMSKAKAMYAVMGMTCSACAGSVEKAIKRLPGIHDAVVDVLNNRALVLF  94

Query  722  DPTVISKNDIVNAIEDAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLH  889
             P+ +++  I   IED GF+ +L+Q    DK      +G+ G++       +E  L  + 
Sbjct  95   YPSFVNEETIRETIEDVGFQATLIQDETSDKSTQLCRIGINGMTCTTCSTTVEKALQAIP  154

Query  890  GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            GV++      +   EV +DP++L    ++  I
Sbjct  155  GVQNVRVALATEAAEVHYDPKILNYNQILAAI  186



>ref|XP_004298728.1| PREDICTED: probable copper-transporting ATPase HMA5 [Fragaria 
vesca subsp. vesca]
Length=993

 Score =   138 bits (348),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 124/218 (57%), Gaps = 5/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P  V  + I   IED GF+A
Sbjct  60    VIGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPDFVNAETIRETIEDVGFQA  119

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++A+      N   T+  +  I GMTC +C ++VE  L ++ GV++A VALAT   +V 
Sbjct  120   TLIAD----EGNEKSTLVCRIRIKGMTCTSCSSTVESALQAVHGVQKAQVALATEEADVH  175

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP ++S N ++  IED GFE  L+ S     KI L V G+     M++LE  L  L GV
Sbjct  176   YDPKIVSCNQLMVTIEDTGFEAILINSGEGMSKIDLKVDGVRTDHSMRILEESLQALPGV  235

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             +    +   R++ + + P++ G R+ ++ I      +F
Sbjct  236   QGVDIHHDDRKISLSYKPDITGPRNFINVIETTGSRRF  273


 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 76/154 (49%), Gaps = 8/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DE N    L   ++R+ GMTC +CS++VE AL +++GV KA VAL   +ADV +DP +V 
Sbjct  124  DEGNEKSTLV-CRIRIKGMTCTSCSSTVESALQAVHGVQKAQVALATEEADVHYDPKIVS  182

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +   IED GFEA ++        +  G       + G+     +  +E  L +LPGV
Sbjct  183  CNQLMVTIEDTGFEAILI-------NSGEGMSKIDLKVDGVRTDHSMRILEESLQALPGV  235

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +   +        + Y P +    + +N IE  G
Sbjct  236  QGVDIHHDDRKISLSYKPDITGPRNFINVIETTG  269


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 80/171 (47%), Gaps = 15/171 (9%)
 Frame = +2

Query  599   FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
             F + GMTC+AC  SVE  +  LPG++ AVV +  +  +V + P  ++   I   IED GF
Sbjct  58    FSVIGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPDFVNAETIRETIEDVGF  117

Query  779   EGSLMQSSAQDKIIL----GVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
             + +L+     +K  L     + G++       +E  L  +HGV+       + E +V +D
Sbjct  118   QATLIADEGNEKSTLVCRIRIKGMTCTSCSSTVESALQAVHGVQKAQVALATEEADVHYD  177

Query  947   PEVLGSRSVVDG----------INGGSG-GKFTLHVKNPYTRMASRDIEES  1066
             P+++    ++            IN G G  K  L V    T  + R +EES
Sbjct  178   PKIVSCNQLMVTIEDTGFEAILINSGEGMSKIDLKVDGVRTDHSMRILEES  228



>ref|XP_008669040.1| PREDICTED: probable copper-transporting ATPase HMA5 [Zea mays]
 tpg|DAA36501.1| TPA: hypothetical protein ZEAMMB73_258717 [Zea mays]
Length=999

 Score =   137 bits (346),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 78/219 (36%), Positives = 123/219 (56%), Gaps = 5/219 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V +  I  AIED GFEA
Sbjct  77    VTGMTCAACAGSVEKAVKRLPGIHDAAVDVLGGRAQVVFYPAFVSEGKIREAIEDVGFEA  136

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +F I GMTC +C N+VE  L + PGV+RA VALAT   E+ 
Sbjct  137   KLINE----EVRAKNILVCRFHIKGMTCTSCTNTVESALQAFPGVQRASVALATEEAEIH  192

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +++ + +++A+E+ GFE  L+ +   + +I L + G+  +    +L+  +  L GV
Sbjct  193   YDRRIVTASQLIHAVEETGFEAILITTGEDRSRIDLKLDGVLSERLTMILKSSIQALPGV  252

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFT  1012
                  +    ++ V + P+  G R +++ I   + G  T
Sbjct  253   EDIKIDTELHKVTVSYKPDQTGPRDLIEVIESATSGGVT  291



>ref|XP_008238887.1| PREDICTED: probable copper-transporting ATPase HMA5 [Prunus mume]
Length=1078

 Score =   137 bits (346),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 127/222 (57%), Gaps = 5/222 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P+ V ++ I   IED GF+A
Sbjct  145   VIGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPNYVNEETIRETIEDVGFQA  204

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      N   T+  +  I GMTC +C  +VE  L ++ GV++A VALAT   +V 
Sbjct  205   TLIND----EGNERSTLVCRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVH  260

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP ++S N ++  IED GFEG L+ +     +I L V G+     M++LE  L  L GV
Sbjct  261   YDPKIVSYNHLLTTIEDTGFEGILLTTGEDMSRIELKVDGVRTDHSMRILEQSLQALPGV  320

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
             +   ++   +++ + +  ++ G R+ ++ I      +F  ++
Sbjct  321   QAIEFDSEIKKISLSYKSDMTGPRNFINVIETTGSRRFKANI  362


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 75/145 (52%), Gaps = 13/145 (9%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            ++R+ GMTC +CST+VE AL +++GV KA VAL   +ADV +DP +V    +   IED G
Sbjct  220  RIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVHYDPKIVSYNHLLTTIEDTG  279

Query  530  FEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSV  706
            FE  +L         T   +S  +  + G+     +  +E  L +LPGV+   +   + +
Sbjct  280  FEGILL--------TTGEDMSRIELKVDGVRTDHSMRILEQSLQALPGVQ--AIEFDSEI  329

Query  707  GEV--EYDPTVISKNDIVNAIEDAG  775
             ++   Y   +    + +N IE  G
Sbjct  330  KKISLSYKSDMTGPRNFINVIETTG  354


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  +  +V + P  +++  I   IED GF
Sbjct  143  FSVIGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPNYVNEETIRETIEDVGF  202

Query  779  EGSLMQSSAQDKIIL----GVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + +L+     ++  L     + G++       +E  L  +HGV+       + E +V +D
Sbjct  203  QATLINDEGNERSTLVCRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVHYD  262

Query  947  PEVLGSRSVVDGI  985
            P+++    ++  I
Sbjct  263  PKIVSYNHLLTTI  275



>ref|NP_001053522.2| Os04g0556000 [Oryza sativa Japonica Group]
 emb|CAD41643.2| OSJNBb0012E24.8 [Oryza sativa Japonica Group]
 dbj|BAF15436.2| Os04g0556000 [Oryza sativa Japonica Group]
Length=849

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 125/222 (56%), Gaps = 5/222 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V ++ I   I+D GFEA
Sbjct  81    VSGMTCAACAGSVEKAVKRLQGIHDAAVDVLGGRAQVVFYPAFVSEEKIRETIQDVGFEA  140

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GMTC +C ++VE IL  +PGV+RA VALAT   E+ 
Sbjct  141   KLIDE----EVKEKNILVCRLHIKGMTCTSCASTVESILQVVPGVQRASVALATEEAEIR  196

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +++ + + +A+E+ GFE  L+ +   Q +I L V G   +  + +++  +  L GV
Sbjct  197   YDRRIVTASQLTHAVEETGFEAILITTGDDQSRIDLKVDGTLNERSIMIVKSSVQALPGV  256

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
                  +P   ++ + + P+  G R +++ I   + G  T+ +
Sbjct  257   EDIKVDPELHKITISYKPDQTGPRDLIEVIESAASGDLTVSI  298


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 74/154 (48%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DEE   +N+   ++ + GMTC +C+++VE  L  + GV +ASVAL   +A++ +D  +V 
Sbjct  144  DEEVKEKNILVCRLHIKGMTCTSCASTVESILQVVPGVQRASVALATEEAEIRYDRRIVT  203

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               + +A+E+ GFEA +L       +  +  V G            +  V+  + +LPGV
Sbjct  204  ASQLTHAVEETGFEA-ILITTGDDQSRIDLKVDGTL------NERSIMIVKSSVQALPGV  256

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +   V        + Y P      D++  IE A 
Sbjct  257  EDIKVDPELHKITISYKPDQTGPRDLIEVIESAA  290


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 63/133 (47%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  L G+  A V +     +V + P  +S+  I   I+D GF
Sbjct  79   FEVSGMTCAACAGSVEKAVKRLQGIHDAAVDVLGGRAQVVFYPAFVSEEKIRETIQDVGF  138

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E  L+    ++K I    L + G++       +E IL  + GV+       + E E+ +D
Sbjct  139  EAKLIDEEVKEKNILVCRLHIKGMTCTSCASTVESILQVVPGVQRASVALATEEAEIRYD  198

Query  947  PEVLGSRSVVDGI  985
              ++ +  +   +
Sbjct  199  RRIVTASQLTHAV  211



>ref|XP_006300388.1| hypothetical protein CARUB_v10019713mg, partial [Capsella rubella]
 gb|EOA33286.1| hypothetical protein CARUB_v10019713mg, partial [Capsella rubella]
Length=1014

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/264 (34%), Positives = 143/264 (54%), Gaps = 19/264 (7%)
 Frame = +2

Query  200  KFIEMSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCA  379
            +F E  P +R   +T + G  S  D     E+            E++ R   +V GMTC+
Sbjct  35   RFSERYPLVRK-HLTRSRGGGSSSDMATAFEIE-----------EDISRAIFQVLGMTCS  82

Query  380  ACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPN  559
            AC+ SVE A+  L G+ +A +  L N+A ++F P++V  + I   IEDAGFEA ++    
Sbjct  83   ACAGSVEKAIKRLPGIHEAVIDALNNRAQILFYPNLVDVETIRETIEDAGFEASLIE---  139

Query  560  ASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVIS  739
             + AN       +  I GMTC +C +++E +L S+ GV+RA VALA    E+ YDP ++S
Sbjct  140  -NEANERSRQVCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVALAIEEAEIHYDPRLLS  198

Query  740  KNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             + ++  IE+AGFE  L+ S+ +D  KI L + G      M+++E  L  L GV+    +
Sbjct  199  YDRLLEEIENAGFEAVLI-STGEDVSKIDLKIDGEFTDESMKIIERSLEALPGVQSVEIS  257

Query  914  PTSRELEVVFDPEVLGSRSVVDGI  985
              +  + V++ P+V G R+ +  I
Sbjct  258  HGTDTISVLYKPDVTGPRNFIQVI  281


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 81/158 (51%), Gaps = 8/158 (5%)
 Frame = +2

Query  308  SYDEENSGENLRRI-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
            S  E  + E  R++ ++R+ GMTC +CS+++E  L S+NGV +A VAL   +A++ +DP 
Sbjct  136  SLIENEANERSRQVCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVALAIEEAEIHYDPR  195

Query  485  VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
            ++    +   IE+AGFEA VL       +  +  + G+F    M        +E  L +L
Sbjct  196  LLSYDRLLEEIENAGFEA-VLISTGEDVSKIDLKIDGEFTDESMKI------IERSLEAL  248

Query  665  PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            PGV+   ++  T    V Y P V    + +  IE   F
Sbjct  249  PGVQSVEISHGTDTISVLYKPDVTGPRNFIQVIESTVF  286



>gb|EAY95120.1| hypothetical protein OsI_16937 [Oryza sativa Indica Group]
Length=1001

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 125/222 (56%), Gaps = 5/222 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V ++ I   I+D GFEA
Sbjct  80    VSGMTCAACAGSVEKAVKRLQGIHDAAVDVLGGRAQVVFYPAFVSEEKIRETIQDVGFEA  139

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GMTC +C ++VE IL  +PGV+RA VALAT   E+ 
Sbjct  140   KLIDE----EVKEKNILVCRLHIKGMTCTSCASTVESILQVVPGVQRASVALATEEAEIR  195

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +++ + + +A+E+ GFE  L+ +   Q +I L V G   +  + +++  +  L GV
Sbjct  196   YDRRIVTASQLTHAVEETGFEAILITTGDDQSRIDLKVDGTLNERSIMIVKSSVQALPGV  255

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
                  +P   ++ + + P+  G R +++ I   + G  T+ +
Sbjct  256   EDIKVDPELHKITISYKPDQTGPRDLIEVIESAASGDLTVSI  297


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 74/154 (48%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DEE   +N+   ++ + GMTC +C+++VE  L  + GV +ASVAL   +A++ +D  +V 
Sbjct  143  DEEVKEKNILVCRLHIKGMTCTSCASTVESILQVVPGVQRASVALATEEAEIRYDRRIVT  202

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               + +A+E+ GFEA +L       +  +  V G            +  V+  + +LPGV
Sbjct  203  ASQLTHAVEETGFEA-ILITTGDDQSRIDLKVDGTL------NERSIMIVKSSVQALPGV  255

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +   V        + Y P      D++  IE A 
Sbjct  256  EDIKVDPELHKITISYKPDQTGPRDLIEVIESAA  289


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 63/133 (47%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  L G+  A V +     +V + P  +S+  I   I+D GF
Sbjct  78   FEVSGMTCAACAGSVEKAVKRLQGIHDAAVDVLGGRAQVVFYPAFVSEEKIRETIQDVGF  137

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E  L+    ++K I    L + G++       +E IL  + GV+       + E E+ +D
Sbjct  138  EAKLIDEEVKEKNILVCRLHIKGMTCTSCASTVESILQVVPGVQRASVALATEEAEIRYD  197

Query  947  PEVLGSRSVVDGI  985
              ++ +  +   +
Sbjct  198  RRIVTASQLTHAV  210



>gb|EAZ31593.1| hypothetical protein OsJ_15734 [Oryza sativa Japonica Group]
 dbj|BAO05266.1| Cu-transporting protein [Oryza sativa Japonica Group]
Length=1002

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 125/222 (56%), Gaps = 5/222 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V ++ I   I+D GFEA
Sbjct  81    VSGMTCAACAGSVEKAVKRLQGIHDAAVDVLGGRAQVVFYPAFVSEEKIRETIQDVGFEA  140

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GMTC +C ++VE IL  +PGV+RA VALAT   E+ 
Sbjct  141   KLIDE----EVKEKNILVCRLHIKGMTCTSCASTVESILQVVPGVQRASVALATEEAEIR  196

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +++ + + +A+E+ GFE  L+ +   Q +I L V G   +  + +++  +  L GV
Sbjct  197   YDRRIVTASQLTHAVEETGFEAILITTGDDQSRIDLKVDGTLNERSIMIVKSSVQALPGV  256

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
                  +P   ++ + + P+  G R +++ I   + G  T+ +
Sbjct  257   EDIKVDPELHKITISYKPDQTGPRDLIEVIESAASGDLTVSI  298


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 74/154 (48%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DEE   +N+   ++ + GMTC +C+++VE  L  + GV +ASVAL   +A++ +D  +V 
Sbjct  144  DEEVKEKNILVCRLHIKGMTCTSCASTVESILQVVPGVQRASVALATEEAEIRYDRRIVT  203

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               + +A+E+ GFEA +L       +  +  V G            +  V+  + +LPGV
Sbjct  204  ASQLTHAVEETGFEA-ILITTGDDQSRIDLKVDGTL------NERSIMIVKSSVQALPGV  256

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +   V        + Y P      D++  IE A 
Sbjct  257  EDIKVDPELHKITISYKPDQTGPRDLIEVIESAA  290


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 63/133 (47%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  L G+  A V +     +V + P  +S+  I   I+D GF
Sbjct  79   FEVSGMTCAACAGSVEKAVKRLQGIHDAAVDVLGGRAQVVFYPAFVSEEKIRETIQDVGF  138

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E  L+    ++K I    L + G++       +E IL  + GV+       + E E+ +D
Sbjct  139  EAKLIDEEVKEKNILVCRLHIKGMTCTSCASTVESILQVVPGVQRASVALATEEAEIRYD  198

Query  947  PEVLGSRSVVDGI  985
              ++ +  +   +
Sbjct  199  RRIVTASQLTHAV  211



>ref|XP_007158491.1| hypothetical protein PHAVU_002G156900g [Phaseolus vulgaris]
 gb|ESW30485.1| hypothetical protein PHAVU_002G156900g [Phaseolus vulgaris]
Length=984

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 122/231 (53%), Gaps = 5/231 (2%)
 Frame = +2

Query  320   ENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDK  499
             E  G   + +   V GMTCAAC+ S+E  +  L G+ +A V +L +KA V++   +V ++
Sbjct  40    ELEGSESKVVVFSVMGMTCAACAGSIEKTIKRLPGIREAVVDVLNHKAQVLYFHSMVNEE  99

Query  500   DIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKR  679
              I  AIEDAGFEA+V+ E     +N   T   +  I GMTC +C  ++E  L SL GV +
Sbjct  100   RIREAIEDAGFEAKVIEE----ESNYTSTQICRIHIRGMTCTSCSTTIESALQSLYGVHK  155

Query  680   AVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDM  856
             A VALAT   EV YDP +++ N ++ AI+D GFE  L+ +     KI   + GI     +
Sbjct  156   AGVALATEEAEVYYDPNILTHNHLMEAIQDTGFEAILISTGEHMSKIEFKIDGIKNDQSL  215

Query  857   QLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
               +E  L  L GV      P   ++ + + P   G R+ ++ I     G F
Sbjct  216   SAIERSLHALPGVETIDIYPDINKIAITYKPHRTGPRTFIEVIESTGSGCF  266


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 82/154 (53%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            +EE++  + +  ++ + GMTC +CST++E AL SL GV KA VAL   +A+V +DP+++ 
Sbjct  116  EEESNYTSTQICRIHIRGMTCTSCSTTIESALQSLYGVHKAGVALATEEAEVYYDPNILT  175

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +  AI+D GFEA +++     H +       +F I G+     ++++E  L +LPGV
Sbjct  176  HNHLMEAIQDTGFEAILIS--TGEHMS-----KIEFKIDGIKNDQSLSAIERSLHALPGV  228

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +   +    +   + Y P        +  IE  G
Sbjct  229  ETIDIYPDINKIAITYKPHRTGPRTFIEVIESTG  262



>ref|XP_009600811.1| PREDICTED: probable copper-transporting ATPase HMA5 [Nicotiana 
tomentosiformis]
Length=1008

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 131/241 (54%), Gaps = 9/241 (4%)
 Frame = +2

Query  299   LLDSYDEE--NSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVV  472
             +   Y+E+  N  EN       V GMTC+AC+ SVE A+  L G+    + +L NKA V+
Sbjct  52    IYSEYEEKDNNIQENEANALFSVIGMTCSACAASVENAIKKLPGIKLVVIDVLNNKAQVI  111

Query  473   FDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGI  652
             F+  +V ++ I   IED GF+A++L E      N   +   +  + GMTC +C  ++E  
Sbjct  112   FNASLVYEEMIRETIEDVGFQAKLLKE----EMNQKSSQVCRIQVNGMTCTSCSTTLESA  167

Query  653   LSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDK--IILG  826
             L  +PGV +A VALAT   E+ YDP ++  N ++ AI + GFEG L+ S+  DK  I+L 
Sbjct  168   LQVIPGVHKAQVALATQEAEICYDPKIVDYNQLLEAIGNTGFEGKLI-STGDDKSRILLK  226

Query  827   VVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGK  1006
             V G + +  ++L++  L +L GV+    +   ++L V +  +V G R  +  I     G 
Sbjct  227   VDGANTENCVKLIKNSLLELQGVQEIDLDLQLKKLSVTYRADVTGPRDFIRAIESTGSGC  286

Query  1007  F  1009
             F
Sbjct  287   F  287



>ref|XP_004976462.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Setaria 
italica]
Length=1000

 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 121/219 (55%), Gaps = 5/219 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GM+CAAC+ SVE  +  L G+  A+V +L  +A V+F P  V ++ I  AIED GFEA
Sbjct  78    VIGMSCAACAGSVEKGVKRLPGIHDAAVDVLGGRAQVIFYPVFVSEEKIREAIEDVGFEA  137

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GMTC +C N+VE  L + PGV+RA VALAT   E+ 
Sbjct  138   KLINE----EVREKNILVCRLHIKGMTCTSCTNTVESALQAFPGVQRASVALATEEAEIR  193

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +++ N ++ A+E+ GFE  L+ +   + +I L + G+  +  + +LE  +  L GV
Sbjct  194   YDRRIVAANQLIQAVEETGFEAVLITAGEDRSRIDLKIDGVLNERLIMILESSIQALPGV  253

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFT  1012
                  N    ++ + + P+  G R +++ I   + G  T
Sbjct  254   EDIKVNTELHKITISYKPDQTGPRDLIEVIESATSGDIT  292


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 74/153 (48%), Gaps = 7/153 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            +EE   +N+   ++ + GMTC +C+ +VE AL +  GV +ASVAL   +A++ +D  +V 
Sbjct  141  NEEVREKNILVCRLHIKGMTCTSCTNTVESALQAFPGVQRASVALATEEAEIRYDRRIVA  200

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +  A+E+ GFEA VL       +  +        I G+     +  +E  + +LPGV
Sbjct  201  ANQLIQAVEETGFEA-VLITAGEDRSRID------LKIDGVLNERLIMILESSIQALPGV  253

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDA  772
            +   V        + Y P      D++  IE A
Sbjct  254  EDIKVNTELHKITISYKPDQTGPRDLIEVIESA  286



>gb|KJB25813.1| hypothetical protein B456_004G210800 [Gossypium raimondii]
Length=988

 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 129/220 (59%), Gaps = 8/220 (4%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L NKA V+F P  V ++ I  AIEDAGF+A
Sbjct  53    VMGMTCSACAGSVEKAVKRLPGIKEAVVDVLNNKAQVMFYPSFVNEESILEAIEDAGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      +       +  I GMTC +C  ++E  L  +PGV++  VALAT   ++ 
Sbjct  113   ALIQD----ETDDKSVQVCRIRINGMTCTSCSTTLENALQPVPGVQKVQVALATEEAQIH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             +DP +I+ N ++  IE+ GF G+++ S+ +D  KI L + G+     M++LE  L  L G
Sbjct  169   HDPKIITYNQLMQKIEETGF-GAVLVSTGEDMSKINLRIDGVRTVNSMRMLENSLQALPG  227

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGING-GSGGKF  1009
             V+    +P  +++ V + P++ G R+ +  I+  GS  +F
Sbjct  228   VQAVQTSPELKKIAVSYKPDMTGPRNFIKVIDSTGSSRRF  267


