BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig449

Length=684
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010320545.1|  PREDICTED: auxin efflux facilitator SlPIN4 i...    367   9e-120   Solanum lycopersicum
ref|XP_009601548.1|  PREDICTED: auxin efflux carrier component 7-...    367   9e-120   Nicotiana tomentosiformis
dbj|BAJ09455.1|  auxin efflux carrier                                   367   9e-120   Solanum lycopersicum
ref|NP_001234184.1|  auxin efflux facilitator SlPIN4                    367   1e-119   Solanum lycopersicum
ref|XP_006344239.1|  PREDICTED: auxin efflux carrier component 3-...    367   1e-119   Solanum tuberosum [potatoes]
ref|XP_009802789.1|  PREDICTED: auxin efflux carrier component 7-...    365   4e-119   Nicotiana sylvestris
ref|XP_011075639.1|  PREDICTED: auxin efflux carrier component 7-...    363   2e-118   Sesamum indicum [beniseed]
ref|XP_011075655.1|  PREDICTED: auxin efflux carrier component 7-...    363   3e-118   Sesamum indicum [beniseed]
ref|XP_010552711.1|  PREDICTED: auxin efflux carrier component 3        359   1e-117   Tarenaya hassleriana [spider flower]
ref|XP_011070630.1|  PREDICTED: auxin efflux carrier component 7-...    360   3e-117   Sesamum indicum [beniseed]
ref|XP_010498810.1|  PREDICTED: auxin efflux carrier component 7-...    356   4e-117   Camelina sativa [gold-of-pleasure]
emb|CDY25767.1|  BnaA07g10150D                                          358   4e-117   Brassica napus [oilseed rape]
gb|KDO64681.1|  hypothetical protein CISIN_1g006199mg                   356   4e-117   Citrus sinensis [apfelsine]
ref|NP_564189.1|  auxin efflux carrier component 7                      356   5e-117   Arabidopsis thaliana [mouse-ear cress]
gb|AAC00611.1|  unknown protein                                         357   1e-116   Arabidopsis thaliana [mouse-ear cress]
emb|CDY68262.1|  BnaC06g43740D                                          357   1e-116   Brassica napus [oilseed rape]
emb|CDX96288.1|  BnaA07g28990D                                          357   1e-116   
emb|CAC67688.1|  efflux carrier, pin3                                   358   1e-116   Brassica juncea [brown mustard]
ref|XP_009103201.1|  PREDICTED: auxin efflux carrier component 7        357   1e-116   Brassica rapa
emb|CAC24691.1|  efflux carrier of polar auxin transport                358   1e-116   Brassica juncea [brown mustard]
gb|EYU30062.1|  hypothetical protein MIMGU_mgv1a002731mg                358   2e-116   Erythranthe guttata [common monkey flower]
ref|NP_177250.1|  auxin efflux carrier component 3                      358   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009761336.1|  PREDICTED: auxin efflux carrier component 3-...    357   2e-116   Nicotiana sylvestris
ref|XP_009761335.1|  PREDICTED: auxin efflux carrier component 3-...    357   3e-116   Nicotiana sylvestris
emb|CAC67457.1|  efflux carrier, pin2                                   357   3e-116   Brassica juncea [brown mustard]
gb|AGG79243.1|  auxin efflux facilitator PIN3b                          357   3e-116   Nicotiana tabacum [American tobacco]
emb|CAN66787.1|  hypothetical protein VITISV_013835                     357   3e-116   Vitis vinifera
emb|CDP00766.1|  unnamed protein product                                358   3e-116   Coffea canephora [robusta coffee]
ref|XP_009601533.1|  PREDICTED: auxin efflux carrier component 3-...    357   3e-116   Nicotiana tomentosiformis
ref|XP_009601532.1|  PREDICTED: auxin efflux carrier component 3-...    357   3e-116   Nicotiana tomentosiformis
ref|NP_849700.1|  auxin efflux carrier component 7                      357   4e-116   Arabidopsis thaliana [mouse-ear cress]
gb|KDO64678.1|  hypothetical protein CISIN_1g006199mg                   357   4e-116   Citrus sinensis [apfelsine]
ref|XP_002284302.1|  PREDICTED: auxin efflux carrier component 3        357   4e-116   Vitis vinifera
gb|AFJ03880.1|  auxin transport protein                                 357   4e-116   Capsella bursa-pastoris
ref|XP_010477592.1|  PREDICTED: auxin efflux carrier component 7 ...    356   4e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010498809.1|  PREDICTED: auxin efflux carrier component 7-...    356   4e-116   Camelina sativa [gold-of-pleasure]
ref|NP_001077584.1|  auxin efflux carrier component 7                   356   4e-116   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH47611.1|  auxin:hydrogen symporter/transporter                   357   4e-116   Zinnia elegans [garden zinnia]
ref|XP_010477589.1|  PREDICTED: auxin efflux carrier component 7 ...    356   4e-116   Camelina sativa [gold-of-pleasure]
gb|KDO64680.1|  hypothetical protein CISIN_1g006199mg                   356   5e-116   Citrus sinensis [apfelsine]
ref|XP_010477591.1|  PREDICTED: auxin efflux carrier component 7 ...    356   5e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010101728.1|  Auxin efflux carrier component 3                   357   5e-116   Morus notabilis
gb|AEJ76925.1|  auxin transport protein                                 357   6e-116   Capsella bursa-pastoris
gb|KFK41521.1|  hypothetical protein AALP_AA2G140400                    357   6e-116   Arabis alpina [alpine rockcress]
ref|XP_006307013.1|  hypothetical protein CARUB_v10008599mg             356   6e-116   Capsella rubella
gb|KDO64677.1|  hypothetical protein CISIN_1g006199mg                   357   6e-116   Citrus sinensis [apfelsine]
ref|XP_006360412.1|  PREDICTED: auxin efflux carrier component 3-...    356   6e-116   Solanum tuberosum [potatoes]
ref|XP_006300840.1|  hypothetical protein CARUB_v10019932mg             357   7e-116   Capsella rubella
ref|XP_002893260.1|  pin-formed 7                                       356   7e-116   
gb|KDO64676.1|  hypothetical protein CISIN_1g006199mg                   357   8e-116   Citrus sinensis [apfelsine]
ref|XP_006416127.1|  hypothetical protein EUTSA_v10007111mg             355   1e-115   Eutrema salsugineum [saltwater cress]
ref|XP_010471101.1|  PREDICTED: auxin efflux carrier component 3-...    356   1e-115   
ref|XP_010427902.1|  PREDICTED: auxin efflux carrier component 3-...    356   1e-115   Camelina sativa [gold-of-pleasure]
ref|XP_006469168.1|  PREDICTED: auxin efflux carrier component 3-...    356   2e-115   Citrus sinensis [apfelsine]
ref|NP_001234177.1|  auxin efflux facilitator SlPIN3                    354   2e-115   Solanum lycopersicum
ref|XP_002887338.1|  predicted protein                                  355   2e-115   Arabidopsis lyrata subsp. lyrata
ref|XP_012072212.1|  PREDICTED: auxin efflux carrier component 3-...    355   2e-115   Jatropha curcas
ref|XP_009105760.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    355   2e-115   Brassica rapa
ref|XP_006390822.1|  hypothetical protein EUTSA_v10018257mg             355   3e-115   Eutrema salsugineum [saltwater cress]
emb|CDY12491.1|  BnaC07g13310D                                          353   3e-115   Brassica napus [oilseed rape]
ref|XP_010319114.1|  PREDICTED: auxin efflux facilitator SlPIN3 i...    354   3e-115   
gb|EPS59246.1|  hypothetical protein M569_15563                         351   5e-115   Genlisea aurea
gb|AIF28328.1|  PIN-like protein                                        344   8e-115   Aextoxicon punctatum
ref|XP_010462853.1|  PREDICTED: auxin efflux carrier component 7-...    356   8e-115   
ref|XP_010527774.1|  PREDICTED: auxin efflux carrier component 4-...    353   8e-115   Tarenaya hassleriana [spider flower]
gb|AAM55297.1|  auxin efflux carrier protein                            354   8e-115   Medicago truncatula
ref|XP_010415790.1|  PREDICTED: auxin efflux carrier component 3        354   8e-115   Camelina sativa [gold-of-pleasure]
gb|KGN51517.1|  hypothetical protein Csa_5G576590                       353   9e-115   Cucumis sativus [cucumbers]
gb|AGG79240.1|  auxin efflux facilitator PIN3                           353   1e-114   Nicotiana tabacum [American tobacco]
ref|XP_007157735.1|  hypothetical protein PHAVU_002G094000g             353   1e-114   Phaseolus vulgaris [French bean]
ref|XP_007157734.1|  hypothetical protein PHAVU_002G094000g             353   1e-114   Phaseolus vulgaris [French bean]
ref|NP_565261.1|  auxin efflux carrier component 4                      352   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008467158.1|  PREDICTED: auxin efflux carrier component 4-...    353   2e-114   Cucumis melo [Oriental melon]
