BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig456

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009759587.1|  PREDICTED: AT-rich interactive domain-contai...    149   3e-39   Nicotiana sylvestris
ref|XP_010314335.1|  PREDICTED: AT-rich interactive domain-contai...    151   1e-37   Solanum lycopersicum
ref|XP_011072682.1|  PREDICTED: AT-rich interactive domain-contai...    150   1e-37   Sesamum indicum [beniseed]
gb|EYU21278.1|  hypothetical protein MIMGU_mgv1a001736mg                150   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_006362097.1|  PREDICTED: AT-rich interactive domain-contai...    150   2e-37   Solanum tuberosum [potatoes]
ref|XP_009604965.1|  PREDICTED: AT-rich interactive domain-contai...    150   2e-37   Nicotiana tomentosiformis
ref|XP_010273825.1|  PREDICTED: AT-rich interactive domain-contai...    137   6e-33   Nelumbo nucifera [Indian lotus]
emb|CDO97800.1|  unnamed protein product                                136   2e-32   Coffea canephora [robusta coffee]
emb|CBI35803.3|  unnamed protein product                                134   8e-32   Vitis vinifera
ref|XP_008340179.1|  PREDICTED: AT-rich interactive domain-contai...    133   3e-31   Malus domestica [apple tree]
ref|XP_008340180.1|  PREDICTED: AT-rich interactive domain-contai...    133   3e-31   Malus domestica [apple tree]
ref|XP_009357933.1|  PREDICTED: AT-rich interactive domain-contai...    131   1e-30   Pyrus x bretschneideri [bai li]
gb|KJB07354.1|  hypothetical protein B456_001G018000                    129   2e-30   Gossypium raimondii
gb|KJB07353.1|  hypothetical protein B456_001G018000                    129   4e-30   Gossypium raimondii
gb|KJB07352.1|  hypothetical protein B456_001G018000                    129   6e-30   Gossypium raimondii
ref|XP_008228116.1|  PREDICTED: AT-rich interactive domain-contai...    128   1e-29   Prunus mume [ume]
ref|XP_010096547.1|  AT-rich interactive domain-containing protein 4    127   2e-29   Morus notabilis
ref|XP_008348478.1|  PREDICTED: AT-rich interactive domain-contai...    115   6e-28   
ref|XP_007217035.1|  hypothetical protein PRUPE_ppa001668mg             123   6e-28   Prunus persica
ref|XP_011039906.1|  PREDICTED: AT-rich interactive domain-contai...    122   7e-28   Populus euphratica
ref|XP_006452906.1|  hypothetical protein CICLE_v10007563mg             122   1e-27   Citrus clementina [clementine]
ref|XP_006474564.1|  PREDICTED: AT-rich interactive domain-contai...    122   1e-27   Citrus sinensis [apfelsine]
ref|XP_011039905.1|  PREDICTED: AT-rich interactive domain-contai...    122   2e-27   Populus euphratica
gb|KJB54557.1|  hypothetical protein B456_009G038600                    121   2e-27   Gossypium raimondii
ref|XP_006381551.1|  hypothetical protein POPTR_0006s13780g             121   4e-27   
ref|XP_008380743.1|  PREDICTED: AT-rich interactive domain-contai...    120   9e-27   
ref|XP_009338314.1|  PREDICTED: AT-rich interactive domain-contai...    119   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_008462245.1|  PREDICTED: AT-rich interactive domain-contai...    119   2e-26   Cucumis melo [Oriental melon]
ref|XP_007012520.1|  ARID/BRIGHT DNA-binding domain-containing pr...    118   3e-26   
ref|XP_004141824.2|  PREDICTED: AT-rich interactive domain-contai...    116   2e-25   Cucumis sativus [cucumbers]
ref|XP_010685228.1|  PREDICTED: AT-rich interactive domain-contai...    115   2e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG05519.1|  AT-rich interactive domain-containing 4 -like pro...    114   4e-25   Gossypium arboreum [tree cotton]
ref|XP_002324130.2|  arid/bright DNA-binding domain-containing fa...    114   6e-25   
ref|XP_011003461.1|  PREDICTED: AT-rich interactive domain-contai...    114   1e-24   Populus euphratica
gb|KJB65462.1|  hypothetical protein B456_010G095800                    113   2e-24   Gossypium raimondii
ref|XP_003627823.1|  hypothetical protein MTR_8g038730                  107   2e-24   
ref|XP_002277324.2|  PREDICTED: AT-rich interactive domain-contai...    112   4e-24   Vitis vinifera
ref|XP_007135372.1|  hypothetical protein PHAVU_010G123900g             112   5e-24   Phaseolus vulgaris [French bean]
ref|XP_010092743.1|  hypothetical protein L484_024638                   107   5e-24   
ref|XP_010087779.1|  hypothetical protein L484_016350                   105   6e-24   
ref|XP_004303747.1|  PREDICTED: AT-rich interactive domain-contai...    111   7e-24   Fragaria vesca subsp. vesca
emb|CBI27746.3|  unnamed protein product                                111   8e-24   Vitis vinifera
ref|XP_010047433.1|  PREDICTED: AT-rich interactive domain-contai...    109   4e-23   Eucalyptus grandis [rose gum]
ref|XP_003547888.1|  PREDICTED: AT-rich interactive domain-contai...    107   2e-22   Glycine max [soybeans]
ref|XP_012077118.1|  PREDICTED: AT-rich interactive domain-contai...    107   2e-22   Jatropha curcas
ref|XP_011651722.1|  PREDICTED: AT-rich interactive domain-contai...    106   4e-22   Cucumis sativus [cucumbers]
ref|XP_009391205.1|  PREDICTED: AT-rich interactive domain-contai...    104   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003627434.1|  Fiber protein Fb21                                 103   3e-21   Medicago truncatula
ref|XP_007138611.1|  hypothetical protein PHAVU_009G223200g             103   3e-21   Phaseolus vulgaris [French bean]
ref|XP_004510562.1|  PREDICTED: AT-rich interactive domain-contai...    102   1e-20   Cicer arietinum [garbanzo]
ref|XP_008797363.1|  PREDICTED: AT-rich interactive domain-contai...    101   2e-20   Phoenix dactylifera
ref|XP_008797362.1|  PREDICTED: AT-rich interactive domain-contai...    101   2e-20   
ref|XP_003546529.2|  PREDICTED: AT-rich interactive domain-contai...    101   2e-20   Glycine max [soybeans]
ref|XP_006828651.1|  PREDICTED: AT-rich interactive domain-contai...    101   2e-20   Amborella trichopoda
gb|AES65616.2|  ARID/bright DNA-binding domain protein                  100   5e-20   Medicago truncatula
ref|XP_003595365.1|  Fiber protein-like protein                         100   5e-20   
gb|KHN34213.1|  AT-rich interactive domain-containing protein 4         100   5e-20   Glycine soja [wild soybean]
ref|XP_004973595.1|  PREDICTED: AT-rich interactive domain-contai...  99.8    5e-20   
ref|XP_008460342.1|  PREDICTED: AT-rich interactive domain-contai...    100   5e-20   
ref|XP_009382962.1|  PREDICTED: AT-rich interactive domain-contai...    100   6e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004488152.1|  PREDICTED: AT-rich interactive domain-contai...  99.4    9e-20   Cicer arietinum [garbanzo]
ref|XP_004973593.1|  PREDICTED: AT-rich interactive domain-contai...  99.4    1e-19   Setaria italica
ref|XP_004488153.1|  PREDICTED: AT-rich interactive domain-contai...  99.4    1e-19   
ref|XP_008783147.1|  PREDICTED: AT-rich interactive domain-contai...  98.6    2e-19   Phoenix dactylifera
ref|XP_003533805.1|  PREDICTED: AT-rich interactive domain-contai...  98.2    2e-19   Glycine max [soybeans]
gb|EEC83666.1|  hypothetical protein OsI_29439                        97.8    3e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001061946.1|  Os08g0451400                                     97.8    3e-19   
ref|NP_001063250.1|  Os09g0434100                                     94.7    3e-19   
ref|XP_008651353.1|  PREDICTED: uncharacterized protein LOC100279...  96.3    1e-18   
ref|XP_008800473.1|  PREDICTED: AT-rich interactive domain-contai...  95.5    2e-18   
ref|XP_008800474.1|  PREDICTED: AT-rich interactive domain-contai...  95.5    2e-18   Phoenix dactylifera
gb|EEC84628.1|  hypothetical protein OsI_31490                        95.5    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_010917383.1|  PREDICTED: AT-rich interactive domain-contai...  95.1    3e-18   Elaeis guineensis
ref|XP_010937271.1|  PREDICTED: AT-rich interactive domain-contai...  94.7    3e-18   
gb|EEE69768.1|  hypothetical protein OsJ_29479                        94.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006419128.1|  hypothetical protein EUTSA_v10002415mg           94.4    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_003578160.1|  PREDICTED: AT-rich interactive domain-contai...  94.4    4e-18   Brachypodium distachyon [annual false brome]
ref|XP_006587068.1|  PREDICTED: AT-rich interactive domain-contai...  93.2    1e-17   Glycine max [soybeans]
ref|XP_006587067.1|  PREDICTED: AT-rich interactive domain-contai...  92.8    1e-17   
gb|KHN47629.1|  AT-rich interactive domain-containing protein 4       93.2    1e-17   Glycine soja [wild soybean]
ref|XP_006661267.1|  PREDICTED: AT-rich interactive domain-contai...  92.4    2e-17   Oryza brachyantha
ref|XP_004956915.1|  PREDICTED: AT-rich interactive domain-contai...  91.3    5e-17   Setaria italica
ref|XP_008670211.1|  PREDICTED: AT-rich interactive domain-contai...  90.9    5e-17   Zea mays [maize]
ref|XP_003574575.1|  PREDICTED: AT-rich interactive domain-contai...  89.7    1e-16   
dbj|BAJ99014.1|  predicted protein                                    89.7    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85134.1|  predicted protein                                    89.7    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009380144.1|  PREDICTED: AT-rich interactive domain-contai...  89.4    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT25617.1|  hypothetical protein F775_26930                       89.4    2e-16   
gb|EMS66350.1|  hypothetical protein TRIUR3_24005                     89.0    2e-16   Triticum urartu
ref|XP_010520513.1|  PREDICTED: AT-rich interactive domain-contai...  87.4    9e-16   Tarenaya hassleriana [spider flower]
gb|EEC83462.1|  hypothetical protein OsI_28965                        82.8    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002445593.1|  hypothetical protein SORBIDRAFT_07g022155        82.8    3e-14   
gb|EEE68795.1|  hypothetical protein OsJ_27534                        80.9    3e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83667.1|  hypothetical protein OsI_29440                        80.5    4e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_006290637.1|  hypothetical protein CARUB_v10016730mg           80.9    9e-14   Capsella rubella
emb|CDY12335.1|  BnaA06g20090D                                        80.9    1e-13   Brassica napus [oilseed rape]
ref|NP_001061949.1|  Os08g0451700                                     79.7    1e-13   
ref|XP_006662238.1|  PREDICTED: AT-rich interactive domain-contai...  79.7    2e-13   Oryza brachyantha
ref|XP_009123264.1|  PREDICTED: AT-rich interactive domain-contai...  79.3    3e-13   Brassica rapa
ref|XP_002877271.1|  ARID/BRIGHT DNA-binding domain-containing pr...  79.0    4e-13   
gb|KFK33849.1|  hypothetical protein AALP_AA5G068200                  78.6    5e-13   Arabis alpina [alpine rockcress]
ref|XP_007012523.1|  ARID/BRIGHT DNA-binding domain-containing pr...  78.2    6e-13   
ref|XP_007012522.1|  ARID/BRIGHT DNA-binding domain-containing pr...  78.2    8e-13   
tpg|DAA48833.1|  TPA: hypothetical protein ZEAMMB73_656706            75.5    1e-12   
tpg|DAA48832.1|  TPA: hypothetical protein ZEAMMB73_656706            75.5    3e-12   
ref|NP_189910.2|  ARID/BRIGHT DNA-binding domain-containing protein   75.9    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130362.1|  uncharacterized protein LOC100191457             75.1    7e-12   Zea mays [maize]
ref|XP_002516200.1|  DNA binding protein, putative                    74.7    9e-12   
ref|XP_010426242.1|  PREDICTED: AT-rich interactive domain-contai...  70.5    1e-11   Camelina sativa [gold-of-pleasure]
gb|KCW56430.1|  hypothetical protein EUGRSUZ_I02158                   73.6    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010029504.1|  PREDICTED: AT-rich interactive domain-contai...  73.6    2e-11   Eucalyptus grandis [rose gum]
gb|KCW56432.1|  hypothetical protein EUGRSUZ_I02158                   73.6    2e-11   Eucalyptus grandis [rose gum]
gb|EAZ07198.1|  hypothetical protein OsI_29442                        68.6    4e-11   Oryza sativa Indica Group [Indian rice]
emb|CAB89045.1|  putative protein                                     70.1    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425814.1|  PREDICTED: AT-rich interactive domain-contai...  69.3    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010503035.1|  PREDICTED: AT-rich interactive domain-contai...  67.0    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010514719.1|  PREDICTED: AT-rich interactive domain-contai...  67.0    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010514718.1|  PREDICTED: AT-rich interactive domain-contai...  66.6    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010089838.1|  hypothetical protein L484_022354                 58.5    1e-07   



>ref|XP_009759587.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Nicotiana sylvestris]
Length=303

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG S+ SCSLLAVVCG+AAE   K DV D  P Y   EI SSGRLEVQLLKNPSTD
Sbjct  1    MFHNQGASRQSCSLLAVVCGKAAEYDQKPDVKDGTPRYCFPEIVSSGRLEVQLLKNPSTD  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EFRK LD+ +PNIV+LQG++L +DE  S VW G +LSS EAISGL SA   T VYLE+P
Sbjct  61   EFRKVLDSWQPNIVYLQGERLSDDEVGSPVWGGVDLSSVEAISGLFSATLPTAVYLELP  119