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG+K AVV +  +  +V + P+ +++  I+ AIEDAGF
Sbjct  51   FSVMGMTCSACAGSVEKAVKRLPGIKEAVVDVLNNKAQVMFYPSFVNEESILEAIEDAGF  110

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + +L+Q    DK +    + + G++       LE  L  + GV+       + E ++  D
Sbjct  111  QAALIQDETDDKSVQVCRIRINGMTCTSCSTTLENALQPVPGVQKVQVALATEEAQIHHD  170

Query  947  PEVLGSRSVVDGI  985
            P+++    ++  I
Sbjct  171  PKIITYNQLMQKI  183


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             +E   ++++  ++R+ GMTC +CST++E AL  + GV K  VAL   +A +  DP ++ 
Sbjct  116  QDETDDKSVQVCRIRINGMTCTSCSTTLENALQPVPGVQKVQVALATEEAQIHHDPKIIT  175

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +   IE+ GF A VL       +  N        I G+     +  +E  L +LPGV
Sbjct  176  YNQLMQKIEETGFGA-VLVSTGEDMSKIN------LRIDGVRTVNSMRMLENSLQALPGV  228

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +    +       V Y P +    + +  I+  G
Sbjct  229  QAVQTSPELKKIAVSYKPDMTGPRNFIKVIDSTG  262



>gb|KJB25814.1| hypothetical protein B456_004G210800 [Gossypium raimondii]
Length=988

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 129/220 (59%), Gaps = 8/220 (4%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L NKA V+F P  V ++ I  AIEDAGF+A
Sbjct  53    VMGMTCSACAGSVEKAVKRLPGIKEAVVDVLNNKAQVMFYPSFVNEESILEAIEDAGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      +       +  I GMTC +C  ++E  L  +PGV++  VALAT   ++ 
Sbjct  113   ALIQD----ETDDKSVQVCRIRINGMTCTSCSTTLENALQPVPGVQKVQVALATEEAQIH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             +DP +I+ N ++  IE+ GF G+++ S+ +D  KI L + G+     M++LE  L  L G
Sbjct  169   HDPKIITYNQLMQKIEETGF-GAVLVSTGEDMSKINLRIDGVRTVNSMRMLENSLQALPG  227

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGING-GSGGKF  1009
             V+    +P  +++ V + P++ G R+ +  I+  GS  +F
Sbjct  228   VQAVQTSPELKKIAVSYKPDMTGPRNFIKVIDSTGSSRRF  267


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG+K AVV +  +  +V + P+ +++  I+ AIEDAGF
Sbjct  51   FSVMGMTCSACAGSVEKAVKRLPGIKEAVVDVLNNKAQVMFYPSFVNEESILEAIEDAGF  110

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + +L+Q    DK +    + + G++       LE  L  + GV+       + E ++  D
Sbjct  111  QAALIQDETDDKSVQVCRIRINGMTCTSCSTTLENALQPVPGVQKVQVALATEEAQIHHD  170

Query  947  PEVLGSRSVVDGI  985
            P+++    ++  I
Sbjct  171  PKIITYNQLMQKI  183


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
             +E   ++++  ++R+ GMTC +CST++E AL  + GV K  VAL   +A +  DP ++ 
Sbjct  116  QDETDDKSVQVCRIRINGMTCTSCSTTLENALQPVPGVQKVQVALATEEAQIHHDPKIIT  175

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +   IE+ GF A VL       +  N        I G+     +  +E  L +LPGV
Sbjct  176  YNQLMQKIEETGFGA-VLVSTGEDMSKIN------LRIDGVRTVNSMRMLENSLQALPGV  228

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +    +       V Y P +    + +  I+  G
Sbjct  229  QAVQTSPELKKIAVSYKPDMTGPRNFIKVIDSTG  262



>ref|XP_007158490.1| hypothetical protein PHAVU_002G156800g [Phaseolus vulgaris]
 gb|ESW30484.1| hypothetical protein PHAVU_002G156800g [Phaseolus vulgaris]
Length=985

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 135/246 (55%), Gaps = 14/246 (6%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTCAAC+ SVE A+  L G+ +A V +L N+A V+F P  V ++ I  AIEDAGFEA
Sbjct  46    VVGMTCAACAGSVEKAVKRLPGIREAIVDVLNNRAHVIFYPSFVNEETIREAIEDAGFEA  105

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              +L +   +H  +      +F I GMTC +C +++E  L  L GV  A V LAT   +V 
Sbjct  106   LLLTD--GTHDKSVKVC--RFQIKGMTCTSCSSTIESALQGLHGVLEARVGLATEEAQVH  161

Query  719   YDPT-VISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVG-ISGQMDMQLLEGILSKLH  889
             Y+P  +++ NDI+ AIED+GFE  L+ SS    +I L V G ++    M+L+   L  L 
Sbjct  162   YNPNLLLTPNDILQAIEDSGFEAVLISSSEDFTEIDLHVEGAVTDDASMKLILDSLRALP  221

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV-------KNPYTRMAS  1048
             GV      P   ++ V + P+V G R++++ I     G F   +       +N + R  +
Sbjct  222   GVLVVDLTPEFSKITVSYKPDVTGPRNLINVIEQTGNGNFKAKIYPTEQGQRNSHRREET  281

Query  1049  RDIEES  1066
             R   +S
Sbjct  282   RQYYKS  287


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 4/127 (3%)
 Frame = +2

Query  590  SGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIED  769
            +  F + GMTCAAC  SVE  +  LPG++ A+V +  +   V + P+ +++  I  AIED
Sbjct  41   TALFSVVGMTCAACAGSVEKAVKRLPGIREAIVDVLNNRAHVIFYPSFVNEETIREAIED  100

Query  770  AGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEV  937
            AGFE  L+     DK +      + G++       +E  L  LHGV        + E +V
Sbjct  101  AGFEALLLTDGTHDKSVKVCRFQIKGMTCTSCSSTIESALQGLHGVLEARVGLATEEAQV  160

Query  938  VFDPEVL  958
             ++P +L
Sbjct  161  HYNPNLL  167


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 79/145 (54%), Gaps = 9/145 (6%)
 Frame = +2

Query  344  RIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH-VVKDKDIENAIE  520
            R Q++  GMTC +CS+++E AL  L+GV++A V L   +A V ++P+ ++   DI  AIE
Sbjct  121  RFQIK--GMTCTSCSSTIESALQGLHGVLEARVGLATEEAQVHYNPNLLLTPNDILQAIE  178

Query  521  DAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
            D+GFEA +++      ++ + T     + G +T  A +  +   L +LPGV    +    
Sbjct  179  DSGFEAVLIS------SSEDFTEIDLHVEGAVTDDASMKLILDSLRALPGVLVVDLTPEF  232

Query  701  SVGEVEYDPTVISKNDIVNAIEDAG  775
            S   V Y P V    +++N IE  G
Sbjct  233  SKITVSYKPDVTGPRNLINVIEQTG  257



>ref|XP_007210906.1| hypothetical protein PRUPE_ppa000836mg [Prunus persica]
 gb|EMJ12105.1| hypothetical protein PRUPE_ppa000836mg [Prunus persica]
Length=986

 Score =   135 bits (340),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 127/222 (57%), Gaps = 5/222 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P+ V ++ I   IED GF+A
Sbjct  53    VIGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFYPNYVNEETIREKIEDVGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      N   T+  +  I GMTC +C  +VE  L ++ GV++A VALAT   +V 
Sbjct  113   TLIND----EGNERSTLVCRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP ++S + ++  IED GFEG L+ +     +I L V G+     M++LE  L  L GV
Sbjct  169   YDPKIVSYDHLLTTIEDTGFEGILLTTGEDMSRIELKVDGVRTDHSMRILEQSLQALPGV  228

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
             +   ++   +++ + +  ++ G R+ ++ I      +F  ++
Sbjct  229   QAIEFDSEIKKISLSYKSDMTGPRNFINVIETTGSRRFKANI  270


 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 75/145 (52%), Gaps = 13/145 (9%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            ++R+ GMTC +CST+VE AL +++GV KA VAL   +ADV +DP +V    +   IED G
Sbjct  128  RIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVHYDPKIVSYDHLLTTIEDTG  187

Query  530  FEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSV  706
            FE  +L         T   +S  +  + G+     +  +E  L +LPGV+   +   + +
Sbjct  188  FEGILL--------TTGEDMSRIELKVDGVRTDHSMRILEQSLQALPGVQ--AIEFDSEI  237

Query  707  GEV--EYDPTVISKNDIVNAIEDAG  775
             ++   Y   +    + +N IE  G
Sbjct  238  KKISLSYKSDMTGPRNFINVIETTG  262


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  +  +V + P  +++  I   IED GF
Sbjct  51   FSVIGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFYPNYVNEETIREKIEDVGF  110

Query  779  EGSLMQSSAQDKIIL----GVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + +L+     ++  L     + G++       +E  L  +HGV+       + E +V +D
Sbjct  111  QATLINDEGNERSTLVCRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVHYD  170

Query  947  PEVL  958
            P+++
Sbjct  171  PKIV  174



>ref|XP_002969660.1| hypothetical protein SELMODRAFT_231359 [Selaginella moellendorffii]
 gb|EFJ28784.1| hypothetical protein SELMODRAFT_231359 [Selaginella moellendorffii]
Length=924

 Score =   135 bits (339),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 124/207 (60%), Gaps = 5/207 (2%)
 Frame = +2

Query  368  MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
            M CAAC+ S+E A+  L G+  A+VA L  +A V++ P  V ++ I  AI+DAGF+A V+
Sbjct  1    MECAACAGSIEKAIKRLPGIKNAAVAALHARAQVIYHPAFVAEEAIREAIQDAGFQASVI  60

Query  548  AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
             +    H++ N +   +  I GMTC AC  S+E  L  + GVKRAVVALAT   E+ YDP
Sbjct  61   ED----HSHQNESNICRVRIKGMTCTACSTSIESALRKMAGVKRAVVALATEESEIHYDP  116

Query  728  TVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGVRHF  904
             V+S   ++ AI+DAGFE  L+ +   ++++ L + G+  Q  ++++E  L  L GV+  
Sbjct  117  KVVSHGLLMAAIDDAGFETELISAGEDRNRVYLRLQGVHSQEALKVIEISLMALPGVKSV  176

Query  905  FYNPTSRELEVVFDPEVLGSRSVVDGI  985
             +N     L V +DP++ G R  ++ I
Sbjct  177  EFNAIEERLMVSYDPDLTGPRCFIEVI  203


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 83/166 (50%), Gaps = 14/166 (8%)
 Frame = +2

Query  317  EENSGENLRRI-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            E++S +N   I +VR+ GMTC ACSTS+E AL  + GV +A VAL   ++++ +DP VV 
Sbjct  61   EDHSHQNESNICRVRIKGMTCTACSTSIESALRKMAGVKRAVVALATEESEIHYDPKVVS  120

Query  494  DKDIENAIEDAGFEAEVLA---EPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
               +  AI+DAGFE E+++   + N  +    G  S +           +  +E  L +L
Sbjct  121  HGLLMAAIDDAGFETELISAGEDRNRVYLRLQGVHSQE----------ALKVIEISLMAL  170

Query  665  PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSS  802
            PGVK            V YDP +      +  IE      +L ++S
Sbjct  171  PGVKSVEFNAIEERLMVSYDPDLTGPRCFIEVIEQTSPTPNLYRAS  216



>ref|XP_009400594.1| PREDICTED: probable copper-transporting ATPase HMA5 [Musa acuminata 
subsp. malaccensis]
Length=930

 Score =   135 bits (339),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/213 (38%), Positives = 122/213 (57%), Gaps = 6/213 (3%)
 Frame = +2

Query  368  MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
            MTCAAC+ SVE A+  L G+  A+V +L ++A VVF P  V +  I   IED GFEA  +
Sbjct  1    MTCAACAGSVEKAIKRLPGIHDAAVDVLNDRAQVVFYPAFVSEDTIRETIEDVGFEATSV  60

Query  548  AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
             E        N T+  +  I GMTC +C N+VE  L ++ GV +A+VALAT   E+ YDP
Sbjct  61   KE----LMKENSTLLCRLQIKGMTCTSCTNTVESALQAVNGVHKALVALATEEAEICYDP  116

Query  728  TVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGVRHF  904
               S N ++ A+ED+GFE +L+ +   +++I L + G      + +++  L  L GV   
Sbjct  117  RFASANQLIEAVEDSGFEATLITTGEDRNRIQLKIDGTFYSRYISMVKSSLQALPGVDDI  176

Query  905  FYNPTSRELEVVFDPEVLGSRSVVDGI-NGGSG  1000
              +P  R++ V + P+  G R+ ++ I + GSG
Sbjct  177  NIDPVLRKVTVSYKPDQTGPRNFIEVIESTGSG  209


 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 77/156 (49%), Gaps = 16/156 (10%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            +ENS   L R+Q++  GMTC +C+ +VE AL ++NGV KA VAL   +A++ +DP     
Sbjct  65   KENS-TLLCRLQIK--GMTCTSCTNTVESALQAVNGVHKALVALATEEAEICYDPRFASA  121

Query  497  KDIENAIEDAGFEAEVLA---EPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLP  667
              +  A+ED+GFEA ++    + N      +GT   ++          ++ V+  L +LP
Sbjct  122  NQLIEAVEDSGFEATLITTGEDRNRIQLKIDGTFYSRY----------ISMVKSSLQALP  171

Query  668  GVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            GV    +        V Y P      + +  IE  G
Sbjct  172  GVDDINIDPVLRKVTVSYKPDQTGPRNFIEVIESTG  207



>ref|XP_002446920.1| hypothetical protein SORBIDRAFT_06g024910 [Sorghum bicolor]
 gb|EES11248.1| hypothetical protein SORBIDRAFT_06g024910 [Sorghum bicolor]
Length=998

 Score =   135 bits (339),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 122/216 (56%), Gaps = 5/216 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V +  I  AIED GFEA
Sbjct  76    VSGMTCAACAGSVEKAVKRLPGIHDAAVDVLWGRAQVVFCPAFVSENKITEAIEDVGFEA  135

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GM C  C ++VE  L + PGV+RA VALAT   E+ 
Sbjct  136   KLIDE----EVKEKNVLLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEIR  191

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +IS + ++ A+E+ GFE  L+ +   Q +I L + G+  +  + +L+  +  L GV
Sbjct  192   YDRRIISASQLIQAVEETGFEAILVTTGEDQSRIDLKMDGVLDETLIMILKSSVQALPGV  251

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
              +  +N    ++ + + P+  G R +++ IN  + G
Sbjct  252   ENITFNSELHKVTISYKPDQTGPRDLIEVINSATFG  287


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG+  A V +     +V + P  +S+N I  AIED GF
Sbjct  74   FSVSGMTCAACAGSVEKAVKRLPGIHDAAVDVLWGRAQVVFCPAFVSENKITEAIEDVGF  133

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E  L+    ++K +    L + G++ +     +E  L    GV+       + E E+ +D
Sbjct  134  EAKLIDEEVKEKNVLLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEIRYD  193

Query  947  PEVLGSRSVVDGI  985
              ++ +  ++  +
Sbjct  194  RRIISASQLIQAV  206


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 72/155 (46%), Gaps = 7/155 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DEE   +N+   ++ + GM C  C+++VE AL +  GV +ASVAL   +A++ +D  ++ 
Sbjct  139  DEEVKEKNVLLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEIRYDRRIIS  198

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +  A+E+ GFEA +L       +  +        + G+     +  ++  + +LPGV
Sbjct  199  ASQLIQAVEETGFEA-ILVTTGEDQSRID------LKMDGVLDETLIMILKSSVQALPGV  251

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            +            + Y P      D++  I  A F
Sbjct  252  ENITFNSELHKVTISYKPDQTGPRDLIEVINSATF  286



>ref|XP_001786130.1| predicted protein [Physcomitrella patens]
 gb|EDQ49058.1| predicted protein, partial [Physcomitrella patens]
Length=147

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 94/142 (66%), Gaps = 4/142 (3%)
 Frame = +2

Query  368  MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
            M CAAC+ S+E A+  L G+ +A+V++LQN+A VV+ P  V+++ I  AIEDAGFEAE +
Sbjct  1    MECAACAGSIEKAVKRLPGIEEATVSVLQNRAQVVYRPAFVQEESIREAIEDAGFEAEAI  60

Query  548  AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
             +        +G++S +F I GMTC +C NS+E  L  L GV++AVVALAT   EV +D 
Sbjct  61   VDDAGQR---SGSIS-RFRIKGMTCTSCSNSIESSLKKLDGVQKAVVALATEECEVRHDA  116

Query  728  TVISKNDIVNAIEDAGFEGSLM  793
             VIS   +  AI+D G+E  L+
Sbjct  117  GVISHVQLAAAIDDLGYEAELL  138


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            + R+ GMTC +CS S+E +L  L+GV KA VAL   + +V  D  V+    +  AI+D G
Sbjct  73   RFRIKGMTCTSCSNSIESSLKKLDGVQKAVVALATEECEVRHDAGVISHVQLAAAIDDLG  132

Query  530  FEAEVL  547
            +EAE+L
Sbjct  133  YEAELL  138


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 4/119 (3%)
 Frame = +2

Query  614  MTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEG-SL  790
            M CAAC  S+E  +  LPG++ A V++  +  +V Y P  + +  I  AIEDAGFE  ++
Sbjct  1    MECAACAGSIEKAVKRLPGIEEATVSVLQNRAQVVYRPAFVQEESIREAIEDAGFEAEAI  60

Query  791  MQSSAQDKIILGVVGISGQMDMQL---LEGILSKLHGVRHFFYNPTSRELEVVFDPEVL  958
            +  + Q    +    I G         +E  L KL GV+       + E EV  D  V+
Sbjct  61   VDDAGQRSGSISRFRIKGMTCTSCSNSIESSLKKLDGVQKAVVALATEECEVRHDAGVI  119



>gb|KEH20505.1| heavy metal P-type ATPase [Medicago truncatula]
Length=706

 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 125/218 (57%), Gaps = 4/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTCAAC+ SVE A+  L G+ +A V +L +KA V++ P +V ++ I +AIEDAGFEA
Sbjct  59    VMGMTCAACAGSVEKAIKRLPGIREAVVDVLNDKAQVLYLPTIVNEESIRDAIEDAGFEA  118

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             + + + +++  NT+  +  +  IGGMTC +C ++V+ +L SL GV+ A VALAT   E+ 
Sbjct  119   KSMEDDSSN--NTSFQIC-RVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIR  175

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP +IS   ++  I + GF   L+       KI L + GI  +  M ++E  L  L GV
Sbjct  176   YDPKIISYTQLMETISNTGFNPILISKGEHISKIELKIDGIKNEQSMYIIEQSLRTLQGV  235

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                       ++ + + P + G R+ ++ I     G F
Sbjct  236   ETIETYLDINKIVLTYKPYMTGPRTFIELIESSGSGCF  273


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 5/135 (4%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG++ AVV +     +V Y PT++++  I +AIEDAGF
Sbjct  57   FCVMGMTCAACAGSVEKAIKRLPGIREAVVDVLNDKAQVLYLPTIVNEESIRDAIEDAGF  116

Query  779  EGSLMQ--SSAQDKIILGVVGISGQMDMQL---LEGILSKLHGVRHFFYNPTSRELEVVF  943
            E   M+  SS      +  V I G         ++ +L  L GV+       + E E+ +
Sbjct  117  EAKSMEDDSSNNTSFQICRVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIRY  176

Query  944  DPEVLGSRSVVDGIN  988
            DP+++    +++ I+
Sbjct  177  DPKIISYTQLMETIS  191


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 73/154 (47%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            D+ ++  + +  +V + GMTC +CS++V+  L SL GV  A VAL   +A++ +DP ++ 
Sbjct  123  DDSSNNTSFQICRVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIRYDPKIIS  182

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +   I + GF   ++++    H +       +  I G+     +  +E  L +L GV
Sbjct  183  YTQLMETISNTGFNPILISK--GEHISKI-----ELKIDGIKNEQSMYIIEQSLRTLQGV  235

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +     L  +   + Y P +      +  IE +G
Sbjct  236  ETIETYLDINKIVLTYKPYMTGPRTFIELIESSG  269



>ref|XP_002446919.1| hypothetical protein SORBIDRAFT_06g024900 [Sorghum bicolor]
 gb|AAT42168.1| putative copper-exporting ATPase [Sorghum bicolor]
 gb|EES11247.1| hypothetical protein SORBIDRAFT_06g024900 [Sorghum bicolor]
Length=1002

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 123/219 (56%), Gaps = 5/219 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V ++ I  AIEDAGFEA
Sbjct  80    VTGMTCAACAGSVEKAVKRLPGIHDAAVDVLGGRAQVVFYPAFVSEEKIREAIEDAGFEA  139

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GMTC +C ++VE  L  LPGV+RA VALAT   E+ 
Sbjct  140   KLINE----EVREKNILVCRLHIKGMTCTSCTSTVESALQVLPGVQRASVALATEEAEIH  195

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +I+ + +++A E+ GFE  L+ +   + +I L + G+  +    +L+  +  L GV
Sbjct  196   YDRRIIAASQLIHAAEETGFEAILITTGEDRSRIDLKLDGLLTERLTMILKSSIQALPGV  255

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFT  1012
                  +    ++ V + P+  G R +++ I   + G  T
Sbjct  256   EDVKVDTELHKITVSYKPDQTGPRDLIEVIESATSGDVT  294



>emb|CDP19140.1| unnamed protein product [Coffea canephora]
Length=967

 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 125/224 (56%), Gaps = 9/224 (4%)
 Frame = +2

Query  335   NLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENA  514
              +R I  +V GMTC++C+TS+E ALM LNG+    V+ LQ +A V ++P  +  K I+ A
Sbjct  35    KIRTIVFKVIGMTCSSCATSMESALMKLNGIKSVMVSPLQGQAVVKYNPESISAKLIKEA  94

Query  515   IEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
              E+ GF+ +   E + +          +  I GM C +C  SVE  L  + GVK+AVV L
Sbjct  95    AEETGFQVDEFPEQDIAVC--------RLRIKGMACTSCSESVERALLMVDGVKKAVVGL  146

Query  695   ATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMDMQLLEG  871
             A    ++ YDP++ + + I  AIED+GF  +L+ S S  +K+ L + GIS Q D+ ++  
Sbjct  147   ALEEAKIHYDPSITNTDLITEAIEDSGFGANLISSGSDLNKVHLKLEGISSQDDLNVIRC  206

