BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig510

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629595.1|  PREDICTED: probable pectin methyltransferase...  95.1    7e-19   Nicotiana tomentosiformis
ref|XP_009760349.1|  PREDICTED: probable pectin methyltransferase...  93.6    2e-18   Nicotiana sylvestris
ref|XP_006367734.1|  PREDICTED: probable pectin methyltransferase...  93.6    2e-18   Solanum tuberosum [potatoes]
ref|XP_010320179.1|  PREDICTED: probable pectin methyltransferase...  90.9    2e-17   Solanum lycopersicum
gb|KHG28112.1|  putative pectin methyltransferase QUA2 -like protein  77.8    4e-13   Gossypium arboreum [tree cotton]
gb|KJB64258.1|  hypothetical protein B456_010G039800                  77.4    5e-13   Gossypium raimondii
ref|XP_012067887.1|  PREDICTED: probable pectin methyltransferase...  77.4    5e-13   Jatropha curcas
gb|KJB64259.1|  hypothetical protein B456_010G039800                  77.4    6e-13   Gossypium raimondii
gb|KJB64260.1|  hypothetical protein B456_010G039800                  77.4    6e-13   Gossypium raimondii
ref|XP_011074193.1|  PREDICTED: probable pectin methyltransferase...  77.0    7e-13   Sesamum indicum [beniseed]
emb|CDP01069.1|  unnamed protein product                              76.6    1e-12   Coffea canephora [robusta coffee]
ref|XP_007018751.1|  S-adenosyl-L-methionine-dependent methyltran...  73.2    2e-11   
ref|XP_007018750.1|  S-adenosyl-L-methionine-dependent methyltran...  73.2    2e-11   
gb|EYU36493.1|  hypothetical protein MIMGU_mgv1a018181mg              67.4    8e-10   Erythranthe guttata [common monkey flower]
ref|XP_002513934.1|  S-adenosylmethionine-dependent methyltransfe...  67.8    9e-10   
ref|XP_002302304.2|  hypothetical protein POPTR_0002s09820g           67.8    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009372838.1|  PREDICTED: probable pectin methyltransferase...  64.7    7e-09   Pyrus x bretschneideri [bai li]
ref|XP_011016595.1|  PREDICTED: probable pectin methyltransferase...  64.7    7e-09   Populus euphratica
ref|XP_008383924.1|  PREDICTED: probable pectin methyltransferase...  63.9    1e-08   Malus domestica [apple tree]
ref|XP_009334333.1|  PREDICTED: probable pectin methyltransferase...  63.2    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_010535445.1|  PREDICTED: probable pectin methyltransferase...  62.4    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_006472585.1|  PREDICTED: probable pectin methyltransferase...  61.6    7e-08   Citrus sinensis [apfelsine]
gb|KJB59032.1|  hypothetical protein B456_009G236100                  61.6    8e-08   Gossypium raimondii
gb|KJB59033.1|  hypothetical protein B456_009G236100                  61.6    8e-08   Gossypium raimondii
gb|KJB59030.1|  hypothetical protein B456_009G236100                  61.6    9e-08   Gossypium raimondii
ref|XP_009334340.1|  PREDICTED: probable pectin methyltransferase...  61.2    9e-08   Pyrus x bretschneideri [bai li]
gb|KHG17567.1|  putative pectin methyltransferase QUA2 -like protein  61.2    1e-07   Gossypium arboreum [tree cotton]
ref|XP_002306569.2|  hypothetical protein POPTR_0005s17180g           61.2    1e-07   
ref|XP_008372670.1|  PREDICTED: probable pectin methyltransferase...  60.1    3e-07   
ref|XP_011003042.1|  PREDICTED: probable pectin methyltransferase...  59.7    3e-07   Populus euphratica
ref|XP_006433967.1|  hypothetical protein CICLE_v10000463mg           59.7    3e-07   Citrus clementina [clementine]
gb|KDO80996.1|  hypothetical protein CISIN_1g005417mg                 59.7    4e-07   Citrus sinensis [apfelsine]
ref|XP_003542374.1|  PREDICTED: probable pectin methyltransferase...  58.9    5e-07   Glycine max [soybeans]
gb|KHN44795.1|  Putative pectin methyltransferase QUA2                58.9    5e-07   Glycine soja [wild soybean]
ref|XP_010521185.1|  PREDICTED: probable pectin methyltransferase...  57.4    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_008219451.1|  PREDICTED: probable pectin methyltransferase...  56.2    4e-06   Prunus mume [ume]
ref|XP_004300652.1|  PREDICTED: probable pectin methyltransferase...  54.7    1e-05   Fragaria vesca subsp. vesca
ref|XP_007225175.1|  hypothetical protein PRUPE_ppa002227mg           54.3    2e-05   Prunus persica
ref|XP_010267469.1|  PREDICTED: probable pectin methyltransferase...  53.9    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_006581532.1|  PREDICTED: probable pectin methyltransferase...  53.5    3e-05   Glycine max [soybeans]
gb|KHN08942.1|  Putative pectin methyltransferase QUA2                53.5    3e-05   Glycine soja [wild soybean]
ref|XP_008466224.1|  PREDICTED: probable pectin methyltransferase...  52.4    8e-05   Cucumis melo [Oriental melon]
ref|XP_002285784.1|  PREDICTED: probable pectin methyltransferase...  52.4    9e-05   Vitis vinifera
gb|KHN13350.1|  Putative pectin methyltransferase QUA2                51.6    1e-04   Glycine soja [wild soybean]
ref|XP_003544795.1|  PREDICTED: probable pectin methyltransferase...  51.2    2e-04   Glycine max [soybeans]
ref|XP_004136285.1|  PREDICTED: probable pectin methyltransferase...  51.2    2e-04   Cucumis sativus [cucumbers]
ref|XP_010676321.1|  PREDICTED: probable pectin methyltransferase...  50.4    5e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676338.1|  PREDICTED: probable pectin methyltransferase...  50.1    5e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010060014.1|  PREDICTED: probable pectin methyltransferase...  50.1    6e-04   
ref|XP_007141184.1|  hypothetical protein PHAVU_008G174000g           49.7    7e-04   Phaseolus vulgaris [French bean]