gb|KFK44397.1|  hypothetical protein AALP_AA1G252100                    352   2e-114   Arabis alpina [alpine rockcress]
ref|NP_849923.1|  auxin efflux carrier component 4                      352   2e-114   Arabidopsis thaliana [mouse-ear cress]
gb|EYU40829.1|  hypothetical protein MIMGU_mgv1a025638mg                352   4e-114   Erythranthe guttata [common monkey flower]
ref|XP_010513862.1|  PREDICTED: auxin efflux carrier component 4-...    350   5e-114   Camelina sativa [gold-of-pleasure]
ref|XP_002876748.1|  pin-formed 4                                       351   6e-114   
ref|XP_006290757.1|  hypothetical protein CARUB_v10016856mg             351   6e-114   Capsella rubella
ref|XP_006398529.1|  hypothetical protein EUTSA_v10000822mg             350   6e-114   Eutrema salsugineum [saltwater cress]
gb|AIF28339.1|  PIN-like protein                                        347   7e-114   Hakea drupacea
ref|NP_001267715.1|  auxin efflux carrier component 3-like              351   8e-114   Cucumis sativus [cucumbers]
ref|XP_007045129.1|  Auxin efflux facilitator isoform 6                 348   8e-114   
ref|XP_007045127.1|  Auxin efflux carrier family protein isoform 4      347   9e-114   
dbj|BAO49654.1|  putative auxin efflux carrier protein                  351   1e-113   Vigna angularis [azuki bean]
ref|XP_010554422.1|  PREDICTED: auxin efflux carrier component 4-...    350   2e-113   Tarenaya hassleriana [spider flower]
ref|XP_010424909.1|  PREDICTED: auxin efflux carrier component 4        349   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_007045128.1|  Auxin efflux carrier family protein isoform 5      347   2e-113   
gb|AGJ95053.1|  PIN1a                                                   348   2e-113   Glycine max [soybeans]
gb|AIF28331.1|  PIN-like protein                                        348   3e-113   Trochodendron aralioides
ref|NP_001267499.1|  uncharacterized protein LOC100791394               349   4e-113   Glycine max [soybeans]
ref|XP_007045126.1|  Auxin efflux facilitator isoform 3                 348   8e-113   
ref|XP_011038656.1|  PREDICTED: auxin efflux carrier component 7        348   1e-112   Populus euphratica
gb|AAM54033.1|AF515434_1  PIN1-like auxin transport protein             348   1e-112   Populus tremula x Populus tremuloides
ref|XP_002314810.2|  PIN1-like family protein                           348   1e-112   
gb|AIF28335.1|  PIN-like protein                                        347   2e-112   Euptelea pleiosperma
ref|XP_007045125.1|  Auxin efflux facilitator isoform 2                 348   2e-112   
ref|XP_002312436.1|  PIN1-like family protein                           347   3e-112   Populus trichocarpa [western balsam poplar]
emb|CDY40380.1|  BnaA02g26940D                                          345   3e-112   Brassica napus [oilseed rape]
gb|KJB15455.1|  hypothetical protein B456_002G179000                    344   3e-112   Gossypium raimondii
emb|CDY63826.1|  BnaC02g47640D                                          344   5e-112   Brassica napus [oilseed rape]
ref|XP_011023284.1|  PREDICTED: auxin efflux carrier component 3-...    347   6e-112   Populus euphratica
gb|AAP59843.1|  PIN1-like protein                                       345   8e-112   Populus tomentosa [Chinese white poplar]
gb|KJB15458.1|  hypothetical protein B456_002G179000                    345   1e-111   Gossypium raimondii
gb|KJB15460.1|  hypothetical protein B456_002G179000                    343   1e-111   Gossypium raimondii
gb|KHN43027.1|  Auxin efflux carrier component 3                        344   2e-111   Glycine soja [wild soybean]
gb|KHG04074.1|  Auxin efflux carrier component 3 -like protein          345   2e-111   Gossypium arboreum [tree cotton]
ref|NP_001267527.1|  uncharacterized protein LOC100802247               346   2e-111   Glycine max [soybeans]
gb|KJB15456.1|  hypothetical protein B456_002G179000                    345   2e-111   Gossypium raimondii
ref|XP_009129244.1|  PREDICTED: auxin efflux carrier component 4        344   2e-111   Brassica rapa
ref|XP_006605369.1|  PREDICTED: uncharacterized protein LOC100802...    345   2e-111   Glycine max [soybeans]
ref|XP_006605368.1|  PREDICTED: uncharacterized protein LOC100802...    346   2e-111   Glycine max [soybeans]
ref|XP_007153407.1|  hypothetical protein PHAVU_003G032500g             345   2e-111   Phaseolus vulgaris [French bean]
ref|XP_007045124.1|  Auxin efflux carrier family protein isoform 1      347   2e-111   
ref|XP_003529411.1|  PREDICTED: auxin efflux carrier component 3-...    345   2e-111   Glycine max [soybeans]
dbj|BAD05032.1|  putative auxin transport protein                       344   3e-111   Pisum sativum [garden pea]
dbj|BAH23798.1|  putative auxin transport facilitator protein           344   3e-111   Pisum sativum [garden pea]
gb|AAQ14258.1|AF247005_1  auxin efflux carrier                          344   3e-111   Momordica charantia [balsam pear]
gb|KJB15454.1|  hypothetical protein B456_002G179000                    345   3e-111   Gossypium raimondii
ref|NP_001276316.1|  uncharacterized protein LOC100785146               345   3e-111   Glycine max [soybeans]
gb|KJB15457.1|  hypothetical protein B456_002G179000                    344   3e-111   Gossypium raimondii
ref|XP_006583898.1|  PREDICTED: auxin efflux carrier component 3-...    345   3e-111   Glycine max [soybeans]
gb|KJB15459.1|  hypothetical protein B456_002G179000                    345   4e-111   Gossypium raimondii
gb|KEH40559.1|  auxin efflux carrier family transporter                 341   4e-111   Medicago truncatula
emb|CDY41467.1|  BnaA08g20690D                                          342   4e-111   Brassica napus [oilseed rape]
ref|XP_004498307.1|  PREDICTED: auxin efflux carrier component 3-...    344   4e-111   Cicer arietinum [garbanzo]
dbj|BAO49658.1|  putative auxin efflux carrier protein                  344   5e-111   Vigna angularis [azuki bean]
gb|AIF28330.1|  PIN-like protein                                        340   9e-111   Trochodendron aralioides
gb|KFK33369.1|  hypothetical protein AALP_AA5G004800                    342   1e-110   Arabis alpina [alpine rockcress]
ref|XP_009356144.1|  PREDICTED: auxin efflux carrier component 3-...    343   1e-110   Pyrus x bretschneideri [bai li]
gb|KFK33370.1|  hypothetical protein AALP_AA5G004800                    342   1e-110   Arabis alpina [alpine rockcress]
ref|XP_008243361.1|  PREDICTED: auxin efflux carrier component 3-...    343   1e-110   Prunus mume [ume]
ref|XP_007226967.1|  hypothetical protein PRUPE_ppa002528mg             343   2e-110   Prunus persica
emb|CDX91695.1|  BnaC08g06140D                                          340   2e-110   
ref|XP_008454788.1|  PREDICTED: auxin efflux carrier component 7-...    342   2e-110   Cucumis melo [Oriental melon]
ref|XP_004505266.1|  PREDICTED: auxin efflux carrier component 3-...    342   3e-110   Cicer arietinum [garbanzo]
gb|AAM55299.1|  auxin efflux carrier protein                            341   3e-110   Medicago truncatula
dbj|BAH47610.1|  auxin:hydrogen symporter/transporter                   341   4e-110   Zinnia elegans [garden zinnia]
ref|XP_008389216.1|  PREDICTED: auxin efflux carrier component 3-...    342   5e-110   
gb|AIF28356.1|  PIN-like protein                                        334   6e-110   Posidonia australis
ref|XP_002526018.1|  Auxin efflux carrier component, putative           341   6e-110   Ricinus communis
ref|XP_009110124.1|  PREDICTED: auxin efflux carrier component 7-...    339   7e-110   Brassica rapa
gb|KCW86214.1|  hypothetical protein EUGRSUZ_B02902                     340   1e-109   Eucalyptus grandis [rose gum]
gb|AIF28374.1|  PIN-like protein                                        327   1e-109   Cunninghamia lanceolata [China fir]
ref|XP_010044176.1|  PREDICTED: auxin efflux carrier component 4-...    340   2e-109   Eucalyptus grandis [rose gum]
ref|XP_010672758.1|  PREDICTED: auxin efflux carrier component 3-...    341   2e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010672759.1|  PREDICTED: auxin efflux carrier component 3-...    340   3e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010260501.1|  PREDICTED: auxin efflux carrier component 4-...    339   4e-109   Nelumbo nucifera [Indian lotus]
gb|AIF28368.1|  PIN-like protein                                        327   5e-109   Nageia nagi