Query  872   ILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
              L  L GV H  ++     + V ++P+++G R ++  I     G
Sbjct  207   SLEYLEGVNHVEFDIKEHVVSVSYEPDIIGPRYLIQCIQEAGKG  250


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 85/175 (49%), Gaps = 19/175 (11%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            +E   +++   ++R+ GM C +CS SVE AL+ ++GV KA V L   +A + +DP +   
Sbjct  103  DEFPEQDIAVCRLRIKGMACTSCSESVERALLMVDGVKKAVVGLALEEAKIHYDPSITNT  162

Query  497  KDIENAIEDAGFEAEVL---AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLP  667
              I  AIED+GF A ++   ++ N  H    G +S Q  +  + C+         L  L 
Sbjct  163  DLITEAIEDSGFGANLISSGSDLNKVHLKLEG-ISSQDDLNVIRCS---------LEYLE  212

Query  668  GVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG-----FEGSLMQSS-AQDK  814
            GV      +   V  V Y+P +I    ++  I++AG     ++ SL      QDK
Sbjct  213  GVNHVEFDIKEHVVSVSYEPDIIGPRYLIQCIQEAGKGLSSYQASLFTPPRPQDK  267



>ref|XP_002975836.1| hypothetical protein SELMODRAFT_150817 [Selaginella moellendorffii]
 gb|EFJ22741.1| hypothetical protein SELMODRAFT_150817 [Selaginella moellendorffii]
Length=925

 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 116/207 (56%), Gaps = 5/207 (2%)
 Frame = +2

Query  368  MTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVL  547
            M C AC+ S+E AL  L G+ +A+VA++Q KA VVF P  V  + I  AI DAGF+A +L
Sbjct  1    MKCTACAGSIEKALKRLPGIKEAAVAVIQEKAQVVFHPAFVDVETIREAIVDAGFDAALL  60

Query  548  AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
             +P     NT      +  + GMTC +C  S+E  L  + GVK AVVALAT   E+ +DP
Sbjct  61   EDPVEQSTNT----VCRLRVRGMTCTSCSGSIEAALRKIQGVKTAVVALATEQAEILHDP  116

Query  728  TVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHF  904
             V+S   ++ A+ED GFE  L+ +   ++K+ L + G+  Q   + +   L  L GV   
Sbjct  117  RVVSCAKLMEAVEDVGFEAELISAGEERNKVHLQLEGVHSQEGFRNIVTSLEALAGVTEV  176

Query  905  FYNPTSRELEVVFDPEVLGSRSVVDGI  985
               PT   + V +DP++ G R  ++ I
Sbjct  177  ELFPTEERVVVSYDPDLTGPRCFIEII  203


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 73/148 (49%), Gaps = 19/148 (13%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            ++RV GMTC +CS S+E AL  + GV  A VAL   +A+++ DP VV    +  A+ED G
Sbjct  73   RLRVRGMTCTSCSGSIEAALRKIQGVKTAVVALATEQAEILHDPRVVSCAKLMEAVEDVG  132

Query  530  FEAEVLA---EPNASHANTNGTVSGQ-F--MIGGMTCAACVNSVEGILSSLPGVKRAVVA  691
            FEAE+++   E N  H    G  S + F  ++  +   A V  VE      P  +R VV+
Sbjct  133  FEAELISAGEERNKVHLQLEGVHSQEGFRNIVTSLEALAGVTEVE----LFPTEERVVVS  188

Query  692  LATSVGEVEYDPTVISKNDIVNAIEDAG  775
                     YDP +      +  IE  G
Sbjct  189  ---------YDPDLTGPRCFIEIIEQTG  207



>gb|KEH20506.1| heavy metal P-type ATPase [Medicago truncatula]
Length=882

 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 125/218 (57%), Gaps = 4/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTCAAC+ SVE A+  L G+ +A V +L +KA V++ P +V ++ I +AIEDAGFEA
Sbjct  59    VMGMTCAACAGSVEKAIKRLPGIREAVVDVLNDKAQVLYLPTIVNEESIRDAIEDAGFEA  118

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             + + + +++  NT+  +  +  IGGMTC +C ++V+ +L SL GV+ A VALAT   E+ 
Sbjct  119   KSMEDDSSN--NTSFQIC-RVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIR  175

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP +IS   ++  I + GF   L+       KI L + GI  +  M ++E  L  L GV
Sbjct  176   YDPKIISYTQLMETISNTGFNPILISKGEHISKIELKIDGIKNEQSMYIIEQSLRTLQGV  235

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                       ++ + + P + G R+ ++ I     G F
Sbjct  236   ETIETYLDINKIVLTYKPYMTGPRTFIELIESSGSGCF  273


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 5/135 (4%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG++ AVV +     +V Y PT++++  I +AIEDAGF
Sbjct  57   FCVMGMTCAACAGSVEKAIKRLPGIREAVVDVLNDKAQVLYLPTIVNEESIRDAIEDAGF  116

Query  779  EGSLMQ--SSAQDKIILGVVGISGQMDMQL---LEGILSKLHGVRHFFYNPTSRELEVVF  943
            E   M+  SS      +  V I G         ++ +L  L GV+       + E E+ +
Sbjct  117  EAKSMEDDSSNNTSFQICRVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIRY  176

Query  944  DPEVLGSRSVVDGIN  988
            DP+++    +++ I+
Sbjct  177  DPKIISYTQLMETIS  191


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 73/154 (47%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            D+ ++  + +  +V + GMTC +CS++V+  L SL GV  A VAL   +A++ +DP ++ 
Sbjct  123  DDSSNNTSFQICRVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIRYDPKIIS  182

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +   I + GF   ++++    H +       +  I G+     +  +E  L +L GV
Sbjct  183  YTQLMETISNTGFNPILISK--GEHIS-----KIELKIDGIKNEQSMYIIEQSLRTLQGV  235

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +     L  +   + Y P +      +  IE +G
Sbjct  236  ETIETYLDINKIVLTYKPYMTGPRTFIELIESSG  269



>ref|XP_006574305.1| PREDICTED: probable copper-transporting ATPase HMA5-like [Glycine 
max]
Length=922

 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 125/217 (58%), Gaps = 8/217 (4%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GM+CAAC+ SVE A+  L G+ +A V +L N+A V+F P  V  + I  AIEDAGFEA
Sbjct  46    VVGMSCAACAGSVEKAVKRLPGIREAIVDVLNNRAHVIFYPSFVNVETIREAIEDAGFEA  105

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              +L +   S          +  I GM+C +C +++E +L +L GV  A V LAT   +V 
Sbjct  106   ALLTDDKKS------VQVCRIQIKGMSCTSCSSTLESVLQALDGVLEARVGLATEEAQVH  159

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVR  898
             Y+P +++ N I+ AI+D+GFE  L+ SS+QD   + ++ + G + M+L+E  L  L GV 
Sbjct  160   YNPILLTTNHILQAIQDSGFEAQLI-SSSQDLSKIDLL-VEGDITMKLIEDSLQTLPGVL  217

Query  899   HFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                      ++ V + P+V G R+ ++ I+    G F
Sbjct  218   AVDITTELNKISVSYKPDVTGPRNFINVIHETGNGNF  254


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 75/144 (52%), Gaps = 12/144 (8%)
 Frame = +2

Query  344  RIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
            RIQ++  GM+C +CS+++E  L +L+GV++A V L   +A V ++P ++    I  AI+D
Sbjct  119  RIQIK--GMSCTSCSSTLESVLQALDGVLEARVGLATEEAQVHYNPILLTTNHILQAIQD  176

Query  524  AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
            +GFEA++++  +   +  +  V G            +  +E  L +LPGV    +    +
Sbjct  177  SGFEAQLISS-SQDLSKIDLLVEGDI---------TMKLIEDSLQTLPGVLAVDITTELN  226

Query  704  VGEVEYDPTVISKNDIVNAIEDAG  775
               V Y P V    + +N I + G
Sbjct  227  KISVSYKPDVTGPRNFINVIHETG  250



>ref|XP_010089121.1| Putative copper-transporting ATPase 3 [Morus notabilis]
 gb|EXB37368.1| Putative copper-transporting ATPase 3 [Morus notabilis]
Length=984

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 123/219 (56%), Gaps = 6/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+AC+ SVE A+  L G+ +A+V +L NKA V++ P+ V ++ I  AIEDAGFEA
Sbjct  50    VTGMTCSACAGSVEKAVKRLPGIREAAVDVLNNKALVLYYPNFVTEERIREAIEDAGFEA  109

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ E      +       +  I GMTC +C +++E  L SL GV+ A VALAT   EV 
Sbjct  110   TIIKEEPLKDKSIQVC---RIHINGMTCTSCSSTIESALKSLHGVQTAQVALATEEAEVY  166

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YD  +IS N I+  IED GFE ++  S  +D  KI + V G      ++ +   L  L G
Sbjct  167   YDTRLISYNQILQTIEDTGFE-AIFISVGEDISKIDIQVDGFKTDYSLKTIARSLESLPG  225

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V+     P  +++ + +  ++ G R+ ++ I     G F
Sbjct  226   VQAIETYPELKKISISYKADLTGPRTFIEVIESSGSGHF  264


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 5/134 (4%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ A V +  +   V Y P  +++  I  AIEDAGF
Sbjct  48   FAVTGMTCSACAGSVEKAVKRLPGIREAAVDVLNNKALVLYYPNFVTEERIREAIEDAGF  107

Query  779  EGSLMQSSA-QDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVF  943
            E ++++    +DK I    + + G++       +E  L  LHGV+       + E EV +
Sbjct  108  EATIIKEEPLKDKSIQVCRIHINGMTCTSCSSTIESALKSLHGVQTAQVALATEEAEVYY  167

Query  944  DPEVLGSRSVVDGI  985
            D  ++    ++  I
Sbjct  168  DTRLISYNQILQTI  181


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            +E    ++++  ++ + GMTC +CS+++E AL SL+GV  A VAL   +A+V +D  ++ 
Sbjct  114  EEPLKDKSIQVCRIHINGMTCTSCSSTIESALKSLHGVQTAQVALATEEAEVYYDTRLIS  173

Query  494  DKDIENAIEDAGFEA  538
               I   IED GFEA
Sbjct  174  YNQILQTIEDTGFEA  188



>gb|KHN25709.1| Putative copper-transporting ATPase 3 [Glycine soja]
Length=957

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 125/217 (58%), Gaps = 8/217 (4%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GM+CAAC+ SVE A+  L G+ +A V +L N+A V+F P  V  + I  AIEDAGFEA
Sbjct  25    VVGMSCAACAGSVEKAVKRLPGIREAIVDVLNNRAHVIFYPSFVNVETIREAIEDAGFEA  84

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              +L +   S          +  I GM+C +C +++E +L +L GV  A V LAT   +V 
Sbjct  85    ALLTDDKKS------VQVCRIQIKGMSCTSCSSTLESVLQALDGVLEARVGLATEEAQVH  138

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVR  898
             Y+P +++ N I+ AI+D+GFE  L+ SS+QD   + ++ + G + M+L+E  L  L GV 
Sbjct  139   YNPILLTTNHILQAIQDSGFEAQLI-SSSQDLSKIDLL-VEGDITMKLIEDSLQTLPGVL  196

Query  899   HFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                      ++ V + P+V G R+ ++ I+    G F
Sbjct  197   AVDITTELNKISVSYKPDVTGPRNFINVIHETGNGNF  233


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 75/144 (52%), Gaps = 12/144 (8%)
 Frame = +2

Query  344  RIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
            RIQ++  GM+C +CS+++E  L +L+GV++A V L   +A V ++P ++    I  AI+D
Sbjct  98   RIQIK--GMSCTSCSSTLESVLQALDGVLEARVGLATEEAQVHYNPILLTTNHILQAIQD  155

Query  524  AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
            +GFEA++++  +   +  +  V G            +  +E  L +LPGV    +    +
Sbjct  156  SGFEAQLISS-SQDLSKIDLLVEGDI---------TMKLIEDSLQTLPGVLAVDITTELN  205

Query  704  VGEVEYDPTVISKNDIVNAIEDAG  775
               V Y P V    + +N I + G
Sbjct  206  KISVSYKPDVTGPRNFINVIHETG  229



>ref|XP_004511584.1| PREDICTED: putative copper-transporting ATPase HMA5-like isoform 
X3 [Cicer arietinum]
Length=851

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 124/218 (57%), Gaps = 7/218 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE  +  L+G+ +A V +L N+A V+F P  V ++ I  AIE+AGFEA
Sbjct  53    VLGMTCSACAGSVEKGIKRLHGIHEAVVDVLNNRARVIFHPSFVNEEAICEAIENAGFEA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              +L +     +N N     +  I GMTC +C  +VE  L ++PGV++A VALAT   +V 
Sbjct  113   AILTDA----SNENSIQVCRIQIKGMTCTSCSTAVESALKAIPGVQKAHVALATEEAQVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVG--ISGQMDMQLLEGILSKLH  889
             Y+P +++   I+  ++DAGFE +L+ SS    KI L V G  ++    + L+E  L  L 
Sbjct  169   YNPNIVTHIHILQVVDDAGFEPTLISSSEDLSKIDLHVEGHDLNDHSILILVEDSLRSLP  228

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
             GV          ++ + + P++ G R  ++ I   S G
Sbjct  229   GVLELHTTLEFNKISLSYKPDITGPRDFINVIQETSSG  266


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 83/160 (52%), Gaps = 8/160 (5%)
 Frame = +2

Query  290  EVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADV  469
            E  +L     ENS + + RIQ++  GMTC +CST+VE AL ++ GV KA VAL   +A V
Sbjct  111  EAAILTDASNENSIQ-VCRIQIK--GMTCTSCSTAVESALKAIPGVQKAHVALATEEAQV  167

Query  470  VFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEG  649
             ++P++V    I   ++DAGFE  +++  +   +  +  V G      +   + +  VE 
Sbjct  168  HYNPNIVTHIHILQVVDDAGFEPTLISS-SEDLSKIDLHVEGH----DLNDHSILILVED  222

Query  650  ILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIED  769
             L SLPGV      L  +   + Y P +    D +N I++
Sbjct  223  SLRSLPGVLELHTTLEFNKISLSYKPDITGPRDFINVIQE  262


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 67/128 (52%), Gaps = 4/128 (3%)
 Frame = +2

Query  587  VSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIE  766
            V+  F + GMTC+AC  SVE  +  L G+  AVV +  +   V + P+ +++  I  AIE
Sbjct  47   VTALFSVLGMTCSACAGSVEKGIKRLHGIHEAVVDVLNNRARVIFHPSFVNEEAICEAIE  106

Query  767  DAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELE  934
            +AGFE +++  ++ +  I    + + G++       +E  L  + GV+       + E +
Sbjct  107  NAGFEAAILTDASNENSIQVCRIQIKGMTCTSCSTAVESALKAIPGVQKAHVALATEEAQ  166

Query  935  VVFDPEVL  958
            V ++P ++
Sbjct  167  VHYNPNIV  174



>ref|XP_009400268.1| PREDICTED: probable copper-transporting ATPase HMA5 [Musa acuminata 
subsp. malaccensis]
Length=1002

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 119/218 (55%), Gaps = 5/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GM CAAC+ SVE A+  L G+  A+V +L ++A V+F P  V +  I   IED GF+A
Sbjct  70    VVGMACAACAGSVEKAIKRLPGIHDAAVDVLNDRAQVIFYPAFVSEDTIRETIEDVGFKA  129

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             E++ E           +  +  I GMTC +C +++E  L  +PGV +A+VALAT   EV 
Sbjct  130   ELIQE----EMKEKSVLICRLRIKGMTCTSCSSTIESALQDVPGVHKALVALATEEAEVR  185

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP V+S N +++A+ED GFE  L+ +    ++I L V G      + ++   L  L GV
Sbjct  186   YDPRVVSANQLMDAVEDTGFEAILVTTGEDINRIELKVDGPFSTRYISMVNNSLQALPGV  245

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                  +P   ++ + + P+  G R+ ++ I     G+ 
Sbjct  246   DDINIDPVLHKVTISYKPDQTGPRNFIEIIESTGSGQL  283



>gb|AET04016.2| heavy metal P-type ATPase [Medicago truncatula]
Length=994

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 125/218 (57%), Gaps = 4/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTCAAC+ SVE A+  L G+ +A V +L +KA V++ P +V ++ I +AIEDAGFEA
Sbjct  59    VMGMTCAACAGSVEKAIKRLPGIREAVVDVLNDKAQVLYLPTIVNEESIRDAIEDAGFEA  118

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             + + + +++  NT+  +  +  IGGMTC +C ++V+ +L SL GV+ A VALAT   E+ 
Sbjct  119   KSMEDDSSN--NTSFQIC-RVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIR  175

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP +IS   ++  I + GF   L+       KI L + GI  +  M ++E  L  L GV
Sbjct  176   YDPKIISYTQLMETISNTGFNPILISKGEHISKIELKIDGIKNEQSMYIIEQSLRTLQGV  235

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                       ++ + + P + G R+ ++ I     G F
Sbjct  236   ETIETYLDINKIVLTYKPYMTGPRTFIELIESSGSGCF  273


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 5/135 (4%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG++ AVV +     +V Y PT++++  I +AIEDAGF
Sbjct  57   FCVMGMTCAACAGSVEKAIKRLPGIREAVVDVLNDKAQVLYLPTIVNEESIRDAIEDAGF  116

Query  779  EGSLMQ--SSAQDKIILGVVGISGQMDMQL---LEGILSKLHGVRHFFYNPTSRELEVVF  943
            E   M+  SS      +  V I G         ++ +L  L GV+       + E E+ +
Sbjct  117  EAKSMEDDSSNNTSFQICRVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIRY  176

Query  944  DPEVLGSRSVVDGIN  988
            DP+++    +++ I+
Sbjct  177  DPKIISYTQLMETIS  191


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 73/154 (47%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            D+ ++  + +  +V + GMTC +CS++V+  L SL GV  A VAL   +A++ +DP ++ 
Sbjct  123  DDSSNNTSFQICRVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIRYDPKIIS  182

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +   I + GF   ++++    H +       +  I G+     +  +E  L +L GV
Sbjct  183  YTQLMETISNTGFNPILISK--GEHIS-----KIELKIDGIKNEQSMYIIEQSLRTLQGV  235

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +     L  +   + Y P +      +  IE +G
Sbjct  236  ETIETYLDINKIVLTYKPYMTGPRTFIELIESSG  269



>ref|XP_010418362.1| PREDICTED: probable copper-transporting ATPase HMA5 [Camelina 
sativa]
Length=998

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 137/236 (58%), Gaps = 14/236 (6%)
 Frame = +2

Query  332   ENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIEN  511
             E + R   +V GMTC+AC+ SVE A+  L+G+ +A +  L N+A ++F P++V  + I  
Sbjct  51    EEISRAIFQVLGMTCSACAGSVEKAIKRLSGIHEAVIDALNNRAQILFYPNLVDVETIRE  110

Query  512   AIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVA  691
              IEDAGFEA ++     + AN       +  I GMTC +C +++E +L S+ GV+RA VA
Sbjct  111   TIEDAGFEASLI----ENEANERSRQVCRIRISGMTCTSCSSTIERVLQSVNGVQRAHVA  166

Query  692   LATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLL  865
             LA    E+ YDP ++S + ++  IE+AGFE  L+ S+ +D  KI L + G      M+++
Sbjct  167   LAIEEAEIHYDPRLLSYDRLLEEIENAGFEAVLI-STGEDVSKIDLKIDGEFTDESMEII  225

Query  866   EGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRS---VVDGINGGSGGKFTLHVK  1024
             E  L  L GV+    +  + ++ V++ P+V G R+   V++ I  G  G    H+K
Sbjct  226   ERSLEALPGVQSVEISHGTDKISVLYRPDVTGPRNFIQVIESIVFGHSG----HIK  277



>ref|XP_009339920.1| PREDICTED: probable copper-transporting ATPase HMA5 [Pyrus x 
bretschneideri]
Length=987

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 124/222 (56%), Gaps = 5/222 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P+ V  ++I   IED GF+A
Sbjct  53    VMGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPNFVSAENIRETIEDVGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      N    +  +  I GMTC +C  +VE  L ++ GV++A VALAT   +V 
Sbjct  113   TLIND----EGNEKSILICRIRIKGMTCTSCSTTVESALQAVDGVQKAQVALATEEADVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP V+S N ++  IED GFEG L+ +     +I L V G+     M++L   L  L GV
Sbjct  169   YDPKVVSYNQLLQTIEDTGFEGILITAGEDMSRIELEVDGVRTDRSMRILGQSLQALPGV  228

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
             +   ++   +++ V +  ++ G RS ++ I      +F   +
Sbjct  229   QTIDFDSEIKKISVSYKSDMTGPRSFINVIETTGSRRFKAKI  270


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            ++E + +++   ++R+ GMTC +CST+VE AL +++GV KA VAL   +ADV +DP VV 
Sbjct  116  NDEGNEKSILICRIRIKGMTCTSCSTTVESALQAVDGVQKAQVALATEEADVHYDPKVVS  175

Query  494  DKDIENAIEDAGFE  535
               +   IED GFE
Sbjct  176  YNQLLQTIEDTGFE  189


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  +  +V + P  +S  +I   IED GF
Sbjct  51   FSVMGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPNFVSAENIRETIEDVGF  110

Query  779  EGSLMQSSAQDKIIL----GVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + +L+     +K IL     + G++       +E  L  + GV+       + E +V +D
Sbjct  111  QATLINDEGNEKSILICRIRIKGMTCTSCSTTVESALQAVDGVQKAQVALATEEADVHYD  170

Query  947  PEVLGSRSVVDGI  985
            P+V+    ++  I
Sbjct  171  PKVVSYNQLLQTI  183



>ref|XP_003629540.1| Heavy metal P-type ATPase [Medicago truncatula]
Length=1140

 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 125/218 (57%), Gaps = 4/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTCAAC+ SVE A+  L G+ +A V +L +KA V++ P +V ++ I +AIEDAGFEA
Sbjct  209   VMGMTCAACAGSVEKAIKRLPGIREAVVDVLNDKAQVLYLPTIVNEESIRDAIEDAGFEA  268

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             + + + +++  NT+  +  +  IGGMTC +C ++V+ +L SL GV+ A VALAT   E+ 
Sbjct  269   KSMEDDSSN--NTSFQIC-RVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIR  325

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP +IS   ++  I + GF   L+       KI L + GI  +  M ++E  L  L GV
Sbjct  326   YDPKIISYTQLMETISNTGFNPILISKGEHISKIELKIDGIKNEQSMYIIEQSLRTLQGV  385