>ref|XP_010314335.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Solanum 
lycopersicum]
 ref|XP_010314336.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Solanum 
lycopersicum]
Length=771

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG S+ SCSLLAV+CGR +E   K+DV D +P Y   EI SSGRLEVQ+LKNPSTD
Sbjct  1    MFHCQGASRQSCSLLAVLCGRTSEYDQKKDVHDGKPRYCFPEIVSSGRLEVQVLKNPSTD  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF K LD+ +PNIV+LQG+ L NDE  SLVW G +LSS EAISGL S+   T VYLE+P
Sbjct  61   EFHKVLDSWQPNIVYLQGEHLSNDEVGSLVWGGLDLSSAEAISGLFSSVLPTAVYLELP  119



>ref|XP_011072682.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Sesamum 
indicum]
Length=773

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG  K++C+LLAV+C  AA N  KQDV +E+  +P  EI SSGRLEVQ LKNP+TD
Sbjct  1    MFHTQGALKNTCNLLAVLCTGAAGNKQKQDVLEEKRKFPFPEIVSSGRLEVQSLKNPTTD  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EFRK LD+ +PN+V+LQG+QLPNDE  S+VW G  LSS EA+SGL S+   TTVYLE+P
Sbjct  61   EFRKVLDSWQPNLVYLQGEQLPNDEVGSVVWGGLELSSPEAVSGLFSSTMPTTVYLEVP  119



>gb|EYU21278.1| hypothetical protein MIMGU_mgv1a001736mg [Erythranthe guttata]
Length=767

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG  K++C+LLAV+C RAAEN + Q+V DERP +P  EI SSGRLEVQ LKNP+ D
Sbjct  1    MFHTQGALKNTCNLLAVLCNRAAENKHSQNVLDERPNFPFPEIVSSGRLEVQTLKNPTVD  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF K LD+ + N+V+LQG+ L ND+  S+VW GF LSS EAI+GL +++  TTVYLE+P
Sbjct  61   EFSKVLDSSQANLVYLQGEHLENDKIGSIVWGGFELSSPEAITGLFNSKLPTTVYLEVP  119



>ref|XP_006362097.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Solanum tuberosum]
Length=770

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QGTS+ SCSLLAV+CG  +E   K+DV D +P Y   EI SSGRLEVQ+LKNPSTD
Sbjct  1    MFHCQGTSRQSCSLLAVLCGSTSEYDQKKDVHDGKPRYCFPEIVSSGRLEVQVLKNPSTD  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF K LD+ +PNIV+LQG+ L NDE  SLVW G +LSS EAISGL S+   T VYLE+P
Sbjct  61   EFHKVLDSWQPNIVYLQGEHLSNDEVGSLVWGGLDLSSAEAISGLFSSALPTAVYLELP  119



>ref|XP_009604965.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=772

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG S+ +CSLLAVVCG+  E   K DV D +P Y   EI SSGRLEVQLLKNPSTD
Sbjct  1    MFHNQGASRQNCSLLAVVCGKTTEYDQKPDVKDGKPRYCFPEIVSSGRLEVQLLKNPSTD  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EFRK LD+ +PNIV+LQG++L NDE  SL+W G ++SS EAISGL SA   T VYLE+P
Sbjct  61   EFRKVLDSWQPNIVYLQGERLSNDEVGSLIWGGVDMSSVEAISGLFSATLPTAVYLELP  119



>ref|XP_010273825.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Nelumbo 
nucifera]
 ref|XP_010273826.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Nelumbo 
nucifera]
Length=780

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  QG SKH+CSLLAV CG+  +  YKQD++D+RP YP  E  S GRLEV  L NP+T
Sbjct  1    MMFHAQGASKHTCSLLAVFCGKNPD--YKQDISDDRPRYPFPEFVSVGRLEVHTLTNPTT  58

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEFR+ L++ +PN V+LQG++L N +E  SLVW G +LSS E + GL      TTVYLE+
Sbjct  59   DEFRRVLESSEPNFVYLQGEKLSNEEEIGSLVWGGVDLSSAEVLCGLFGTTLPTTVYLEV  118

Query  797  P  799
            P
Sbjct  119  P  119



>emb|CDO97800.1| unnamed protein product [Coffea canephora]
Length=772

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+ V G  K++C+LLAV+CGR  +N  KQ+   ++  YP  ++ SSGRLEVQ LKNP+ D
Sbjct  1    MFHVPGAPKYTCNLLAVLCGRTTDNEQKQEATIQKTKYPFPDLLSSGRLEVQTLKNPTVD  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EFRK +D+ +PNI++LQG+Q  N+E  SLVW G +L++ EAI+GL  +   TTVYLE+P
Sbjct  61   EFRKVVDSWQPNILYLQGEQFANNEVGSLVWGGVDLNTAEAITGLFGSMLPTTVYLEVP  119



>emb|CBI35803.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   134 bits (337),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M   QG S H+C LLAV CG+ +E   + + +++RP YP  +  SSGRLEVQ L +PS D
Sbjct  1    MLHTQGISNHTCGLLAVTCGKTSECKQEHETSNDRPRYPFPDFVSSGRLEVQTLTSPSPD  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EFR+  ++V+PN V+ QG+QL NDE  SLVW G  LSS E I GL  ++  TTVYLEIP
Sbjct  61   EFRRVFESVQPNFVYFQGEQLQNDEVGSLVWGGVELSSAEDICGLFGSKLPTTVYLEIP  119



>ref|XP_008340179.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X1 [Malus domestica]
Length=790

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG SKH CSLL V CG  +E    +D AD++  YP  E+ SSGRLEVQ L  P+ +
Sbjct  1    MFHSQGASKHPCSLLVVTCGNLSEEKCNKDTADDKLRYPFPELVSSGRLEVQTLTKPTKE  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EFRK L++ KPN+V+LQG+QL N E  SLVWE  +LS+ EAIS +  A   TTVYLE+P
Sbjct  61   EFRKMLESYKPNLVYLQGEQLGNSEIGSLVWEDVDLSTAEAISEIFGATLPTTVYLEVP  119



>ref|XP_008340180.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X2 [Malus domestica]
Length=782

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG SKH CSLL V CG  +E    +D AD++  YP  E+ SSGRLEVQ L  P+ +
Sbjct  1    MFHSQGASKHPCSLLVVTCGNLSEEKCNKDTADDKLRYPFPELVSSGRLEVQTLTKPTKE  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EFRK L++ KPN+V+LQG+QL N E  SLVWE  +LS+ EAIS +  A   TTVYLE+P
Sbjct  61   EFRKMLESYKPNLVYLQGEQLGNSEIGSLVWEDVDLSTAEAISEIFGATLPTTVYLEVP  119



>ref|XP_009357933.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=782

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+   G SKH CSLL V CG+ +E  + +D AD++  YP  E+ SSGRLEVQ L  P+ +
Sbjct  1    MFHSHGASKHPCSLLVVTCGKNSEEKFNKDTADDKLRYPFPELVSSGRLEVQTLTKPTKE  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF K L++ KPN+V+LQG+QL N E  SLVWE  +LS+ EAIS +  A   TTVYLE+P
Sbjct  61   EFCKMLESYKPNLVYLQGEQLGNSEIGSLVWEDVDLSTAEAISEIFGATLPTTVYLEVP  119



>gb|KJB07354.1| hypothetical protein B456_001G018000 [Gossypium raimondii]
Length=624

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCG-RAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            +M+S QG+S++ CSLLAV+CG + ++N  KQ V+D +P YP  E++SSGRLEVQLL NPS
Sbjct  1    MMFSAQGSSRNHCSLLAVLCGGKVSDNKQKQPVSDYKPRYPFPELSSSGRLEVQLLNNPS  60

Query  617  TDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLE  793
             DEFR+ L++ +PNIV+LQG+Q+ + +E  SLV    +LS+ EA+ G+  +   TTVYLE
Sbjct  61   IDEFRRVLESFEPNIVYLQGEQIVDGEEIGSLVLGDVDLSTPEALCGVFGSTFPTTVYLE  120

Query  794  IP  799
            IP
Sbjct  121  IP  122



>gb|KJB07353.1| hypothetical protein B456_001G018000 [Gossypium raimondii]
Length=694

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCG-RAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            +M+S QG+S++ CSLLAV+CG + ++N  KQ V+D +P YP  E++SSGRLEVQLL NPS
Sbjct  1    MMFSAQGSSRNHCSLLAVLCGGKVSDNKQKQPVSDYKPRYPFPELSSSGRLEVQLLNNPS  60

Query  617  TDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLE  793
             DEFR+ L++ +PNIV+LQG+Q+ + +E  SLV    +LS+ EA+ G+  +   TTVYLE
Sbjct  61   IDEFRRVLESFEPNIVYLQGEQIVDGEEIGSLVLGDVDLSTPEALCGVFGSTFPTTVYLE  120

Query  794  IP  799
            IP
Sbjct  121  IP  122



>gb|KJB07352.1| hypothetical protein B456_001G018000 [Gossypium raimondii]
Length=746

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCG-RAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            +M+S QG+S++ CSLLAV+CG + ++N  KQ V+D +P YP  E++SSGRLEVQLL NPS
Sbjct  1    MMFSAQGSSRNHCSLLAVLCGGKVSDNKQKQPVSDYKPRYPFPELSSSGRLEVQLLNNPS  60

Query  617  TDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLE  793
             DEFR+ L++ +PNIV+LQG+Q+ + +E  SLV    +LS+ EA+ G+  +   TTVYLE
Sbjct  61   IDEFRRVLESFEPNIVYLQGEQIVDGEEIGSLVLGDVDLSTPEALCGVFGSTFPTTVYLE  120

Query  794  IP  799
            IP
Sbjct  121  IP  122



>ref|XP_008228116.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Prunus 
mume]
Length=783

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M   QG SKH+CSLL V CG+ +E+   +D  DE+  YP  E+ SSGRLEVQ L  PS +
Sbjct  1    MNHSQGASKHTCSLLVVTCGKISEDKPNKDTLDEKLKYPFPELVSSGRLEVQTLAKPSKE  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF K L++ KPN+V+LQG+QL N+E  S VWE  +LS+ EAIS +  A   TTVYLE+P
Sbjct  61   EFCKMLESYKPNLVYLQGEQLENNEIGSPVWEDVDLSTAEAISEIFGATLPTTVYLEVP  119



>ref|XP_010096547.1| AT-rich interactive domain-containing protein 4 [Morus notabilis]
 gb|EXB64667.1| AT-rich interactive domain-containing protein 4 [Morus notabilis]
Length=779

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG+SK +CSLLAV CG  +E+  K+DV + R  YP  E+ SSGRLEVQ L +PS +
Sbjct  1    MFHSQGSSKQTCSLLAVTCGNVSESKRKKDVPENRSLYPFPELISSGRLEVQTLTSPSKE  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF K L++ KPN+V+LQG+QL NDE   LVW   +LS+ E++S L      TTVYLEIP
Sbjct  61   EFSKLLESYKPNLVYLQGEQLANDEVGPLVWGDVDLSTPESVSELFGTTLPTTVYLEIP  119



>ref|XP_008348478.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Malus domestica]
Length=141

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG SK+ CSLL V C   +E    +D AD++  YP  E+ SSGRLEVQ L  P+ +
Sbjct  1    MFHSQGASKYPCSLLVVNCAEISEEKRNKDTADDKLRYPFPELVSSGRLEVQTLTKPTKE  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            EF K L++ KPN+V+LQG+QL N+E  SLVWE  +LS+ EAIS +  A   TTV ++ 
Sbjct  61   EFCKMLESYKPNLVYLQGEQLGNNEIGSLVWEDVDLSTPEAISEIFGATLPTTVCIKF  118



>ref|XP_007217035.1| hypothetical protein PRUPE_ppa001668mg [Prunus persica]
 gb|EMJ18234.1| hypothetical protein PRUPE_ppa001668mg [Prunus persica]
Length=783

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M   QG SK +CSLL V CG+ +E    +D  DE+  YP  E+ S GRLEVQ L  PS +
Sbjct  1    MNHSQGASKQTCSLLVVTCGKISEEKPNEDTLDEKLKYPFPELVSLGRLEVQTLTKPSKE  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF K L++ KPN+V+LQG+QL N+E  S VWE  +LS+ EAIS + SA   TTVYLE+P
Sbjct  61   EFCKMLESYKPNLVYLQGEQLENNEIGSPVWEDVDLSTAEAISEIFSATLPTTVYLEVP  119



>ref|XP_011039906.1| PREDICTED: AT-rich interactive domain-containing protein 4 isoform 
X2 [Populus euphratica]
Length=641

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  QG  ++ C+LLAV+CG++ +N  KQ ++D++P +P  E+AS+GRLEVQ+L NPST
Sbjct  1    MMFHAQGPLRNHCTLLAVLCGKSGDNKQKQPLSDDKPRFPFPELASAGRLEVQVLTNPST  60

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEF++ L +++P+IV+ QG+Q+ + +E   L W   +LS+ E++ GL S+    TVYLEI
Sbjct  61   DEFQRVLHSLEPSIVYFQGEQIEDSEEIGPLRWGDVDLSTPESLCGLFSSTLPPTVYLEI  120

Query  797  P  799
            P
Sbjct  121  P  121



>ref|XP_006452906.1| hypothetical protein CICLE_v10007563mg [Citrus clementina]
 gb|ESR66146.1| hypothetical protein CICLE_v10007563mg [Citrus clementina]
Length=745

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  Q +S++ CSLLAV+  +  ++  KQ   D++P YP  EIASSGRLEV LL +PST
Sbjct  1    MMFHAQSSSRNHCSLLAVLSRKFVDDKQKQAATDDKPKYPFPEIASSGRLEVHLLSSPST  60