ref|XP_004140432.1|  PREDICTED: auxin efflux carrier component 7        338   6e-109   
gb|AIF28377.1|  PIN-like protein                                        335   8e-109   Amentotaxus argotaenia
gb|AIF28378.1|  PIN-like protein                                        329   1e-108   Taxus baccata
ref|XP_009339666.1|  PREDICTED: auxin efflux carrier component 3-...    337   3e-108   
dbj|BAJ10462.1|  auxin efflux facilitator                               337   3e-108   Cucumis sativus [cucumbers]
gb|AIF28371.1|  PIN-like protein                                        328   4e-108   Chamaecyparis lawsoniana [Oregon cedar]
ref|XP_006849750.1|  PREDICTED: auxin efflux carrier component 7        337   8e-108   Amborella trichopoda
ref|XP_010274646.1|  PREDICTED: auxin efflux carrier component 4-...    336   8e-108   Nelumbo nucifera [Indian lotus]
gb|AIF28366.1|  PIN-like protein                                        325   1e-107   Prumnopitys andina
gb|AIF28364.1|  PIN-like protein                                        330   1e-107   Keteleeria evelyniana
ref|XP_009357915.1|  PREDICTED: auxin efflux carrier component 3 ...    335   2e-107   Pyrus x bretschneideri [bai li]
ref|XP_009357924.1|  PREDICTED: auxin efflux carrier component 3 ...    335   2e-107   Pyrus x bretschneideri [bai li]
ref|XP_008339560.1|  PREDICTED: auxin efflux carrier component 3 ...    335   2e-107   Malus domestica [apple tree]
ref|XP_008339561.1|  PREDICTED: auxin efflux carrier component 3 ...    333   2e-107   Malus domestica [apple tree]
gb|AIF28299.1|  PIN-like protein                                        326   2e-107   Papaver somniferum
ref|XP_009357931.1|  PREDICTED: auxin efflux carrier component 3 ...    332   4e-107   
ref|XP_004297366.1|  PREDICTED: auxin efflux carrier component 3-...    334   7e-107   Fragaria vesca subsp. vesca
gb|KJB30812.1|  hypothetical protein B456_005G161800                    322   1e-106   Gossypium raimondii
gb|AIF28317.1|  PIN-like protein                                        323   2e-106   Nuphar advena
gb|AIF28388.1|  PIN-like protein                                        328   4e-106   Chamaecyparis hodginsii
ref|XP_008775285.1|  PREDICTED: auxin efflux carrier component 3-...    327   4e-106   
gb|AIF28430.1|  PIN-like protein                                        321   7e-106   Amentotaxus argotaenia
gb|AIF28355.1|  PIN-like protein                                        315   1e-105   Talbotia elegans
gb|AIF28334.1|  PIN-like protein                                        319   4e-105   Euptelea pleiosperma
gb|AIF28308.1|  PIN-like protein                                        316   1e-104   Maranta leuconeura
gb|AIF28362.1|  PIN-like protein                                        328   2e-104   Pseudotsuga menziesii
gb|AIF28295.1|  PIN-like protein                                        327   2e-104   Nuphar advena
gb|ACH91613.2|  PIN-like auxin efflux carrier                           328   2e-104   Picea abies
ref|XP_010924933.1|  PREDICTED: probable auxin efflux carrier com...    327   2e-104   Elaeis guineensis
ref|XP_008775284.1|  PREDICTED: probable auxin efflux carrier com...    327   2e-104   Phoenix dactylifera
ref|XP_006339260.1|  PREDICTED: auxin efflux carrier component 1-...    325   2e-104   Solanum tuberosum [potatoes]
gb|AIF28369.1|  PIN-like protein                                        327   3e-104   Manoao colensoi [manoao]
gb|AIF28386.1|  PIN-like protein                                        328   3e-104   Chamaecyparis lawsoniana [Oregon cedar]
ref|XP_009602422.1|  PREDICTED: auxin efflux carrier component 1-...    325   3e-104   Nicotiana tomentosiformis
gb|AIF28425.1|  PIN-like protein                                        322   3e-104   Manoao colensoi [manoao]
ref|NP_001234204.1|  auxin efflux facilitator SlPIN7                    325   3e-104   Solanum lycopersicum
gb|EYU18610.1|  hypothetical protein MIMGU_mgv1a003446mg                325   3e-104   Erythranthe guttata [common monkey flower]
gb|AIF28411.1|  PIN-like protein                                        315   4e-104   Torreya taxifolia [Florida torreya]
gb|AGG79241.1|  auxin efflux facilitator PIN9                           325   4e-104   Nicotiana tabacum [American tobacco]
gb|AIF28415.1|  PIN-like protein                                        313   4e-104   Juniperus scopulorum
gb|AIF28390.1|  PIN-like protein                                        327   5e-104   Thuja plicata [giant arborvitae]
ref|XP_009803280.1|  PREDICTED: auxin efflux carrier component 1-...    324   6e-104   Nicotiana sylvestris
gb|AIF28376.1|  PIN-like protein                                        327   7e-104   Thuja plicata [giant arborvitae]
emb|CDP06197.1|  unnamed protein product                                324   7e-104   Coffea canephora [robusta coffee]
ref|XP_011075451.1|  PREDICTED: probable auxin efflux carrier com...    323   8e-104   Sesamum indicum [beniseed]
gb|AIF28389.1|  PIN-like protein                                        322   1e-103   Papuacedrus papuana
ref|XP_002282220.1|  PREDICTED: probable auxin efflux carrier com...    324   1e-103   Vitis vinifera
ref|XP_011075450.1|  PREDICTED: probable auxin efflux carrier com...    323   2e-103   Sesamum indicum [beniseed]
ref|XP_009783366.1|  PREDICTED: probable auxin efflux carrier com...    323   2e-103   Nicotiana sylvestris
gb|AGG79244.1|  auxin efflux facilitator PIN1b                          323   2e-103   Nicotiana tabacum [American tobacco]
gb|AIF28385.1|  PIN-like protein                                        324   2e-103   Sciadopitys verticillata [umbrella-pine]
gb|AIF28349.1|  PIN-like protein                                        323   4e-103   Sabal bermudana
ref|NP_001234163.1|  auxin efflux facilitator SlPIN1                    323   4e-103   Solanum lycopersicum
gb|AIF28391.1|  PIN-like protein                                        325   4e-103   Thujopsis dolabrata [hiba arborvitae]
ref|XP_009371249.1|  PREDICTED: probable auxin efflux carrier com...    322   4e-103   
ref|XP_012083907.1|  PREDICTED: probable auxin efflux carrier com...    322   4e-103   Jatropha curcas
ref|NP_001234220.1|  auxin efflux facilitator SlPIN9                    322   5e-103   Solanum lycopersicum
ref|XP_006362273.1|  PREDICTED: auxin efflux carrier component 1-...    322   6e-103   Solanum tuberosum [potatoes]
gb|EYU24143.1|  hypothetical protein MIMGU_mgv1a003175mg                322   7e-103   Erythranthe guttata [common monkey flower]
ref|XP_006341527.1|  PREDICTED: auxin efflux carrier component 1-...    322   7e-103   Solanum tuberosum [potatoes]
ref|XP_009614860.1|  PREDICTED: probable auxin efflux carrier com...    322   8e-103   Nicotiana tomentosiformis
ref|XP_009763717.1|  PREDICTED: auxin efflux carrier component 2-...    314   8e-103   Nicotiana sylvestris
ref|XP_009609779.1|  PREDICTED: probable auxin efflux carrier com...    321   1e-102   Nicotiana tomentosiformis
ref|XP_009785135.1|  PREDICTED: probable auxin efflux carrier com...    321   1e-102   Nicotiana sylvestris
ref|XP_007028296.1|  Auxin efflux carrier family protein isoform 2      321   1e-102   
ref|XP_007028297.1|  Auxin efflux carrier family protein isoform 3      321   1e-102   
ref|XP_011084207.1|  PREDICTED: probable auxin efflux carrier com...    321   1e-102   Sesamum indicum [beniseed]
gb|EPS70360.1|  auxin efflux carrier                                    320   1e-102   Genlisea aurea
gb|KJB53043.1|  hypothetical protein B456_008G290000                    319   2e-102   Gossypium raimondii
ref|XP_008362771.1|  PREDICTED: probable auxin efflux carrier com...    320   2e-102   
gb|AIF28354.1|  PIN-like protein                                        321   2e-102   Talbotia elegans
ref|XP_009341965.1|  PREDICTED: probable auxin efflux carrier com...    321   2e-102   Pyrus x bretschneideri [bai li]
gb|KHN30345.1|  Auxin efflux carrier component 1                        320   2e-102   Glycine soja [wild soybean]
ref|NP_001267492.1|  uncharacterized protein LOC100820506               320   3e-102   Glycine max [soybeans]
ref|XP_008345946.1|  PREDICTED: auxin efflux carrier component 1-...    308   3e-102   
ref|XP_008387342.1|  PREDICTED: probable auxin efflux carrier com...    320   3e-102   
gb|KJB46194.1|  hypothetical protein B456_007G352200                    319   4e-102   Gossypium raimondii