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                       ++ + + P + G R+ ++ I     G F
Sbjct  386   ETIETYLDINKIVLTYKPYMTGPRTFIELIESSGSGCF  423


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 5/135 (4%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG++ AVV +     +V Y PT++++  I +AIEDAGF
Sbjct  207  FCVMGMTCAACAGSVEKAIKRLPGIREAVVDVLNDKAQVLYLPTIVNEESIRDAIEDAGF  266

Query  779  EGSLMQ--SSAQDKIILGVVGISGQMDMQL---LEGILSKLHGVRHFFYNPTSRELEVVF  943
            E   M+  SS      +  V I G         ++ +L  L GV+       + E E+ +
Sbjct  267  EAKSMEDDSSNNTSFQICRVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIRY  326

Query  944  DPEVLGSRSVVDGIN  988
            DP+++    +++ I+
Sbjct  327  DPKIISYTQLMETIS  341


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 73/154 (47%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            D+ ++  + +  +V + GMTC +CS++V+  L SL GV  A VAL   +A++ +DP ++ 
Sbjct  273  DDSSNNTSFQICRVHIGGMTCTSCSSNVQSVLQSLRGVQIAQVALATEEAEIRYDPKIIS  332

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +   I + GF   ++++    H +       +  I G+     +  +E  L +L GV
Sbjct  333  YTQLMETISNTGFNPILISK--GEHIS-----KIELKIDGIKNEQSMYIIEQSLRTLQGV  385

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +     L  +   + Y P +      +  IE +G
Sbjct  386  ETIETYLDINKIVLTYKPYMTGPRTFIELIESSG  419



>gb|AID81885.1| heavy metal ATPase transporter 5 [Camelina sativa]
Length=998

 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 137/236 (58%), Gaps = 14/236 (6%)
 Frame = +2

Query  332   ENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIEN  511
             E + R   +V GMTC+AC+ SVE A+  L+G+ +A +  L N+A ++F P++V  + I  
Sbjct  51    EEISRAIFQVLGMTCSACAGSVEKAIKRLSGIHEAVIDALNNRAQILFYPNLVDVETIRE  110

Query  512   AIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVA  691
              IEDAGFEA ++     + AN       +  I GMTC +C +++E +L S+ GV+RA VA
Sbjct  111   TIEDAGFEASLI----ENEANERSRQVCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVA  166

Query  692   LATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLL  865
             LA    E+ YDP ++S + ++  IE+AGFE  L+ S+ +D  KI L + G      M+++
Sbjct  167   LAIEEAEIHYDPRLLSYDRLLEEIENAGFEAVLI-STGEDVSKIDLKIDGEFTDESMEII  225

Query  866   EGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRS---VVDGINGGSGGKFTLHVK  1024
             E  L  L GV+    +  + ++ V++ P+V G R+   V++ I  G  G    H+K
Sbjct  226   ERSLEALPGVQSVEISHGTDKISVLYRPDVTGPRNFIQVIESIVFGHSG----HIK  277



>ref|XP_006391745.1| hypothetical protein EUTSA_v10023234mg [Eutrema salsugineum]
 gb|ESQ29031.1| hypothetical protein EUTSA_v10023234mg [Eutrema salsugineum]
Length=994

 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 92/264 (35%), Positives = 143/264 (54%), Gaps = 19/264 (7%)
 Frame = +2

Query  200  KFIEMSPSMRDVQMTATNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCA  379
            +F E  P +R   + +  G       G   E  +L+  +EE S     R   RV GMTC+
Sbjct  15   RFSERYPVVRKRLIRSHGG-------GSPSETAVLEIDEEEIS-----RAVFRVLGMTCS  62

Query  380  ACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPN  559
            AC+ SVE  +  L G+ +A +  L N+A ++F P  V  + I   IEDAGFEA ++    
Sbjct  63   ACAGSVEKEIKRLPGIHEAVIDALNNRAQILFYPKSVNVETIRETIEDAGFEASLIE---  119

Query  560  ASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVIS  739
             + AN       +  I GMTC +C +++E IL S+ GV+RA VALA    EV YDP ++S
Sbjct  120  -NEANERSRQVCRIRINGMTCTSCSSTIERILQSVNGVQRAHVALAIEEAEVHYDPRLLS  178

Query  740  KNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHGVRHFFYN  913
             + ++  IE+AGFE  L+ S+ +D  KI L + G      M ++E  L  L GV++  ++
Sbjct  179  YDILLEEIENAGFEAVLI-STGEDVSKIDLKIDGEFTDESMSIIERSLEALPGVQNVEFD  237

Query  914  PTSRELEVVFDPEVLGSRSVVDGI  985
              + ++ V++ P+V G R+ +  I
Sbjct  238  RGADKISVLYKPDVTGPRNFIRVI  261


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 79/158 (50%), Gaps = 8/158 (5%)
 Frame = +2

Query  308  SYDEENSGENLRRI-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
            S  E  + E  R++ ++R+ GMTC +CS+++E  L S+NGV +A VAL   +A+V +DP 
Sbjct  116  SLIENEANERSRQVCRIRINGMTCTSCSSTIERILQSVNGVQRAHVALAIEEAEVHYDPR  175

Query  485  VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
            ++    +   IE+AGFEA VL       +  +  + G+F    M+       +E  L +L
Sbjct  176  LLSYDILLEEIENAGFEA-VLISTGEDVSKIDLKIDGEFTDESMSI------IERSLEAL  228

Query  665  PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            PGV+            V Y P V    + +  IE   F
Sbjct  229  PGVQNVEFDRGADKISVLYKPDVTGPRNFIRVIESTVF  266



>ref|XP_008667611.1| PREDICTED: uncharacterized protein LOC100274413 isoform X1 [Zea 
mays]
Length=1036

 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 122/216 (56%), Gaps = 5/216 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V +  I  AIED GFEA
Sbjct  105   VSGMTCAACAGSVEKAVKRLPGIHDAAVDVLWGRAQVVFYPAFVSENKITEAIEDVGFEA  164

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GM C  C ++VE  L + PGV+RA VALAT   E+ 
Sbjct  165   KLIDE----EVKEKNILLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEIR  220

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +IS + ++ A+E+ GFE  L+ +   Q +I L + G+  +  + +L+  +  L GV
Sbjct  221   YDRRIISASQLIQAVEETGFEALLVTAGEDQSRIDLKMDGVLDERLIMILKSSIQALPGV  280

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
              +  +N    ++ V ++P+  G R +++ I   + G
Sbjct  281   ENVKFNSELHKVTVSYNPDHTGPRDLIEVIKAATFG  316


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 66/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG+  A V +     +V + P  +S+N I  AIED GF
Sbjct  103  FSVSGMTCAACAGSVEKAVKRLPGIHDAAVDVLWGRAQVVFYPAFVSENKITEAIEDVGF  162

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E  L+    ++K I    L + G++ +     +E  L    GV+       + E E+ +D
Sbjct  163  EAKLIDEEVKEKNILLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEIRYD  222

Query  947  PEVLGSRSVVDGI  985
              ++ +  ++  +
Sbjct  223  RRIISASQLIQAV  235


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/155 (26%), Positives = 74/155 (48%), Gaps = 7/155 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DEE   +N+   ++ + GM C  C+++VE AL +  GV +ASVAL   +A++ +D  ++ 
Sbjct  168  DEEVKEKNILLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEIRYDRRIIS  227

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +  A+E+ GFEA +L       +  +        + G+     +  ++  + +LPGV
Sbjct  228  ASQLIQAVEETGFEA-LLVTAGEDQSRID------LKMDGVLDERLIMILKSSIQALPGV  280

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            +            V Y+P      D++  I+ A F
Sbjct  281  ENVKFNSELHKVTVSYNPDHTGPRDLIEVIKAATF  315



>ref|XP_009339921.1| PREDICTED: probable copper-transporting ATPase HMA5 [Pyrus x 
bretschneideri]
Length=987

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 123/218 (56%), Gaps = 5/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P+ V  ++I   IED GF+A
Sbjct  53    VMGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPNFVSAENIRETIEDVGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      N    +  +  I GMTC +C  +VE  L ++ GV++A VALAT   +V 
Sbjct  113   TLIND----EGNEKSILICRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP V+S N ++  IED GFEG L+ +     +I L V G+     M++L   L  L GV
Sbjct  169   YDPKVVSYNQLLQTIEDTGFEGILITAGEDMSRIELEVDGVRTDRSMRILGQSLQALPGV  228

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             +   ++   +++ V +  ++ G RS ++ I      +F
Sbjct  229   QTIDFDSEIKKISVSYKSDMTGPRSFINVIETTGSRRF  266


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            ++E + +++   ++R+ GMTC +CST+VE AL +++GV KA VAL   +ADV +DP VV 
Sbjct  116  NDEGNEKSILICRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVHYDPKVVS  175

Query  494  DKDIENAIEDAGFE  535
               +   IED GFE
Sbjct  176  YNQLLQTIEDTGFE  189


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 69/133 (52%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  +  +V + P  +S  +I   IED GF
Sbjct  51   FSVMGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPNFVSAENIRETIEDVGF  110

Query  779  EGSLMQSSAQDKIIL----GVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + +L+     +K IL     + G++       +E  L  +HGV+       + E +V +D
Sbjct  111  QATLINDEGNEKSILICRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVHYD  170

Query  947  PEVLGSRSVVDGI  985
            P+V+    ++  I
Sbjct  171  PKVVSYNQLLQTI  183



>gb|AAT42153.1| putative ATP dependent copper transporter [Zea mays]
 tpg|DAA36499.1| TPA: putative ATP dependent copper transporter [Zea mays]
Length=1001

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 122/216 (56%), Gaps = 5/216 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V +  I  AIED GFEA
Sbjct  70    VSGMTCAACAGSVEKAVKRLPGIHDAAVDVLWGRAQVVFYPAFVSENKITEAIEDVGFEA  129

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GM C  C ++VE  L + PGV+RA VALAT   E+ 
Sbjct  130   KLIDE----EVKEKNILLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEIR  185

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +IS + ++ A+E+ GFE  L+ +   Q +I L + G+  +  + +L+  +  L GV
Sbjct  186   YDRRIISASQLIQAVEETGFEALLVTAGEDQSRIDLKMDGVLDERLIMILKSSIQALPGV  245

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
              +  +N    ++ V ++P+  G R +++ I   + G
Sbjct  246   ENVKFNSELHKVTVSYNPDHTGPRDLIEVIKAATFG  281


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 66/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG+  A V +     +V + P  +S+N I  AIED GF
Sbjct  68   FSVSGMTCAACAGSVEKAVKRLPGIHDAAVDVLWGRAQVVFYPAFVSENKITEAIEDVGF  127

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E  L+    ++K I    L + G++ +     +E  L    GV+       + E E+ +D
Sbjct  128  EAKLIDEEVKEKNILLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEIRYD  187

Query  947  PEVLGSRSVVDGI  985
              ++ +  ++  +
Sbjct  188  RRIISASQLIQAV  200


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/155 (26%), Positives = 74/155 (48%), Gaps = 7/155 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DEE   +N+   ++ + GM C  C+++VE AL +  GV +ASVAL   +A++ +D  ++ 
Sbjct  133  DEEVKEKNILLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEIRYDRRIIS  192

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +  A+E+ GFEA +L       +  +        + G+     +  ++  + +LPGV
Sbjct  193  ASQLIQAVEETGFEA-LLVTAGEDQSRID------LKMDGVLDERLIMILKSSIQALPGV  245

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            +            V Y+P      D++  I+ A F
Sbjct  246  ENVKFNSELHKVTVSYNPDHTGPRDLIEVIKAATF  280



>ref|XP_004511582.1| PREDICTED: putative copper-transporting ATPase HMA5-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511583.1| PREDICTED: putative copper-transporting ATPase HMA5-like isoform 
X2 [Cicer arietinum]
Length=998

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 124/220 (56%), Gaps = 7/220 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE  +  L+G+ +A V +L N+A V+F P  V ++ I  AIE+AGFEA
Sbjct  53    VLGMTCSACAGSVEKGIKRLHGIHEAVVDVLNNRARVIFHPSFVNEEAICEAIENAGFEA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              +L +     +N N     +  I GMTC +C  +VE  L ++PGV++A VALAT   +V 
Sbjct  113   AILTDA----SNENSIQVCRIQIKGMTCTSCSTAVESALKAIPGVQKAHVALATEEAQVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVG--ISGQMDMQLLEGILSKLH  889
             Y+P +++   I+  ++DAGFE +L+ SS    KI L V G  ++    + L+E  L  L 
Sbjct  169   YNPNIVTHIHILQVVDDAGFEPTLISSSEDLSKIDLHVEGHDLNDHSILILVEDSLRSLP  228

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             GV          ++ + + P++ G R  ++ I   S G  
Sbjct  229   GVLELHTTLEFNKISLSYKPDITGPRDFINVIQETSSGNL  268


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 83/160 (52%), Gaps = 8/160 (5%)
 Frame = +2

Query  290  EVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADV  469
            E  +L     ENS + + RIQ++  GMTC +CST+VE AL ++ GV KA VAL   +A V
Sbjct  111  EAAILTDASNENSIQ-VCRIQIK--GMTCTSCSTAVESALKAIPGVQKAHVALATEEAQV  167

Query  470  VFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEG  649
             ++P++V    I   ++DAGFE  +++  +   +  +  V G      +   + +  VE 
Sbjct  168  HYNPNIVTHIHILQVVDDAGFEPTLISS-SEDLSKIDLHVEGH----DLNDHSILILVED  222

Query  650  ILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIED  769
             L SLPGV      L  +   + Y P +    D +N I++
Sbjct  223  SLRSLPGVLELHTTLEFNKISLSYKPDITGPRDFINVIQE  262


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 67/128 (52%), Gaps = 4/128 (3%)
 Frame = +2

Query  587  VSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIE  766
            V+  F + GMTC+AC  SVE  +  L G+  AVV +  +   V + P+ +++  I  AIE
Sbjct  47   VTALFSVLGMTCSACAGSVEKGIKRLHGIHEAVVDVLNNRARVIFHPSFVNEEAICEAIE  106

Query  767  DAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELE  934
            +AGFE +++  ++ +  I    + + G++       +E  L  + GV+       + E +
Sbjct  107  NAGFEAAILTDASNENSIQVCRIQIKGMTCTSCSTAVESALKAIPGVQKAHVALATEEAQ  166

Query  935  VVFDPEVL  958
            V ++P ++
Sbjct  167  VHYNPNIV  174



>ref|XP_008442022.1| PREDICTED: probable copper-transporting ATPase HMA5 isoform X1 
[Cucumis melo]
Length=981

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 122/220 (55%), Gaps = 13/220 (6%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+AC+ SVE A+  L G+ +A V +L  KA V F P  V    I  AI DAGFEA
Sbjct  53    VTGMTCSACAGSVEKAIKRLPGIREAVVGVLNAKARVQFYPSFVNVDQICEAINDAGFEA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              V+        N +     +  + GMTC +C  ++E  L ++ GV+ A VALAT   E+ 
Sbjct  113   SVV--------NDDMIERCRIRVIGMTCTSCSTTLESTLLAIGGVQNAQVALATEEAEIC  164

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD---KIILGVVGISGQMDMQLLEGILSKLH  889
             YDP +++ N ++ AIED+GFE  L+  S +D   KI L V G+  +  M+L+   L  L 
Sbjct  165   YDPRILNYNQLLQAIEDSGFEAILI--STEDDVSKIQLHVEGVRTESSMRLIGSSLEALP  222

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             GV     +P + +L + + P V G R+V+  I     G++
Sbjct  223   GVLGIDIDPAANKLSLSYKPNVTGPRNVIQVIESTGSGRY  262


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 78/147 (53%), Gaps = 9/147 (6%)
 Frame = +2

Query  338  LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
            + R ++RV GMTC +CST++E  L+++ GV  A VAL   +A++ +DP ++    +  AI
Sbjct  120  IERCRIRVIGMTCTSCSTTLESTLLAIGGVQNAQVALATEEAEICYDPRILNYNQLLQAI  179

Query  518  EDAGFEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
            ED+GFEA ++        +T   VS  Q  + G+   + +  +   L +LPGV    +  
Sbjct  180  EDSGFEAILI--------STEDDVSKIQLHVEGVRTESSMRLIGSSLEALPGVLGIDIDP  231

Query  695  ATSVGEVEYDPTVISKNDIVNAIEDAG  775
            A +   + Y P V    +++  IE  G
Sbjct  232  AANKLSLSYKPNVTGPRNVIQVIESTG  258


 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 70/129 (54%), Gaps = 0/129 (0%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  +   V++ P+ ++ + I  AI DAGF
Sbjct  51   FSVTGMTCSACAGSVEKAIKRLPGIREAVVGVLNAKARVQFYPSFVNVDQICEAINDAGF  110

Query  779  EGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVL  958
            E S++     ++  + V+G++       LE  L  + GV++      + E E+ +DP +L
Sbjct  111  EASVVNDDMIERCRIRVIGMTCTSCSTTLESTLLAIGGVQNAQVALATEEAEICYDPRIL  170

Query  959  GSRSVVDGI  985
                ++  I
Sbjct  171  NYNQLLQAI  179



>ref|XP_008442023.1| PREDICTED: probable copper-transporting ATPase HMA5 isoform X2 
[Cucumis melo]
Length=976

 Score =   133 bits (334),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 122/220 (55%), Gaps = 13/220 (6%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+AC+ SVE A+  L G+ +A V +L  KA V F P  V    I  AI DAGFEA
Sbjct  53    VTGMTCSACAGSVEKAIKRLPGIREAVVGVLNAKARVQFYPSFVNVDQICEAINDAGFEA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              V+        N +     +  + GMTC +C  ++E  L ++ GV+ A VALAT   E+ 
Sbjct  113   SVV--------NDDMIERCRIRVIGMTCTSCSTTLESTLLAIGGVQNAQVALATEEAEIC  164

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD---KIILGVVGISGQMDMQLLEGILSKLH  889
             YDP +++ N ++ AIED+GFE  L+  S +D   KI L V G+  +  M+L+   L  L 
Sbjct  165   YDPRILNYNQLLQAIEDSGFEAILI--STEDDVSKIQLHVEGVRTESSMRLIGSSLEALP  222

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             GV     +P + +L + + P V G R+V+  I     G++
Sbjct  223   GVLGIDIDPAANKLSLSYKPNVTGPRNVIQVIESTGSGRY  262


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 78/147 (53%), Gaps = 9/147 (6%)
 Frame = +2

Query  338  LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
            + R ++RV GMTC +CST++E  L+++ GV  A VAL   +A++ +DP ++    +  AI
Sbjct  120  IERCRIRVIGMTCTSCSTTLESTLLAIGGVQNAQVALATEEAEICYDPRILNYNQLLQAI  179

Query  518  EDAGFEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
            ED+GFEA ++        +T   VS  Q  + G+   + +  +   L +LPGV    +  
Sbjct  180  EDSGFEAILI--------STEDDVSKIQLHVEGVRTESSMRLIGSSLEALPGVLGIDIDP  231

Query  695  ATSVGEVEYDPTVISKNDIVNAIEDAG  775
            A +   + Y P V    +++  IE  G
Sbjct  232  AANKLSLSYKPNVTGPRNVIQVIESTG  258


 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 70/129 (54%), Gaps = 0/129 (0%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  +   V++ P+ ++ + I  AI DAGF
Sbjct  51   FSVTGMTCSACAGSVEKAIKRLPGIREAVVGVLNAKARVQFYPSFVNVDQICEAINDAGF  110

Query  779  EGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVL  958
            E S++     ++  + V+G++       LE  L  + GV++      + E E+ +DP +L
Sbjct  111  EASVVNDDMIERCRIRVIGMTCTSCSTTLESTLLAIGGVQNAQVALATEEAEICYDPRIL  170

Query  959  GSRSVVDGI  985
                ++  I
Sbjct  171  NYNQLLQAI  179



>ref|XP_007210396.1| hypothetical protein PRUPE_ppa000896mg [Prunus persica]
 gb|EMJ11595.1| hypothetical protein PRUPE_ppa000896mg [Prunus persica]
Length=968

 Score =   132 bits (333),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 126/219 (58%), Gaps = 7/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ S+E A+  L G+ +A+V +L N A V++ P  V ++ I   IED GFEA
Sbjct  36    VAGMTCSACAGSIEKAVKRLPGIREAAVDVLNNTAHVLYYPSFVTEEKICETIEDVGFEA  95

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E  +  +     +S    I GMTC +C +++E  L ++ GV+RA VALAT   +V 
Sbjct  96    KLIKEETSDKSRQVCRIS----ISGMTCTSCSSTIESALQAIHGVQRAQVALATEEAQVH  151

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP ++S N ++  +E+ GFE +L+ S  +D  KI L V GI  +  ++ +   L  L G
Sbjct  152   YDPKIVSYNQLLETVENTGFEATLI-SLGEDISKIELKVDGIKTEQSIRAIAKSLEALPG  210

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             +++    P   ++ + +  +++G R+ ++ I       F
Sbjct  211   IQNIETFPELNKISISYKADIVGPRTFIEVIESSGSAHF  249


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 72/148 (49%), Gaps = 4/148 (3%)
 Frame = +2

Query  554  PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
            P A+       V   F + GMTC+AC  S+E  +  LPG++ A V +  +   V Y P+ 
Sbjct  19   PEAATNVKGSEVKALFSVAGMTCSACAGSIEKAVKRLPGIREAAVDVLNNTAHVLYYPSF  78

Query  734  ISKNDIVNAIEDAGFEGSLMQSSAQDK----IILGVVGISGQMDMQLLEGILSKLHGVRH  901
            +++  I   IED GFE  L++    DK      + + G++       +E  L  +HGV+ 
Sbjct  79   VTEEKICETIEDVGFEAKLIKEETSDKSRQVCRISISGMTCTSCSSTIESALQAIHGVQR  138

Query  902  FFYNPTSRELEVVFDPEVLGSRSVVDGI  985
                  + E +V +DP+++    +++ +
Sbjct  139  AQVALATEEAQVHYDPKIVSYNQLLETV  166


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 78/154 (51%), Gaps = 9/154 (6%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            EE S ++ +  ++ ++GMTC +CS+++E AL +++GV +A VAL   +A V +DP +V  
Sbjct  100  EETSDKSRQVCRISISGMTCTSCSSTIESALQAIHGVQRAQVALATEEAQVHYDPKIVSY  159

Query  497  KDIENAIEDAGFEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPGV  673
              +   +E+ GFEA ++        +    +S  +  + G+     + ++   L +LPG+
Sbjct  160  NQLLETVENTGFEATLI--------SLGEDISKIELKVDGIKTEQSIRAIAKSLEALPGI  211