>ref|XP_009629595.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
tomentosiformis]
Length=697

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            N     DDSQMKDK EKED + ++SAGDQ+ LS+KFL RIL  D SP+K  + ENG LS+
Sbjct  18   NGPDIWDDSQMKDKTEKEDLERNRSAGDQTPLSIKFLSRILFPDNSPSKQSLGENGLLSD  77

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PFSPG GR+++K+TLLL++LSLV I++LALTGSF
Sbjct  78   PFSPGTGRNRLKYTLLLIRLSLVVIIILALTGSF  111



>ref|XP_009760349.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
sylvestris]
Length=697

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            N     DDSQMKDK EKED + +++AGDQ+ LS+KFL R+L  D SP+K  + ENG LS+
Sbjct  18   NGPDIWDDSQMKDKTEKEDLERNRAAGDQTHLSIKFLSRMLFPDNSPSKQSLGENGLLSD  77

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PFSPG GR+++K+TLLL++LSLV I++LALTGSF
Sbjct  78   PFSPGTGRNRLKYTLLLIRLSLVVIIILALTGSF  111



>ref|XP_006367734.1| PREDICTED: probable pectin methyltransferase QUA2-like [Solanum 
tuberosum]
Length=697

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            N   F DDSQMKDKIEKED + ++S GDQ++   KFL RIL  D SP+K+ + ENG LS+
Sbjct  18   NGPDFWDDSQMKDKIEKEDLERNRSPGDQTYSPTKFLCRILFPDNSPSKHNLGENGLLSD  77

Query  483  PFSPGAGRSQIKF  521
            PFSPG GR+++K+
Sbjct  78   PFSPGTGRNRLKY  90



>ref|XP_010320179.1| PREDICTED: probable pectin methyltransferase QUA2 [Solanum lycopersicum]
Length=697

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            N   F DDSQMKDKIEKED + ++S GD ++   KFL RIL  D SP+K+ + ENG LS+
Sbjct  18   NGPDFWDDSQMKDKIEKEDLERNRSPGDLTYSPTKFLCRILFPDNSPSKHNLGENGLLSD  77

Query  483  PFSPGAGRSQIKF  521
            PFSPG GR+++K+
Sbjct  78   PFSPGTGRNRLKY  90



>gb|KHG28112.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=697

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K GV+ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGVTENGFASD  76

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSF
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSF  110



>gb|KJB64258.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64261.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=630

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSF
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSF  110



>ref|XP_012067887.1| PREDICTED: probable pectin methyltransferase QUA2 [Jatropha curcas]
 gb|KDP41393.1| hypothetical protein JCGZ_15800 [Jatropha curcas]
Length=690