dbj|BAO49655.1|  putative auxin efflux carrier protein                  319   4e-102   Vigna angularis [azuki bean]
ref|XP_007162070.1|  hypothetical protein PHAVU_001G121100g             319   4e-102   Phaseolus vulgaris [French bean]
gb|KJB46196.1|  hypothetical protein B456_007G352200                    319   4e-102   Gossypium raimondii
ref|XP_002527704.1|  Auxin efflux carrier component, putative           321   4e-102   
ref|XP_006826885.1|  PREDICTED: probable auxin efflux carrier com...    320   4e-102   Amborella trichopoda
ref|XP_007204212.1|  hypothetical protein PRUPE_ppa003159mg             320   5e-102   Prunus persica
ref|XP_008240670.1|  PREDICTED: probable auxin efflux carrier com...    319   5e-102   Prunus mume [ume]
emb|CDO98348.1|  unnamed protein product                                320   5e-102   Coffea canephora [robusta coffee]
ref|XP_010271843.1|  PREDICTED: probable auxin efflux carrier com...    320   6e-102   Nelumbo nucifera [Indian lotus]
ref|XP_007028295.1|  Auxin efflux carrier family protein isoform 1      322   6e-102   
gb|AGA83304.1|  UML                                                     319   6e-102   Lotus japonicus
gb|KJB46195.1|  hypothetical protein B456_007G352200                    318   7e-102   Gossypium raimondii
gb|AIF28305.1|  PIN-like protein                                        319   7e-102   Platanus occidentalis [American sycamore]
emb|CBI32787.3|  unnamed protein product                                318   8e-102   Vitis vinifera
gb|AIF28395.1|  PIN-like protein                                        319   8e-102   Taxus baccata
gb|AIF28304.1|  PIN-like protein                                        319   1e-101   Platanus occidentalis [American sycamore]
gb|KJB53042.1|  hypothetical protein B456_008G290000                    318   1e-101   Gossypium raimondii
gb|KHN08891.1|  Putative auxin efflux carrier component 1c              318   1e-101   Glycine soja [wild soybean]
ref|XP_007036847.1|  Auxin efflux facilitator isoform 2                 315   1e-101   
ref|XP_011660216.1|  PREDICTED: auxin efflux carrier component 1-...    319   1e-101   Cucumis sativus [cucumbers]
ref|NP_001275530.1|  auxin efflux carrier component 1-like              319   1e-101   Cucumis sativus [cucumbers]
ref|XP_010263760.1|  PREDICTED: probable auxin efflux carrier com...    318   2e-101   Nelumbo nucifera [Indian lotus]
gb|AIF28375.1|  PIN-like protein                                        316   2e-101   Chamaecyparis hodginsii
ref|XP_006482066.1|  PREDICTED: probable auxin efflux carrier com...    318   2e-101   Citrus sinensis [apfelsine]
ref|XP_008464398.1|  PREDICTED: probable auxin efflux carrier com...    318   2e-101   Cucumis melo [Oriental melon]
ref|XP_011072996.1|  PREDICTED: auxin efflux carrier component 1-...    318   2e-101   Sesamum indicum [beniseed]
gb|KDO53622.1|  hypothetical protein CISIN_1g007826mg                   318   2e-101   Citrus sinensis [apfelsine]
ref|XP_010246119.1|  PREDICTED: auxin efflux carrier component 2-...    319   2e-101   Nelumbo nucifera [Indian lotus]
ref|XP_002307966.1|  putative auxin efflux carrier protein 10           317   2e-101   Populus trichocarpa [western balsam poplar]
gb|AAQ14257.1|AF247004_1  auxin efflux carrier                          318   2e-101   Momordica charantia [balsam pear]
ref|XP_012066694.1|  PREDICTED: auxin efflux carrier component 2        318   3e-101   Jatropha curcas
ref|XP_002282693.1|  PREDICTED: probable auxin efflux carrier com...    318   3e-101   Vitis vinifera
ref|XP_010274725.1|  PREDICTED: probable auxin efflux carrier com...    318   3e-101   Nelumbo nucifera [Indian lotus]
ref|XP_004493383.1|  PREDICTED: probable auxin efflux carrier com...    317   3e-101   Cicer arietinum [garbanzo]
emb|CBI32786.3|  unnamed protein product                                316   3e-101   Vitis vinifera
gb|AIF28381.1|  PIN-like protein                                        319   3e-101   Prumnopitys andina
gb|AIF28382.1|  PIN-like protein                                        317   3e-101   Dacrycarpus compactus
ref|XP_002517316.1|  Auxin efflux carrier component, putative           318   4e-101   
ref|XP_010097558.1|  Auxin efflux carrier component 1                   318   4e-101   Morus notabilis
ref|XP_009411771.1|  PREDICTED: probable auxin efflux carrier com...    317   4e-101   
dbj|BAO49652.1|  putative auxin efflux carrier protein                  317   5e-101   Vigna angularis [azuki bean]
ref|XP_008800898.1|  PREDICTED: auxin efflux carrier component 4        318   6e-101   Phoenix dactylifera
gb|AAD04377.1|  putative auxin efflux carrier protein                   311   6e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007152685.1|  hypothetical protein PHAVU_004G150600g             317   7e-101   Phaseolus vulgaris [French bean]
ref|XP_009411770.1|  PREDICTED: probable auxin efflux carrier com...    317   8e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002282650.1|  PREDICTED: probable auxin efflux carrier com...    316   8e-101   Vitis vinifera
ref|XP_010246122.1|  PREDICTED: auxin efflux carrier component 2-...    317   9e-101   Nelumbo nucifera [Indian lotus]
ref|XP_004512743.1|  PREDICTED: auxin efflux carrier component 1-...    317   9e-101   Cicer arietinum [garbanzo]
gb|AIF28414.1|  PIN-like protein                                        308   1e-100   Chamaecyparis lawsoniana [Oregon cedar]
gb|AIU94749.1|  auxin efflux carrier                                    317   1e-100   Morus alba var. multicaulis
gb|ACH91863.1|  PIN-FORMED1                                             317   1e-100   Cardamine hirsuta
ref|XP_010246171.1|  PREDICTED: probable auxin efflux carrier com...    316   1e-100   Nelumbo nucifera [Indian lotus]
ref|XP_011040757.1|  PREDICTED: probable auxin efflux carrier com...    316   1e-100   Populus euphratica
ref|XP_010246173.1|  PREDICTED: probable auxin efflux carrier com...    316   1e-100   
gb|AGJ95058.1|  PIN4b                                                   316   1e-100   
ref|XP_010678065.1|  PREDICTED: probable auxin efflux carrier com...    316   1e-100   
ref|XP_012088553.1|  PREDICTED: probable auxin efflux carrier com...    316   2e-100   
gb|AAQ14256.1|AF246995_1  AEC1                                          316   2e-100   
ref|XP_012088551.1|  PREDICTED: probable auxin efflux carrier com...    316   2e-100   
gb|KJB37163.1|  hypothetical protein B456_006G191800                    315   2e-100   
ref|XP_012088550.1|  PREDICTED: probable auxin efflux carrier com...    316   2e-100   
ref|XP_010055808.1|  PREDICTED: probable auxin efflux carrier com...    315   2e-100   
ref|XP_007036846.1|  Auxin efflux facilitator isoform 1                 315   2e-100   
ref|XP_008788502.1|  PREDICTED: probable auxin efflux carrier com...    316   2e-100   
gb|AIW04421.1|  PIN1-like auxin transport protein PIN1                  315   2e-100   
gb|AIF28280.1|  PIN-like protein                                        308   2e-100   
dbj|BAO49653.1|  putative auxin efflux carrier protein                  316   2e-100   
gb|AIF28423.1|  PIN-like protein                                        317   3e-100   
ref|XP_008788503.1|  PREDICTED: probable auxin efflux carrier com...    315   3e-100   
gb|ABN08535.1|  Auxin Efflux Carrier                                    314   3e-100   
gb|AIF28248.1|  PIN-like protein                                        308   3e-100   
ref|XP_002322614.1|  putative auxin efflux carrier protein 10           314   4e-100   
emb|CAJ84441.1|  auxin efflux carrier                                   315   4e-100   
gb|AIF28413.1|  PIN-like protein                                        316   4e-100   
gb|AJT59723.1|  efflux facilitator PIN2                                 314   5e-100   
gb|KEH23588.1|  auxin efflux carrier family transporter                 314   5e-100   
ref|XP_003619829.1|  Auxin efflux carrier protein                       315   5e-100   
gb|AIF28347.1|  PIN-like protein                                        305   5e-100   
gb|AHN96184.1|  PIN-formed protein 1                                    315   5e-100   
ref|XP_010924198.1|  PREDICTED: auxin efflux carrier component 3 ...    315   5e-100   
gb|AJT59724.1|  efflux facilitator PIN2                                 315   5e-100   
gb|AHN96183.1|  PIN-formed protein 1                                    315   5e-100   