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEFR+ L++ +PNIV+LQG+++ + +E  SLVW   +LS+ EA+ GL  +   TTVYLEI
Sbjct  61   DEFRRLLESSEPNIVYLQGEKINDSEEIGSLVWGDVDLSTPEALCGLFGSTLPTTVYLEI  120

Query  797  P  799
            P
Sbjct  121  P  121



>ref|XP_006474564.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Citrus sinensis]
 gb|KDO73756.1| hypothetical protein CISIN_1g004566mg [Citrus sinensis]
Length=745

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  Q +S++ CSLLAV+  +  ++  KQ   D++P YP  EIASSGRLEV LL +PST
Sbjct  1    MMFHAQSSSRNHCSLLAVLSRKFVDDKQKQAATDDKPKYPFPEIASSGRLEVHLLSSPST  60

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEFR+ L++ +PNIV+LQG+++ + +E  SLVW   +LS+ EA+ GL  +   TTVYLEI
Sbjct  61   DEFRRLLESSEPNIVYLQGEKINDSEEIGSLVWGDVDLSTPEALCGLFGSTLPTTVYLEI  120

Query  797  P  799
            P
Sbjct  121  P  121



>ref|XP_011039905.1| PREDICTED: AT-rich interactive domain-containing protein 4 isoform 
X1 [Populus euphratica]
Length=749

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  QG  ++ C+LLAV+CG++ +N  KQ ++D++P +P  E+AS+GRLEVQ+L NPST
Sbjct  1    MMFHAQGPLRNHCTLLAVLCGKSGDNKQKQPLSDDKPRFPFPELASAGRLEVQVLTNPST  60

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEF++ L +++P+IV+ QG+Q+ + +E   L W   +LS+ E++ GL S+    TVYLEI
Sbjct  61   DEFQRVLHSLEPSIVYFQGEQIEDSEEIGPLRWGDVDLSTPESLCGLFSSTLPPTVYLEI  120

Query  797  P  799
            P
Sbjct  121  P  121



>gb|KJB54557.1| hypothetical protein B456_009G038600 [Gossypium raimondii]
Length=745

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCG-RAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            +M++ QG+S++ CSLLAV+C  + ++N  +Q V+D +P YP  +I SSGRLEVQLL NPS
Sbjct  1    MMFNAQGSSRNHCSLLAVLCSSKVSDNKLRQPVSDHKPRYPFPDIVSSGRLEVQLLINPS  60

Query  617  TDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
             DEFR+  ++ +PNIV+ QG+Q  +++  SLV    +LS+ EAI GL  +   +TVYLE 
Sbjct  61   IDEFRRVFESTEPNIVYFQGEQNADEDIGSLVLGDVDLSTPEAICGLFGSTLPSTVYLET  120

Query  797  P  799
            P
Sbjct  121  P  121



>ref|XP_006381551.1| hypothetical protein POPTR_0006s13780g [Populus trichocarpa]
 gb|ERP59348.1| hypothetical protein POPTR_0006s13780g [Populus trichocarpa]
Length=749

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  QG  ++ C+LLAV+CG++ +N  KQ ++D++P +P  E+AS+GRLEVQ+L NPST
Sbjct  1    MMFHAQGPLRNHCTLLAVLCGKSGDNKQKQPLSDDKPRFPFPELASAGRLEVQVLTNPST  60

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEF++ L +++P+IV+ QG+Q+ + +E   L W   +LS+ E++ GL  +    TVYLEI
Sbjct  61   DEFQRVLHSLEPSIVYFQGEQIEDSEEIGPLRWGDIDLSTPESLCGLFGSTLPPTVYLEI  120

Query  797  P  799
            P
Sbjct  121  P  121



>ref|XP_008380743.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Malus domestica]
 ref|XP_008380744.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Malus domestica]
 ref|XP_008380745.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Malus domestica]
Length=783

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG SK  CSLL V C   +E    +D AD++  YP  E+ SSGRLEVQ L  P+ +
Sbjct  1    MFHSQGASKXPCSLLVVNCAEISEEKRNKDTADDKLRYPFPELVSSGRLEVQTLTKPTKE  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            E  K L++ KPN+V+LQG+QL N+E  SLVWE  +LS+ EAIS +  A   TTVYLE+P
Sbjct  61   EXCKMLESYKPNLVYLQGEQLGNNEIGSLVWEDVDLSTPEAISEIFGATLPTTVYLEVP  119



>ref|XP_009338314.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009338315.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009338316.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009338317.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=782

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG +KH CSLL V C   +E    +D AD++  YP  E+ SSGRLEVQ L  P+ +
Sbjct  1    MFHSQG-AKHPCSLLVVNCAEISEEKCSKDTADDKLRYPFPELVSSGRLEVQTLTKPTKE  59

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            E  K L++ KPN+V+LQG+QL N+E  SLVWE  +LS+ EAIS +  A   TTVYLE+P
Sbjct  60   ELCKMLESYKPNLVYLQGEQLGNNEIGSLVWEDVDLSTPEAISEIFGATLPTTVYLEVP  118



>ref|XP_008462245.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Cucumis melo]
 ref|XP_008462246.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Cucumis melo]
Length=781

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +++  Q  ++++C LLA+  G   E+  K+D  +++  YP  ++ SSGRLEVQ+L NPS 
Sbjct  1    MVFHSQVPARYTCRLLAIPSGSIPEDKSKKDNPEDQQRYPFPQLNSSGRLEVQVLSNPSK  60

Query  620  DEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            D+F + L++ KPNIV+LQG+QL NDE  SLVW G +LS+ EAISGL +   LTTVYL+I
Sbjct  61   DQFCRTLESYKPNIVYLQGEQLENDEVGSLVWGGVDLSTVEAISGLFNYPLLTTVYLDI  119



>ref|XP_007012520.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 1 [Theobroma 
cacao]
 ref|XP_007012521.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY30139.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY30140.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 1 [Theobroma 
cacao]
Length=746

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCG-RAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            +M+S QG+S++ CSLLAV+ G   ++N  KQ V+D++P YP  E+ASSGRLEVQLL +P+
Sbjct  1    MMFSAQGSSRNHCSLLAVLSGGNVSDNKQKQPVSDDKPRYPFPELASSGRLEVQLLNSPN  60

Query  617  TDEFRKALDTVKPNIVFLQGDQ-LPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLE  793
             DE R+ L++ +PN+V+LQG+Q   ++E   L+W   +LS+ E + GL  +   TTVYLE
Sbjct  61   IDELRRVLESTEPNVVYLQGEQNADSEEIGPLIWGDVDLSTPETLCGLFDSTLPTTVYLE  120

Query  794  IP  799
             P
Sbjct  121  TP  122



>ref|XP_004141824.2| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_011659602.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN45446.1| hypothetical protein Csa_7G448080 [Cucumis sativus]
Length=818

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +++  Q  ++++C LLA+  G   E+  K+D  +++  YP  ++ SSGRLEVQ+L NPS 
Sbjct  38   MVFHSQVPARYTCRLLAIPYGSVPEDKCKKDNPEDQQRYPFPQLNSSGRLEVQVLSNPSK  97

Query  620  DEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            D+F + L++ KPNIV+LQG+QL NDE  SLVW G +LS+ EAISGL +    TTVYL+I
Sbjct  98   DQFCRTLESYKPNIVYLQGEQLENDEVGSLVWRGVDLSNVEAISGLFNYPLPTTVYLDI  156



>ref|XP_010685228.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Beta 
vulgaris subsp. vulgaris]
Length=783

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 82/117 (70%), Gaps = 4/117 (3%)
 Frame = +2

Query  449  SVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTDEF  628
            + QG+SK SCS+LAV C    ++  ++  +++R  YP  E+ASS R EV+ LKNPS DEF
Sbjct  10   NTQGSSKQSCSVLAVFC----DSELREWESEDRLRYPFPELASSSRFEVRTLKNPSFDEF  65

Query  629  RKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
             + L+++KP+IV+LQG  LPNDE   LVW+G +LS +EAIS L      TTVYLEIP
Sbjct  66   GRTLESLKPSIVYLQGQPLPNDEIGPLVWDGVDLSHDEAISELFDHVLPTTVYLEIP  122



>gb|KHG05519.1| AT-rich interactive domain-containing 4 -like protein [Gossypium 
arboreum]
Length=695

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 86/122 (70%), Gaps = 2/122 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCG-RAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            +M+S Q +S++ CSLLA++CG   ++N  KQ V++++  YP  EIASSGRLEVQLL NPS
Sbjct  1    MMFSAQRSSRNHCSLLAILCGGEVSDNKQKQPVSNDKSRYPFPEIASSGRLEVQLLNNPS  60

Query  617  TDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLE  793
             DE R+ L++ +PN+V+LQG+Q P+ +E   LV    +LS+ E + GL  +   TTVYLE
Sbjct  61   IDEVRRVLESSEPNVVYLQGEQNPDSEEIGYLVCGDVHLSTPEVLYGLFGSTLPTTVYLE  120

Query  794  IP  799
             P
Sbjct  121  TP  122



>ref|XP_002324130.2| arid/bright DNA-binding domain-containing family protein [Populus 
trichocarpa]
 gb|EEF02695.2| arid/bright DNA-binding domain-containing family protein [Populus 
trichocarpa]
Length=746

 Score =   114 bits (286),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  QG  ++ C+LLAV+CG++ E   K  ++D++P YP  E+ S+GRLEVQ+L NPST
Sbjct  1    MMFHAQGPLRNHCTLLAVLCGKSGEQ--KLPLSDDKPRYPLPELESTGRLEVQVLNNPST  58

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEFR+ L +++P+IV+ QG+Q+ + +E  SL W    LS+ E++ GL  +    TVYLE+
Sbjct  59   DEFRQVLQSLEPSIVYFQGEQVEDREEIGSLRWADVGLSTPESLCGLFGSTLPPTVYLEM  118

Query  797  P  799
            P
Sbjct  119  P  119



>ref|XP_011003461.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Populus euphratica]
Length=746

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  QG  ++ C+LLAV+CG++ E   K  ++D++P YP  E+AS+GRL+VQ+L NPST
Sbjct  1    MMFHAQGPLRNHCTLLAVLCGKSGEQ--KLPLSDDKPRYPLPELASTGRLQVQVLNNPST  58

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEFR+ L +++ +IV+ QG+Q+ + +E  SL W   +LS+ E++ GL  +    TVYLEI
Sbjct  59   DEFRQVLQSLEASIVYFQGEQVEDREEIGSLRWADVDLSTPESLCGLFGSTLPPTVYLEI  118

Query  797  P  799
            P
Sbjct  119  P  119



>gb|KJB65462.1| hypothetical protein B456_010G095800 [Gossypium raimondii]
Length=754

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 86/122 (70%), Gaps = 2/122 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCG-RAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            +M+S Q +S++ CSLLA++CG   ++N  KQ V++++  YP  EIASSGRLEVQLL NPS
Sbjct  1    MMFSAQRSSRNHCSLLAILCGGEVSDNKQKQPVSNDKSRYPFPEIASSGRLEVQLLNNPS  60

Query  617  TDEFRKALDTVKPNIVFLQGDQ-LPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLE  793
             DE R+ L++ +PN+V+LQG+Q   ++E   LV    +LS+ EA+ GL  +   TTVYLE
Sbjct  61   IDEVRRVLESSEPNVVYLQGEQNADSEEIGYLVCGDVHLSTPEALYGLFGSTLPTTVYLE  120

Query  794  IP  799
             P
Sbjct  121  TP  122



>ref|XP_003627823.1| hypothetical protein MTR_8g038730 [Medicago truncatula]
 gb|ABE87648.1| DNA binding , related [Medicago truncatula]
 gb|AET02299.1| AT-rich interactive domain protein [Medicago truncatula]
Length=204

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 75/121 (62%), Gaps = 5/121 (4%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVC-GRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            L +  QGTSK +C+LLAV    R+ E    Q     +  YP  E+ SSGRLEVQ L NP 
Sbjct  2    LQFQPQGTSKQTCTLLAVTSETRSVE----QKQLQNQHKYPIPELVSSGRLEVQTLCNPE  57

Query  617  TDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
             ++FRK L++ KPN V+ QG+QL ++E  SLVW+G  LS+ E IS L      T VYLEI
Sbjct  58   KEQFRKVLESCKPNFVYFQGEQLLDEEVGSLVWKGVELSNPEEISELFDTTLPTAVYLEI  117

Query  797  P  799
            P
Sbjct  118  P  118



>ref|XP_002277324.2| PREDICTED: AT-rich interactive domain-containing protein 4 [Vitis 
vinifera]
Length=740

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 83/121 (69%), Gaps = 6/121 (5%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+ VQ  S++ C+LLAVVCG+    I   +   + P YP  E+ SSGRLEVQ+LKNPS 
Sbjct  1    MMFHVQAASRNHCALLAVVCGK----IPVSEDQQQHP-YPFPELVSSGRLEVQILKNPSI  55

Query  620  DEFRKALDTVKPNIVFLQGDQLP-NDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
             EF+++L++++PN ++LQG+QLP ++E  SL W G +LSS EA+  L      TTVYLE 
Sbjct  56   HEFQRSLESLEPNFLYLQGEQLPGSEEIGSLTWGGVDLSSAEALVELFGPTLPTTVYLET  115

Query  797  P  799
            P
Sbjct  116  P  116



>ref|XP_007135372.1| hypothetical protein PHAVU_010G123900g [Phaseolus vulgaris]
 gb|ESW07366.1| hypothetical protein PHAVU_010G123900g [Phaseolus vulgaris]
Length=781