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLS  479
            NSQ  L DSQMKDK EKED D ++S+ DQS+L++KF LR+L  D  SP+K G  ENG+ S
Sbjct  16   NSQE-LWDSQMKDKTEKEDLDRNRSS-DQSYLALKFPLRVLFPDNSSPSKYGTGENGFAS  73

Query  480  NPFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            +PFS G  RS+ KFTLLLLKLSL  I+VLALTGSF
Sbjct  74   DPFSIGTPRSRHKFTLLLLKLSLAVILVLALTGSF  108



>gb|KJB64259.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=691

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSF
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSF  110



>gb|KJB64260.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=697

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSF
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSF  110



>ref|XP_011074193.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074194.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074195.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=697

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAG-DQSFLSMKFLLRILSTDKSPTKNGVSENGYLS  479
            NSQ F +DSQMK++ EKED D S++ G D +FLS+KF  R L TD   +K+  SENG++S
Sbjct  19   NSQDFWEDSQMKERTEKEDLDRSRANGADNTFLSLKFPFRYLFTDNLSSKH-FSENGFMS  77

Query  480  NPFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            +PFSPG  RS+ K TL LLK SLV IV+LALTGSF
Sbjct  78   DPFSPGPLRSRHKVTLTLLKFSLVVIVILALTGSF  112



>emb|CDP01069.1| unnamed protein product [Coffea canephora]
Length=696

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +3

Query  321  DDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGA  500
            DDSQMKDK+EKED D      DQ++LS++   R L TD S +K+G+ ENG++S+PFSPG 
Sbjct  22   DDSQMKDKLEKEDVDRKSPNADQTYLSIRQPFRFLLTDNSSSKHGLMENGFVSDPFSPGV  81

Query  501  GRSQIKFTllllklslvaivvlalTGSF  584
             R++ K TLLLL+LSLV IV+LALTGSF
Sbjct  82   LRNRHKRTLLLLRLSLVVIVILALTGSF  109



>ref|XP_007018751.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY15976.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=658

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D SQ+K K EK+D D ++S  DQS+LS++F  R+L  D SP K+GV+ENG+ S+
Sbjct  17   NSNDFWD-SQVKAKTEKDDLDRNRSP-DQSYLSLRFPFRLLFPDSSPLKHGVTENGFASD  74

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PFS G  RS+ K T+L LKLSL+ IV+LALTGSF
Sbjct  75   PFSVGTPRSRHKLTMLFLKLSLIVIVILALTGSF  108



>ref|XP_007018750.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15975.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=695

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D SQ+K K EK+D D ++S  DQS+LS++F  R+L  D SP K+GV+ENG+ S+
Sbjct  17   NSNDFWD-SQVKAKTEKDDLDRNRSP-DQSYLSLRFPFRLLFPDSSPLKHGVTENGFASD  74

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PFS G  RS+ K T+L LKLSL+ IV+LALTGSF
Sbjct  75   PFSVGTPRSRHKLTMLFLKLSLIVIVILALTGSF  108



>gb|EYU36493.1| hypothetical protein MIMGU_mgv1a018181mg, partial [Erythranthe 
guttata]
Length=497

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAG-DQSFLSMKFLLRILSTDKSPTKNGVSENGYLS  479
            NS    +DSQMK++ +KED D  ++ G D +  S+KFL R L  D   +K+G++EN ++S
Sbjct  21   NSHDLWEDSQMKERPDKEDVDPKRTNGADHTHSSIKFLFRYLFPDNLSSKHGLNENSFMS  80

Query  480  NPFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            +PFSPG  RS+ K TL  LKLSLV IV+LALTGSF
Sbjct  81   DPFSPGPTRSRHKVTLSFLKLSLVVIVILALTGSF  115



>ref|XP_002513934.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48517.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=656

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  494
            L DSQMKDK EKE+ + ++S+ DQS+L+++F  R+L  D  SP+K G +ENG  S+PFS 
Sbjct  21   LWDSQMKDKPEKEELEKNRSS-DQSYLALRFPFRVLFPDNVSPSKYGSTENGIASDPFSI  79

Query  495  GAGRSQIKFTllllklslvaivvlalTGSF  584
            G  RS+ KFTLLLLKLSLV I+VLALTGSF
Sbjct  80   GTPRSRHKFTLLLLKLSLVVILVLALTGSF  109