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +        +   + Y   ++     +  IE +G
Sbjct  212  QNIETFPELNKISISYKADIVGPRTFIEVIESSG  245



>ref|XP_008383979.1| PREDICTED: probable copper-transporting ATPase HMA5 [Malus domestica]
 ref|XP_008383980.1| PREDICTED: probable copper-transporting ATPase HMA5 [Malus domestica]
Length=986

 Score =   132 bits (333),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 123/218 (56%), Gaps = 5/218 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P+ +  ++I   IED GF+A
Sbjct  53    VMGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPNFISAENIRETIEDVGFQA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              ++ +      N    +  +  I GMTC +C  +VE  L ++ GV++A VALAT   +V 
Sbjct  113   TLIND----EGNDKSILICRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVH  168

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YDP V+S N ++  IED GFEG L+ +     +I L V G+     M++L   L  L GV
Sbjct  169   YDPKVVSYNQLLQTIEDTGFEGILITAGEDMSRIELEVDGVRTDRSMRILGQSLQALPGV  228

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             +   ++   +++ V +  ++ G RS ++ I      +F
Sbjct  229   QTIDFDSEIKKIAVSYKSDMTGPRSFINVIETTGSRRF  266


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 69/133 (52%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  +  +V + P  IS  +I   IED GF
Sbjct  51   FSVMGMTCSACAGSVEKAVKRLPGIREAVVDVLNNRAQVMFFPNFISAENIRETIEDVGF  110

Query  779  EGSLMQSSAQDKIIL----GVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            + +L+     DK IL     + G++       +E  L  +HGV+       + E +V +D
Sbjct  111  QATLINDEGNDKSILICRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVHYD  170

Query  947  PEVLGSRSVVDGI  985
            P+V+    ++  I
Sbjct  171  PKVVSYNQLLQTI  183


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            ++E + +++   ++R+ GMTC +CST+VE AL +++GV KA VAL   +ADV +DP VV 
Sbjct  116  NDEGNDKSILICRIRIKGMTCTSCSTTVESALQAVHGVQKAQVALATEEADVHYDPKVVS  175

Query  494  DKDIENAIEDAGFE  535
               +   IED GFE
Sbjct  176  YNQLLQTIEDTGFE  189



>ref|XP_003580298.1| PREDICTED: probable copper-transporting ATPase HMA5 isoform X1 
[Brachypodium distachyon]
Length=999

 Score =   132 bits (332),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 124/222 (56%), Gaps = 5/222 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+ +A+V +L  +A V F P  V ++ I+  IEDAGF A
Sbjct  70    VSGMTCAACAGSVEKAVKRLPGIHEAAVDVLGGRAQVAFYPASVSEEKIKETIEDAGFGA  129

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GMTC +C ++VE  L  +PGV+RA VALA    E+ 
Sbjct  130   KLIDE----EVKEKSILVCRLHIKGMTCTSCASTVESALQVVPGVQRASVALAIEEAEIR  185

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  VIS   +++A+E+ GFE  L+ +   Q +I L V GI  +  + +++  +  L GV
Sbjct  186   YDRRVISATQLIHAVEETGFEAILVTTGEDQSRIDLKVHGILDERSIMIVKSSVQALPGV  245

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHV  1021
                  +    +L + + P+  G R +++ I   + G  T+ +
Sbjct  246   EDIKVDTELHKLTISYKPDQTGPRDLIEVIESATSGHVTVSI  287



>ref|XP_010430438.1| PREDICTED: probable copper-transporting ATPase HMA5 [Camelina 
sativa]
Length=998

 Score =   132 bits (332),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 136/236 (58%), Gaps = 14/236 (6%)
 Frame = +2

Query  332   ENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIEN  511
             E + R   +V GMTC+AC+ SVE A+  L+G+ +A +  L N+A ++F P++V  + I  
Sbjct  51    EEISRAIFQVLGMTCSACAGSVEKAIKRLSGIHEAVIDALNNRAQILFYPNLVDVETIRE  110

Query  512   AIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVA  691
              IEDAGFEA ++     + AN       +  I GMTC +C +++E +L S+ GV+RA VA
Sbjct  111   TIEDAGFEASLI----ENEANERSRQVCRIRISGMTCTSCSSTIERVLQSVNGVQRAHVA  166

Query  692   LATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLL  865
             LA    E+ YDP ++S + ++  IE AGFE  L+ S+ +D  KI L + G      M+++
Sbjct  167   LAIEEAEIHYDPRLLSCDRLLEEIESAGFEAVLI-STGEDVSKIDLKIDGEFTDESMEII  225

Query  866   EGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRS---VVDGINGGSGGKFTLHVK  1024
             E  L  L GV+    +  + ++ V++ P+V G R+   V++ I  G  G    H+K
Sbjct  226   ERSLEALPGVQSVEISHGTDKISVLYRPDVTGPRNFIQVIESIVFGHSG----HIK  277



>ref|XP_010913948.1| PREDICTED: probable copper-transporting ATPase HMA5 [Elaeis guineensis]
Length=970

 Score =   132 bits (331),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/257 (32%), Positives = 132/257 (51%), Gaps = 14/257 (5%)
 Frame = +2

Query  305   DSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
             D+     + +N R++  R+ G+ CA+C+ S+E A+ ++ G+   SV+ +Q +A + + P 
Sbjct  19    DAQASPRNEKNTRKVMFRIRGIKCASCAASIESAIGNMKGIESISVSPIQGQAAIRYRPA  78

Query  485   VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
              V  K I+ AIED  +E +   E   S          +  I GM C +C  SVE  L  +
Sbjct  79    FVNAKTIKEAIEDLNYEVDEFPEQEISVC--------RLRIKGMACTSCSESVERALLMV  130

Query  665   PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGIS  841
              GVKRAVV LA    ++ +DP +   + ++ AIEDAGF   L+ S    +K+ L + G+ 
Sbjct  131   NGVKRAVVGLALEEAKIHFDPNITDSDHLIEAIEDAGFGADLISSGDDLNKVHLKLEGLH  190

Query  842   GQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI-NGGSGGKF---  1009
                D  L++  L  + GV H   +P  +++ V +DP++ G RS++  I   G G  F   
Sbjct  191   SPEDAILIQSSLEAIEGVNHVEIDPMGQKVTVAYDPDLTGPRSLIKCIEETGQGPNFFSA  250

Query  1010  TLHVKNPYTRMASRDIE  1060
              LH   P +R   R  E
Sbjct  251   RLHTP-PRSRETERHHE  266



>gb|EYU23488.1| hypothetical protein MIMGU_mgv1a000951mg [Erythranthe guttata]
Length=935

 Score =   132 bits (331),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 125/222 (56%), Gaps = 7/222 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+AC+ SVE A+  L G+  A V  L ++A VVF P  V ++ I   IEDAGFEA
Sbjct  12    VTGMTCSACAASVEKAVKHLPGIKDAVVDALNHRAQVVFSPAFVNEETIRETIEDAGFEA  71

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              +++E      N   T   +  I G++C +C  ++E  LSS+ GV +A+V+L+    EV 
Sbjct  72    RLISEET---INDRSTQVCRIRIQGLSCISCSMTLEYYLSSVHGVTKALVSLSNEKIEVH  128

Query  719   YDPTVISKNDIVNAIEDAGFEGSLM-QSSAQDKIILGVVGI-SGQMDMQLLEGILSKLHG  892
             +DP + + + I+ A+ D GFEG+L+    A   + L + G+   +   +++E  L  L G
Sbjct  129   FDPRISTVDQILEAVRDVGFEGTLITYGGATRSVQLQLEGVLENENSTKIIENSLRSLPG  188

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGI--NGGSGGKFT  1012
             VR   + P  +++ V ++P++ G R  +  I  NG     F+
Sbjct  189   VREVKFEPDRKKMSVTYEPDLKGPRDFIKTIESNGLKAAIFS  230


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 73/141 (52%), Gaps = 15/141 (11%)
 Frame = +2

Query  587  VSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIE  766
            V   F + GMTC+AC  SVE  +  LPG+K AVV       +V + P  +++  I   IE
Sbjct  6    VKALFSVTGMTCSACAASVEKAVKHLPGIKDAVVDALNHRAQVVFSPAFVNEETIRETIE  65

Query  767  DAGFEGSLM-------QSSAQDKI-ILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTS  922
            DAGFE  L+       +S+   +I I G+  IS  M    LE  LS +HGV     + ++
Sbjct  66   DAGFEARLISEETINDRSTQVCRIRIQGLSCISCSMT---LEYYLSSVHGVTKALVSLSN  122

Query  923  RELEVVFDPEVLGSRSVVDGI  985
             ++EV FDP +    S VD I
Sbjct  123  EKIEVHFDPRI----STVDQI  139


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 79/169 (47%), Gaps = 10/169 (6%)
 Frame = +2

Query  290  EVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADV  469
            E RL+   +E  +  + +  ++R+ G++C +CS ++E  L S++GV KA V+L   K +V
Sbjct  70   EARLIS--EETINDRSTQVCRIRIQGLSCISCSMTLEYYLSSVHGVTKALVSLSNEKIEV  127

Query  470  VFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGG-MTCAACVNSVE  646
             FDP +     I  A+ D GFE  ++    A       T S Q  + G +        +E
Sbjct  128  HFDPRISTVDQILEAVRDVGFEGTLITYGGA-------TRSVQLQLEGVLENENSTKIIE  180

Query  647  GILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLM  793
              L SLPGV+            V Y+P +    D +  IE  G + ++ 
Sbjct  181  NSLRSLPGVREVKFEPDRKKMSVTYEPDLKGPRDFIKTIESNGLKAAIF  229



>ref|XP_006586324.1| PREDICTED: probable copper-transporting ATPase HMA5-like [Glycine 
max]
Length=924

 Score =   132 bits (331),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 119/212 (56%), Gaps = 8/212 (4%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            +EE S     +    V GMTC+AC+ SVE A+  L G+ +A V +L N+A V+F P  V 
Sbjct  38   EEEGSSNISSKALFSVVGMTCSACAASVEKAVKRLPGIRQAVVDVLNNRAQVLFYPSFVN  97

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
             K I   IEDAGF+A  + + N +          +  I GMTC +C ++VE  L S+ GV
Sbjct  98   VKTIREVIEDAGFQATFIRDDNETSVQI-----CRIRIQGMTCTSCSSTVESALQSIQGV  152

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQ  847
             +A VALAT   EV Y P V++ N I+ A+ED GF+ +L+ S+ +D  +I L V GI   
Sbjct  153  VKAQVALATEEAEVHYTPNVVTYNQILEAVEDTGFQATLI-STGEDMSRIDLQVEGIRTG  211

Query  848  MDMQLLEGILSKLHGVRHFFYNPTSRELEVVF  943
              M+L+E  L  L GV+    +P   ++  VF
Sbjct  212  RSMRLIENSLQALPGVQGVETHPEFNKVIPVF  243



>ref|XP_009339922.1| PREDICTED: probable copper-transporting ATPase HMA5 [Pyrus x 
bretschneideri]
Length=979

 Score =   132 bits (331),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 139/271 (51%), Gaps = 27/271 (10%)
 Frame = +2

Query  212   MSPSMRDVQM-TATNGNSSEEDFGDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACS  388
             MSP  R   M     G S E    +  EV+ L S                V G+TC+AC+
Sbjct  12    MSPRPRYPSMHKHPKGTSPEARHVNGSEVKALFS----------------VVGITCSACA  55

Query  389   TSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASH  568
              S+E A+  L+G+ +A+V +L N A V++ P +V ++ I   +EDAGFEA+++ E     
Sbjct  56    GSIEKAVKRLSGIREAAVDVLNNTAHVLYYPSLVTEEKIRETMEDAGFEAKLIKE-----  110

Query  569   ANTNGTVSG--QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISK  742
                NG +    +  I GMTC +C ++VE  L ++ GV+RA VALAT   EV YDP ++S 
Sbjct  111   ETINGKLRQVCRISINGMTCTSCSSTVESALQAVHGVQRAQVALATEEAEVHYDPKIVSY  170

Query  743   NDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNP  916
             N +   +E+ GFE  L+ S   D  KI L V GI  +  ++ +   L  L GV+     P
Sbjct  171   NQLSEIVENTGFEAKLI-SLGDDISKIELKVDGIKTEQSIRAITKSLEALPGVQDIETFP  229

Query  917   TSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                ++ V +  +V+G R+ ++ I       F
Sbjct  230   ELNKISVCYKQDVIGPRTFIEVIESSGSAHF  260



>ref|XP_002269758.2| PREDICTED: probable copper-transporting ATPase HMA5 [Vitis vinifera]
Length=965

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 120/231 (52%), Gaps = 4/231 (2%)
 Frame = +2

Query  317   EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
             EEN+  +  +    VTGMTC+ACS  VE AL  L G+  A V  L N+A V F P ++ +
Sbjct  22    EENAEGSQAKAMYSVTGMTCSACSGQVERALRQLPGIQDAVVDALSNRAQVTFYPALINE  81

Query  497   KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
             + I   IED G++A ++ +      N   T   +  I G+ C +C  +VE  L +L GV 
Sbjct  82    ETIRETIEDVGYQATLIQD---HQTNAKSTQMCRIRINGI-CTSCSTAVESALQALRGVL  137

Query  677   RAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDM  856
              A VA A    +V YDP ++S  +++ AIED G    L+ +    K+ L V G+     M
Sbjct  138   MAQVASADEEAQVHYDPKMVSYKELLEAIEDTGSVAILITTGYMSKLQLKVDGVCTDHSM  197

Query  857   QLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             +L+E  L  L GV+    +PT  +  V + P+V G R+ +  I     G++
Sbjct  198   RLIENSLRSLPGVQDIVIDPTLNKFSVSYKPDVTGPRNFIQVIESTGSGRY  248



>ref|XP_010676475.1| PREDICTED: probable copper-transporting ATPase HMA5 [Beta vulgaris 
subsp. vulgaris]
Length=999

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 137/263 (52%), Gaps = 16/263 (6%)
 Frame = +2

Query  257   NSSEEDFGDCEEVRLLDSYDEENSGENLRRIQ-----VRVTGMTCAACSTSVEGALMSLN  421
             NSS  D         +  Y +  S   + +++       V GMTC+AC+ SVE A+  L 
Sbjct  28    NSSRSDLSQRAHYPSMPKYPKGVSMSKIEKMEESKALFSVMGMTCSACAASVEKAIKRLP  87

Query  422   GVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQF  601
             G+ +A V +L N+A V+F P     + I   I DAGFEA ++ +  ++ +N    V    
Sbjct  88    GIQEAIVDVLNNRAQVIFYPSFANVELILETIVDAGFEATLIDDDISNGSNQVCRVQ---  144

Query  602   MIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFE  781
              I GMTC  C N+VE  L  + GVK+A VALAT   E+ YDP V++ N+++ A+ED GFE
Sbjct  145   -IRGMTCTTCANAVEASLLGVHGVKKAQVALATEEAEIHYDPKVVTYNELLEAVEDTGFE  203

Query  782   GSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEV  955
               L+ S+ +D  K+ L V G+      +++E  L  L GV     +    ++ V +  ++
Sbjct  204   AVLI-STGEDRCKVQLKVDGVRTDHSWRMIESSLEALPGVETINTDAKLEKVSVSYKSDI  262

Query  956   LGSRSVVDGINGGSGGKFTLHVK  1024
              G RS+++ I     G    H+K
Sbjct  263   TGPRSIIEVIESIGPG----HIK  281



>ref|XP_010473581.1| PREDICTED: probable copper-transporting ATPase HMA5 [Camelina 
sativa]
Length=997

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 130/220 (59%), Gaps = 7/220 (3%)
 Frame = +2

Query  332  ENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIEN  511
            E + R   +V GMTC+AC+ SVE A+  ++G+ +A +  L N+A ++F P++V  + I  
Sbjct  50   EEISRAIFQVLGMTCSACAGSVEKAIKRVSGIHEAVIDALNNRAQILFYPNLVDVETIRE  109

Query  512  AIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVA  691
             IEDAGFEA ++     + AN       +  I GMTC +C +++E +L S+ GV+RA VA
Sbjct  110  TIEDAGFEASLIE----NEANERSRQVCRIRISGMTCTSCSSTIERVLQSVNGVQRAHVA  165

Query  692  LATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLL  865
            LA    E+ YDP ++S + ++  IE+AGFE  L+ S+ +D  KI L + G      M+++
Sbjct  166  LAIEEAEIHYDPRLLSYDRLLEEIENAGFEAVLI-STGEDVSKIDLKIDGEFTDESMEII  224

Query  866  EGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            E  L  L GV+    +  + ++ V++ P+V G R+ +  I
Sbjct  225  ERSLEALPGVQSVEISHGTDKISVLYRPDVTGPRNFIQVI  264


 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 82/158 (52%), Gaps = 8/158 (5%)
 Frame = +2

Query  308  SYDEENSGENLRRI-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
            S  E  + E  R++ ++R++GMTC +CS+++E  L S+NGV +A VAL   +A++ +DP 
Sbjct  119  SLIENEANERSRQVCRIRISGMTCTSCSSTIERVLQSVNGVQRAHVALAIEEAEIHYDPR  178

Query  485  VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
            ++    +   IE+AGFEA VL       +  +  + G+F    M        +E  L +L
Sbjct  179  LLSYDRLLEEIENAGFEA-VLISTGEDVSKIDLKIDGEFTDESMEI------IERSLEAL  231

Query  665  PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            PGV+   ++  T    V Y P V    + +  IE   F
Sbjct  232  PGVQSVEISHGTDKISVLYRPDVTGPRNFIQVIESTVF  269



>ref|XP_008238861.1| PREDICTED: probable copper-transporting ATPase HMA5 [Prunus mume]
Length=986

 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 126/219 (58%), Gaps = 7/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ S+E A+  L G+ +A+V +L N A V++ P  V ++ I   IED GFEA
Sbjct  55    VVGMTCSACAGSIEKAVKRLPGIREAAVDVLNNTAHVLYYPSFVTEEKICETIEDVGFEA  114

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E  +  +     +S    I GMTC +C ++VE  L ++ GV+RA VALAT   +V 
Sbjct  115   KLIKEETSDKSRQVCRIS----ISGMTCTSCSSTVESALQAIHGVQRAQVALATEEAQVH  170

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP ++S N ++  +++ GFE +L+ S  +D  KI L V GI  +  ++ +   L  + G
Sbjct  171   YDPKIVSYNQLLETVKNTGFEATLI-SLGEDISKIELKVDGIKTEQSIRAIAKSLEAIPG  229

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V++    P   ++ + +  +++G R+ ++ I       F
Sbjct  230   VQNLETFPELNKISISYKADIVGPRTFIEVIESSGSAHF  268


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 72/149 (48%), Gaps = 4/149 (3%)
 Frame = +2

Query  554  PNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTV  733
            P A+       V   F + GMTC+AC  S+E  +  LPG++ A V +  +   V Y P+ 
Sbjct  38   PEAATNVKGSEVKALFSVVGMTCSACAGSIEKAVKRLPGIREAAVDVLNNTAHVLYYPSF  97

Query  734  ISKNDIVNAIEDAGFEGSLMQSSAQDK----IILGVVGISGQMDMQLLEGILSKLHGVRH  901
            +++  I   IED GFE  L++    DK      + + G++       +E  L  +HGV+ 
Sbjct  98   VTEEKICETIEDVGFEAKLIKEETSDKSRQVCRISISGMTCTSCSSTVESALQAIHGVQR  157

Query  902  FFYNPTSRELEVVFDPEVLGSRSVVDGIN  988
                  + E +V +DP+++    +++ + 
Sbjct  158  AQVALATEEAQVHYDPKIVSYNQLLETVK  186


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 78/154 (51%), Gaps = 9/154 (6%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            EE S ++ +  ++ ++GMTC +CS++VE AL +++GV +A VAL   +A V +DP +V  
Sbjct  119  EETSDKSRQVCRISISGMTCTSCSSTVESALQAIHGVQRAQVALATEEAQVHYDPKIVSY  178

Query  497  KDIENAIEDAGFEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPGV  673
              +   +++ GFEA ++        +    +S  +  + G+     + ++   L ++PGV
Sbjct  179  NQLLETVKNTGFEATLI--------SLGEDISKIELKVDGIKTEQSIRAIAKSLEAIPGV  230

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +        +   + Y   ++     +  IE +G
Sbjct  231  QNLETFPELNKISISYKADIVGPRTFIEVIESSG  264



>ref|XP_011653459.1| PREDICTED: probable copper-transporting ATPase HMA5 [Cucumis 
sativus]
 gb|KGN53909.1| hypothetical protein Csa_4G188370 [Cucumis sativus]
Length=981

 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 121/219 (55%), Gaps = 11/219 (5%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+AC+ SVE A+  L G+ +A V +L  KA V F P  V    I  AI DAGFEA
Sbjct  53    VTGMTCSACAGSVEKAIKRLPGIREAVVGVLNAKARVQFYPSFVNVDQICEAINDAGFEA  112

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              V+        N +     +  + GMTC +C  ++E  L ++ GV+ A VALAT   E+ 
Sbjct  113   SVV--------NDDMIERCRIRVIGMTCTSCSTTLESTLLAIGGVQNAQVALATEEAEIC  164

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
             YDP +++ N ++ AIED+GFE  L+ S+ +D  KI L V G+  +  M+L+   L  L G
Sbjct  165   YDPRILNYNQLLQAIEDSGFEAILI-STEEDVSKIQLHVEGVRTENSMRLIGSSLEALPG  223

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V      P   +L + + P + G R+V+  I     G++
Sbjct  224   VLGIDIEPAVNKLSLSYKPNITGPRNVIQVIESTGSGRY  262


 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 77/147 (52%), Gaps = 9/147 (6%)
 Frame = +2

Query  338  LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
            + R ++RV GMTC +CST++E  L+++ GV  A VAL   +A++ +DP ++    +  AI
Sbjct  120  IERCRIRVIGMTCTSCSTTLESTLLAIGGVQNAQVALATEEAEICYDPRILNYNQLLQAI  179

Query  518  EDAGFEAEVLAEPNASHANTNGTVSG-QFMIGGMTCAACVNSVEGILSSLPGVKRAVVAL  694
            ED+GFEA ++        +T   VS  Q  + G+     +  +   L +LPGV    +  
Sbjct  180  EDSGFEAILI--------STEEDVSKIQLHVEGVRTENSMRLIGSSLEALPGVLGIDIEP  231