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 15/124 (12%)
 Frame = +2

Query  446  YSVQGTSKHSCSLLAVVCG------RAAENIYKQDVADERPGYPTSEIASSGRLEVQLLK  607
            +   G  KH+C+LLAV CG      +A++N +K         YP  E+ S+GRLEVQ L+
Sbjct  4    FHPHGAPKHACTLLAVTCGASFAEHKASQNQHK---------YPFPELVSAGRLEVQTLR  54

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            NP  ++FRK L++ +PN V+LQG+QL ND+  SLVW+G  LS+ E I  L  +   T VY
Sbjct  55   NPDKEQFRKVLESYQPNFVYLQGEQLENDKVGSLVWQGLELSTSEDIIELFGSTLPTAVY  114

Query  788  LEIP  799
            LEIP
Sbjct  115  LEIP  118



>ref|XP_010092743.1| hypothetical protein L484_024638 [Morus notabilis]
 gb|EXB52088.1| hypothetical protein L484_024638 [Morus notabilis]
Length=226

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG+SK +CSLL V CG+ +E+  K+DV + +P YP  E+ S GRLEVQ L +PS +
Sbjct  1    MFHSQGSSKQTCSLLVVTCGKVSESKCKKDVPENQPLYPFPELVSLGRLEVQTLTSPSKE  60

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVW  715
            EF K L++ KPN+V+LQG+QL NDE   LVW
Sbjct  61   EFSKLLESYKPNLVYLQGEQLGNDEVGPLVW  91



>ref|XP_010087779.1| hypothetical protein L484_016350 [Morus notabilis]
 gb|EXB29860.1| hypothetical protein L484_016350 [Morus notabilis]
Length=150

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +2

Query  452  VQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTDEFR  631
            V+G+SK +CSLL V  G+ +E+  K+DV + +P YP+ E+ SSG LEVQ L NPS +EF 
Sbjct  55   VEGSSKQTCSLLVVTRGKVSESKRKKDVPENQPLYPSPELVSSGHLEVQTLTNPSKEEFS  114

Query  632  KALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNL  730
            K L++ KPN+V+LQG+QL NDE   LVW   +L
Sbjct  115  KLLESYKPNLVYLQGEQLGNDEVGPLVWGDVDL  147



>ref|XP_004303747.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=779

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 78/119 (66%), Gaps = 4/119 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QGT    CS+L V CG  +E+   ++  +++  YP  E+ SSGRLEVQ L NPS +
Sbjct  1    MFHAQGT----CSVLVVTCGEISEDKRGKETPEDKLRYPFPELVSSGRLEVQTLTNPSEE  56

Query  623  EFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF K L++ KPN+V+LQG+QL NDE   LVW    LS+ E++S +  A   TTVYLE+P
Sbjct  57   EFCKLLESYKPNLVYLQGEQLENDEVGPLVWRDAYLSTAESMSDIFDATLPTTVYLEVP  115



>emb|CBI27746.3| unnamed protein product [Vitis vinifera]
Length=739

 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 6/120 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+ VQ  S++ C+LLAVVCG+    I   +   + P YP  E+ SSGRLEVQ+LKNPS  
Sbjct  1    MFHVQAASRNHCALLAVVCGK----IPVSEDQQQHP-YPFPELVSSGRLEVQILKNPSIH  55

Query  623  EFRKALDTVKPNIVFLQGDQLP-NDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF+++L++++PN ++LQG+QLP ++E  SL W G +LSS EA+  L      TTVYLE P
Sbjct  56   EFQRSLESLEPNFLYLQGEQLPGSEEIGSLTWGGVDLSSAEALVELFGPTLPTTVYLETP  115



>ref|XP_010047433.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Eucalyptus 
grandis]
 gb|KCW79346.1| hypothetical protein EUGRSUZ_C00764 [Eucalyptus grandis]
Length=746

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M  V+G  ++ CSLLAV+CG  ++N +K  + +++  YP  E+ SSGRLEV  L NPST
Sbjct  1    MMLHVKGPHRNRCSLLAVLCGEVSDNKHKHVIPEDQSTYPFPELTSSGRLEVTSLNNPST  60

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEFR+AL++++P+I++L+G+Q  + +E  SLVW    LS+ + +  L  +   + VYLEI
Sbjct  61   DEFRRALESLEPSILYLRGEQREDGEELGSLVWRNAYLSTPDDLCALFGSTLPSAVYLEI  120

Query  797  P  799
            P
Sbjct  121  P  121



>ref|XP_003547888.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Glycine max]
 gb|KHN39580.1| AT-rich interactive domain-containing protein 4 [Glycine soja]
Length=782

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 77/118 (65%), Gaps = 3/118 (3%)
 Frame = +2

Query  446  YSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTDE  625
            +  QGT KH+C+LLAV C  ++    +  ++  +  YP  E+ S+GRLEVQ L +P  ++
Sbjct  4    FHSQGTPKHTCTLLAVTCRTSSA---EHKLSHAQRTYPFPELVSAGRLEVQTLCSPEKEQ  60

Query  626  FRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            FRK L++ +PN V+L+GDQL N E  SLVW+G  LS+ E I+ L  +   T VYLEIP
Sbjct  61   FRKVLESFQPNFVYLRGDQLENGEVGSLVWQGVELSTCEDITELFGSTLPTAVYLEIP  118



>ref|XP_012077118.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Jatropha 
curcas]
 gb|KDP33968.1| hypothetical protein JCGZ_07539 [Jatropha curcas]
Length=750

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  QG S++ CSLLAV+C + +++  KQ  + ++P YP  E+ SSGRLEVQLL +P T
Sbjct  1    MMFHAQGPSRNHCSLLAVLCSKTSDSKQKQPASGDKPKYPFPELVSSGRLEVQLLASPGT  60

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            DEFR+ L + +PNIV+LQG+ + + +E  SL     +LS+ E +  L  +    TVYLE 
Sbjct  61   DEFRRVLQSSEPNIVYLQGEVIEDSEEIGSLRLGDVDLSNPETLCDLFGSTLPATVYLET  120

Query  797  P  799
            P
Sbjct  121  P  121



>ref|XP_011651722.1| PREDICTED: AT-rich interactive domain-containing protein 4 isoform 
X1 [Cucumis sativus]
 ref|XP_011651723.1| PREDICTED: AT-rich interactive domain-containing protein 4 isoform 
X1 [Cucumis sativus]
 gb|KGN58471.1| hypothetical protein Csa_3G646580 [Cucumis sativus]
Length=784

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +++SV   ++ +CSLLAV CG   +   +++V +++  YP  E+ S GRLEV++L NPS 
Sbjct  1    MLHSVV-AARQTCSLLAVTCGNVPKVKCEEEVDEDKLKYPFPELVSCGRLEVRVLANPSK  59

Query  620  DEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            DEF + +++  P+ V+LQG+QL NDE  SLVW G +LS E+ + GL +A   T VYLEIP
Sbjct  60   DEFSRIVESCLPSFVYLQGEQLGNDEIGSLVWNGVDLSLED-LCGLFNAALPTFVYLEIP  118



>ref|XP_009391205.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391206.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391207.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=771

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M   QG  + +C LLAV+CG+ A+   ++  A  RP YP  E+ SSGRLEVQ L NP+ D
Sbjct  1    MSQPQGYGRENCILLAVLCGQFADR--RRGDAKNRPQYPFPELVSSGRLEVQTLINPTVD  58

Query  623  EFRKALDTVKPNIVFLQGDQLPNDE-FSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
             F +A   V+PNI++ QG+QL N+E   SLVW G ++S  E ++   S    T VYLEIP
Sbjct  59   RFSEAQKLVQPNILYFQGEQLENEEQIGSLVWGGVDVSDSEMLTSFISPPLPTIVYLEIP  118



>ref|XP_003627434.1| Fiber protein Fb21 [Medicago truncatula]
 gb|AET01910.1| ARID/bright DNA-binding domain protein [Medicago truncatula]
Length=769

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            L +  QGTSK +C+LLAV    +     +Q     +  YP  E+ SSGRLEVQ L NP  
Sbjct  2    LQFQPQGTSKQTCTLLAVT---SETRSVEQKQLQNQQKYPFPELVSSGRLEVQTLCNPEK  58

Query  620  DEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            ++FRK L++ KPN V+ QG+QL ++E  SLVW+G   S+ E IS L      T VYLEIP
Sbjct  59   EQFRKVLESCKPNFVYFQGEQLLDEEVGSLVWQGGEFSNPEEISELFDTTLPTAVYLEIP  118



>ref|XP_007138611.1| hypothetical protein PHAVU_009G223200g [Phaseolus vulgaris]
 gb|ESW10605.1| hypothetical protein PHAVU_009G223200g [Phaseolus vulgaris]
Length=753

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQD---VADERPGYPTSEIASSGRLEVQLLKN  610
            +M+  QG S+H CSLLAV+ G+  +   KQ     ++++P YP  E++SSG LEV+LL  
Sbjct  1    MMFHSQGASRH-CSLLAVLSGKLRDTKQKQKQSAASEDQPPYPFPELSSSGSLEVKLLIK  59

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+TDE  +AL+ ++P+ V+LQG  L +  E   LVWE F+LS+ EA+ GL  ++   TVY
Sbjct  60   PNTDELGRALEQLQPDFVYLQGQLLEDRGEIGPLVWEDFDLSAPEALCGLFGSKLPNTVY  119

Query  788  LEIP  799
            LE P
Sbjct  120  LETP  123



>ref|XP_004510562.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Cicer arietinum]
Length=783

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 5/121 (4%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCG-RAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            L +  QG+SK +C+LL V    R AE  + Q+  +    +P  E+ SSGRLEVQ L NP 
Sbjct  2    LQFHPQGSSKQTCTLLTVTSATRCAEQKHPQNHHN----FPFPELVSSGRLEVQTLCNPE  57

Query  617  TDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
             ++F K L++ +P+IV+LQG+QL N+E  S+VW+G  LS+ E IS L      T VYLEI
Sbjct  58   KEQFCKVLESYQPSIVYLQGEQLVNEEVGSVVWQGVELSTPEDISELFGTSLPTAVYLEI  117

Query  797  P  799
            P
Sbjct  118  P  118



>ref|XP_008797363.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X2 [Phoenix dactylifera]
Length=782

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+ VQG +K +CSLLAV+CG+ A    +   A +R  YP  E+ SSGRLEVQ L NP+ +
Sbjct  1    MFHVQGFAKQNCSLLAVLCGKFAHR--QSGEARQRSLYPFPELVSSGRLEVQTLNNPTFE  58

Query  623  EFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            ++ +   +V+PN ++ QG+QL N +E  SL W  FN    +A S L S    T VYLE+P
Sbjct  59   KYSEVQKSVQPNFLYFQGEQLENEEEIGSLTWGTFNALDPQAFSSLISPPLPTIVYLEVP  118



>ref|XP_008797362.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X1 [Phoenix dactylifera]
Length=852

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+ VQG +K +CSLLAV+CG+ A    +   A +R  YP  E+ SSGRLEVQ L NP+ +
Sbjct  1    MFHVQGFAKQNCSLLAVLCGKFAHR--QSGEARQRSLYPFPELVSSGRLEVQTLNNPTFE  58

Query  623  EFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            ++ +   +V+PN ++ QG+QL N +E  SL W  FN    +A S L S    T VYLE+P
Sbjct  59   KYSEVQKSVQPNFLYFQGEQLENEEEIGSLTWGTFNALDPQAFSSLISPPLPTIVYLEVP  118



>ref|XP_003546529.2| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Glycine max]
Length=751

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 83/124 (67%), Gaps = 5/124 (4%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQD---VADERPGYPTSEIASSGRLEVQLLKN  610
            +M   QG S+H CSLLAV+ G++ +   KQ     ++++  YP  E++SSGRLEV++L  
Sbjct  1    MMLHSQGVSRH-CSLLAVLSGKSRDIKQKQKQGTASEDQFPYPFPELSSSGRLEVKVLTK  59

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+ DE  ++L+ ++P+ V+LQG QL + +E   LVWE F+LS  EA+ GL S++   TVY
Sbjct  60   PTADELGRSLEQLQPDFVYLQGQQLEDSEEIGPLVWEDFDLSVPEALCGLFSSKIPNTVY  119

Query  788  LEIP  799
            LE P
Sbjct  120  LETP  123



>ref|XP_006828651.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Amborella 
trichopoda]
 gb|ERM96067.1| hypothetical protein AMTR_s00129p00111730 [Amborella trichopoda]
Length=810

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 5/123 (4%)
 Frame = +2

Query  443  MYSVQGT---SKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNP  613
            M   QGT    K SC LL V+CG+ ++   KQ+ A++RP YP  E+ SSGRLEVQ++ NP
Sbjct  1    MLQGQGTYSVPKQSCILLGVLCGKRSDK-EKQENAEDRPVYPFPELVSSGRLEVQIITNP  59

Query  614  STDEFRKALDTVKPNIVFLQGDQ-LPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYL  790
            S++EF++ L++   + V+LQG+Q L  DE   LV    N+SS +AI+ L  ++  +TVYL
Sbjct  60   SSEEFKRVLESSDFDFVYLQGEQSLHKDEVGPLVLGDVNISSADAITRLFGSKLPSTVYL  119

Query  791  EIP  799
            EIP
Sbjct  120  EIP  122



>gb|AES65616.2| ARID/bright DNA-binding domain protein [Medicago truncatula]
Length=758

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 83/128 (65%), Gaps = 9/128 (7%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVA-------DERPGYPTSEIASSGRLEVQ  598
            +M+  QG S+H CSLLAV+ G++ ++  KQ          D+   YP  E++SSGRLEV+
Sbjct  1    MMFHFQGVSRH-CSLLAVLSGKSHDSKQKQKQKQDDDASEDQFSSYPFPELSSSGRLEVK  59