ref|XP_011000408.1|  PREDICTED: probable auxin efflux carrier com...    314   5e-100   
ref|XP_007014497.1|  Auxin efflux carrier family protein                315   6e-100   
gb|KHN00146.1|  Auxin efflux carrier component 1                        314   6e-100   
ref|NP_001267515.1|  uncharacterized protein LOC100786572               314   7e-100   
ref|XP_008455726.1|  PREDICTED: probable auxin efflux carrier com...    314   7e-100   
ref|XP_006376716.1|  hypothetical protein POPTR_0012s04470g             312   7e-100   
ref|XP_003624952.1|  Auxin efflux carrier component                     314   7e-100   
ref|XP_006490773.1|  PREDICTED: auxin efflux carrier component 1-...    310   7e-100   
gb|AIF28259.1|  PIN-like protein                                        308   7e-100   
gb|AIF28380.1|  PIN-like protein                                        315   8e-100   
gb|AIF28352.1|  PIN-like protein                                        315   8e-100   
dbj|BAH23795.1|  putative auxin transport facilitator protein           313   8e-100   
ref|XP_006593364.1|  PREDICTED: auxin efflux carrier protein 3 is...    315   1e-99    
gb|KHN22650.1|  Auxin efflux carrier component 2                        315   1e-99    
ref|XP_010055815.1|  PREDICTED: probable auxin efflux carrier com...    315   1e-99    
gb|KJB39253.1|  hypothetical protein B456_007G003800                    314   1e-99    
ref|XP_009610818.1|  PREDICTED: auxin efflux carrier component 2        315   1e-99    
dbj|BAH47609.1|  auxin:hydrogen symporter/transporter                   313   1e-99    
ref|XP_010471420.1|  PREDICTED: auxin efflux carrier component 1-...    314   1e-99    
ref|XP_010924195.1|  PREDICTED: auxin efflux carrier component 4 ...    314   2e-99    
ref|XP_006376717.1|  hypothetical protein POPTR_0012s04470g             313   2e-99    
ref|XP_010924197.1|  PREDICTED: auxin efflux carrier component 4 ...    314   2e-99    
ref|NP_001237559.1|  auxin efflux carrier protein 3                     315   2e-99    
gb|AIN44211.1|  PIN1                                                    313   2e-99    
ref|XP_010922067.1|  PREDICTED: probable auxin efflux carrier com...    313   2e-99    
gb|AGY29597.1|  auxin efflux carrier                                    313   2e-99    
ref|NP_001238365.1|  auxin efflux carrier protein 4                     313   2e-99    
gb|AIF28292.1|  PIN-like protein                                        311   2e-99    
ref|XP_010416169.1|  PREDICTED: auxin efflux carrier component 1        313   2e-99    
ref|XP_007154690.1|  hypothetical protein PHAVU_003G139600g             313   2e-99    
ref|XP_002324677.2|  auxin efflux carrier component 2 family protein    313   2e-99    
ref|XP_002317874.1|  auxin efflux carrier component 1 family protein    313   2e-99    
gb|KHN17646.1|  Auxin efflux carrier component 2                        313   2e-99    
ref|XP_010112842.1|  putative auxin efflux carrier component 1c         312   3e-99    
gb|AIF28310.1|  PIN-like protein                                        309   3e-99    
ref|XP_006600116.1|  PREDICTED: auxin efflux carrier protein 4 is...    313   3e-99    
gb|AIF28379.1|  PIN-like protein                                        298   3e-99    
ref|XP_006300880.1|  hypothetical protein CARUB_v10019970mg             313   3e-99    
ref|XP_010036951.1|  PREDICTED: auxin efflux carrier component 1-...    312   3e-99    
ref|XP_010932635.1|  PREDICTED: probable auxin efflux carrier com...    314   3e-99    
ref|XP_006390539.1|  hypothetical protein EUTSA_v10018278mg             313   3e-99    
gb|AGJ95052.1|  PIN4a                                                   312   3e-99    
ref|XP_010932634.1|  PREDICTED: probable auxin efflux carrier com...    314   4e-99    
dbj|BAJ10464.1|  auxin efflux facilitator                               312   4e-99    
gb|AIF28257.1|  PIN-like protein                                        310   4e-99    
ref|NP_001292667.1|  probable auxin efflux carrier component 1c         312   4e-99    
ref|XP_004144328.1|  PREDICTED: probable auxin efflux carrier com...    312   5e-99    
gb|KGN63875.1|  hypothetical protein Csa_1G025070                       312   5e-99    
gb|ERN07440.1|  hypothetical protein AMTR_s00019p00250330               312   5e-99    
emb|CDX96484.1|  BnaA07g30950D                                          310   5e-99    
gb|AEK01107.1|  auxin transport protein                                 312   5e-99    
ref|NP_177500.1|  auxin efflux carrier component 1                      312   5e-99    
gb|KDO61974.1|  hypothetical protein CISIN_1g036474mg                   313   5e-99    
ref|XP_006474301.1|  PREDICTED: auxin efflux carrier component 2-...    313   5e-99    
gb|AIF28252.1|  PIN-like protein                                        311   6e-99    
ref|XP_010673043.1|  PREDICTED: probable auxin efflux carrier com...    312   6e-99    
ref|XP_002887490.1|  pin-formed 1                                       312   7e-99    
gb|AIF28262.1|  PIN-like protein                                        312   7e-99    
ref|XP_007210282.1|  hypothetical protein PRUPE_ppa002944mg             312   7e-99    
ref|XP_011039131.1|  PREDICTED: probable auxin efflux carrier com...    311   8e-99    
ref|XP_006845765.2|  PREDICTED: auxin efflux carrier component 2        312   8e-99    
ref|XP_008453480.1|  PREDICTED: probable auxin efflux carrier com...    311   8e-99    
gb|KJB53695.1|  hypothetical protein B456_009G001600                    312   9e-99    
ref|XP_007160541.1|  hypothetical protein PHAVU_002G330300g             311   9e-99    
ref|XP_011017712.1|  PREDICTED: auxin efflux carrier component 2        312   1e-98    
gb|AHN96182.1|  PIN-formed protein 1                                    311   1e-98    
ref|XP_009360078.1|  PREDICTED: probable auxin efflux carrier com...    311   1e-98    
gb|AAM54034.1|AF515435_1  PIN1-like auxin transport protein             310   1e-98    
ref|XP_006663800.1|  PREDICTED: probable auxin efflux carrier com...    309   2e-98    
gb|AIF28288.1|  PIN-like protein                                        311   2e-98    
ref|XP_006490772.1|  PREDICTED: probable auxin efflux carrier com...    310   2e-98    
ref|XP_008453545.1|  PREDICTED: auxin efflux carrier component 2        311   2e-98    
ref|XP_004299530.1|  PREDICTED: probable auxin efflux carrier com...    311   2e-98    
ref|XP_004503270.1|  PREDICTED: probable auxin efflux carrier com...    308   2e-98    
emb|CDP03009.1|  unnamed protein product                                311   2e-98    
emb|CDX82059.1|  BnaC02g22310D                                          308   2e-98    
dbj|BAH23796.1|  putative auxin transport facilitator protein           310   2e-98    
dbj|BAH47608.1|  auxin:hydrogen symporter/transporter                   310   2e-98    
gb|AAO38045.1|  auxin efflux carrier protein PIN1                       310   2e-98    
ref|XP_011009711.1|  PREDICTED: probable auxin efflux carrier com...    310   2e-98    
ref|XP_009356039.1|  PREDICTED: probable auxin efflux carrier com...    311   2e-98    
ref|XP_011009713.1|  PREDICTED: probable auxin efflux carrier com...    310   2e-98    
ref|XP_011009714.1|  PREDICTED: probable auxin efflux carrier com...    310   2e-98    
gb|AIF28346.1|  PIN-like protein                                        306   2e-98    
ref|XP_011650199.1|  PREDICTED: auxin efflux carrier component 2-...    311   3e-98    
gb|AIF28416.1|  PIN-like protein                                        311   3e-98    
ref|XP_010087961.1|  Auxin efflux carrier component 2                   315   3e-98    
ref|XP_009359964.1|  PREDICTED: auxin efflux carrier component 2-...    311   3e-98    
gb|AAG17172.1|AF190881_1  PIN1-like auxin transport protein             310   3e-98    
ref|XP_009391391.1|  PREDICTED: probable auxin efflux carrier com...    311   3e-98    
gb|KEH32536.1|  auxin efflux carrier family transporter                 308   3e-98    
ref|XP_009350116.1|  PREDICTED: auxin efflux carrier component 2-...    311   4e-98    
gb|EPS72784.1|  hypothetical protein M569_01970                         308   4e-98    
ref|XP_010931527.1|  PREDICTED: probable auxin efflux carrier com...    308   4e-98    
ref|XP_009106015.1|  PREDICTED: auxin efflux carrier component 1-...    310   4e-98    
gb|AGV28593.1|  auxin efflux carrier 1a                                 309   4e-98    