>ref|XP_002302304.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
 gb|EEE81577.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
Length=694

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL-STDKSPTKNGVSENGYLSNPFSP  494
            L DSQMKDK EKED D ++S+ DQS+L+++F  R+L   + SP+K G  ENG+ S+PF  
Sbjct  21   LWDSQMKDKTEKEDLDRNRSS-DQSYLALRFPFRVLFPENNSPSKYGSGENGFASDPFIV  79

Query  495  GAGRSQIKFTllllklslvaivvlalTGSF  584
            G+ RS+ K+ LLLLKLSL  IV+LALTGSF
Sbjct  80   GSPRSRHKWALLLLKLSLAVIVILALTGSF  109



>ref|XP_009372838.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372846.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372855.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            +S  FLD SQMKDK +KED D   S+ + SF + +  +R+L  D SP+K+G +ENG+ S+
Sbjct  17   SSNDFLD-SQMKDKTDKEDLDRRASSDNNSF-AFRLPVRVLFPDNSPSKHGNTENGFASD  74

Query  483  PFSPGAGRSQIK  518
            PF  G  RS+ K
Sbjct  75   PFMAGTPRSRHK  86



>ref|XP_011016595.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
 ref|XP_011016602.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=693

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  494
            L DSQMKDK EKED D ++S+ DQS+L+++F  R+L  D  SP+K G  ENG+ S+PF  
Sbjct  21   LWDSQMKDKTEKEDLDRNRSS-DQSYLALRFPFRVLFPDNNSPSKYGSGENGFASDPFIV  79

Query  495  GAGRSQ  512
            G+ RS+
Sbjct  80   GSPRSR  85



>ref|XP_008383924.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008383925.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            DSQMKDK +KED D   S+ + SF + KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASSDNNSF-AFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            RS+ K TLLLLKLSLV IV+LALTGSF
Sbjct  82   RSRHKLTLLLLKLSLVLIVILALTGSF  108



>ref|XP_009334333.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334334.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334335.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            DSQMKDK +KED D   S+ D + L+ KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASS-DNNSLAFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            RS+ K  LLLLKLSLV IV+LALTGSF
Sbjct  82   RSRHKLALLLLKLSLVLIVILALTGSF  108



>ref|XP_010535445.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=689

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  497
            L DSQMKDK EK D D S+S  D +FL+++F    L ++ S  KNG++ENG+ S+P+  G
Sbjct  21   LWDSQMKDKTEKGDLDRSRSM-DNTFLALRFPFGFLFSNHSSPKNGINENGFASDPYISG  79

Query  498  AGRSQIKFTllllklslvaivvlalTGSF  584
              RS+ +  +LLLK+SLV IV++ALTGSF
Sbjct  80   TARSRHRLMMLLLKISLVVIVIVALTGSF  108



>ref|XP_006472585.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006472586.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Citrus sinensis]
Length=697

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 64/89 (72%), Gaps = 3/89 (3%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  497
            DS+MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DSEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  498  AGRSQIKFTllllklslvaivvlalTGSF  584
              RS+  FT+L LK SL+AIV LALTGSF
Sbjct  82   TPRSRQNFTMLFLKFSLIAIVFLALTGSF  110



>gb|KJB59032.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=597

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PF  G  RS+ + T+L LKLSLV IV+LALTGSF
Sbjct  75   PFGGGTPRSRHRLTMLFLKLSLVVIVILALTGSF  108



>gb|KJB59033.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
 gb|KJB59034.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=644

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PF  G  RS+ + T+L LKLSLV IV+LALTGSF
Sbjct  75   PFGGGTPRSRHRLTMLFLKLSLVVIVILALTGSF  108



>gb|KJB59030.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=696

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PF  G  RS+ + T+L LKLSLV IV+LALTGSF
Sbjct  75   PFGGGTPRSRHRLTMLFLKLSLVVIVILALTGSF  108



>ref|XP_009334340.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334341.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334342.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            +SQMKDK +KED D   S+ D + L+ KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   NSQMKDKTDKEDLDRRASS-DNNSLAFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            RS+ K  LLLLKLSLV IV+LALTGSF
Sbjct  82   RSRHKLALLLLKLSLVLIVILALTGSF  108