Query  599  LLKNPSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSL  775
            +L  P+ DE  + L+ ++P+ V+LQG QL +  E  SLVWE F+LS+ EA+ GL S++  
Sbjct  60   VLTKPTFDELARVLEQLQPDFVYLQGQQLDDSGEIGSLVWEDFDLSTPEALCGLFSSKLP  119

Query  776  TTVYLEIP  799
             TVYLE P
Sbjct  120  NTVYLETP  127



>ref|XP_003595365.1| Fiber protein-like protein [Medicago truncatula]
Length=844

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 83/128 (65%), Gaps = 9/128 (7%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVA-------DERPGYPTSEIASSGRLEVQ  598
            +M+  QG S+H CSLLAV+ G++ ++  KQ          D+   YP  E++SSGRLEV+
Sbjct  1    MMFHFQGVSRH-CSLLAVLSGKSHDSKQKQKQKQDDDASEDQFSSYPFPELSSSGRLEVK  59

Query  599  LLKNPSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSL  775
            +L  P+ DE  + L+ ++P+ V+LQG QL +  E  SLVWE F+LS+ EA+ GL S++  
Sbjct  60   VLTKPTFDELARVLEQLQPDFVYLQGQQLDDSGEIGSLVWEDFDLSTPEALCGLFSSKLP  119

Query  776  TTVYLEIP  799
             TVYLE P
Sbjct  120  NTVYLETP  127



>gb|KHN34213.1| AT-rich interactive domain-containing protein 4 [Glycine soja]
Length=753

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQD---VADERPGYPTSEIASSGRLEVQLLKN  610
            +M   QG S+H CSLLAV+ G++ +   KQ     ++++  YP  E++SSGRLEV++L  
Sbjct  1    MMLHSQGVSRH-CSLLAVLSGKSRDIKQKQKQGTASEDQFPYPFPELSSSGRLEVKVLTK  59

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+ DE  ++L+ ++P+ V+LQG QL +  E   LVWE F+LS  EA+ GL S++   TVY
Sbjct  60   PTADELGRSLEQLQPDFVYLQGQQLEDSGEIGPLVWEDFDLSVPEALCGLFSSKIPNTVY  119

Query  788  LEIP  799
            LE P
Sbjct  120  LETP  123



>ref|XP_004973595.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X3 [Setaria italica]
Length=685

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 77/127 (61%), Gaps = 11/127 (9%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQD----VADE----RPGYPTSEIASSGRLEVQ  598
            M  +Q TS+H+  LLAV+C + AE   KQ     +A E    R  YP  E+ SSGRLEV 
Sbjct  1    MSQIQSTSRHNSVLLAVLCRKFAE---KQQTPARLAPEPKRVRRSYPFPELVSSGRLEVH  57

Query  599  LLKNPSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLT  778
             L NPS ++FR+A   V+PN+++LQG QL N+E  SLVW   +LS  +  S L S    T
Sbjct  58   TLINPSVEQFREAQQAVQPNLLYLQGQQLENEEIGSLVWGDTDLSDLQTFSSLISPPFPT  117

Query  779  TVYLEIP  799
             VYLE+P
Sbjct  118  IVYLEVP  124



>ref|XP_008460342.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Cucumis melo]
 ref|XP_008460343.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Cucumis melo]
 ref|XP_008460344.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Cucumis melo]
Length=784

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 81/120 (68%), Gaps = 2/120 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +++SV   ++ +CSLLAV CG   +   ++++ +++  YP  E+ SSGRLEV++L NPS 
Sbjct  1    MLHSVVA-ARQTCSLLAVTCGNVPKVQCEEEIDEDKLKYPFPELVSSGRLEVRVLANPSK  59

Query  620  DEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            DEF + +++  P+ V+LQG+QL +DE  SLVW   +LS E+ + GL +    T VYLEIP
Sbjct  60   DEFSRIVESWLPSFVYLQGEQLGSDEIGSLVWNDVDLSLED-LCGLFNTALPTIVYLEIP  118



>ref|XP_009382962.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=753

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+   G SK +C L+AV+CG+      + +V  + P YP  E+ SSGRLEV  L NPS 
Sbjct  1    MMHQTHGFSKQTCRLVAVLCGKFTGK--RNEVKRQHP-YPFPELVSSGRLEVHTLVNPSV  57

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            D FR+A  ++KPNI++ QG +L N +E  +LVW   ++S  +  S L      TTVYLE+
Sbjct  58   DSFREAQKSLKPNILYFQGSELENEEEIGTLVWGDLDVSKPDMFSALIDPPLPTTVYLEV  117

Query  797  P  799
            P
Sbjct  118  P  118



>ref|XP_004488152.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=755

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 79/125 (63%), Gaps = 6/125 (5%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQD----VADERPGYPTSEIASSGRLEVQLLK  607
            +M   QG S+H CSLLAV+ G++ +   KQ       D+   Y   E++SSGRLEV++L 
Sbjct  1    MMLHFQGVSRH-CSLLAVLSGKSHDTKQKQKENDASEDQYSSYHFPELSSSGRLEVKVLN  59

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
             PS DE  + L+ ++P+ V+LQG QL +  E  SLVWE F+LS+ EA+  L S++   TV
Sbjct  60   KPSADELGRVLEQLQPDFVYLQGQQLDDGGEIGSLVWEDFDLSTPEALCELFSSKLPNTV  119

Query  785  YLEIP  799
            YLE P
Sbjct  120  YLETP  124



>ref|XP_004973593.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X1 [Setaria italica]
 ref|XP_004973594.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X2 [Setaria italica]
Length=766

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 77/127 (61%), Gaps = 11/127 (9%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQD----VADE----RPGYPTSEIASSGRLEVQ  598
            M  +Q TS+H+  LLAV+C + AE   KQ     +A E    R  YP  E+ SSGRLEV 
Sbjct  1    MSQIQSTSRHNSVLLAVLCRKFAE---KQQTPARLAPEPKRVRRSYPFPELVSSGRLEVH  57

Query  599  LLKNPSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLT  778
             L NPS ++FR+A   V+PN+++LQG QL N+E  SLVW   +LS  +  S L S    T
Sbjct  58   TLINPSVEQFREAQQAVQPNLLYLQGQQLENEEIGSLVWGDTDLSDLQTFSSLISPPFPT  117

Query  779  TVYLEIP  799
             VYLE+P
Sbjct  118  IVYLEVP  124



>ref|XP_004488153.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=761

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 79/125 (63%), Gaps = 6/125 (5%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQD----VADERPGYPTSEIASSGRLEVQLLK  607
            +M   QG S+H CSLLAV+ G++ +   KQ       D+   Y   E++SSGRLEV++L 
Sbjct  1    MMLHFQGVSRH-CSLLAVLSGKSHDTKQKQKENDASEDQYSSYHFPELSSSGRLEVKVLN  59

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
             PS DE  + L+ ++P+ V+LQG QL +  E  SLVWE F+LS+ EA+  L S++   TV
Sbjct  60   KPSADELGRVLEQLQPDFVYLQGQQLDDGGEIGSLVWEDFDLSTPEALCELFSSKLPNTV  119

Query  785  YLEIP  799
            YLE P
Sbjct  120  YLETP  124



>ref|XP_008783147.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Phoenix dactylifera]
 ref|XP_008783156.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Phoenix dactylifera]
 ref|XP_008783165.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Phoenix dactylifera]
 ref|XP_008783173.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Phoenix dactylifera]
Length=785

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (58%), Gaps = 3/120 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+     SK  C L+AV CG+ AE   K++    +P YP  E+ SSGRLEV  L NP+ D
Sbjct  1    MFQAPSFSKQGCRLIAVSCGKFAER--KREQVKHQPSYPFPELVSSGRLEVHTLVNPTLD  58

Query  623  EFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            + R A  ++ PNI++ QG+QL N +E  SLVW   N S  +  S L      T VYLE+P
Sbjct  59   QIRDAQKSLDPNILYFQGEQLENEEEIGSLVWGNINASEPQTFSSLIGPSLPTIVYLEVP  118



>ref|XP_003533805.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=752

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQ---DVADERPGYPTSEIASSGRLEVQLLKN  610
            +M+  QG S+H CSLLAV+ G++ +   KQ   + ++++  YP  E++SSGRLEV++L  
Sbjct  1    MMFHSQGVSRH-CSLLAVLSGKSRDIKQKQKQGNASEDQFPYPFPELSSSGRLEVKVLIE  59

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+ DE   AL+ ++P+ V+LQG QL +  E   L WE F+LS  EA+ GL S++   TVY
Sbjct  60   PTADELGLALEQLQPDFVYLQGQQLEDRGEIGPLGWEDFDLSVPEALCGLFSSKLPNTVY  119

Query  788  LEIP  799
            LE P
Sbjct  120  LETP  123



>gb|EEC83666.1| hypothetical protein OsI_29439 [Oryza sativa Indica Group]
Length=761

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 75/125 (60%), Gaps = 6/125 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-----DVADERPGYPTSEIASSGRLEVQLLK  607
            M  +Q +S  +C+LLAV+CG+  +   K      +V   R  YP  E+ SSGRLEV  L 
Sbjct  1    MAQIQSSSLVNCTLLAVLCGKVTDKQQKPPGLVPEVKRPRLSYPFPELISSGRLEVHTLI  60

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+ D+FRKA   V+PN+++LQG QL N +E  +LVW   ++S  +  S L S    T V
Sbjct  61   NPTVDQFRKAQQAVQPNLMYLQGQQLENEEEIGTLVWGDADVSDPQIFSSLISPPFPTIV  120

Query  785  YLEIP  799
            YLE+P
Sbjct  121  YLEVP  125



>ref|NP_001061946.1| Os08g0451400 [Oryza sativa Japonica Group]
 dbj|BAF23860.1| Os08g0451400 [Oryza sativa Japonica Group]
 gb|EEE68794.1| hypothetical protein OsJ_27533 [Oryza sativa Japonica Group]
Length=761

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 75/125 (60%), Gaps = 6/125 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-----DVADERPGYPTSEIASSGRLEVQLLK  607
            M  +Q +S  +C+LLAV+CG+  +   K      +V   R  YP  E+ SSGRLEV  L 
Sbjct  1    MAQIQSSSLVNCTLLAVLCGKVTDKQQKPPGLVPEVKRPRLSYPFPELISSGRLEVHTLI  60

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+ D+FRKA   V+PN+++LQG QL N +E  +LVW   ++S  +  S L S    T V
Sbjct  61   NPTVDQFRKAQQAVQPNLMYLQGQQLENEEEIGTLVWGDADVSDPQIFSSLISPPFPTIV  120

Query  785  YLEIP  799
            YLE+P
Sbjct  121  YLEVP  125



>ref|NP_001063250.1| Os09g0434100 [Oryza sativa Japonica Group]
 dbj|BAF25164.1| Os09g0434100 [Oryza sativa Japonica Group]
Length=295

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 5/124 (4%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADE----RPGYPTSEIASSGRLEVQLLKN  610
            M  +Q  S+ +C LLAV+CG+ AE   +     E    RP YP  E++SSGRLEV  L N
Sbjct  1    MSQIQSFSRQNCVLLAVLCGKHAEKRAQARSGLEAKRLRPSYPFPELSSSGRLEVHTLFN  60

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+ ++F +A   V+PN +++QG QL ++ E  SLVW   ++S  +A S L S    T VY
Sbjct  61   PTPEQFLEAQRVVQPNFLYIQGQQLEDEKEIGSLVWGDNDVSDPQAFSCLISPPFPTIVY  120

Query  788  LEIP  799
            LE+P
Sbjct  121  LEVP  124



>ref|XP_008651353.1| PREDICTED: uncharacterized protein LOC100279908 isoform X1 [Zea 
mays]
Length=768

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 77/125 (62%), Gaps = 6/125 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-----DVADERPGYPTSEIASSGRLEVQLLK  607
            M  +Q  S+++C+LLAV+CG+ AEN         +    RP YP  E++S+GRLEV  L 
Sbjct  1    MSQIQSFSRNNCALLAVLCGKYAENRTPAARSGLEAKRPRPAYPFPELSSAGRLEVHTLF  60

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+ ++F +A   V+PN +++QG QL ++ E  SLVW   ++S  +A S L S    T V
Sbjct  61   NPTPEQFLEAQRVVQPNFLYIQGQQLEDEKEIGSLVWGDADVSDPQAFSTLISPPFPTIV  120

Query  785  YLEIP  799
            YLE+P
Sbjct  121  YLEVP  125



>ref|XP_008800473.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X1 [Phoenix dactylifera]
Length=823

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 70/120 (58%), Gaps = 3/120 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  Q  SK  C L+AV+CG+ AE    ++    RP YP  E+ SSGRLEV  L NP+ D
Sbjct  1    MFQAQSFSKPGCRLIAVLCGKFAER--PREELKHRPLYPFPELVSSGRLEVHTLVNPTLD  58

Query  623  EFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            + R    ++ PNI++ QG+QL N +E  SLVW   ++S  +  S L      T VYLE+P
Sbjct  59   KIRDVQKSLDPNILYFQGEQLENEEEIGSLVWGTVDVSEPQIFSSLIGPSLPTIVYLEVP  118



>ref|XP_008800474.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X2 [Phoenix dactylifera]
Length=784

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 70/120 (58%), Gaps = 3/120 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  Q  SK  C L+AV+CG+ AE    ++    RP YP  E+ SSGRLEV  L NP+ D
Sbjct  1    MFQAQSFSKPGCRLIAVLCGKFAER--PREELKHRPLYPFPELVSSGRLEVHTLVNPTLD  58

Query  623  EFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            + R    ++ PNI++ QG+QL N +E  SLVW   ++S  +  S L      T VYLE+P
Sbjct  59   KIRDVQKSLDPNILYFQGEQLENEEEIGSLVWGTVDVSEPQIFSSLIGPSLPTIVYLEVP  118