dbj|BAK02872.1|  predicted protein                                      312   4e-98    
gb|AGV28594.1|  auxin efflux carrier 1b                                 309   4e-98    
ref|NP_001048095.1|  Os02g0743400                                       309   4e-98    
gb|AAD04376.1|  putative auxin efflux carrier protein                   310   5e-98    
ref|XP_011069941.1|  PREDICTED: auxin efflux carrier component 2        310   5e-98    
dbj|BAJ97950.1|  predicted protein                                      309   6e-98    
ref|NP_001267673.1|  auxin efflux carrier component 2-like              310   6e-98    
ref|XP_009380324.1|  PREDICTED: probable auxin efflux carrier com...    306   6e-98    
gb|AIF28351.1|  PIN-like protein                                        305   7e-98    
gb|AAN71616.1|  PIN-like protein                                        308   7e-98    
gb|AIF28278.1|  PIN-like protein                                        308   9e-98    
emb|CDY47745.1|  BnaA02g16500D                                          308   9e-98    
ref|XP_002322104.1|  auxin efflux carrier component 1 family protein    309   9e-98    
ref|XP_009416741.1|  PREDICTED: probable auxin efflux carrier com...    310   9e-98    
ref|NP_001057227.1|  Os06g0232300                                       308   9e-98    
ref|XP_009416747.1|  PREDICTED: probable auxin efflux carrier com...    309   9e-98    
gb|AIF28418.1|  PIN-like protein                                        302   1e-97    
gb|AAT48628.1|  putative auxin efflux carrier protein 7                 306   1e-97    
gb|AIF28412.1|  PIN-like protein                                        305   1e-97    
gb|KFK27268.1|  hypothetical protein AALP_AA8G359900                    310   1e-97    
gb|AIF28247.1|  PIN-like protein                                        305   1e-97    
gb|AIF28519.1|  PIN-like protein                                        297   1e-97    
gb|AIF28417.1|  PIN-like protein                                        299   1e-97    
ref|XP_008363929.1|  PREDICTED: auxin efflux carrier component 2        310   1e-97    
ref|XP_007227619.1|  hypothetical protein PRUPE_ppa024134mg             310   1e-97    
ref|XP_010909245.1|  PREDICTED: probable auxin efflux carrier com...    308   1e-97    
gb|AIF28261.1|  PIN-like protein                                        308   1e-97    
ref|XP_003564038.1|  PREDICTED: probable auxin efflux carrier com...    308   1e-97    
ref|XP_009414067.1|  PREDICTED: probable auxin efflux carrier com...    309   1e-97    
gb|EYU33972.1|  hypothetical protein MIMGU_mgv1a003655mg                307   2e-97    
ref|XP_008223846.1|  PREDICTED: auxin efflux carrier component 2-...    309   2e-97    
gb|AIF28256.1|  PIN-like protein                                        307   2e-97    
ref|NP_001234170.1|  auxin efflux facilitator SlPIN2                    308   2e-97    
gb|AIF28290.1|  PIN-like protein                                        298   2e-97    
gb|AIF28260.1|  PIN-like protein                                        308   2e-97    
ref|XP_008393426.1|  PREDICTED: probable auxin efflux carrier com...    308   2e-97    
ref|XP_009128000.1|  PREDICTED: auxin efflux carrier component 1        308   2e-97    
ref|XP_003610025.1|  Auxin efflux carrier component                     306   3e-97    
gb|AIF28283.1|  PIN-like protein                                        307   3e-97    
ref|XP_010909244.1|  PREDICTED: probable auxin efflux carrier com...    308   3e-97    
ref|XP_003610026.1|  Auxin efflux carrier component                     308   3e-97    
ref|XP_011620732.1|  PREDICTED: probable auxin efflux carrier com...    307   3e-97    
gb|AAD16060.1|  root gravitropism control protein                       308   3e-97    
ref|NP_568848.1|  auxin efflux carrier component 2                      308   3e-97    
ref|XP_006366195.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    308   3e-97    
ref|XP_004507913.1|  PREDICTED: auxin efflux carrier component 2-...    308   4e-97    
gb|AGY29598.1|  auxin efflux carrier                                    308   4e-97    
ref|XP_002864498.1|  hypothetical protein ARALYDRAFT_918870             308   4e-97    
ref|XP_004953880.1|  PREDICTED: auxin efflux carrier component 1-...    306   4e-97    
dbj|BAA97359.1|  auxin transport protein EIR1                           308   5e-97    
ref|XP_010483204.1|  PREDICTED: auxin efflux carrier component 2-...    308   5e-97    
gb|AIF28258.1|  PIN-like protein                                        307   5e-97    
gb|ERM99121.1|  hypothetical protein AMTR_s00101p00149240               307   5e-97    
ref|XP_010443377.1|  PREDICTED: auxin efflux carrier component 2 ...    308   5e-97    
ref|XP_006401246.1|  hypothetical protein EUTSA_v10012929mg             308   6e-97    
ref|XP_008646250.1|  PREDICTED: auxin efflux carrier component 1        306   6e-97    
ref|XP_010451791.1|  PREDICTED: auxin efflux carrier component 2-...    308   6e-97    
dbj|BAO49656.1|  putative auxin efflux carrier protein                  306   6e-97    
gb|KDP23925.1|  hypothetical protein JCGZ_27085                         306   6e-97    
gb|AIF28522.1|  PIN-like protein                                        295   7e-97    
gb|AIF28282.1|  PIN-like protein                                        307   7e-97    
gb|AIF28344.1|  PIN-like protein                                        293   7e-97    
emb|CBX25245.1|  hypothetical_protein                                   304   8e-97    
ref|NP_001238349.1|  auxin efflux carrier protein 1                     302   1e-96    
ref|XP_006280155.1|  hypothetical protein CARUB_v10026053mg             307   1e-96    
ref|XP_009380316.1|  PREDICTED: probable auxin efflux carrier com...    306   1e-96    
ref|XP_008374845.1|  PREDICTED: probable auxin efflux carrier com...    306   1e-96    
ref|XP_008812806.1|  PREDICTED: probable auxin efflux carrier com...    306   2e-96    
ref|XP_008788445.1|  PREDICTED: probable auxin efflux carrier com...    306   2e-96    
ref|XP_004965061.1|  PREDICTED: probable auxin efflux carrier com...    305   3e-96    
gb|AIF28518.1|  PIN-like protein                                        295   3e-96    
ref|XP_004953879.1|  PREDICTED: auxin efflux carrier component 1-...    306   3e-96    
gb|AIF28534.1|  PIN-like protein                                        301   3e-96    
ref|XP_006655945.1|  PREDICTED: probable auxin efflux carrier com...    304   4e-96    
ref|XP_002436761.1|  hypothetical protein SORBIDRAFT_10g008290          305   4e-96    
gb|AIF28289.1|  PIN-like protein                                        305   5e-96    
ref|XP_004299793.1|  PREDICTED: auxin efflux carrier component 2-...    305   5e-96    
ref|XP_004965062.1|  PREDICTED: probable auxin efflux carrier com...    304   6e-96    
gb|AIF28435.1|  PIN-like protein                                        291   8e-96    
ref|XP_009126903.1|  PREDICTED: auxin efflux carrier component 2        305   9e-96    
ref|XP_010695799.1|  PREDICTED: auxin efflux carrier component 2        305   1e-95    
ref|XP_008659083.1|  PREDICTED: probable auxin efflux carrier com...    303   1e-95    
ref|NP_001237546.1|  auxin efflux carrier protein 2                     299   1e-95    
ref|XP_009132150.1|  PREDICTED: auxin efflux carrier component 2-...    304   2e-95    
emb|CAN70111.1|  hypothetical protein VITISV_032889                     301   3e-95    
gb|AIF28394.1|  PIN-like protein                                        301   3e-95    
ref|XP_010536878.1|  PREDICTED: auxin efflux carrier component 2        303   3e-95    
gb|AIF28285.1|  PIN-like protein                                        303   4e-95    
ref|XP_010537499.1|  PREDICTED: auxin efflux carrier component 1        303   4e-95    
ref|XP_010673044.1|  PREDICTED: probable auxin efflux carrier com...    301   4e-95    
gb|AGM20675.1|  PIN                                                     301   1e-94    
ref|XP_003570666.1|  PREDICTED: LOW QUALITY PROTEIN: auxin efflux...    300   1e-94    
gb|AIF28516.1|  PIN-like protein                                        291   1e-94    
ref|XP_002266059.1|  PREDICTED: auxin efflux carrier component 2        301   1e-94    
ref|NP_001043692.1|  Os01g0643300                                       300   2e-94    
ref|XP_009120227.1|  PREDICTED: auxin efflux carrier component 2-...    300   2e-94    