>gb|KHG17567.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=696

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +3

Query  303  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  482
            NS  F D +++KDK EKE+ D + S+  QSFLS++   R+   D SP K GV+ENG+ S+
Sbjct  17   NSNDFWD-AEVKDKTEKEESDRNHSS-SQSFLSLRSPFRLFFQDNSPPKYGVTENGFTSD  74

Query  483  PFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
            PF  G  RS+ + T+L LKLSLV IV+LALTGSF
Sbjct  75   PFRGGTPRSRHRLTMLFLKLSLVVIVILALTGSF  108



>ref|XP_002306569.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
 gb|EEE93565.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
Length=718

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTD-KSPTKNGVSENGYLSNPFSP  494
            L DSQMKDK EKED D ++S+ DQS+L++KF  R+L  D  SP+K    E+G+ S+PFS 
Sbjct  45   LWDSQMKDKTEKEDMDRNRSS-DQSYLALKFPFRVLFPDNNSPSKYVNGESGFASDPFSV  103

Query  495  GAGRSQ  512
            G+ RS+
Sbjct  104  GSPRSR  109



>ref|XP_008372670.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008372733.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            DSQMKDK +KED D   S+ + SF + +  +R+L  D SP+K G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASSDNNSF-AFRMPIRVLFPDNSPSKXGNTENGFASDPFMAGTP  81

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            RS+ K  LLLLKLSLV IV+LALTGSF
Sbjct  82   RSRHKLMLLLLKLSLVLIVILALTGSF  108



>ref|XP_011003042.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=694

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL-STDKSPTKNGVSENGYLSNPFSP  494
            L DSQMKDK EKED D ++S+ DQS+L++KF  R+L   + SP+K    E+G+ S+PFS 
Sbjct  21   LWDSQMKDKTEKEDMDSNRSS-DQSYLALKFPFRVLFPYNNSPSKYVNGESGFASDPFSV  79

Query  495  GAGRSQ  512
            G+ RS+
Sbjct  80   GSPRSR  85



>ref|XP_006433967.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
 gb|ESR47207.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
Length=697

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 3/89 (3%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  497
            D +MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  498  AGRSQIKFTllllklslvaivvlalTGSF  584
              RS+  FT+L LK SL+AIV LALTGSF
Sbjct  82   TPRSRQNFTMLFLKFSLIAIVFLALTGSF  110



>gb|KDO80996.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
 gb|KDO80997.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=697

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 3/89 (3%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  497
            D +MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  498  AGRSQIKFTllllklslvaivvlalTGSF  584
              RS+  FT+L LK SL+AIV LALTGSF
Sbjct  82   TPRSRQNFTMLFLKFSLIAIVFLALTGSF  110



>ref|XP_003542374.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006593562.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=694

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 3/91 (3%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  491
            L DSQ KDK EKED D ++ + D S  +++F LR+L  + S +K  NG++ENG+ S+PF 
Sbjct  23   LWDSQSKDKTEKEDLD-TRGSSDHSPFTLRFPLRVLLGNNSDSKYGNGIAENGFASDPFM  81

Query  492  PGAGRSQIKFTllllklslvaivvlalTGSF  584
             G  RS++K  LL LK SLV IVVLALTGSF
Sbjct  82   VGTPRSRLKLMLLSLKFSLVFIVVLALTGSF  112



>gb|KHN44795.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=670

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 3/91 (3%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  491
            L DSQ KDK EKED D ++ + D S  +++F LR+L  + S +K  NG++ENG+ S+PF 
Sbjct  23   LWDSQSKDKTEKEDLD-TRGSSDHSPFTLRFPLRVLLGNNSDSKYGNGIAENGFASDPFM  81

Query  492  PGAGRSQIKFTllllklslvaivvlalTGSF  584
             G  RS++K  LL LK SLV IVVLALTGSF
Sbjct  82   VGTPRSRLKLMLLSLKFSLVFIVVLALTGSF  112



>ref|XP_010521185.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=696

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  497
            L DSQMKDKIEKED + S+S  D + L+++     L  + S +KNG+SENG  S+P+S  
Sbjct  21   LWDSQMKDKIEKEDLNRSRSM-DNTSLALRSPFGFLFNNHSSSKNGISENGVTSDPYSGS  79

Query  498  AGRSQIKFTllllklslvaivvlalTGSF  584
              RS+ +F LL LK+SLV IVV+ALTGSF
Sbjct  80   NSRSRQRFMLLFLKISLVGIVVVALTGSF  108