>gb|EEC84628.1| hypothetical protein OsI_31490 [Oryza sativa Indica Group]
Length=766

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 5/124 (4%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADE----RPGYPTSEIASSGRLEVQLLKN  610
            M  +Q  S+ +C LLAV+CG+ AE   +     E    RP YP  E++SSGRLEV  L N
Sbjct  1    MSQIQSFSRQNCVLLAVLCGKHAEKRAQARSGPEAKRLRPSYPFPELSSSGRLEVHTLFN  60

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+ ++F +A   V+PN +++QG QL ++ E  SLVW   ++S  +A S L S    T VY
Sbjct  61   PTPEQFLEAQRVVQPNFLYIQGQQLEDEKEIGSLVWGDNDVSDPQAFSCLISPPFPTIVY  120

Query  788  LEIP  799
            LE+P
Sbjct  121  LEVP  124



>ref|XP_010917383.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Elaeis guineensis]
Length=785

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+ VQG +K +CSLLAV+CG+      +   A  R  YP  E+ SSGRLEVQ L NP+ +
Sbjct  1    MFHVQGFAKQNCSLLAVLCGKFDHR--QSGEARWRSLYPYPELVSSGRLEVQTLNNPTFE  58

Query  623  EFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            +F +   +V+PN ++ QG+QL N +E  SL W   + S  +  S L S    T VYLE+P
Sbjct  59   KFSEVQKSVQPNFLYFQGEQLENEEEIGSLTWGTLDASDPQEFSSLISPPLPTIVYLEVP  118



>ref|XP_010937271.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Elaeis guineensis]
 ref|XP_010937272.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Elaeis guineensis]
Length=784

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 69/120 (58%), Gaps = 3/120 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+     SK  C L+AV+CG  AE   K++    R  YP  E+ SSGRLEV  L NP+ D
Sbjct  1    MFQAPSFSKQGCRLIAVLCGEFAER--KREEVKHRSSYPFPELVSSGRLEVHTLVNPTLD  58

Query  623  EFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            + R A  ++ PNI++ QG+QL N +E  SLVW   ++S  +  S L      T VYLE+P
Sbjct  59   KIRDAQKSLDPNILYFQGEQLENEEEIGSLVWGTVDVSEPQTFSSLIGPSLPTIVYLEVP  118



>gb|EEE69768.1| hypothetical protein OsJ_29479 [Oryza sativa Japonica Group]
Length=765

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 5/124 (4%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADE----RPGYPTSEIASSGRLEVQLLKN  610
            M  +Q  S+ +C LLAV+CG+ AE   +     E    RP YP  E++SSGRLEV  L N
Sbjct  1    MSQIQSFSRQNCVLLAVLCGKHAEKRAQARSGLEAKRLRPSYPFPELSSSGRLEVHTLFN  60

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+ ++F +A   V+PN +++QG QL ++ E  SLVW   ++S  +A S L S    T VY
Sbjct  61   PTPEQFLEAQRVVQPNFLYIQGQQLEDEKEIGSLVWGDNDVSDPQAFSCLISPPFPTIVY  120

Query  788  LEIP  799
            LE+P
Sbjct  121  LEVP  124



>ref|XP_006419128.1| hypothetical protein EUTSA_v10002415mg [Eutrema salsugineum]
 gb|ESQ37564.1| hypothetical protein EUTSA_v10002415mg [Eutrema salsugineum]
Length=743

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 80/121 (66%), Gaps = 4/121 (3%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  QG S++ C+++AVVCG  ++N   Q     +P YP  +++SSGRL+ Q+L NP+T
Sbjct  1    MMFHGQGFSRNRCNVVAVVCGELSDN---QKAEAHQPNYPIPDLSSSGRLKFQVLNNPTT  57

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            +EF+ A+++  P+IV+LQG+Q  + DE   LV    + S+ +A+  L  +   TTVYLE+
Sbjct  58   EEFQVAINSSAPDIVYLQGEQSGDSDEVGPLVLGYADFSTPDALVTLFGSTLPTTVYLEL  117

Query  797  P  799
            P
Sbjct  118  P  118



>ref|XP_003578160.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Brachypodium 
distachyon]
Length=769

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 73/125 (58%), Gaps = 6/125 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-----DVADERPGYPTSEIASSGRLEVQLLK  607
            M  +Q  S+ SC LLAV+CG+ A+    Q     +    RP YP  E+ SSGRLEV  L 
Sbjct  1    MSQIQSLSRQSCVLLAVLCGKHADKRLLQGRSGPEAKRPRPSYPFPELGSSGRLEVHTLF  60

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+ ++F +A   V+PN +++QG QL ++ E  SLVW   ++S  +A   L S    T V
Sbjct  61   NPTPEQFLEAQRVVQPNFLYIQGQQLEDEKEIGSLVWGDTDMSDPQAFVCLISPPFPTIV  120

Query  785  YLEIP  799
            YLE+P
Sbjct  121  YLEVP  125



>ref|XP_006587068.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X3 [Glycine max]
Length=772

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 82/124 (66%), Gaps = 6/124 (5%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQ---DVADERPGYPTSEIASSGRLEVQLLKN  610
            L+Y  +G S+H CSLLAV+ G++ +   KQ   + ++++  YP  E++SSGRLEV++L  
Sbjct  22   LLYQ-KGVSRH-CSLLAVLSGKSRDIKQKQKQGNASEDQFPYPFPELSSSGRLEVKVLIE  79

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+ DE   AL+ ++P+ V+LQG QL +  E   L WE F+LS  EA+ GL S++   TVY
Sbjct  80   PTADELGLALEQLQPDFVYLQGQQLEDRGEIGPLGWEDFDLSVPEALCGLFSSKLPNTVY  139

Query  788  LEIP  799
            LE P
Sbjct  140  LETP  143



>ref|XP_006587067.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=795

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 79/119 (66%), Gaps = 5/119 (4%)
 Frame = +2

Query  455  QGTSKHSCSLLAVVCGRAAENIYKQ---DVADERPGYPTSEIASSGRLEVQLLKNPSTDE  625
            +G S+H CSLLAV+ G++ +   KQ   + ++++  YP  E++SSGRLEV++L  P+ DE
Sbjct  49   KGVSRH-CSLLAVLSGKSRDIKQKQKQGNASEDQFPYPFPELSSSGRLEVKVLIEPTADE  107

Query  626  FRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
               AL+ ++P+ V+LQG QL +  E   L WE F+LS  EA+ GL S++   TVYLE P
Sbjct  108  LGLALEQLQPDFVYLQGQQLEDRGEIGPLGWEDFDLSVPEALCGLFSSKLPNTVYLETP  166



>gb|KHN47629.1| AT-rich interactive domain-containing protein 4 [Glycine soja]
Length=855

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 79/119 (66%), Gaps = 5/119 (4%)
 Frame = +2

Query  455  QGTSKHSCSLLAVVCGRAAENIYKQ---DVADERPGYPTSEIASSGRLEVQLLKNPSTDE  625
            +G S+H CSLLAV+ G++ +   KQ   + ++++  YP  E++SSGRLEV++L  P+ DE
Sbjct  107  KGVSRH-CSLLAVLSGKSRDIKQKQKQGNASEDQFPYPFPELSSSGRLEVKVLIEPTADE  165

Query  626  FRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
               AL+ ++P+ V+LQG QL +  E   L WE F+LS  EA+ GL S++   TVYLE P
Sbjct  166  LGLALEQLQPDFVYLQGQQLEDRGEIGPLGWEDFDLSVPEALCGLFSSKLPNTVYLETP  224



>ref|XP_006661267.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Oryza brachyantha]
Length=768

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 75/126 (60%), Gaps = 7/126 (6%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ------DVADERPGYPTSEIASSGRLEVQLL  604
            M  +Q  S+ +C LLAV+CG+ AE   +       +    RP YP  E++SSGRLEV  L
Sbjct  1    MSQIQSFSRQNCVLLAVLCGKHAEKRPQARPGQGPEAKRLRPSYPFPELSSSGRLEVHTL  60

Query  605  KNPSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTT  781
             NP+ ++F +A   V+PN +++QG QL ++ E  SLVW   ++S  +A S L S    T 
Sbjct  61   FNPTPEQFLEAQRMVQPNFLYIQGQQLEDEKEIGSLVWGDNDVSDPQAFSCLISPPFPTI  120

Query  782  VYLEIP  799
            VYLE+P
Sbjct  121  VYLEVP  126



>ref|XP_004956915.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Setaria italica]
Length=768

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-----DVADERPGYPTSEIASSGRLEVQLLK  607
            M  +Q  S+ +C LLAV+CG+ AE          +    RP YP  E++S GRLEV  L 
Sbjct  1    MSQIQSFSRSNCVLLAVLCGKHAEKRVTAAKSGPEAKRLRPSYPFPELSSVGRLEVHTLF  60

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+ ++F +A   V+PN +++QG+QL ++ E  SLVW   ++S  +A S L S    T V
Sbjct  61   NPTPEQFLEAQRVVQPNFLYIQGEQLEDEKEIGSLVWGDADVSDPQAFSTLISPPFPTIV  120

Query  785  YLEIP  799
            YLE+P
Sbjct  121  YLEVP  125



>ref|XP_008670211.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Zea mays]
 tpg|DAA40128.1| TPA: hypothetical protein ZEAMMB73_432104 [Zea mays]
Length=768

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-----DVADERPGYPTSEIASSGRLEVQLLK  607
            M  +Q  S+++C LL V+CG+ AE          +    RP YP  E++S+GRLEV  L 
Sbjct  1    MSQIQSFSRNNCVLLVVLCGKYAEKRAPAAKSGLEAKRPRPSYPFPELSSAGRLEVHTLF  60

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+ ++F +A   V+PN +++QG QL ++ E  SLVW   ++S  +A S L S    T V
Sbjct  61   NPTPEQFLEAQRVVQPNFLYIQGQQLEDEKEIGSLVWGDADVSDPQAFSTLISPPFPTIV  120

Query  785  YLEIP  799
            YLE+P
Sbjct  121  YLEVP  125



>ref|XP_003574575.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Brachypodium distachyon]
Length=766

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 71/123 (58%), Gaps = 5/123 (4%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADE----RPGYPTSEIASSGRLEVQLLKN  610
            M  +Q TS+    LL+V+CG+ AE   +   A E    +P YP+ E+ SSGRLEV+ L N
Sbjct  1    MSQIQSTSRQIYVLLSVLCGKYAER-QRSPAAPEAKQLQPSYPSPELISSGRLEVRTLIN  59

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYL  790
            P+  +F++ L  V+PN ++LQG +L N+E  +L W    +S       L +    T VYL
Sbjct  60   PTIAQFQETLQAVQPNFLYLQGQKLENEEIGTLAWHDVYVSDPHMFCSLITPPFPTIVYL  119

Query  791  EIP  799
            EIP
Sbjct  120  EIP  122



>dbj|BAJ99014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 73/126 (58%), Gaps = 8/126 (6%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-------DVADERPGYPTSEIASSGRLEVQL  601
            M  +Q  S+ SC LLAV+CG+ A+   +        +    RP YP  E++S+GRLEV  
Sbjct  1    MSQIQSLSR-SCVLLAVLCGKHADKQQRTPPGRSGPEAKRLRPSYPFPELSSAGRLEVHT  59

Query  602  LKNPSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTT  781
            L NP+ ++F +A   V+PN  ++QG QL ++E  SLVW   ++S  ++   L S    T 
Sbjct  60   LVNPTPEQFLEAQRVVQPNFFYIQGQQLEDEEIGSLVWGDADMSDPQSFVCLISPPFPTI  119

Query  782  VYLEIP  799
            VYLE+P
Sbjct  120  VYLEVP  125



>dbj|BAJ85134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 73/126 (58%), Gaps = 8/126 (6%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-------DVADERPGYPTSEIASSGRLEVQL  601
            M  +Q  S+ SC LLAV+CG+ A+   +        +    RP YP  E++S+GRLEV  
Sbjct  1    MSQIQSLSR-SCVLLAVLCGKHADKQQRTPPGRSGPEAKRLRPSYPFPELSSAGRLEVHT  59

Query  602  LKNPSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTT  781
            L NP+ ++F +A   V+PN  ++QG QL ++E  SLVW   ++S  ++   L S    T 
Sbjct  60   LVNPTPEQFLEAQRVVQPNFFYIQGQQLEDEEIGSLVWGDADMSDPQSFVCLISPPFPTI  119

Query  782  VYLEIP  799
            VYLE+P
Sbjct  120  VYLEVP  125



>ref|XP_009380144.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=774

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 74/115 (64%), Gaps = 8/115 (7%)
 Frame = +2

Query  464  SKHSCSLLAVVCGRAAENIYKQDVADERPGYPT--SEIASSGRLEVQLLKNPSTDEFRKA  637
            +K +C L+AV+CG+ AE   +++V   + G+ +   E+ SSGRLEV  L NP+ D FR A
Sbjct  4    TKQACRLIAVLCGKFAER--RREV---KRGHLSLFPELVSSGRLEVHTLVNPTMDSFRNA  58

Query  638  LDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
              +++PNI++ QG+QL N +E  +L W G ++S  E  S L +  S T VYLE+P
Sbjct  59   QKSLEPNILYFQGEQLENEEEIGTLFWGGIDVSEAETFSSLMAPPSPTIVYLEVP  113



>gb|EMT25617.1| hypothetical protein F775_26930 [Aegilops tauschii]
Length=773

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ--------DVADERPGYPTSEIASSGRLEVQ  598
            M  +Q  S+ SC LLAV+CG+ A+   ++        +    RP YP  E++S+GRLEV 
Sbjct  1    MSQIQSLSR-SCVLLAVLCGKHADKQQQRAPPGRSGPEAKRLRPSYPFPELSSAGRLEVH  59