Query  695  ATSVGEVEYDPTVISKNDIVNAIEDAG  775
            A +   + Y P +    +++  IE  G
Sbjct  232  AVNKLSLSYKPNITGPRNVIQVIESTG  258


 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 70/129 (54%), Gaps = 0/129 (0%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTC+AC  SVE  +  LPG++ AVV +  +   V++ P+ ++ + I  AI DAGF
Sbjct  51   FSVTGMTCSACAGSVEKAIKRLPGIREAVVGVLNAKARVQFYPSFVNVDQICEAINDAGF  110

Query  779  EGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVL  958
            E S++     ++  + V+G++       LE  L  + GV++      + E E+ +DP +L
Sbjct  111  EASVVNDDMIERCRIRVIGMTCTSCSTTLESTLLAIGGVQNAQVALATEEAEICYDPRIL  170

Query  959  GSRSVVDGI  985
                ++  I
Sbjct  171  NYNQLLQAI  179



>gb|AGT16460.1| ATP dependent copper transporter [Saccharum hybrid cultivar R570]
Length=995

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 119/216 (55%), Gaps = 5/216 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V +  I  AIED GFEA
Sbjct  73    VSGMTCAACAGSVEKAVKRLPGIHDAAVDVLWGRAQVVFCPAFVSENKITEAIEDVGFEA  132

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GM C  C ++VE  L + PGV+RA VALAT   EV 
Sbjct  133   KLIDE----EVKEKNILLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEVR  188

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  +IS + ++ A+E  GFE  L+ +   Q +I L + G+  +  + +L   +  L GV
Sbjct  189   YDRRIISASQLIQAVEQTGFEAILVTTGEDQSRIDLKMDGVLDERLIMILTSSVESLPGV  248

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
              +  +N    ++ + + P+  G R +++ I   + G
Sbjct  249   ENIKFNSELHKVTISYKPDQTGPRDLIEVIKSATFG  284


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 66/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG+  A V +     +V + P  +S+N I  AIED GF
Sbjct  71   FSVSGMTCAACAGSVEKAVKRLPGIHDAAVDVLWGRAQVVFCPAFVSENKITEAIEDVGF  130

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E  L+    ++K I    L + G++ +     +E  L    GV+       + E EV +D
Sbjct  131  EAKLIDEEVKEKNILLCRLHIKGMACKYCTSTVEFALQASPGVQRASVALATEEAEVRYD  190

Query  947  PEVLGSRSVVDGI  985
              ++ +  ++  +
Sbjct  191  RRIISASQLIQAV  203



>gb|KFK40512.1| hypothetical protein AALP_AA2G005400 [Arabis alpina]
Length=995

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 126/221 (57%), Gaps = 8/221 (4%)
 Frame = +2

Query  332  ENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIEN  511
            E + R    V GMTC+AC+ SVE A+  L+G+ +A +  L N+A ++F P  V  + I  
Sbjct  47   EPISRAVYSVLGMTCSACAGSVEKAIKRLSGIHEAVIDALNNRAQILFYPKFVDVETIRE  106

Query  512  AIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVA  691
             IEDAGFEA ++     + AN       +  I GMTC +C +++E +L S+ GV+RA VA
Sbjct  107  TIEDAGFEASLIE----NEANERSRQVCRIRINGMTCTSCSSTIERVLQSVYGVERAHVA  162

Query  692  LATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVG-ISGQMDMQL  862
            LA    E+ YDP ++S   ++  IE+AGFE  L+ S+ +D  KI L + G  +    M++
Sbjct  163  LAIEEAEIHYDPRLLSYEKLLEEIENAGFEAVLI-STGEDVSKIDLKIDGEFTDDESMEI  221

Query  863  LEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            +E  L  L GV+    N  S ++ V++ P+V G R  +  I
Sbjct  222  IERSLEALPGVQDVEINHGSDKISVLYKPDVTGPRDFIRVI  262


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 86/176 (49%), Gaps = 14/176 (8%)
 Frame = +2

Query  275  FGDCEEVR-------LLDSYDEENSGENLRRI-QVRVTGMTCAACSTSVEGALMSLNGVV  430
            F D E +R          S  E  + E  R++ ++R+ GMTC +CS+++E  L S+ GV 
Sbjct  98   FVDVETIRETIEDAGFEASLIENEANERSRQVCRIRINGMTCTSCSSTIERVLQSVYGVE  157

Query  431  KASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIG  610
            +A VAL   +A++ +DP ++  + +   IE+AGFEA VL       +  +  + G+F   
Sbjct  158  RAHVALAIEEAEIHYDPRLLSYEKLLEEIENAGFEA-VLISTGEDVSKIDLKIDGEF---  213

Query  611  GMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
              T    +  +E  L +LPGV+   +   +    V Y P V    D +  IE   F
Sbjct  214  --TDDESMEIIERSLEALPGVQDVEINHGSDKISVLYKPDVTGPRDFIRVIESTVF  267


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 68/137 (50%), Gaps = 5/137 (4%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            + + GMTC+AC  SVE  +  L G+  AV+    +  ++ + P  +    I   IEDAGF
Sbjct  54   YSVLGMTCSACAGSVEKAIKRLSGIHEAVIDALNNRAQILFYPKFVDVETIRETIEDAGF  113

Query  779  EGSLMQSSAQDK----IILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E SL+++ A ++      + + G++       +E +L  ++GV          E E+ +D
Sbjct  114  EASLIENEANERSRQVCRIRINGMTCTSCSSTIERVLQSVYGVERAHVALAIEEAEIHYD  173

Query  947  PEVLGSRSVVDGI-NGG  994
            P +L    +++ I N G
Sbjct  174  PRLLSYEKLLEEIENAG  190



>ref|XP_003571259.1| PREDICTED: probable copper-transporting ATPase HMA5 [Brachypodium 
distachyon]
 ref|XP_010233977.1| PREDICTED: probable copper-transporting ATPase HMA5 [Brachypodium 
distachyon]
Length=981

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/217 (34%), Positives = 120/217 (55%), Gaps = 9/217 (4%)
 Frame = +2

Query  341  RRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE  520
            R++   V G++CA+C+ S+E  +  L GV    V++LQ +A V + P     K I+ AIE
Sbjct  37   RKVMFNVRGISCASCAVSIETVVAGLKGVESVQVSVLQGQAVVQYSPEETDAKTIKEAIE  96

Query  521  DAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
            D  FE + L E   +          +  I GM C +C  S+E  L  +PGVK+AVV LA 
Sbjct  97   DINFEVDELQEQEIAVC--------RLRIKGMACTSCSESIERALLMVPGVKKAVVGLAL  148

Query  701  SVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGIL  877
               +V +DP + S++ I+ AIEDAGF   L+ S    +K+ L + G+S   D +L++ +L
Sbjct  149  EEAKVHFDPNITSRDLIIEAIEDAGFGADLISSGDDVNKMHLQLEGVSSPEDTKLIQSVL  208

Query  878  SKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGIN  988
              + GV +  ++   + ++V +DP++ G R ++  I 
Sbjct  209  ETVEGVNNVEWDTVGQTIKVAYDPDITGPRLLIQRIQ  245


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 76/164 (46%), Gaps = 18/164 (11%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            ++R+ GM C +CS S+E AL+ + GV KA V L   +A V FDP++     I  AIEDAG
Sbjct  114  RLRIKGMACTSCSESIERALLMVPGVKKAVVGLALEEAKVHFDPNITSRDLIIEAIEDAG  173

Query  530  FEAEVLA---EPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
            F A++++   + N  H    G  S +              ++ +L ++ GV         
Sbjct  174  FGADLISSGDDVNKMHLQLEGVSSPE----------DTKLIQSVLETVEGVNNVEWDTVG  223

Query  701  SVGEVEYDPTVISKNDIVNAIEDAG-----FEGSLMQSSAQDKI  817
               +V YDP +     ++  I++A      +  SL     Q ++
Sbjct  224  QTIKVAYDPDITGPRLLIQRIQEAAQPPKCYNASLYSPPKQREV  267



>ref|XP_010055623.1| PREDICTED: probable copper-transporting ATPase HMA5 [Eucalyptus 
grandis]
 gb|KCW72134.1| hypothetical protein EUGRSUZ_E00578 [Eucalyptus grandis]
Length=986

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 125/224 (56%), Gaps = 7/224 (3%)
 Frame = +2

Query  344   RIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
             R  + V GMTC+AC+ SVE A+  L G+ +A V +L  +A V++ P  V ++ I   I+D
Sbjct  48    RALLSVVGMTCSACAGSVEKAVKRLPGIREAVVDVLNGRAQVLYYPSFVNEETIRETIDD  107

Query  524   AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
              GF+A ++ +      N   T   +  I GMTC +C ++VE  L ++ GV++A VALAT 
Sbjct  108   VGFQATLIED----ETNQRTTQVCRIRINGMTCTSCSSTVESALQAVQGVQKAQVALATE  163

Query  704   VGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGIL  877
               +V+YDP V + + ++  IED GFE  L+ S+ +D   I L V G+     M++L   L
Sbjct  164   EAQVQYDPRVTNLDLLLKTIEDTGFEAVLV-STGEDVSNIHLKVDGVRTDHSMRILVNSL  222

Query  878   SKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
               L GV     +P   +  + + P+++G RS ++ I     G+F
Sbjct  223   QALPGVEDVTTDPEVCKFTLSYKPDLMGPRSFIEVIESTGSGRF  266


 Score = 70.9 bits (172),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 73/154 (47%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            ++E +    +  ++R+ GMTC +CS++VE AL ++ GV KA VAL   +A V +DP V  
Sbjct  116  EDETNQRTTQVCRIRINGMTCTSCSSTVESALQAVQGVQKAQVALATEEAQVQYDPRVTN  175

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               +   IED GFEA VL       +N +  V G      M     VNS    L +LPGV
Sbjct  176  LDLLLKTIEDTGFEA-VLVSTGEDVSNIHLKVDGVRTDHSMRI--LVNS----LQALPGV  228

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +            + Y P ++     +  IE  G
Sbjct  229  EDVTTDPEVCKFTLSYKPDLMGPRSFIEVIESTG  262



>ref|XP_008645432.1| PREDICTED: probable copper-transporting ATPase HMA5 [Zea mays]
Length=980

 Score =   130 bits (327),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 127/245 (52%), Gaps = 14/245 (6%)
 Frame = +2

Query  341   RRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE  520
             R++   V G++CA+C+ S+E  +  LNGV    V+ LQ +A V + P     + I+ AIE
Sbjct  40    RKVLFSVRGISCASCAVSIETVVAGLNGVESIQVSSLQGQAVVQYRPEETDARTIKEAIE  99

Query  521   DAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
             D  FE + L E   +          +  I GM C +C  SVE  L  +PGVK+A V LA 
Sbjct  100   DLNFEVDELQEQEIAVC--------RLRIKGMACTSCSESVERALQMVPGVKKAAVGLAL  151

Query  701   SVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGIL  877
                +V YDP V S++ I+ A+EDAGF   L+ S    +K+ L + G++   D  L++ +L
Sbjct  152   EEAKVHYDPNVTSRDRIIEAVEDAGFGADLISSGDDVNKVHLKLEGVNSPEDTILIQSVL  211

Query  878   SKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGK----FTLHVKNPYTRMA  1045
               + GV +  ++   + +EV +DP+  G R ++  I   +        TLH   P  R A
Sbjct  212   EAVEGVNNVEWDTVEQTIEVAYDPDFTGPRLLIQCIQDTAQPPKCFNVTLH-SPPKQREA  270

Query  1046  SRDIE  1060
              R+ E
Sbjct  271   ERNHE  275



>gb|AFW70752.1| hypothetical protein ZEAMMB73_147775 [Zea mays]
Length=974

 Score =   130 bits (327),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 127/245 (52%), Gaps = 14/245 (6%)
 Frame = +2

Query  341   RRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE  520
             R++   V G++CA+C+ S+E  +  LNGV    V+ LQ +A V + P     + I+ AIE
Sbjct  34    RKVLFSVRGISCASCAVSIETVVAGLNGVESIQVSSLQGQAVVQYRPEETDARTIKEAIE  93

Query  521   DAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
             D  FE + L E   +          +  I GM C +C  SVE  L  +PGVK+A V LA 
Sbjct  94    DLNFEVDELQEQEIAVC--------RLRIKGMACTSCSESVERALQMVPGVKKAAVGLAL  145

Query  701   SVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLEGIL  877
                +V YDP V S++ I+ A+EDAGF   L+ S    +K+ L + G++   D  L++ +L
Sbjct  146   EEAKVHYDPNVTSRDRIIEAVEDAGFGADLISSGDDVNKVHLKLEGVNSPEDTILIQSVL  205

Query  878   SKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGK----FTLHVKNPYTRMA  1045
               + GV +  ++   + +EV +DP+  G R ++  I   +        TLH   P  R A
Sbjct  206   EAVEGVNNVEWDTVEQTIEVAYDPDFTGPRLLIQCIQDTAQPPKCFNVTLH-SPPKQREA  264

Query  1046  SRDIE  1060
              R+ E
Sbjct  265   ERNHE  269



>ref|XP_003611105.1| Heavy metal P-type ATPase [Medicago truncatula]
Length=703

 Score =   129 bits (324),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 123/217 (57%), Gaps = 6/217 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE ++  L+G+ +A V +L N+A V+F P  V ++ I  AIEDAGF+A
Sbjct  52    VHGMTCSACAGSVEKSIKRLHGIHEAVVDVLHNRARVIFHPSFVNEEAICEAIEDAGFDA  111

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              +L +      N N     +  I GMTC +C  +VE  L +L GV  A VALAT   +V 
Sbjct  112   ALLTDVT----NENTIQVCRIQIKGMTCTSCSTAVESALKALSGVVGAQVALATEEAQVH  167

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDM-QLLEGILSKLHG  892
             Y+P +I+ + I+ A+++AGFE +L+ SS    KI L V G     DM +L+E  L  L G
Sbjct  168   YNPNIITHSQILEAVDEAGFEATLISSSEDLSKIDLHVEGDLTNNDMIKLVEDSLRSLPG  227

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
             V     N    ++ + +  ++ G R  ++ I   S G
Sbjct  228   VLELHTNLEFNKISLSYKADITGPRDFINVIVETSNG  264


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 81/155 (52%), Gaps = 9/155 (6%)
 Frame = +2

Query  299  LLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFD  478
            LL     EN+ + + RIQ++  GMTC +CST+VE AL +L+GVV A VAL   +A V ++
Sbjct  113  LLTDVTNENTIQ-VCRIQIK--GMTCTSCSTAVESALKALSGVVGAQVALATEEAQVHYN  169

Query  479  PHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILS  658
            P+++    I  A+++AGFEA +++  +   +  +  V G      M     +  VE  L 
Sbjct  170  PNIITHSQILEAVDEAGFEATLISS-SEDLSKIDLHVEGDLTNNDM-----IKLVEDSLR  223

Query  659  SLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAI  763
            SLPGV      L  +   + Y   +    D +N I
Sbjct  224  SLPGVLELHTNLEFNKISLSYKADITGPRDFINVI  258


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 73/151 (48%), Gaps = 4/151 (3%)
 Frame = +2

Query  548  AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
            +EP  S       V+  F + GMTC+AC  SVE  +  L G+  AVV +  +   V + P
Sbjct  33   SEPGTSTVEEPSKVTALFSVHGMTCSACAGSVEKSIKRLHGIHEAVVDVLHNRARVIFHP  92

Query  728  TVISKNDIVNAIEDAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGV  895
            + +++  I  AIEDAGF+ +L+     +  I    + + G++       +E  L  L GV
Sbjct  93   SFVNEEAICEAIEDAGFDAALLTDVTNENTIQVCRIQIKGMTCTSCSTAVESALKALSGV  152

Query  896  RHFFYNPTSRELEVVFDPEVLGSRSVVDGIN  988
                    + E +V ++P ++    +++ ++
Sbjct  153  VGAQVALATEEAQVHYNPNIITHSQILEAVD  183



>ref|XP_002887959.1| hypothetical protein ARALYDRAFT_475008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64218.1| hypothetical protein ARALYDRAFT_475008 [Arabidopsis lyrata subsp. 
lyrata]
Length=973

 Score =   130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 126/218 (58%), Gaps = 7/218 (3%)
 Frame = +2

Query  338  LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
            + R   +V GMTC+AC+ SVE A+  L G+ +A +  L N+A ++F P  V  + I   I
Sbjct  49   ISRAVFQVLGMTCSACAGSVEKAIKRLPGIHEAVIDALNNRAQILFYPKSVHVETIRETI  108

Query  518  EDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALA  697
            EDAGFEA ++     + AN       +  I GMTC +C +++E +L S+ GV+RA VALA
Sbjct  109  EDAGFEASLIE----NEANERSKQVCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVALA  164

Query  698  TSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEG  871
                E+ YDP ++S + ++  IE+AGFE  L+ S+ +D  KI L + G      M+++E 
Sbjct  165  IEEAEIHYDPRLLSYDKLLEEIENAGFEAVLI-STGEDVSKIDLKIDGEFTDESMEIIER  223

Query  872  ILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
             L  L GV+    +  + ++ V++ P+V G R+ +  I
Sbjct  224  SLEALPGVQSVEISHGTDKISVLYKPDVTGPRNFIQVI  261


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 82/163 (50%), Gaps = 10/163 (6%)
 Frame = +2

Query  290  EVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADV  469
            E  L+++   E S +  R   +R+ GMTC +CS+++E  L S+NGV +A VAL   +A++
Sbjct  114  EASLIENEANERSKQVCR---IRINGMTCTSCSSTIERVLQSVNGVQRAHVALAIEEAEI  170

Query  470  VFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEG  649
             +DP ++    +   IE+AGFEA VL       +  +  + G+F    M        +E 
Sbjct  171  HYDPRLLSYDKLLEEIENAGFEA-VLISTGEDVSKIDLKIDGEFTDESMEI------IER  223

Query  650  ILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
             L +LPGV+   ++  T    V Y P V    + +  IE   F
Sbjct  224  SLEALPGVQSVEISHGTDKISVLYKPDVTGPRNFIQVIESTVF  266



>ref|XP_009112946.1| PREDICTED: probable copper-transporting ATPase HMA5 [Brassica 
rapa]
Length=999

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 122/212 (58%), Gaps = 7/212 (3%)
 Frame = +2

Query  356  RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFE  535
            RV GMTC+AC+ S+E  +  L G+ +A +  L N+A + F P  V  + I   IEDAGFE
Sbjct  60   RVIGMTCSACAGSIEKEIKRLPGIHEAVIDALNNRAQIQFYPSSVNVETIRETIEDAGFE  119

Query  536  AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
            A ++     + AN       +  I GMTC +C +++E +L SL GV+RA VALA    EV
Sbjct  120  ASLIE----NEANERSRQVCRIRINGMTCTSCSSTIESVLQSLHGVQRAHVALAIEEAEV  175

Query  716  EYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLH  889
             YDPT++S + ++  I++AGFE  L+ S+ +D  KI L + G      M ++E  L  L 
Sbjct  176  HYDPTLLSCDKLLEEIDNAGFEAVLI-STGEDVSKIDLKIDGEFTDESMMMIEKSLEALP  234

Query  890  GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            GV+    +  S ++ V++ P+V G R+ +  I
Sbjct  235  GVQSVEISHGSDKISVLYKPDVTGPRNFIRVI  266


 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 81/158 (51%), Gaps = 8/158 (5%)
 Frame = +2

Query  308  SYDEENSGENLRRI-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
            S  E  + E  R++ ++R+ GMTC +CS+++E  L SL+GV +A VAL   +A+V +DP 
Sbjct  121  SLIENEANERSRQVCRIRINGMTCTSCSSTIESVLQSLHGVQRAHVALAIEEAEVHYDPT  180

Query  485  VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
            ++    +   I++AGFEA VL       +  +  + G+F    M        +E  L +L
Sbjct  181  LLSCDKLLEEIDNAGFEA-VLISTGEDVSKIDLKIDGEFTDESMMM------IEKSLEAL  233

Query  665  PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            PGV+   ++  +    V Y P V    + +  IE   F
Sbjct  234  PGVQSVEISHGSDKISVLYKPDVTGPRNFIRVIESTVF  271


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 73/137 (53%), Gaps = 4/137 (3%)
 Frame = +2

Query  590  SGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIED  769
            S  F + GMTC+AC  S+E  +  LPG+  AV+    +  ++++ P+ ++   I   IED
Sbjct  56   SAVFRVIGMTCSACAGSIEKEIKRLPGIHEAVIDALNNRAQIQFYPSSVNVETIRETIED  115

Query  770  AGFEGSLMQSSAQDK----IILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEV  937
            AGFE SL+++ A ++      + + G++       +E +L  LHGV+         E EV
Sbjct  116  AGFEASLIENEANERSRQVCRIRINGMTCTSCSSTIESVLQSLHGVQRAHVALAIEEAEV  175

Query  938  VFDPEVLGSRSVVDGIN  988
             +DP +L    +++ I+
Sbjct  176  HYDPTLLSCDKLLEEID  192



>emb|CDY34353.1| BnaA09g10950D [Brassica napus]
Length=1032

 Score =   129 bits (325),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 122/212 (58%), Gaps = 7/212 (3%)
 Frame = +2

Query  356  RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFE  535
            RV GMTC+AC+ S+E  +  L G+ +A +  L N+A + F P  V  + I   IEDAGFE
Sbjct  60   RVIGMTCSACAGSIEKEIKRLPGIHEAVIDALNNRAQIQFYPSSVNVETIRETIEDAGFE  119

Query  536  AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
            A ++     + AN       +  I GMTC +C +++E +L SL GV+RA VALA    EV
Sbjct  120  ASLIE----NEANERSRQVCRIRINGMTCTSCSSTIESVLQSLHGVQRAHVALAIEEAEV  175

Query  716  EYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLH  889
             YDPT++S + ++  I++AGFE  L+ S+ +D  KI L + G      M ++E  L  L 
Sbjct  176  HYDPTLLSCDKLLEEIDNAGFEAVLI-STGEDVSKIDLKIDGEFTDESMMMIEKSLEALP  234

Query  890  GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            GV+    +  S ++ V++ P+V G R+ +  I
Sbjct  235  GVQSVEISHGSDKISVLYKPDVTGPRNFIRVI  266


 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 81/158 (51%), Gaps = 8/158 (5%)
 Frame = +2

Query  308  SYDEENSGENLRRI-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
            S  E  + E  R++ ++R+ GMTC +CS+++E  L SL+GV +A VAL   +A+V +DP 
Sbjct  121  SLIENEANERSRQVCRIRINGMTCTSCSSTIESVLQSLHGVQRAHVALAIEEAEVHYDPT  180