>ref|XP_008219451.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
 ref|XP_008219452.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
Length=698

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 41/91 (45%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +3

Query  246  MARPlhrglsvggggrhsgNSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL  425
            M+RPLHRG S   G R SG+S  F D SQMKDK +KED +   S+ D + ++ +F +R+L
Sbjct  1    MSRPLHRGSSGAAGERISGSSNDFWD-SQMKDKTDKEDLERRASS-DNNSIAFRFPIRVL  58

Query  426  STDKSPTKNGVSENGYLSNPFSPGAGRSQIK  518
              D SP+K+G + NG+ S+P      RS+ K
Sbjct  59   FPDNSPSKHGNTGNGFASDPLIASTPRSRHK  89



>ref|XP_004300652.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465516.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465517.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465518.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465519.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
Length=693

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            DSQMKDK +KED D   S+ DQ+  S +  +R+L  + SP+K GV ENG+ S P    + 
Sbjct  20   DSQMKDKTDKEDLDRRASS-DQNSFSFRIPVRLLLGENSPSKQGVGENGFASEPLLAVSP  78

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            RS+ K  LLLLKLSLV IV+ ALTGSF
Sbjct  79   RSRHKLALLLLKLSLVLIVIFALTGSF  105



>ref|XP_007225175.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
 gb|EMJ26374.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
Length=698

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +3

Query  246  MARPlhrglsvggggrhsgNSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL  425
            M+RPLHRG S   G R SGNS  F D SQMKDK +KED +   S+ D + ++ +F +R+L
Sbjct  1    MSRPLHRGSSGAAGERISGNSNDFWD-SQMKDKTDKEDLERRASS-DNNSIAFRFPIRVL  58

Query  426  STDKSPTKNGVSENGYLSNPFSPGAGRSQIKFTllllklslvaivvlalTGSF  584
              D SP+K+G + NG+ S+P      RS+ K  LLLLKLSLV IV+LALTGSF
Sbjct  59   FPDNSPSKHGNTGNGFASDPLIASTPRSRHKLALLLLKLSLVLIVILALTGSF  111



>ref|XP_010267469.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
 ref|XP_010267476.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
Length=700

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +3

Query  324  DSQMKDK---IEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSP  494
            DSQMK +    EKED D ++S+ D + LS++FL+ +   D S  K+G+++NG+ S+PF+ 
Sbjct  25   DSQMKSRSPRTEKEDVDRNRSSPDHTSLSLRFLVNLFFPDNSSFKSGLTDNGFGSDPFNM  84

Query  495  GAGRSQIKFT  524
            G+ RS+   T
Sbjct  85   GSSRSRQNLT  94



>ref|XP_006581532.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Glycine max]
 ref|XP_006581533.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
 ref|XP_006581534.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X3 [Glycine max]
 ref|XP_006581535.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X4 [Glycine max]
Length=690

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  497
            L DSQ KDK EKE  D   S+G  S L   F  R+L +D S +K G+SENG+ S+PF  G
Sbjct  21   LWDSQSKDKSEKEGLDRRGSSGHPSPLRSPF--RLLFSDNSNSKYGISENGFSSDPFIIG  78

Query  498  AGRSQIKFT  524
              RS++K  
Sbjct  79   TPRSRLKLV  87



>gb|KHN08942.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  497
            L DSQ KDK EKE  D   S+G  S L   F  R+L +D S +K G+SENG+ S+PF  G
Sbjct  21   LWDSQSKDKSEKEGLDRRGSSGHPSPLRSPF--RLLFSDNSNSKYGISENGFSSDPFIIG  78

Query  498  AGRSQIKFT  524
              RS++K  
Sbjct  79   TPRSRLKLV  87



>ref|XP_008466224.1| PREDICTED: probable pectin methyltransferase QUA2 [Cucumis melo]
Length=690

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            DSQMKDK +KE+ D   S      L+ +   R+L  D SP+K+G +ENG+ S+ F  G  
Sbjct  23   DSQMKDKTDKEEVDRKGSLDHGGNLAPRLPFRLLLPDNSPSKHGGTENGFASDSFLVGNS  82

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            RS+ +F L +L+LSLV I++LALTGSF
Sbjct  83   RSRQQFILQMLRLSLVLIIILALTGSF  109



>ref|XP_002285784.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 ref|XP_010664337.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 emb|CBI19170.3| unnamed protein product [Vitis vinifera]
Length=696