Query  599  LLKNPSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLT  778
             L NP+ ++F +A   V+PN  ++QG QL ++E  SLVW   ++S  ++   L S    T
Sbjct  60   TLVNPTPEQFLEAQRLVQPNFFYIQGQQLEDEEIGSLVWGDADMSDPQSFVCLISPPFPT  119

Query  779  TVYLEIP  799
             VYLE+P
Sbjct  120  IVYLEVP  126



>gb|EMS66350.1| hypothetical protein TRIUR3_24005 [Triticum urartu]
Length=747

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ--------DVADERPGYPTSEIASSGRLEVQ  598
            M  +Q  S+ SC LLAV+CG+ A+   ++        +    RP YP  E++S+GRLEV 
Sbjct  1    MSQIQSLSR-SCVLLAVLCGKHADKQQQRAPPGRSGREAKRLRPSYPFPELSSAGRLEVH  59

Query  599  LLKNPSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLT  778
             L NP+ ++F +A   V+PN  ++QG QL ++E  SLVW   ++S  ++   L S    T
Sbjct  60   TLVNPTPEQFLEAQRLVQPNFFYIQGQQLEDEEIGSLVWGDADMSDPQSFVCLISPPFPT  119

Query  779  TVYLEIP  799
             VYLE+P
Sbjct  120  IVYLEVP  126



>ref|XP_010520513.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Tarenaya 
hassleriana]
Length=748

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 75/123 (61%), Gaps = 7/123 (6%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVA---DERPGYPTSEIASSGRLEVQLLKN  610
            +M++ QG S+  C++LAVVC    ++ +KQ      D +  YP  E++SSGRL+VQ+LKN
Sbjct  1    MMFNGQGFSRDRCNVLAVVC----DDKHKQQAPANEDHQRRYPFPELSSSGRLKVQVLKN  56

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYL  790
            PS DE    L++  P  V+LQG+Q    +    +  G+ LS+ + + G+  +   TTVYL
Sbjct  57   PSPDELGAVLESSAPEFVYLQGEQRGESDEVGPLGLGYELSTPDTLVGIFGSMLPTTVYL  116

Query  791  EIP  799
            E+P
Sbjct  117  EVP  119



>gb|EEC83462.1| hypothetical protein OsI_28965 [Oryza sativa Indica Group]
Length=522

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 5/117 (4%)
 Frame = +2

Query  464  SKHSCSLLAVVCGRA----AENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTDEFR  631
            S+  C++LAV+CG+     A           RP YP  E+ SSGRLEV +L NP+ D+F 
Sbjct  72   SRVKCTVLAVLCGKVGKQRAPPCPVPGSQRPRPSYPFPELISSGRLEVHMLINPTVDQFL  131

Query  632  KALDTVKPNIVFLQGDQLPNDE-FSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            +A   ++P  ++LQG QL N+E   +LVW   ++S  +  S L      T VYLE+P
Sbjct  132  EAQRALQPRFMYLQGQQLDNEEKIGTLVWGDADVSDPQIFSSLIRPPFPTIVYLEVP  188



>ref|XP_002445593.1| hypothetical protein SORBIDRAFT_07g022155 [Sorghum bicolor]
 gb|EES15088.1| hypothetical protein SORBIDRAFT_07g022155, partial [Sorghum bicolor]
Length=729

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = +2

Query  473  SCSLLAVVCGRAAEN-----IYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTDEFRKA  637
            +C+LLAV+CG  AE          D    R  YP  E+ASSGRLEV  L NP+ ++FR+A
Sbjct  1    NCTLLAVLCGEIAEKRQTPAPLAPDTKRVRMSYPFPELASSGRLEVHTLINPTLEQFREA  60

Query  638  LDTVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
               V P  ++LQG Q  N+ E  +LVW   +LS  +    L +    T VYLE+P
Sbjct  61   QQAVHPVFLYLQGQQQENEKEIGTLVWGDTDLSDPQMFVSLITPPFPTMVYLEVP  115



>gb|EEE68795.1| hypothetical protein OsJ_27534 [Oryza sativa Japonica Group]
Length=353

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 64/117 (55%), Gaps = 5/117 (4%)
 Frame = +2

Query  464  SKHSCSLLAVVCGRAAENIYKQDVADE----RPGYPTSEIASSGRLEVQLLKNPSTDEFR  631
            S+  C++LAV+CG+  +     D   E    RP +P  E+ SSGRL+V  L NP+ D+F 
Sbjct  8    SRVKCTMLAVLCGKVGKQRMPPDPVPESQRPRPSFPFPELISSGRLDVHTLINPTVDQFL  67

Query  632  KALDTVKPNIVFLQGDQL-PNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            +A   ++P  ++ QG QL   +E   LVW   ++S  +  S L      T VYLE+P
Sbjct  68   EAQRALQPRFMYFQGQQLDKEEEIGRLVWGDADVSDPQIFSSLICPPFPTIVYLEVP  124



>gb|EEC83667.1| hypothetical protein OsI_29440 [Oryza sativa Indica Group]
Length=353

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 64/117 (55%), Gaps = 5/117 (4%)
 Frame = +2

Query  464  SKHSCSLLAVVCGRAAENIYKQDVADE----RPGYPTSEIASSGRLEVQLLKNPSTDEFR  631
            S+  C++LAV+CG+  +     D   E    RP +P  E+ SSGRL+V  L NP+ D+F 
Sbjct  8    SRVKCTMLAVLCGKVGKQRMPPDPVPESQRPRPSFPFPELISSGRLDVHTLINPTVDQFL  67

Query  632  KALDTVKPNIVFLQGDQL-PNDEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            +A   ++P  ++ QG QL   +E   LVW   ++S  +  S L      T VYLE+P
Sbjct  68   EAQRALQPRFMYFQGQQLDKEEEIGRLVWGDADVSDPQIFSSLICPPFPTIVYLEVP  124



>ref|XP_006290637.1| hypothetical protein CARUB_v10016730mg [Capsella rubella]
 gb|EOA23535.1| hypothetical protein CARUB_v10016730mg [Capsella rubella]
Length=745

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  QG S++ C+++AVV G +  N  K +     P YP  +++SSGRL+ Q+L NP+T
Sbjct  1    MMFHGQGFSRNRCNVVAVVSGDS--NNQKDEAPLHLPKYPFPDLSSSGRLKFQVLNNPTT  58

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            +EF+ A+++   + V+LQG+Q  + DE   LV    + S+ +A+  L  +   TTVYLE+
Sbjct  59   EEFQVAVNSSATDFVYLQGEQSGDSDEVGPLVLGYADFSTPDALVALFGSTLPTTVYLEL  118

Query  797  P  799
            P
Sbjct  119  P  119



>emb|CDY12335.1| BnaA06g20090D [Brassica napus]
Length=741

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 75/121 (62%), Gaps = 8/121 (7%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  Q      C++LAVV G   +N   Q     +P YP  +++SSGRL+ Q+L NP+T
Sbjct  1    MMFHAQS----RCNVLAVVSGEHCDN---QKGEAHQPRYPFPDLSSSGRLKFQVLNNPTT  53

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            +EF+ A+++  P+IV+LQG+Q  + D+   LV+   + S+ +A+  L  +   TTVYLE+
Sbjct  54   EEFQVAINSSAPDIVYLQGEQSGDTDQVGPLVFRYADFSTPDALFTLFGSSIPTTVYLEL  113

Query  797  P  799
            P
Sbjct  114  P  114



>ref|NP_001061949.1| Os08g0451700 [Oryza sativa Japonica Group]
 dbj|BAD08781.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23863.1| Os08g0451700 [Oryza sativa Japonica Group]
 dbj|BAG95301.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90383.1| unnamed protein product [Oryza sativa Japonica Group]
Length=464

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 68/124 (55%), Gaps = 5/124 (4%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADE----RPGYPTSEIASSGRLEVQLLKN  610
            M   +  S+  C++LAV+CG+  +         E    RP +P  E+ SSGRL+V  L N
Sbjct  1    MSHFKSGSRVKCTMLAVLCGKVGKQRTPPGPVPESQRPRPSFPFLELISSGRLDVHTLIN  60

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+ D+F +A   ++P  ++LQG  L N +E  +LVW   ++S  +  S L  +   T VY
Sbjct  61   PTVDQFLEAQRALQPRFIYLQGQLLDNEEEIGALVWGDADVSDPQTFSSLICSPFPTIVY  120

Query  788  LEIP  799
            LE+P
Sbjct  121  LEVP  124



>ref|XP_006662238.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Oryza brachyantha]
Length=459

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = +2

Query  437  HLMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            H ++   G+  +S ++LAV+CG+  ++   +     RP YP  E+ SSGRL+V  L NP+
Sbjct  2    HPIHFRSGSQVNS-TMLAVLCGKVGKSAVPE-AERPRPSYPFPELISSGRLKVHTLINPT  59

Query  617  TDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLE  793
             DEF +A   ++P +++LQG QL N +E  +LVW   ++S  +  S L        VYLE
Sbjct  60   VDEFLEAQRALQPRLMYLQGQQLENEEEIGTLVWGDADVSDPQMFSSLIRLPFPAIVYLE  119

Query  794  IP  799
            +P
Sbjct  120  VP  121



>ref|XP_009123264.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Brassica 
rapa]
Length=741

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 74/121 (61%), Gaps = 8/121 (7%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPST  619
            +M+  Q      C++LAVV G   +N   Q     +P YP  +++SSGRL+ Q+L NP+T
Sbjct  1    MMFHAQS----RCNVLAVVSGEHCDN---QKGEAHQPRYPFPDLSSSGRLKFQVLNNPTT  53

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            +EF+ A+++  P+IV+LQG+Q  + D+   L +   + S+ +A+  L  +   TTVYLE+
Sbjct  54   EEFQVAINSSAPDIVYLQGEQSGDTDQVGPLAFRYADFSTPDALFTLFGSSIPTTVYLEL  113

Query  797  P  799
            P
Sbjct  114  P  114



>ref|XP_002877271.1| ARID/BRIGHT DNA-binding domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH53530.1| ARID/BRIGHT DNA-binding domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=748

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 77/122 (63%), Gaps = 2/122 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVA-DERPGYPTSEIASSGRLEVQLLKNPS  616
            +M+  QG S++ C+++AVV G   +   + D A  ++P YP  +++SSGRL+ Q+L NP+
Sbjct  1    MMFHGQGFSRNRCNVVAVVSGELCDTNNQIDGAPHQQPKYPFPDLSSSGRLKFQVLNNPT  60

Query  617  TDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLE  793
             +EF+ A+++   + V+LQG+   + DE   LV+   + S+ +A+  L  +   TTVYLE
Sbjct  61   PEEFQVAVNSSATDFVYLQGEHSGDSDEVGPLVFGYTDFSTPDALVTLFGSTLPTTVYLE  120

Query  794  IP  799
            +P
Sbjct  121  LP  122



>gb|KFK33849.1| hypothetical protein AALP_AA5G068200 [Arabis alpina]
Length=736

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 74/120 (62%), Gaps = 11/120 (9%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTD  622
            M+  QG S++ C++LA+V G  +           +P YP  +++SSGRL+ Q+L  P+T+
Sbjct  1    MFHGQGFSRNRCNVLALVSGELSH----------QPSYPFPDLSSSGRLKFQVLNCPTTE  50

Query  623  EFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            EF+ A+++  P+IV+LQG+Q  + DE   LV    + S+ +A+  L  +   TTVYLE+P
Sbjct  51   EFQVAVNSSAPDIVYLQGEQSGDSDEVGPLVLGYADFSTPDALLSLFGSTLPTTVYLELP  110



>ref|XP_007012523.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 4, 
partial [Theobroma cacao]
 gb|EOY30142.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 4, 
partial [Theobroma cacao]
Length=540

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  569  IASSGRLEVQLLKNPSTDEFRKALDTVKPNIVFLQGDQ-LPNDEFSSLVWEGFNLSSEEA  745
            +ASSGRLEVQLL +P+ DE R+ L++ +PN+V+LQG+Q   ++E   L+W   +LS+ E 
Sbjct  1    LASSGRLEVQLLNSPNIDELRRVLESTEPNVVYLQGEQNADSEEIGPLIWGDVDLSTPET  60

Query  746  ISGLSSARSLTTVYLEIP  799
            + GL  +   TTVYLE P
Sbjct  61   LCGLFDSTLPTTVYLETP  78



>ref|XP_007012522.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY30141.1| ARID/BRIGHT DNA-binding domain-containing protein isoform 3, 
partial [Theobroma cacao]
Length=708

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  569  IASSGRLEVQLLKNPSTDEFRKALDTVKPNIVFLQGDQ-LPNDEFSSLVWEGFNLSSEEA  745
            +ASSGRLEVQLL +P+ DE R+ L++ +PN+V+LQG+Q   ++E   L+W   +LS+ E 
Sbjct  1    LASSGRLEVQLLNSPNIDELRRVLESTEPNVVYLQGEQNADSEEIGPLIWGDVDLSTPET  60

Query  746  ISGLSSARSLTTVYLEIP  799
            + GL  +   TTVYLE P
Sbjct  61   LCGLFDSTLPTTVYLETP  78



>tpg|DAA48833.1| TPA: hypothetical protein ZEAMMB73_656706 [Zea mays]
Length=276

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 66/125 (53%), Gaps = 6/125 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAEN-----IYKQDVADERPGYPTSEIASSGRLEVQLLK  607
            M  +Q T + +C+LLAV+CG  AE          D    R  YP  E+ASSGRLEV  L 
Sbjct  1    MPQIQNTMRQNCTLLAVLCGEFAEKRQTPASLAPDTKRLRLSYPFPELASSGRLEVHTLI  60