Query  485  VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
            ++    +   I++AGFEA VL       +  +  + G+F    M        +E  L +L
Sbjct  181  LLSCDKLLEEIDNAGFEA-VLISTGEDVSKIDLKIDGEFTDESMMM------IEKSLEAL  233

Query  665  PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            PGV+   ++  +    V Y P V    + +  IE   F
Sbjct  234  PGVQSVEISHGSDKISVLYKPDVTGPRNFIRVIESTVF  271


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 73/137 (53%), Gaps = 4/137 (3%)
 Frame = +2

Query  590  SGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIED  769
            S  F + GMTC+AC  S+E  +  LPG+  AV+    +  ++++ P+ ++   I   IED
Sbjct  56   SAVFRVIGMTCSACAGSIEKEIKRLPGIHEAVIDALNNRAQIQFYPSSVNVETIRETIED  115

Query  770  AGFEGSLMQSSAQDK----IILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEV  937
            AGFE SL+++ A ++      + + G++       +E +L  LHGV+         E EV
Sbjct  116  AGFEASLIENEANERSRQVCRIRINGMTCTSCSSTIESVLQSLHGVQRAHVALAIEEAEV  175

Query  938  VFDPEVLGSRSVVDGIN  988
             +DP +L    +++ I+
Sbjct  176  HYDPTLLSCDKLLEEID  192



>emb|CDY25498.1| BnaC09g11230D [Brassica napus]
Length=1034

 Score =   129 bits (325),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 121/208 (58%), Gaps = 7/208 (3%)
 Frame = +2

Query  359  VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
            VTGMTC+AC+ S+E  +  L G+ +A +  L ++A + F P  V  + I   IEDAGFEA
Sbjct  61   VTGMTCSACAGSIEKEIKRLPGIHEAVIDALNHRAQIQFYPSSVNVETIRETIEDAGFEA  120

Query  539  EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             ++     + AN       +  I GMTC +C +++E +L SL GV+RA VALA    EV 
Sbjct  121  SLIE----NEANERSRQVCRIRINGMTCTSCSSTIESVLQSLNGVQRAHVALAIEEAEVH  176

Query  719  YDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLHG  892
            YDPT++S + ++  IE+AGFE  L+ S+ +D  KI L + G      M ++E  L  L G
Sbjct  177  YDPTLLSYDKLLEEIENAGFEAVLI-STGEDVSKIDLKIDGEFTDESMMMIEKSLEALPG  235

Query  893  VRHFFYNPTSRELEVVFDPEVLGSRSVV  976
            V+    +  S ++ V++ P+V G R+ +
Sbjct  236  VQSVEISHGSDKISVLYKPDVTGPRNFI  263


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 8/158 (5%)
 Frame = +2

Query  308  SYDEENSGENLRRI-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
            S  E  + E  R++ ++R+ GMTC +CS+++E  L SLNGV +A VAL   +A+V +DP 
Sbjct  121  SLIENEANERSRQVCRIRINGMTCTSCSSTIESVLQSLNGVQRAHVALAIEEAEVHYDPT  180

Query  485  VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
            ++    +   IE+AGFEA VL       +  +  + G+F    M        +E  L +L
Sbjct  181  LLSYDKLLEEIENAGFEA-VLISTGEDVSKIDLKIDGEFTDESMMM------IEKSLEAL  233

Query  665  PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            PGV+   ++  +    V Y P V    + +  IE   F
Sbjct  234  PGVQSVEISHGSDKISVLYKPDVTGPRNFIRVIESTVF  271


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 73/140 (52%), Gaps = 5/140 (4%)
 Frame = +2

Query  590  SGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIED  769
            S  F + GMTC+AC  S+E  +  LPG+  AV+       ++++ P+ ++   I   IED
Sbjct  56   SAVFGVTGMTCSACAGSIEKEIKRLPGIHEAVIDALNHRAQIQFYPSSVNVETIRETIED  115

Query  770  AGFEGSLMQSSAQDK----IILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEV  937
            AGFE SL+++ A ++      + + G++       +E +L  L+GV+         E EV
Sbjct  116  AGFEASLIENEANERSRQVCRIRINGMTCTSCSSTIESVLQSLNGVQRAHVALAIEEAEV  175

Query  938  VFDPEVLGSRSVVDGI-NGG  994
             +DP +L    +++ I N G
Sbjct  176  HYDPTLLSYDKLLEEIENAG  195



>ref|XP_009766888.1| PREDICTED: probable copper-transporting ATPase HMA5 [Nicotiana 
sylvestris]
 ref|XP_009766889.1| PREDICTED: probable copper-transporting ATPase HMA5 [Nicotiana 
sylvestris]
 ref|XP_009766890.1| PREDICTED: probable copper-transporting ATPase HMA5 [Nicotiana 
sylvestris]
 ref|XP_009766891.1| PREDICTED: probable copper-transporting ATPase HMA5 [Nicotiana 
sylvestris]
Length=966

 Score =   129 bits (325),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/263 (32%), Positives = 137/263 (52%), Gaps = 12/263 (5%)
 Frame = +2

Query  278   GDCEEVRLLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQN  457
              D   V +    D +N  + +R +  +V G+TCA+CS S+E AL  L G+  A+V+ LQ 
Sbjct  17    ADAVAVNMAQLSDSKN--KKIRTLLFKVNGITCASCSNSIESALGKLKGIESATVSPLQG  74

Query  458   KADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVN  637
             +A V + P ++  K I+ A+ED GFE +   E + +          +  I GM C +C  
Sbjct  75    QAVVKYVPELISAKKIKEAVEDTGFEVDEFPEQDIAIC--------RIRIKGMACTSCSE  126

Query  638   SVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDK  814
             SVE  LS   GVK+AVV L+    +V +DP V S + IV  IEDAGF   ++ S S  +K
Sbjct  127   SVERALSMTDGVKKAVVGLSLEEAKVHFDPNVTSTSRIVEVIEDAGFGADIISSGSDLNK  186

Query  815   IILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGG  994
             +   + GI+   D+ +++  L  L GV     N     + + ++P+++G R+++  I   
Sbjct  187   VHFKLEGINSPDDITVIQCCLEALEGVNTVEINQQEYRVTISYEPDIIGPRTLMHCIQEA  246

Query  995   SGGKFTLHVKNPYTRMASRDIEE  1063
               G  T +  + Y     R++E+
Sbjct  247   GHGSST-YRASLYIPPRQRELEK  268



>gb|EUB56731.1| Copper-transporting ATPase 2 [Echinococcus granulosus]
Length=1548

 Score =   129 bits (325),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 111/185 (60%), Gaps = 3/185 (2%)
 Frame = +2

Query  251  NGNSSEEDFGDCEEVRL--LDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNG  424
            NG ++ +     EEV++  + + D E     L+   +RVTGMTC++C  +VE AL+ L G
Sbjct  359  NGRTTLKSPVLSEEVKVGEMTTIDLEPPIHALKCCHLRVTGMTCSSCVQTVENALLKLPG  418

Query  425  VVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTN-GTVSGQF  601
            V  A+V LL  KAD+++DP +++   +   I + GF A++L    A+  + + GT + + 
Sbjct  419  VRSATVGLLSMKADIIYDPTLIQPSALTRQINELGFSAQILEVRRAAEIHGDEGTQTLEV  478

Query  602  MIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFE  781
             I GMTC++CVNS+E  +  LPGV  A VALAT  G+V +D  ++    I+  IED GF+
Sbjct  479  TILGMTCSSCVNSIETAIKKLPGVTSASVALATKRGKVVFDSRIVGARSILKTIEDMGFD  538

Query  782  GSLMQ  796
             S+ +
Sbjct  539  ASVYK  543


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 71/139 (51%), Gaps = 9/139 (6%)
 Frame = +2

Query  596  QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
               + GMTC++CV +VE  L  LPGV+ A V L +   ++ YDPT+I  + +   I + G
Sbjct  394  HLRVTGMTCSSCVQTVENALLKLPGVRSATVGLLSMKADIIYDPTLIQPSALTRQINELG  453

Query  776  FEGSLMQSSAQDKII---------LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRE  928
            F   +++     +I          + ++G++    +  +E  + KL GV        ++ 
Sbjct  454  FSAQILEVRRAAEIHGDEGTQTLEVTILGMTCSSCVNSIETAIKKLPGVTSASVALATKR  513

Query  929  LEVVFDPEVLGSRSVVDGI  985
             +VVFD  ++G+RS++  I
Sbjct  514  GKVVFDSRIVGARSILKTI  532



>dbj|BAJ93251.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=931

 Score =   129 bits (324),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 123/216 (57%), Gaps = 6/216 (3%)
 Frame = +2

Query  359  VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
            VTGMTCAAC+ SVE A+  L G+  A+V +L  +A V F P  V ++ I   IED GF A
Sbjct  6    VTGMTCAACAGSVEKAVKRLPGIHDAAVDVLGCRAQVAFYPAFVSEEKIRETIEDVGFGA  65

Query  539  EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
            +++ E           +  +  I GMTC +C N+VE  L ++PGV+RA VALA    E+ 
Sbjct  66   KLIDE----ELKEKSILVCRLHIKGMTCTSCANTVESTLQAVPGVQRASVALAIEEAEIR  121

Query  719  YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
            YD  V++   +VNA+E++GFE  L+ +   + +I L V GI  +  + +++  +  L GV
Sbjct  122  YDRRVVAATQLVNAVEESGFEAILVTAGEDRSRIDLKVDGILDETSVMIVKSSVQALPGV  181

Query  896  RHFFYNPTSRELEVVFDPEVLGSRSVVDGI-NGGSG  1000
                 +   +++ + + P+  G R +++ I + GSG
Sbjct  182  EDIKIDTELQKITISYKPDKTGPRDLIEVIESAGSG  217


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 77/154 (50%), Gaps = 7/154 (5%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DEE   +++   ++ + GMTC +C+ +VE  L ++ GV +ASVAL   +A++ +D  VV 
Sbjct  69   DEELKEKSILVCRLHIKGMTCTSCANTVESTLQAVPGVQRASVALAIEEAEIRYDRRVVA  128

Query  494  DKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGV  673
               + NA+E++GFEA +L       +  +        + G+     V  V+  + +LPGV
Sbjct  129  ATQLVNAVEESGFEA-ILVTAGEDRSRID------LKVDGILDETSVMIVKSSVQALPGV  181

Query  674  KRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
            +   +        + Y P      D++  IE AG
Sbjct  182  EDIKIDTELQKITISYKPDKTGPRDLIEVIESAG  215


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 63/133 (47%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG+  A V +     +V + P  +S+  I   IED GF
Sbjct  4    FAVTGMTCAACAGSVEKAVKRLPGIHDAAVDVLGCRAQVAFYPAFVSEEKIRETIEDVGF  63

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
               L+    ++K I    L + G++       +E  L  + GV+         E E+ +D
Sbjct  64   GAKLIDEELKEKSILVCRLHIKGMTCTSCANTVESTLQAVPGVQRASVALAIEEAEIRYD  123

Query  947  PEVLGSRSVVDGI  985
              V+ +  +V+ +
Sbjct  124  RRVVAATQLVNAV  136



>ref|XP_002451721.1| hypothetical protein SORBIDRAFT_04g006600 [Sorghum bicolor]
 gb|EES04697.1| hypothetical protein SORBIDRAFT_04g006600 [Sorghum bicolor]
Length=974

 Score =   129 bits (324),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 129/246 (52%), Gaps = 16/246 (7%)
 Frame = +2

Query  341   RRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIE  520
             R++   V GM+CA+C+ S+E  +  L GV    V+ LQ +A V + P     + I+ AIE
Sbjct  34    RKVMFSVRGMSCASCAVSIETVVAGLKGVESIQVSPLQGQAVVQYRPEETDTRTIKEAIE  93

Query  521   DAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALAT  700
             D  FE + L E   +          +  I GM C +C  SVE  L  +PGVK+A V LA 
Sbjct  94    DLNFEVDELQEQEIAVC--------RLRIKGMACTSCSESVERALQMVPGVKKAAVGLAL  145

Query  701   SVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGI  874
                +V YDP V S++ I+ A+EDAGF G+   SS  D  K+ L + G++   D +L++ +
Sbjct  146   EEAKVHYDPNVTSRDLIIEAVEDAGF-GADPISSGDDVNKVHLKLEGVNSPEDTKLVQSV  204

Query  875   LSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI-NGGSGGKF---TLHVKNPYTRM  1042
             L    GV +  ++   + ++V +DP++ G R ++  I N     K    TLH   P  R 
Sbjct  205   LEAAEGVNNVEWDTVEQTIKVAYDPDITGPRLLIQCIQNAAQPPKCFTATLH-SPPKQRE  263

Query  1043  ASRDIE  1060
             A R+ E
Sbjct  264   AERNHE  269



>emb|CDS22770.1| copper transporting ATPase 1 [Echinococcus granulosus]
Length=1536

 Score =   129 bits (325),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 111/185 (60%), Gaps = 3/185 (2%)
 Frame = +2

Query  251  NGNSSEEDFGDCEEVRL--LDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNG  424
            NG ++ +     EEV++  + + D E     L+   +RVTGMTC++C  +VE AL+ L G
Sbjct  359  NGRTTLKSPVLSEEVKVGEMTTIDLEPPIHALKCCHLRVTGMTCSSCVQTVENALLKLPG  418

Query  425  VVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTN-GTVSGQF  601
            V  A+V LL  KAD+++DP +++   +   I + GF A++L    A+  + + GT + + 
Sbjct  419  VRSATVGLLSMKADIIYDPTLIQPSALTRQINELGFSAQILEVRRAAEIHGDEGTQTLEV  478

Query  602  MIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFE  781
             I GMTC++CVNS+E  +  LPGV  A VALAT  G+V +D  ++    I+  IED GF+
Sbjct  479  TILGMTCSSCVNSIETAIKKLPGVTSASVALATKRGKVVFDSRIVGARSILKTIEDMGFD  538

Query  782  GSLMQ  796
             S+ +
Sbjct  539  ASVYK  543


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 71/139 (51%), Gaps = 9/139 (6%)
 Frame = +2

Query  596  QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
               + GMTC++CV +VE  L  LPGV+ A V L +   ++ YDPT+I  + +   I + G
Sbjct  394  HLRVTGMTCSSCVQTVENALLKLPGVRSATVGLLSMKADIIYDPTLIQPSALTRQINELG  453

Query  776  FEGSLMQSSAQDKII---------LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRE  928
            F   +++     +I          + ++G++    +  +E  + KL GV        ++ 
Sbjct  454  FSAQILEVRRAAEIHGDEGTQTLEVTILGMTCSSCVNSIETAIKKLPGVTSASVALATKR  513

Query  929  LEVVFDPEVLGSRSVVDGI  985
             +VVFD  ++G+RS++  I
Sbjct  514  GKVVFDSRIVGARSILKTI  532



>ref|XP_009624984.1| PREDICTED: probable copper-transporting ATPase HMA5 [Nicotiana 
tomentosiformis]
 ref|XP_009624985.1| PREDICTED: probable copper-transporting ATPase HMA5 [Nicotiana 
tomentosiformis]
Length=966

 Score =   129 bits (324),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 132/249 (53%), Gaps = 10/249 (4%)
 Frame = +2

Query  320   ENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDK  499
             ++  + +R +  +V G+TCA+CS S+E AL  L G+  A+V+ LQ +A V + P ++  K
Sbjct  29    DSRNKKIRTLLFKVNGITCASCSNSIESALGKLKGIESATVSPLQGQAVVKYVPELISAK  88

Query  500   DIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKR  679
              I+ A+ED GFE +   E + +          +  I GM C +C  SVE  LS   GVK+
Sbjct  89    KIKEAVEDTGFEVDEFPEQDIAIC--------RIRIKGMACTSCSESVERALSMTDGVKK  140

Query  680   AVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMDM  856
             AVV L+    +V +DP V S + IV  IEDAGF   ++ S S  +K+   + GI+   D 
Sbjct  141   AVVGLSLEEAKVHFDPNVTSTSRIVEVIEDAGFGADIISSGSDLNKVHFKLEGINSPDDF  200

Query  857   QLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTLHVKNPYT  1036
              +++  L  L GV     N     + + ++P+++G R+++  I     G  T +  + Y 
Sbjct  201   TVIQCCLEALEGVNTVEINQQEYRVTISYEPDIIGPRTLMHCIQEAGHGSST-YRASLYI  259

Query  1037  RMASRDIEE  1063
                 R++E+
Sbjct  260   PPRQRELEK  268



>emb|CDS35986.1| copper transporting ATPase 1 [Echinococcus multilocularis]
Length=1524

 Score =   129 bits (325),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 112/185 (61%), Gaps = 3/185 (2%)
 Frame = +2

Query  251  NGNSSEEDFGDCEEVRL--LDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNG  424
            NG ++ +     EEV++  + + D + +   LR   +RVTGMTC++C  +VE AL+ L G
Sbjct  359  NGRTTLKSSALSEEVKVGEMTTIDLQPTIHALRCCHLRVTGMTCSSCVQNVENALLKLPG  418

Query  425  VVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEAEVLAEPNASHANTN-GTVSGQF  601
            V  A+V LL  KAD+++DP +++   +   I + GF A++L    A+  + + GT + + 
Sbjct  419  VRSATVGLLSMKADIIYDPTLIQPSALTRQINELGFSAQILEVRRAAEIHGDEGTQTLEV  478

Query  602  MIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFE  781
             I GMTC++CVNS+E  +  LPGV  A VALAT  G+V +D  ++    I+  IE+ GF+
Sbjct  479  TILGMTCSSCVNSIETAIKKLPGVTAASVALATKRGKVVFDSRIVGARSILKTIENMGFD  538

Query  782  GSLMQ  796
             S+ +
Sbjct  539  ASVYK  543


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 71/139 (51%), Gaps = 9/139 (6%)
 Frame = +2

Query  596  QFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAG  775
               + GMTC++CV +VE  L  LPGV+ A V L +   ++ YDPT+I  + +   I + G
Sbjct  394  HLRVTGMTCSSCVQNVENALLKLPGVRSATVGLLSMKADIIYDPTLIQPSALTRQINELG  453

Query  776  FEGSLMQSSAQDKII---------LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRE  928
            F   +++     +I          + ++G++    +  +E  + KL GV        ++ 
Sbjct  454  FSAQILEVRRAAEIHGDEGTQTLEVTILGMTCSSCVNSIETAIKKLPGVTAASVALATKR  513

Query  929  LEVVFDPEVLGSRSVVDGI  985
             +VVFD  ++G+RS++  I
Sbjct  514  GKVVFDSRIVGARSILKTI  532



>ref|XP_007214551.1| hypothetical protein PRUPE_ppa000897mg [Prunus persica]
 gb|EMJ15750.1| hypothetical protein PRUPE_ppa000897mg [Prunus persica]
Length=967

 Score =   129 bits (323),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 135/256 (53%), Gaps = 10/256 (4%)
 Frame = +2

Query  299   LLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFD  478
             LL   D  N  + +R ++ ++  + CA+C+T++E  L  L+GV  A+V+ +Q +A V + 
Sbjct  22    LLKPLDINNKDKRIRTVKFKIGDIECASCATTIESVLGKLDGVKNATVSPIQGQAAVNYI  81

Query  479   PHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILS  658
             P ++  K I+ AIEDAGF  +   E + +          Q  I GM C +C  SVE  L 
Sbjct  82    PELITAKKIKEAIEDAGFPVDEFPEQDVA--------VTQLRIKGMACTSCSESVESALR  133

Query  659   SLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVG  835
              + GVK AVV LA    +V +DP++   + I+ AIEDAGF   L+ S    +K+ L + G
Sbjct  134   MIAGVKNAVVGLALEEAKVHFDPSLTDTSCIIQAIEDAGFGADLISSGNDVNKVHLKLEG  193

Query  836   ISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTL  1015
             ++   DM +++  L  + GV +   +   +++ + +D  + G RS++  +   +G    L
Sbjct  194   VNSPEDMSIVQSSLESVEGVNNVEVDFAEKKVTIAYDSNLTGPRSLIHCVE-KAGRDLKL  252

Query  1016  HVKNPYTRMASRDIEE  1063
             +  + Y     R+ E+
Sbjct  253   YQASLYVPPRRREAEQ  268



>ref|XP_002282923.1| PREDICTED: probable copper-transporting ATPase HMA5 [Vitis vinifera]
 ref|XP_010651256.1| PREDICTED: probable copper-transporting ATPase HMA5 [Vitis vinifera]
 ref|XP_010651257.1| PREDICTED: probable copper-transporting ATPase HMA5 [Vitis vinifera]
 ref|XP_010651258.1| PREDICTED: probable copper-transporting ATPase HMA5 [Vitis vinifera]
 ref|XP_010651259.1| PREDICTED: probable copper-transporting ATPase HMA5 [Vitis vinifera]
Length=976

 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 132/248 (53%), Gaps = 14/248 (6%)
 Frame = +2

Query  332   ENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIEN  511
             + ++ +  ++  + CA+C+TS+E  L+ LNGV    V++LQ +A V + P ++    I+ 
Sbjct  33    KKIKTVMFKIGNIACASCATSIESVLLELNGVESVMVSVLQGQAAVKYIPELITANAIKE  92

Query  512   AIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVA  691
             AI+DAGF  + L E   +          +  I GM C +C  SVE  LS + GVK+AVV 
Sbjct  93    AIKDAGFPVDDLPEQEIAVC--------RLRIKGMACTSCSESVEHALSLVDGVKKAVVG  144

Query  692   LATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDMQLLE  868
             LA    +V +DP++   N IV A+EDAGF   ++ S    +K+ L + GIS + D+ +++
Sbjct  145   LALEEAKVHFDPSITDFNHIVEAVEDAGFGADVINSGNDVNKVHLKLEGISSEEDINIIQ  204

Query  869   GILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI-NGGSGGKF---TLHVKNPYT  1036
               L  + GV     +    ++ V +DP++ G RS++  I   G G  F   TL+   P  
Sbjct  205   SYLESVEGVNDVEMDLAENKVTVSYDPDLTGPRSLICCIEKAGQGSNFYHATLY-SPPRQ  263

Query  1037  RMASRDIE  1060
             R   R  E
Sbjct  264   RETERQQE  271



>ref|XP_002303665.2| hypothetical protein POPTR_0003s12580g [Populus trichocarpa]
 gb|EEE78644.2| hypothetical protein POPTR_0003s12580g [Populus trichocarpa]
Length=983