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            DSQMK K EKED + ++S+ D + LS KF   +   D S +K+G+SENG+ S+ FS G+ 
Sbjct  23   DSQMKVKTEKEDSEKNRSS-DHTCLSFKFP-SVPFPDNSSSKHGISENGFASDTFSAGSP  80

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            RS+ K T+L+LKLSLV IVVLALTGSF
Sbjct  81   RSRHKLTMLVLKLSLVLIVVLALTGSF  107



>gb|KHN13350.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=693

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG--VSENGYLSNPFS  491
            L DSQ KDKIEKED D   SA D S  +++F LR+L  + S +K G   +ENG+ S+PF 
Sbjct  22   LWDSQSKDKIEKEDLDRRGSA-DHSPFALRFPLRVLLGNNSESKYGNVKAENGFASDPFM  80

Query  492  PGAGR  506
             G  R
Sbjct  81   VGTPR  85



>ref|XP_003544795.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006596348.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=693

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG--VSENGYLSNPFS  491
            L DSQ KDKIEKED D   SA D S  +++F LR+L  + S +K G   +ENG+ S+PF 
Sbjct  22   LWDSQSKDKIEKEDLDKRGSA-DHSPFALRFPLRVLLGNNSESKYGNVKAENGFASDPFM  80

Query  492  PGAGR  506
             G  R
Sbjct  81   VGTPR  85



>ref|XP_004136285.1| PREDICTED: probable pectin methyltransferase QUA2 [Cucumis sativus]
 gb|KGN60218.1| hypothetical protein Csa_3G889740 [Cucumis sativus]
Length=690

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            DSQMKDK +KE+ D   S      L+ +   R+L  D SP+K G +ENG+ S+ F  G  
Sbjct  23   DSQMKDKTDKEEVDRKGSLDHGGNLAPRLPFRLLLPDNSPSKYGGTENGFASDSFLVGNS  82

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            RS+ +F L +L+ SLV I++LALTGSF
Sbjct  83   RSRQQFILQMLRFSLVLIIILALTGSF  109



>ref|XP_010676321.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010676329.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=697

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            DSQMK+K EK+D   S+S  DQ + S+K    + S D   +K GV+ENG+ ++ FS  + 
Sbjct  28   DSQMKEKSEKDDTRASRSLSDQGYSSLKLPFHLNSLDNGHSKLGVNENGFTTDLFSSKSP  87

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            R++ KF LL+L++SLV IV+LALTGSF
Sbjct  88   RNRHKFILLMLRISLVFIVILALTGSF  114



>ref|XP_010676338.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +3

Query  324  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  503
            DSQMK+K EK+D   S+S  DQ + S+K    + S D   +K GV+ENG+ ++ FS  + 
Sbjct  28   DSQMKEKSEKDDTRASRSLSDQGYSSLKLPFHLNSLDNGHSKLGVNENGFTTDLFSSKSP  87

Query  504  RSQIKFTllllklslvaivvlalTGSF  584
            R++ KF LL+L++SLV IV+LALTGSF
Sbjct  88   RNRHKFILLMLRISLVFIVILALTGSF  114



>ref|XP_010060014.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 ref|XP_010060015.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 gb|KCW66537.1| hypothetical protein EUGRSUZ_F00334 [Eucalyptus grandis]
Length=695

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  497
            L DSQMKDK EKED     S+ DQS+  +KF  ++L    SP+K    ENG+ S+P S G
Sbjct  21   LWDSQMKDKSEKEDLSRRDSS-DQSYPPLKFASQLLHPSNSPSKFTNLENGFASDPCSAG  79

Query  498  AGRSQ  512
            + R +
Sbjct  80   SPRKR  84



>ref|XP_007141184.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
 gb|ESW13178.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
Length=693

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 61/91 (67%), Gaps = 3/91 (3%)
 Frame = +3

Query  318  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  491
            L DSQ KDK EKED D   S+ D S L+++F L +L  + S +K  NG+ ENG+ S+ F 
Sbjct  22   LWDSQSKDKTEKEDLDKRGSS-DHSPLALRFPLGLLLGNNSDSKYGNGIGENGFASDSFI  80

Query  492  PGAGRSQIKFTllllklslvaivvlalTGSF  584
              + RS++K  LL LK SLV IVVLALTGSF
Sbjct  81   VSSPRSRLKLMLLSLKFSLVVIVVLALTGSF  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 889770574917