>ref|XP_010320545.1| PREDICTED: auxin efflux facilitator SlPIN4 isoform X1 [Solanum 
lycopersicum]
Length=648

 Score =   367 bits (941),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIA
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAADSLQKVIML VL++WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009601548.1| PREDICTED: auxin efflux carrier component 7-like [Nicotiana tomentosiformis]
 gb|AGG79242.1| auxin efflux facilitator PIN4 [Nicotiana tabacum]
Length=650

 Score =   367 bits (941),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIA
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAADSLQKVIML VL++WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>dbj|BAJ09455.1| auxin efflux carrier [Solanum lycopersicum]
Length=653

 Score =   367 bits (941),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIA
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAADSLQKVIML VL++WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_001234184.1| auxin efflux facilitator SlPIN4 [Solanum lycopersicum]
 gb|ADR30410.1| auxin efflux facilitator SlPIN4 [Solanum lycopersicum]
Length=653

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIA
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAADSLQKVIML VL++WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006344239.1| PREDICTED: auxin efflux carrier component 3-like [Solanum tuberosum]
Length=654

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIA
Sbjct  1    MITWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAADSLQKVIML VL++WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009802789.1| PREDICTED: auxin efflux carrier component 7-like [Nicotiana sylvestris]
Length=654

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLYVVL+AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIA
Sbjct  1    MITWHDLYVVLSAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAADSLQKVIML VL++WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   LNNPYEMNFRFIAADSLQKVIMLVVLSLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_011075639.1| PREDICTED: auxin efflux carrier component 7-like [Sesamum indicum]
 ref|XP_011075647.1| PREDICTED: auxin efflux carrier component 7-like [Sesamum indicum]
Length=650

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+ YAMNFRFIAADSLQKVIML VL +WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNFRFIAADSLQKVIMLVVLGLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_011075655.1| PREDICTED: auxin efflux carrier component 7-like [Sesamum indicum]
Length=644

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+ YAMNFRFIAADSLQKVIML VL +WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNFRFIAADSLQKVIMLVVLGLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010552711.1| PREDICTED: auxin efflux carrier component 3 [Tarenaya hassleriana]
Length=580

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQKVIML +LA+WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKVIMLFLLALWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGDYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_011070630.1| PREDICTED: auxin efflux carrier component 7-like [Sesamum indicum]
Length=651

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+ Y MNFRFIAAD+LQK+IML VL +WANFTKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYTMNFRFIAADTLQKIIMLVVLGLWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010498810.1| PREDICTED: auxin efflux carrier component 7-like isoform X2 [Camelina 
sativa]
Length=530

 Score =   356 bits (914),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CDY25767.1| BnaA07g10150D [Brassica napus]
Length=573

 Score =   358 bits (918),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML++L +WANFT+ GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKLIMLSLLTLWANFTRAGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KDO64681.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=529

 Score =   356 bits (914),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY+VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_564189.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
 gb|AAK96547.1| At1g23080/T26J12_14 [Arabidopsis thaliana]
 gb|AEE30333.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
Length=527

 Score =   356 bits (913),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AAC00611.1| unknown protein [Arabidopsis thaliana]
Length=574

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CDY68262.1| BnaC06g43740D [Brassica napus]
Length=584

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK++MLA+L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CDX96288.1| BnaA07g28990D [Brassica napus]
Length=583

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK++MLA+L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CAC67688.1| efflux carrier, pin3 [Brassica juncea]
Length=635

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK++MLA+L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009103201.1| PREDICTED: auxin efflux carrier component 7 [Brassica rapa]
Length=603

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML++L +WANFT+ GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKLIMLSLLTLWANFTRAGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CAC24691.1| efflux carrier of polar auxin transport [Brassica juncea]
Length=639

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK++MLA+L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|EYU30062.1| hypothetical protein MIMGU_mgv1a002731mg [Erythranthe guttata]
Length=643

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAM LAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMFLAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+ YAMNFRFIAAD+LQK+IML VL  WANFTKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNFRFIAADTLQKIIMLVVLGFWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_177250.1| auxin efflux carrier component 3 [Arabidopsis thaliana]
 sp|Q9S7Z8.1|PIN3_ARATH RecName: Full=Auxin efflux carrier component 3; Short=AtPIN3 
[Arabidopsis thaliana]
 gb|AAD52695.1|AF087818_1 auxin transport protein [Arabidopsis thaliana]
 gb|AAD55507.1|AC008148_17 auxin transport protein [Arabidopsis thaliana]
 gb|AAM96993.1| putative auxin transport protein REH1 [Arabidopsis thaliana]
 gb|AAN72096.1| putative auxin transport protein REH1 [Arabidopsis thaliana]
 dbj|BAE98967.1| auxin transport like protein [Arabidopsis thaliana]
 gb|AEE35140.1| auxin efflux carrier component 3 [Arabidopsis thaliana]
Length=640

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML++L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009761336.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Nicotiana 
sylvestris]
Length=615

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML VL +WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETA  IV  KVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAGEIVSLKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009761335.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Nicotiana 
sylvestris]
Length=619

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML VL +WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETA  IV  KVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAGEIVSLKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CAC67457.1| efflux carrier, pin2 [Brassica juncea]
Length=640

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK++MLA+L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AGG79243.1| auxin efflux facilitator PIN3b [Nicotiana tabacum]
Length=619

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML VL +WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETA  IV  KVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAGEIVSLKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CAN66787.1| hypothetical protein VITISV_013835 [Vitis vinifera]
Length=627

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLYVVLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYVVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   QNNPYAMNFRFIAADTLQKIIMLVVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CDP00766.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   358 bits (919),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLYVVL+AVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITWHDLYVVLSAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN +FIAAD+LQKVIML VLA+WANFTKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNLKFIAADTLQKVIMLVVLALWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMY  Y+GSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYNPYAGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009601533.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=617

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML VL +WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETA  IV  KVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAGEIVSLKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009601532.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=621

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML VL +WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETA  IV  KVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAGEIVSLKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_849700.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
 sp|Q940Y5.2|PIN7_ARATH RecName: Full=Auxin efflux carrier component 7; Short=AtPIN7 
[Arabidopsis thaliana]
 gb|AAD52697.1|AF087820_1 auxin transport protein [Arabidopsis thaliana]
 gb|AEE30332.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
Length=619

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KDO64678.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
 gb|KDO64679.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=621

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY+VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_002284302.1| PREDICTED: auxin efflux carrier component 3 [Vitis vinifera]
Length=649

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLYVVLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYVVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   QNNPYAMNFRFIAADTLQKIIMLVVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AFJ03880.1| auxin transport protein [Capsella bursa-pastoris]
Length=618

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010477592.1| PREDICTED: auxin efflux carrier component 7 isoform X3 [Camelina 
sativa]
Length=604

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010498809.1| PREDICTED: auxin efflux carrier component 7-like isoform X1 [Camelina 
sativa]
Length=612

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_001077584.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
 dbj|BAH19520.1| AT1G23080 [Arabidopsis thaliana]
 gb|AEE30334.1| auxin efflux carrier component 7 [Arabidopsis thaliana]
Length=615

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>dbj|BAH47611.1| auxin:hydrogen symporter/transporter [Zinnia violacea]
Length=625

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT HD Y V++A++PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHF +
Sbjct  1    MITGHDFYTVMSAMVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFTS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML VLA+WANFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYAMNFRFIAADTLQKIIMLVVLALWANFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010477589.1| PREDICTED: auxin efflux carrier component 7 isoform X1 [Camelina 
sativa]
Length=615

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KDO64680.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=604

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY+VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010477591.1| PREDICTED: auxin efflux carrier component 7 isoform X2 [Camelina 
sativa]
Length=611

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010101728.1| Auxin efflux carrier component 3 [Morus notabilis]
 gb|EXB89392.1| Auxin efflux carrier component 3 [Morus notabilis]
Length=652

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NN YAMNFRFIAAD+LQK+IML+VLA+W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNIYAMNFRFIAADTLQKIIMLSVLAIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AEJ76925.1| auxin transport protein [Capsella bursa-pastoris]
Length=649

 Score =   357 bits (916),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML++L +WAN T++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVIWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KFK41521.1| hypothetical protein AALP_AA2G140400 [Arabis alpina]
Length=650

 Score =   357 bits (916),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLCLLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006307013.1| hypothetical protein CARUB_v10008599mg [Capsella rubella]
 gb|EOA39911.1| hypothetical protein CARUB_v10008599mg [Capsella rubella]
Length=618

 Score =   356 bits (913),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KDO64677.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=636

 Score =   357 bits (915),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY+VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006360412.1| PREDICTED: auxin efflux carrier component 3-like [Solanum tuberosum]
Length=622

 Score =   356 bits (913),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQKVIML VL +W+N TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKVIMLIVLCIWSNVTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETA  IV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAGEIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006300840.1| hypothetical protein CARUB_v10019932mg [Capsella rubella]
 gb|EOA33738.1| hypothetical protein CARUB_v10019932mg [Capsella rubella]
Length=648

 Score =   357 bits (915),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML++L +WAN T++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVIWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_002893260.1| pin-formed 7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69519.1| pin-formed 7 [Arabidopsis lyrata subsp. lyrata]
Length=614

 Score =   356 bits (913),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLIIWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KDO64676.1| hypothetical protein CISIN_1g006199mg [Citrus sinensis]
Length=657

 Score =   357 bits (915),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY+VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYLVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006416127.1| hypothetical protein EUTSA_v10007111mg [Eutrema salsugineum]
 gb|ESQ34480.1| hypothetical protein EUTSA_v10007111mg [Eutrema salsugineum]
Length=610

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY+MN RFIAAD+LQK+IML++L +WANFT++G+LEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYSMNLRFIAADTLQKLIMLSLLTIWANFTRSGTLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGDYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010471101.1| PREDICTED: auxin efflux carrier component 3-like [Camelina sativa]
Length=645

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML++L +WAN T++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010427902.1| PREDICTED: auxin efflux carrier component 3-like [Camelina sativa]
Length=645