 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 124/220 (56%), Gaps = 8/220 (4%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH-VVKDKDIENAIEDAGFE  535
             VTGMTC+AC+ SVE A+  L G+++A V +L N+A V+F P  +V ++ I   IEDAGF+
Sbjct  50    VTGMTCSACAGSVEKAIKRLPGILEAVVDVLNNRAQVLFYPSSLVNEETIRETIEDAGFQ  109

Query  536   AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
             A ++ +      N   +   +  I G+ C +C  + E +L ++ GV+R  VAL T   EV
Sbjct  110   ATLIED----EINERSSQVCRIQINGIRCTSCCCTAEIVLQAIHGVQRIQVALETEEAEV  165

Query  716   EYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEGILSKLH  889
              YDP +++ N ++ A+ED GF+ +++ S+ +D  KI L V G+     MQ++E  L  L 
Sbjct  166   YYDPKILNYNHLLEAMEDIGFQ-TMLVSAGEDVSKIDLKVDGLGAGHSMQIIENSLQTLP  224

Query  890   GVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             GV+    +P   ++ + + P + G R  +  I       F
Sbjct  225   GVQVIEIDPELDKVSISYKPSMTGPRKFIKAIESAGSENF  264


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 76/150 (51%), Gaps = 6/150 (4%)
 Frame = +2

Query  554  PNASHANTNGT-VSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP-  727
            P     +  GT V   F + GMTC+AC  SVE  +  LPG+  AVV +  +  +V + P 
Sbjct  32   PKGVAGDVKGTEVKAMFSVTGMTCSACAGSVEKAIKRLPGILEAVVDVLNNRAQVLFYPS  91

Query  728  TVISKNDIVNAIEDAGFEGSLMQSSAQDK----IILGVVGISGQMDMQLLEGILSKLHGV  895
            +++++  I   IEDAGF+ +L++    ++      + + GI         E +L  +HGV
Sbjct  92   SLVNEETIRETIEDAGFQATLIEDEINERSSQVCRIQINGIRCTSCCCTAEIVLQAIHGV  151

Query  896  RHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            +       + E EV +DP++L    +++ +
Sbjct  152  QRIQVALETEEAEVYYDPKILNYNHLLEAM  181


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/145 (25%), Positives = 70/145 (48%), Gaps = 9/145 (6%)
 Frame = +2

Query  350  QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAG  529
            ++++ G+ C +C  + E  L +++GV +  VAL   +A+V +DP ++    +  A+ED G
Sbjct  126  RIQINGIRCTSCCCTAEIVLQAIHGVQRIQVALETEEAEVYYDPKILNYNHLLEAMEDIG  185

Query  530  FEAEVL-AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSV  706
            F+  ++ A  + S  +          + G+     +  +E  L +LPGV+   +      
Sbjct  186  FQTMLVSAGEDVSKIDLK--------VDGLGAGHSMQIIENSLQTLPGVQVIEIDPELDK  237

Query  707  GEVEYDPTVISKNDIVNAIEDAGFE  781
              + Y P++      + AIE AG E
Sbjct  238  VSISYKPSMTGPRKFIKAIESAGSE  262



>gb|AES94063.2| heavy metal P-type ATPase [Medicago truncatula]
Length=996

 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 123/219 (56%), Gaps = 6/219 (3%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V GMTC+AC+ SVE ++  L+G+ +A V +L N+A V+F P  V ++ I  AIEDAGF+A
Sbjct  52    VHGMTCSACAGSVEKSIKRLHGIHEAVVDVLHNRARVIFHPSFVNEEAICEAIEDAGFDA  111

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
              +L +      N N     +  I GMTC +C  +VE  L +L GV  A VALAT   +V 
Sbjct  112   ALLTDVT----NENTIQVCRIQIKGMTCTSCSTAVESALKALSGVVGAQVALATEEAQVH  167

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVGISGQMDM-QLLEGILSKLHG  892
             Y+P +I+ + I+ A+++AGFE +L+ SS    KI L V G     DM +L+E  L  L G
Sbjct  168   YNPNIITHSQILEAVDEAGFEATLISSSEDLSKIDLHVEGDLTNNDMIKLVEDSLRSLPG  227

Query  893   VRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
             V     N    ++ + +  ++ G R  ++ I   S G  
Sbjct  228   VLELHTNLEFNKISLSYKADITGPRDFINVIVETSNGNL  266


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 81/155 (52%), Gaps = 9/155 (6%)
 Frame = +2

Query  299  LLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFD  478
            LL     EN+ + + RIQ++  GMTC +CST+VE AL +L+GVV A VAL   +A V ++
Sbjct  113  LLTDVTNENTIQ-VCRIQIK--GMTCTSCSTAVESALKALSGVVGAQVALATEEAQVHYN  169

Query  479  PHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILS  658
            P+++    I  A+++AGFEA +++  +   +  +  V G      M     +  VE  L 
Sbjct  170  PNIITHSQILEAVDEAGFEATLISS-SEDLSKIDLHVEGDLTNNDM-----IKLVEDSLR  223

Query  659  SLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAI  763
            SLPGV      L  +   + Y   +    D +N I
Sbjct  224  SLPGVLELHTNLEFNKISLSYKADITGPRDFINVI  258


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 73/151 (48%), Gaps = 4/151 (3%)
 Frame = +2

Query  548  AEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDP  727
            +EP  S       V+  F + GMTC+AC  SVE  +  L G+  AVV +  +   V + P
Sbjct  33   SEPGTSTVEEPSKVTALFSVHGMTCSACAGSVEKSIKRLHGIHEAVVDVLHNRARVIFHP  92

Query  728  TVISKNDIVNAIEDAGFEGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGV  895
            + +++  I  AIEDAGF+ +L+     +  I    + + G++       +E  L  L GV
Sbjct  93   SFVNEEAICEAIEDAGFDAALLTDVTNENTIQVCRIQIKGMTCTSCSTAVESALKALSGV  152

Query  896  RHFFYNPTSRELEVVFDPEVLGSRSVVDGIN  988
                    + E +V ++P ++    +++ ++
Sbjct  153  VGAQVALATEEAQVHYNPNIITHSQILEAVD  183



>gb|ACF95872.1| heavy metal P-type ATPase [Arabidopsis thaliana]
Length=995

 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 126/218 (58%), Gaps = 7/218 (3%)
 Frame = +2

Query  338  LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
            + R   +V GMTC+AC+ SVE A+  L G+  A +  L N+A ++F P+ V  + I   I
Sbjct  50   ISRAVFQVLGMTCSACAGSVEKAIKRLPGIHDAVIDALNNRAQILFYPNSVDVETIRETI  109

Query  518  EDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALA  697
            EDAGFEA ++     + AN       +  I GMTC +C +++E +L S+ GV+RA VALA
Sbjct  110  EDAGFEASLIE----NEANERSRQVCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVALA  165

Query  698  TSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEG  871
                E+ YDP ++S + ++  IE+AGFE  L+ S+ +D  KI L + G      M+++E 
Sbjct  166  IEEAEIHYDPRLLSYDRLLEEIENAGFEAVLI-STGEDVSKIDLKIDGELTDESMKVIER  224

Query  872  ILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
             L  L GV+    +  + ++ V++ P+V G R+ +  I
Sbjct  225  SLEALPGVQSVEISHGTDKISVLYKPDVTGPRNFIQVI  262


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 97/205 (47%), Gaps = 20/205 (10%)
 Frame = +2

Query  200  KFIEMSPSMRDVQMTATNGNSSEEDFG----DCEEVR-------LLDSYDEENSGENLRR  346
            K I+  P + D  + A N N ++  F     D E +R          S  E  + E  R+
Sbjct  71   KAIKRLPGIHDAVIDALN-NRAQILFYPNSVDVETIRETIEDAGFEASLIENEANERSRQ  129

Query  347  I-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
            + ++R+ GMTC +CS+++E  L S+NGV +A VAL   +A++ +DP ++    +   IE+
Sbjct  130  VCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVALAIEEAEIHYDPRLLSYDRLLEEIEN  189

Query  524  AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
            AGFEA VL       +  +  + G+     M        +E  L +LPGV+   ++  T 
Sbjct  190  AGFEA-VLISTGEDVSKIDLKIDGELTDESMKV------IERSLEALPGVQSVEISHGTD  242

Query  704  VGEVEYDPTVISKNDIVNAIEDAGF  778
               V Y P V    + +  IE   F
Sbjct  243  KISVLYKPDVTGPRNFIQVIESTVF  267



>gb|ACF95839.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95841.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95845.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95850.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95853.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95858.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95864.1| heavy metal P-type ATPase [Arabidopsis thaliana]
Length=995

 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 126/218 (58%), Gaps = 7/218 (3%)
 Frame = +2

Query  338  LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
            + R   +V GMTC+AC+ SVE A+  L G+  A +  L N+A ++F P+ V  + I   I
Sbjct  50   ISRAVFQVLGMTCSACAGSVEKAIKRLPGIHDAVIDALNNRAQILFYPNSVDVETIRETI  109

Query  518  EDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALA  697
            EDAGFEA ++     + AN       +  I GMTC +C +++E +L S+ GV+RA VALA
Sbjct  110  EDAGFEASLIE----NEANERSRQVCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVALA  165

Query  698  TSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEG  871
                E+ YDP ++S + ++  IE+AGFE  L+ S+ +D  KI L + G      M+++E 
Sbjct  166  IEEAEIHYDPRLLSYDRLLEEIENAGFEAVLI-STGEDVSKIDLKIDGELTDESMKVIER  224

Query  872  ILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
             L  L GV+    +  + ++ V++ P+V G R+ +  I
Sbjct  225  SLEALPGVQSVEISHGTDKISVLYKPDVTGPRNFIQVI  262


 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 97/205 (47%), Gaps = 20/205 (10%)
 Frame = +2

Query  200  KFIEMSPSMRDVQMTATNGNSSEEDFG----DCEEVR-------LLDSYDEENSGENLRR  346
            K I+  P + D  + A N N ++  F     D E +R          S  E  + E  R+
Sbjct  71   KAIKRLPGIHDAVIDALN-NRAQILFYPNSVDVETIRETIEDAGFEASLIENEANERSRQ  129

Query  347  I-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIED  523
            + ++R+ GMTC +CS+++E  L S+NGV +A VAL   +A++ +DP ++    +   IE+
Sbjct  130  VCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVALAIEEAEIHYDPRLLSYDRLLEEIEN  189

Query  524  AGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATS  703
            AGFEA VL       +  +  + G+     M        +E  L +LPGV+   ++  T 
Sbjct  190  AGFEA-VLISTGEDVSKIDLKIDGELTDESMKV------IERSLEALPGVQSVEISHGTD  242

Query  704  VGEVEYDPTVISKNDIVNAIEDAGF  778
               V Y P V    + +  IE   F
Sbjct  243  KISVLYKPDVTGPRNFIQVIESTVF  267



>ref|XP_004976463.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Setaria 
italica]
Length=999

 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 121/216 (56%), Gaps = 5/216 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             V+GMTCAAC+ SVE A+  L G+  A+V +L  +A VVF P  V +  I  AIED GFEA
Sbjct  77    VSGMTCAACAGSVEKAVKRLPGIHDAAVDVLGGRAQVVFYPAFVSENKITEAIEDVGFEA  136

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
             +++ E           +  +  I GM C  C ++VE +L + PGV+RA V LAT   E+ 
Sbjct  137   KLIDE----DVMEKNILLCRLHIKGMACKCCTSTVEFVLQASPGVQRASVVLATEEAEIR  192

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSA-QDKIILGVVGISGQMDMQLLEGILSKLHGV  895
             YD  ++S + ++ A+E+ GFE  L+ +   + +I L + G+  +  + +++  +  L GV
Sbjct  193   YDRRIVSASQLIQAVEETGFEAILVTTGEDRSRIDLKMDGVLDERSLMIVKTSVQALPGV  252

Query  896   RHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGG  1003
              +  +N    ++ + + P+  G R +++ I   + G
Sbjct  253   ENIKFNTDLHKVTISYKPDQTGPRDLIEVIKSATSG  288


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 66/133 (50%), Gaps = 4/133 (3%)
 Frame = +2

Query  599  FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            F + GMTCAAC  SVE  +  LPG+  A V +     +V + P  +S+N I  AIED GF
Sbjct  75   FSVSGMTCAACAGSVEKAVKRLPGIHDAAVDVLGGRAQVVFYPAFVSENKITEAIEDVGF  134

Query  779  EGSLMQSSAQDKII----LGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFD  946
            E  L+     +K I    L + G++ +     +E +L    GV+       + E E+ +D
Sbjct  135  EAKLIDEDVMEKNILLCRLHIKGMACKCCTSTVEFVLQASPGVQRASVVLATEEAEIRYD  194

Query  947  PEVLGSRSVVDGI  985
              ++ +  ++  +
Sbjct  195  RRIVSASQLIQAV  207


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  314  DEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVK  493
            DE+   +N+   ++ + GM C  C+++VE  L +  GV +ASV L   +A++ +D  +V 
Sbjct  140  DEDVMEKNILLCRLHIKGMACKCCTSTVEFVLQASPGVQRASVVLATEEAEIRYDRRIVS  199

Query  494  DKDIENAIEDAGFEA  538
               +  A+E+ GFEA
Sbjct  200  ASQLIQAVEETGFEA  214



>ref|XP_008227189.1| PREDICTED: probable copper-transporting ATPase HMA5 [Prunus mume]
Length=958

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 134/256 (52%), Gaps = 10/256 (4%)
 Frame = +2

Query  299   LLDSYDEENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFD  478
             LL   D  N  + +R ++ ++  + CA+C+T++E  L  L+GV  A+V+ +Q +A V + 
Sbjct  22    LLKPLDINNKDKRIRTVKFKIGDVECASCATTIESVLGKLDGVKNATVSPIQGQAAVNYI  81

Query  479   PHVVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILS  658
             P ++  K I+ AIEDAGF  +   E + +          +  I GM C +C  SVE  L 
Sbjct  82    PELINAKKIKEAIEDAGFPVDEFPEQDVA--------VTRLRIKGMACTSCSESVESALR  133

Query  659   SLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQ-DKIILGVVG  835
              + GVK AVV LA    ++ +DPT+   + I+ AIEDAGF   L+ S    +K+ L + G
Sbjct  134   MIAGVKNAVVGLALEEAKIHFDPTLTDTSCIIQAIEDAGFGADLISSGNDVNKVHLKLEG  193

Query  836   ISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKFTL  1015
             ++   DM +++  L  + GV +   +   +++ + +D  + G RS++  +   +G    L
Sbjct  194   VNSPEDMSIVQSSLESVEGVNNVEVDFAEKKVTIAYDSNLTGPRSLIHCVE-KAGRDLKL  252

Query  1016  HVKNPYTRMASRDIEE  1063
             +    Y     R+ E+
Sbjct  253   YQATLYVPPRRREAEQ  268



>emb|CAN64245.1| hypothetical protein VITISV_035322 [Vitis vinifera]
Length=933

 Score =   128 bits (321),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 113/217 (52%), Gaps = 4/217 (2%)
 Frame = +2

Query  359   VTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFEA  538
             VTGMTC+ACS  VE AL  L G+  A V  L N+A V F P ++ ++ I   IED G++A
Sbjct  4     VTGMTCSACSGQVERALRQLPGIQDAVVDALSNRAQVTFYPALINEETIRETIEDVGYQA  63

Query  539   EVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVE  718
               + +      N   T   +  I G+ C +C  +VE  L +L GV  A VA A    +V 
Sbjct  64    TXIQD---HQTNAKSTQMCRIRINGI-CTSCSTAVESALQALRGVLMAQVASADEEAQVH  119

Query  719   YDPTVISKNDIVNAIEDAGFEGSLMQSSAQDKIILGVVGISGQMDMQLLEGILSKLHGVR  898
             YDP ++S  +++ AIED G    L+ +    K+ L V G+     M+L+E  L  L GV+
Sbjct  120   YDPKMVSYKELLEAIEDTGSVAILITTGYMSKLQLKVDGVCTDHSMRLIENSLRSLPGVQ  179

Query  899   HFFYNPTSRELEVVFDPEVLGSRSVVDGINGGSGGKF  1009
                 +PT  +  V + P+V G R+ +  I     G++
Sbjct  180   DIVIDPTLNKFSVSYKPDVTGPRNFIQVIESTGSGRY  216


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 16/171 (9%)
 Frame = +2

Query  599   FMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
             + + GMTC+AC   VE  L  LPG++ AVV   ++  +V + P +I++  I   IED G+
Sbjct  2     YSVTGMTCSACSGQVERALRQLPGIQDAVVDALSNRAQVTFYPALINEETIRETIEDVGY  61

Query  779   EGSLMQ-----SSAQDKIILGVVGISGQMDMQLLEGILSKLHGVRHFFYNPTSRELEVVF  943
             + + +Q     + +     + + GI        +E  L  L GV          E +V +
Sbjct  62    QATXIQDHQTNAKSTQMCRIRINGICTSCSTA-VESALQALRGVLMAQVASADEEAQVHY  120

Query  944   DPEVLGSRSVVDG----------INGGSGGKFTLHVKNPYTRMASRDIEES  1066
             DP+++  + +++           I  G   K  L V    T  + R IE S
Sbjct  121   DPKMVSYKELLEAIEDTGSVAILITTGYMSKLQLKVDGVCTDHSMRLIENS  171



>ref|XP_010102321.1| Putative copper-transporting ATPase 3 [Morus notabilis]
 gb|EXB93282.1| Putative copper-transporting ATPase 3 [Morus notabilis]
Length=966

 Score =   127 bits (318),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 124/224 (55%), Gaps = 9/224 (4%)
 Frame = +2

Query  317  EENSGENLRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKD  496
            +  + E +  I  RV G+ CA+C+TS+E +L  LNGV    V+ LQ +A + + P ++  
Sbjct  28   DHKTNEKVSTIMFRVRGIECASCATSIESSLGKLNGVRSVVVSPLQGQAVIKYVPELINV  87

Query  497  KDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVK  676
            K+I+  +E+ GFE +   E +            +  I GM C  C  SVE  L  + GVK
Sbjct  88   KEIKETLENTGFEVDDFPELDIEVC--------RLRIKGMACTNCSESVERALQMVNGVK  139

Query  677  RAVVALATSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQS-SAQDKIILGVVGISGQMD  853
            +AVV LA    ++ +DP+VI+ + I+ AIEDAGF   L+ S +  +K+ L + G++ Q D
Sbjct  140  KAVVGLALEEAKIHFDPSVINTDRIIEAIEDAGFGADLISSGNDANKVHLKLEGVNTQED  199

Query  854  MQLLEGILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
            + +++  L    GV    ++    ++ + +DP+V G RS++  I
Sbjct  200  ITIIKSSLESALGVTDVSFDTKDHKVTISYDPKVTGPRSLIKCI  243


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 89/202 (44%), Gaps = 27/202 (13%)
 Frame = +2

Query  182  RGEGFVKFIEMSPSMRDVQMTATNGNSSEEDFG--DCEEVRLLDSYDEENSGENLRRIQV  355
            +G+  +K++    ++++++ T  N     +DF   D E  RL                  
Sbjct  73   QGQAVIKYVPELINVKEIKETLENTGFEVDDFPELDIEVCRL------------------  114

Query  356  RVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAIEDAGFE  535
            R+ GM C  CS SVE AL  +NGV KA V L   +A + FDP V+    I  AIEDAGF 
Sbjct  115  RIKGMACTNCSESVERALQMVNGVKKAVVGLALEEAKIHFDPSVINTDRIIEAIEDAGFG  174

Query  536  AEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALATSVGEV  715
            A++++  N ++            + G+     +  ++  L S  GV             +
Sbjct  175  ADLISSGNDAN-------KVHLKLEGVNTQEDITIIKSSLESALGVTDVSFDTKDHKVTI  227

Query  716  EYDPTVISKNDIVNAIEDAGFE  781
             YDP V     ++  IE+AG +
Sbjct  228  SYDPKVTGPRSLIKCIEEAGHD  249



>gb|ACF95835.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95847.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95852.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95856.1| heavy metal P-type ATPase [Arabidopsis thaliana]
 gb|ACF95861.1| heavy metal P-type ATPase [Arabidopsis thaliana]
Length=995

 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 126/218 (58%), Gaps = 7/218 (3%)
 Frame = +2

Query  338  LRRIQVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPHVVKDKDIENAI  517
            + R   +V GMTC+AC+ SVE A+  L G+  A +  L N+A ++F P+ V  + I   I
Sbjct  50   ISRAVFQVLGMTCSACAGSVEKAIKRLPGIHDAVIDALNNRAQILFYPNSVDVETICETI  109

Query  518  EDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSLPGVKRAVVALA  697
            EDAGFEA ++     + AN       +  I GMTC +C +++E +L S+ GV+RA VALA
Sbjct  110  EDAGFEASLIE----NEANERSRQVCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVALA  165

Query  698  TSVGEVEYDPTVISKNDIVNAIEDAGFEGSLMQSSAQD--KIILGVVGISGQMDMQLLEG  871
                E+ YDP ++S + ++  IE+AGFE  L+ S+ +D  KI L + G      M+++E 
Sbjct  166  IEEAEIHYDPRLLSYDRLLEEIENAGFEAVLI-STGEDVSKIDLKIDGELTDESMKVIER  224

Query  872  ILSKLHGVRHFFYNPTSRELEVVFDPEVLGSRSVVDGI  985
             L  L GV+    +  + ++ V++ P+V G R+ +  I
Sbjct  225  SLEALPGVQSVEISHGTDKISVLYKPDVTGPRNFIQVI  262


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 80/158 (51%), Gaps = 8/158 (5%)
 Frame = +2

Query  308  SYDEENSGENLRRI-QVRVTGMTCAACSTSVEGALMSLNGVVKASVALLQNKADVVFDPH  484
            S  E  + E  R++ ++R+ GMTC +CS+++E  L S+NGV +A VAL   +A++ +DP 
Sbjct  117  SLIENEANERSRQVCRIRINGMTCTSCSSTIERVLQSVNGVQRAHVALAIEEAEIHYDPR  176

Query  485  VVKDKDIENAIEDAGFEAEVLAEPNASHANTNGTVSGQFMIGGMTCAACVNSVEGILSSL  664
            ++    +   IE+AGFEA VL       +  +  + G+     M        +E  L +L
Sbjct  177  LLSYDRLLEEIENAGFEA-VLISTGEDVSKIDLKIDGELTDESMKV------IERSLEAL  229

Query  665  PGVKRAVVALATSVGEVEYDPTVISKNDIVNAIEDAGF  778
            PGV+   ++  T    V Y P V    + +  IE   F
Sbjct  230  PGVQSVEISHGTDKISVLYKPDVTGPRNFIQVIESTVF  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2815412562560