Query  608  NPSTDEFRKALDTVKPNIVFL-QGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+ ++FR+A   V P  ++L    Q   +E  +LVW   +LS  +    L +    T V
Sbjct  61   NPTLEQFREAQQAVHPVFLYLQGQQQENEEEIGTLVWGDTDLSDPQMFVSLITPPFPTMV  120

Query  785  YLEIP  799
            YLE+P
Sbjct  121  YLEVP  125



>tpg|DAA48832.1| TPA: hypothetical protein ZEAMMB73_656706 [Zea mays]
Length=351

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 66/125 (53%), Gaps = 6/125 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENI-----YKQDVADERPGYPTSEIASSGRLEVQLLK  607
            M  +Q T + +C+LLAV+CG  AE          D    R  YP  E+ASSGRLEV  L 
Sbjct  99   MPQIQNTMRQNCTLLAVLCGEFAEKRQTPASLAPDTKRLRLSYPFPELASSGRLEVHTLI  158

Query  608  NPSTDEFRKALDTVKPNIVFL-QGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+ ++FR+A   V P  ++L    Q   +E  +LVW   +LS  +    L +    T V
Sbjct  159  NPTLEQFREAQQAVHPVFLYLQGQQQENEEEIGTLVWGDTDLSDPQMFVSLITPPFPTMV  218

Query  785  YLEIP  799
            YLE+P
Sbjct  219  YLEVP  223



>ref|NP_189910.2| ARID/BRIGHT DNA-binding domain-containing protein [Arabidopsis 
thaliana]
 sp|Q6NQ79.1|ARID4_ARATH RecName: Full=AT-rich interactive domain-containing protein 4; 
Short=ARID domain-containing protein 4 [Arabidopsis thaliana]
 gb|AAQ82841.1| At3g43240 [Arabidopsis thaliana]
 gb|AEE77778.1| ARID/BRIGHT DNA-binding domain-containing protein [Arabidopsis 
thaliana]
Length=747

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-DVADERPGYPTSEIASSGRLEVQLLKNPST  619
            M+  QG S++ C+++AVV G    +   Q D    +P YP  +++SSGRL+ Q+L NP+ 
Sbjct  1    MFHGQGFSRNRCNVVAVVSGAELCDTNNQIDGTSHQPKYPFPDLSSSGRLKFQVLNNPTP  60

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            +EF+ A+++   + V+LQG+   + DE   LV    + S+ +A+  L  +   TTVYLE+
Sbjct  61   EEFQVAVNSSATDFVYLQGEHSGDSDEVGPLVLGYTDFSTPDALVTLFGSTLPTTVYLEL  120

Query  797  P  799
            P
Sbjct  121  P  121



>ref|NP_001130362.1| uncharacterized protein LOC100191457 [Zea mays]
 ref|XP_008666266.1| PREDICTED: uncharacterized protein LOC100191457 isoform X1 [Zea 
mays]
 ref|XP_008666313.1| PREDICTED: uncharacterized protein LOC100191457 isoform X1 [Zea 
mays]
 ref|XP_008666356.1| PREDICTED: uncharacterized protein LOC100191457 isoform X1 [Zea 
mays]
 ref|XP_008666408.1| PREDICTED: uncharacterized protein LOC100191457 isoform X1 [Zea 
mays]
 ref|XP_008666454.1| PREDICTED: uncharacterized protein LOC100191457 isoform X1 [Zea 
mays]
 gb|ACF78553.1| unknown [Zea mays]
Length=749

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 66/125 (53%), Gaps = 6/125 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENI-----YKQDVADERPGYPTSEIASSGRLEVQLLK  607
            M  +Q T + +C+LLAV+CG  AE          D    R  YP  E+ASSGRLEV  L 
Sbjct  1    MPQIQNTMRQNCTLLAVLCGEFAEKRQTPASLAPDTKRLRLSYPFPELASSGRLEVHTLI  60

Query  608  NPSTDEFRKALDTVKPNIVFL-QGDQLPNDEFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+ ++FR+A   V P  ++L    Q   +E  +LVW   +LS  +    L +    T V
Sbjct  61   NPTLEQFREAQQAVHPVFLYLQGQQQENEEEIGTLVWGDTDLSDPQMFVSLITPPFPTMV  120

Query  785  YLEIP  799
            YLE+P
Sbjct  121  YLEVP  125



>ref|XP_002516200.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF46202.1| DNA binding protein, putative [Ricinus communis]
Length=749

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  581  GRLEVQLLKNPSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGL  757
            GRLEVQ+L +PSTDEFR+ L + +PNIV+LQG+ + + +E  SL W G +LS+ +A+  L
Sbjct  47   GRLEVQILSSPSTDEFRRVLQSSEPNIVYLQGEIIEDSEEIGSLRWAGADLSTPDALCEL  106

Query  758  SSARSLTTVYLEIP  799
              +    TVYLEIP
Sbjct  107  FGSTLPPTVYLEIP  120



>ref|XP_010426242.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Camelina sativa]
Length=172

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAEN-IYKQDVADERPGYPTSEIASSGRLEVQLLKNPS  616
            +M+  QG S++ C+++AVV G    N I        +P YP  +++SSGRL++Q+L NP+
Sbjct  1    MMFHGQGFSRNRCNVVAVVSGENNNNQIDGAPPPPLQPKYPFPDLSSSGRLKIQVLNNPT  60

Query  617  TDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLE  793
            T+EF+ A+++   + V+LQG+Q  + DE   LV      S+ +A+  L  +   TTVYLE
Sbjct  61   TEEFQVAVNSSATDFVYLQGEQTGDSDEVGPLVLGFAAFSTPDALVALFGSTLPTTVYLE  120

Query  794  IP  799
            +P
Sbjct  121  LP  122



>gb|KCW56430.1| hypothetical protein EUGRSUZ_I02158 [Eucalyptus grandis]
Length=735

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = +2

Query  464  SKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTDEFRKALD  643
            ++ +CS LAV  G    ++   D A++ P     E ASSG LEV  L++PS DEFR A++
Sbjct  6    ARDACSFLAVTGGGGGSSV---DAAEDHPTCSFLERASSGYLEVHTLRSPSEDEFRLAVE  62

Query  644  TVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            + +P  V+LQGDQL ++ +  SL W      + ++I GL        +YLEIP
Sbjct  63   SRRPAFVYLQGDQLKDEGDVVSLAWNRTTCVTADSIVGLFGETLPVAIYLEIP  115



>ref|XP_010029504.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Eucalyptus grandis]
 gb|KCW56431.1| hypothetical protein EUGRSUZ_I02158 [Eucalyptus grandis]
Length=762

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = +2

Query  464  SKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTDEFRKALD  643
            ++ +CS LAV  G    ++   D A++ P     E ASSG LEV  L++PS DEFR A++
Sbjct  6    ARDACSFLAVTGGGGGSSV---DAAEDHPTCSFLERASSGYLEVHTLRSPSEDEFRLAVE  62

Query  644  TVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            + +P  V+LQGDQL ++ +  SL W      + ++I GL        +YLEIP
Sbjct  63   SRRPAFVYLQGDQLKDEGDVVSLAWNRTTCVTADSIVGLFGETLPVAIYLEIP  115



>gb|KCW56432.1| hypothetical protein EUGRSUZ_I02158 [Eucalyptus grandis]
Length=631

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = +2

Query  464  SKHSCSLLAVVCGRAAENIYKQDVADERPGYPTSEIASSGRLEVQLLKNPSTDEFRKALD  643
            ++ +CS LAV  G    ++   D A++ P     E ASSG LEV  L++PS DEFR A++
Sbjct  6    ARDACSFLAVTGGGGGSSV---DAAEDHPTCSFLERASSGYLEVHTLRSPSEDEFRLAVE  62

Query  644  TVKPNIVFLQGDQLPND-EFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEIP  799
            + +P  V+LQGDQL ++ +  SL W      + ++I GL        +YLEIP
Sbjct  63   SRRPAFVYLQGDQLKDEGDVVSLAWNRTTCVTADSIVGLFGETLPVAIYLEIP  115



>gb|EAZ07198.1| hypothetical protein OsI_29442 [Oryza sativa Indica Group]
Length=117

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADE----RPGYPTSEIASSGRLEVQLLKN  610
            M   +  S+  C++LAV+CG+  +         E    RP +P  E+ SSGRL+V  L N
Sbjct  1    MSHFKSGSRVKCTMLAVLCGKVGKQRTPPGPVPESQRPRPSFPFLELISSGRLDVHTLIN  60

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAI  748
            P+ D+F +A   ++P  ++LQG  L N +E  +LVW   ++S    +
Sbjct  61   PTVDQFLEAQRALQPRFIYLQGQLLDNEEEIGALVWGDADVSDHRHL  107



>emb|CAB89045.1| putative protein [Arabidopsis thaliana]
Length=717

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = +2

Query  443  MYSVQGTSKHSCSLLAVVCGRAAENIYKQ-DVADERPGYPTSEIASSGRLEVQLLKNPST  619
            M+  QG S++ C+++AVV G    +   Q D    +P YP  +++SSGRL+V  L NP+ 
Sbjct  1    MFHGQGFSRNRCNVVAVVSGAELCDTNNQIDGTSHQPKYPFPDLSSSGRLKV--LNNPTP  58

Query  620  DEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVYLEI  796
            +EF+ A+++   + V+LQG+   + DE   LV    + S+ +A+  L  +   TTVYLE+
Sbjct  59   EEFQVAVNSSATDFVYLQGEHSGDSDEVGPLVLGYTDFSTPDALVTLFGSTLPTTVYLEL  118

Query  797  P  799
            P
Sbjct  119  P  119



>ref|XP_010425814.1| PREDICTED: AT-rich interactive domain-containing protein 4 [Camelina 
sativa]
Length=749

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 73/125 (58%), Gaps = 7/125 (6%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAEN----IYKQDVADERPGYPTSEIASSGRLEVQLLK  607
            +M+  QG S++ C+++AVV G    N             +  +P  +++SSGRL++Q+L 
Sbjct  1    MMFHGQGFSRNRCNVVAVVSGENNNNQIDGAPPPPPLQPKYPFP--DLSSSGRLKIQVLN  58

Query  608  NPSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTV  784
            NP+T+EF+ A+++   + V+LQG+Q  + DE   LV      S+ +A+  L  +   TTV
Sbjct  59   NPTTEEFQVAVNSSATDFVYLQGEQTGDSDEVGPLVLGFAAFSTPDALVALFGSTLPTTV  118

Query  785  YLEIP  799
            YLE+P
Sbjct  119  YLELP  123



>ref|XP_010503035.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
[Camelina sativa]
Length=398

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (61%), Gaps = 12/127 (9%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPG------YPTSEIASSGRLEVQL  601
            +M+  QG S++ C+++AVV   + EN  + D A   P       +P  +++SSGRL++Q+
Sbjct  1    MMFHGQGFSRNRCNVVAVV---SRENDNQIDGAPPPPPLQPKYPFP--DLSSSGRLKIQV  55

Query  602  LKNPSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLT  778
            L NP+T+EF+ A+++   + V+LQG+Q  + DE    V    + S+ +A+  L  +   T
Sbjct  56   LNNPTTEEFQVAVNSSATDFVYLQGEQSGDSDEVGPFVLGFTDFSTPDALVALFGSTLPT  115

Query  779  TVYLEIP  799
            TVYLE+P
Sbjct  116  TVYLELP  122



>ref|XP_010514719.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=748

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (61%), Gaps = 12/127 (9%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENIYKQDVADERPG------YPTSEIASSGRLEVQL  601
            +M+  QG S++ C+++AVV   + EN  + D A   P       +P  +++SSGRL++Q+
Sbjct  1    MMFHGQGFSRNRCNVVAVV---SRENDNQIDGAPPPPPLQPKYPFP--DLSSSGRLKIQV  55

Query  602  LKNPSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLT  778
            L NP+T+EF+ A+++   + V+LQG+Q  + DE    V    + S+ +A+  L  +   T
Sbjct  56   LNNPTTEEFQVAVNSSATDFVYLQGEQSGDSDEVGPFVLGFTDFSTPDALVALFGSTLPT  115

Query  779  TVYLEIP  799
            TVYLE+P
Sbjct  116  TVYLELP  122



>ref|XP_010514718.1| PREDICTED: AT-rich interactive domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=748

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 73/124 (59%), Gaps = 6/124 (5%)
 Frame = +2

Query  440  LMYSVQGTSKHSCSLLAVVCGRAAENI---YKQDVADERPGYPTSEIASSGRLEVQLLKN  610
            +M+  QG S++ C+++AVV G     I           +  +P  +++SSGRL++Q+L N
Sbjct  1    MMFHGQGFSRNRCNVVAVVSGVNDNQIDGAPPPPPLQPKYPFP--DLSSSGRLKIQVLSN  58

Query  611  PSTDEFRKALDTVKPNIVFLQGDQLPN-DEFSSLVWEGFNLSSEEAISGLSSARSLTTVY  787
            P+T+EF+ ++++   + V+LQG+Q  + DE    V    + S+ +A+  L  +   TTVY
Sbjct  59   PTTEEFQVSVNSSATDFVYLQGEQSGDSDEVGPFVLGFADFSTPDALVALFGSTLPTTVY  118

Query  788  LEIP  799
            LE+P
Sbjct  119  LELP  122



>ref|XP_010089838.1| hypothetical protein L484_022354 [Morus notabilis]
 gb|EXB38454.1| hypothetical protein L484_022354 [Morus notabilis]
Length=98

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  587  LEVQLLKNPSTDEFRKALDTVKPNIVFLQGDQLPNDEFSSLVWEGFNLSS  736
            +EVQ L +PS +EF K L++ KPN+V+LQG+QL NDE   LVW   +LS+
Sbjct  48   VEVQTLTSPSKEEFSKLLESYKPNLVYLQGEQLGNDEVGPLVWGDVDLST  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876