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML++L +WAN T++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006469168.1| PREDICTED: auxin efflux carrier component 3-like [Citrus sinensis]
Length=657

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYSVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_001234177.1| auxin efflux facilitator SlPIN3 [Solanum lycopersicum]
 gb|ADR30411.1| auxin efflux facilitator SlPIN3 [Solanum lycopersicum]
Length=604

 Score =   354 bits (909),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQKVIML VL +W+N TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKVIMLIVLCIWSNVTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETA  IV FKVESD
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAGEIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_002887338.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63597.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=642

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML++L +WAN T++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_012072212.1| PREDICTED: auxin efflux carrier component 3-like [Jatropha curcas]
 gb|KDP38049.1| hypothetical protein JCGZ_04692 [Jatropha curcas]
Length=648

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLVALGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009105760.1| PREDICTED: LOW QUALITY PROTEIN: auxin efflux carrier component 
3 [Brassica rapa]
Length=635

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
              NPYAMN RFIAAD+LQK++MLA+L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TXNPYAMNLRFIAADTLQKILMLALLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEY+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006390822.1| hypothetical protein EUTSA_v10018257mg [Eutrema salsugineum]
 gb|ESQ28108.1| hypothetical protein EUTSA_v10018257mg [Eutrema salsugineum]
Length=642

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK++ML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKILMLGLLVLWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+Y+GSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGDYAGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CDY12491.1| BnaC07g13310D [Brassica napus]
Length=574

 Score =   353 bits (905),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGI RFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGIKRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN  FIAAD+LQK+IML++L +WANFT+ GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLHFIAADTLQKLIMLSLLTLWANFTRAGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010319114.1| PREDICTED: auxin efflux facilitator SlPIN3 isoform X1 [Solanum 
lycopersicum]
 dbj|BAJ09456.1| auxin efflux carrier [Solanum lycopersicum]
Length=613

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQKVIML VL +W+N TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKVIMLIVLCIWSNVTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETA  IV FKVESD
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAGEIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|EPS59246.1| hypothetical protein M569_15563, partial [Genlisea aurea]
Length=536

 Score =   351 bits (900),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT HDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITLHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NN YAMNFRF+AAD++QK+IML++LA+W N +++GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   QNNIYAMNFRFVAADTVQKLIMLSILALWGNLSRSGSLEWSITVFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28328.1| PIN-like protein, partial [Aextoxicon punctatum]
Length=338

 Score =   344 bits (882),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTA+IPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAMIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   INDPYKMNFRFIAADTLQKIIMLVVLIIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG YS SLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LRAMYGNYSASLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010462853.1| PREDICTED: auxin efflux carrier component 7-like [Camelina sativa]
Length=726

 Score =   356 bits (914),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIMLTLLILWANFTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010527774.1| PREDICTED: auxin efflux carrier component 4-like [Tarenaya hassleriana]
Length=619

 Score =   353 bits (906),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML VL +WAN TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVVLCLWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASI+ FKV+SD
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIISFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AAM55297.1| auxin efflux carrier protein [Medicago truncatula]
 gb|KEH30872.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=659

 Score =   354 bits (909),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQK+IML  L +W NFT NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKIIMLLALTIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG+LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASI+ FKV+SD
Sbjct  121  LIAMYGEYSGTLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIISFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010415790.1| PREDICTED: auxin efflux carrier component 3 [Camelina sativa]
Length=646

 Score =   354 bits (908),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAVIPLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAVIPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML++L +WAN T++GSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLSLLVLWANLTRSGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFE+RGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEFRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KGN51517.1| hypothetical protein Csa_5G576590 [Cucumis sativus]
Length=636

 Score =   353 bits (907),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWKDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +N+PYAMNFRFIAAD+LQK+IML  L +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNDPYAMNFRFIAADTLQKIIMLFFLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AGG79240.1| auxin efflux facilitator PIN3 [Nicotiana tabacum]
Length=620

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLYVVLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYVVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINLFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML VL +WAN TKNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLVVLCLWANLTKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETA  IV  KVESD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAGEIVSLKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_007157735.1| hypothetical protein PHAVU_002G094000g [Phaseolus vulgaris]
 gb|ESW29729.1| hypothetical protein PHAVU_002G094000g [Phaseolus vulgaris]
Length=658

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWADLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML  LA+W NFT NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIIMLFALAIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_007157734.1| hypothetical protein PHAVU_002G094000g [Phaseolus vulgaris]
 gb|ESW29728.1| hypothetical protein PHAVU_002G094000g [Phaseolus vulgaris]
Length=660

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWADLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML  LA+W NFT NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIIMLFALAIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_565261.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
 gb|AAF36769.1| auxin transporter splice variant b [Arabidopsis thaliana]
 gb|AAC67319.2| putative auxin transport protein [Arabidopsis thaliana]
 gb|AAM15143.1| putative auxin transport protein [Arabidopsis thaliana]
 gb|AEC05448.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
Length=612

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRF+AAD+LQK+IML +LA+WAN TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_008467158.1| PREDICTED: auxin efflux carrier component 4-like [Cucumis melo]
Length=636

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWKDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFFLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KFK44397.1| hypothetical protein AALP_AA1G252100 [Arabis alpina]
Length=598

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY+MN  FIAAD+LQK++ML++L +WANFT++G+LEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYSMNLHFIAADTLQKIMMLSLLTLWANFTRSGNLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGEYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_849923.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
 sp|Q8RWZ6.1|PIN4_ARATH RecName: Full=Auxin efflux carrier component 4; Short=AtPIN4 
[Arabidopsis thaliana]
 gb|AAM14031.1| putative auxin transport protein [Arabidopsis thaliana]
 gb|AAP40497.1| putative auxin transport protein [Arabidopsis thaliana]
 gb|AEC05449.1| auxin efflux carrier component 4 [Arabidopsis thaliana]
Length=616

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRF+AAD+LQK+IML +LA+WAN TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|EYU40829.1| hypothetical protein MIMGU_mgv1a025638mg [Erythranthe guttata]
Length=632

 Score =   352 bits (903),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISWNDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+ YAMNFRF+AAD+LQK+IMLAVLA+WAN +KNGSLEWSITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNFRFVAADTLQKIIMLAVLAMWANISKNGSLEWSITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            V+  DG
Sbjct  181  VLGNDG  186



>ref|XP_010513862.1| PREDICTED: auxin efflux carrier component 4-like [Camelina sativa]
Length=605

 Score =   350 bits (899),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMN RFIAAD+LQK+IML VLA+W+N TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNLRFIAADTLQKIIMLFVLALWSNLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_002876748.1| pin-formed 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53007.1| pin-formed 4 [Arabidopsis lyrata subsp. lyrata]
Length=610

 Score =   351 bits (900),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRF+AAD+LQK+IML +L +WAN TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFVAADTLQKIIMLVLLGLWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006290757.1| hypothetical protein CARUB_v10016856mg [Capsella rubella]
 gb|EOA23655.1| hypothetical protein CARUB_v10016856mg [Capsella rubella]
Length=612

 Score =   351 bits (900),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMN RFIAAD+LQK+IML +LA+WAN TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNLRFIAADTLQKIIMLFLLALWANLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGSYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006398529.1| hypothetical protein EUTSA_v10000822mg [Eutrema salsugineum]
 gb|ESQ39982.1| hypothetical protein EUTSA_v10000822mg [Eutrema salsugineum]
Length=609

 Score =   350 bits (899),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML +LA+WAN TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVLLALWANLTKNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGIEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28339.1| PIN-like protein, partial [Hakea drupacea]
Length=507

 Score =   347 bits (891),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYTVLTAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+I+L VL +W NFT+ GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIILLVVLGIWTNFTRTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG+YSG+LMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP+TAASIV FKV+SD
Sbjct  121  LSAMYGQYSGTLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IMSLDG  186



>ref|NP_001267715.1| auxin efflux carrier component 3-like [Cucumis sativus]
 dbj|BAJ10466.1| auxin efflux facilitator [Cucumis sativus]
Length=636

 Score =   351 bits (900),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWKDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +N+PYA+NFRFIAAD+LQK+IML  L +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNDPYAVNFRFIAADTLQKIIMLFFLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_007045129.1| Auxin efflux facilitator isoform 6 [Theobroma cacao]
 gb|EOY00961.1| Auxin efflux facilitator isoform 6 [Theobroma cacao]
Length=525

 Score =   348 bits (892),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_007045127.1| Auxin efflux carrier family protein isoform 4 [Theobroma cacao]
 gb|EOY00959.1| Auxin efflux carrier family protein isoform 4 [Theobroma cacao]
Length=520

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>dbj|BAO49654.1| putative auxin efflux carrier protein [Vigna angularis]
Length=653

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWTDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMNFRFIAAD+LQK+IML  LA+W NFT NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNFRFIAADTLQKIIMLFALAIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDYSGQLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010554422.1| PREDICTED: auxin efflux carrier component 4-like [Tarenaya hassleriana]
Length=626

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTA++PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLTAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML VL +WA+ TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVVLGLWASLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010424909.1| PREDICTED: auxin efflux carrier component 4 [Camelina sativa]
Length=608

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMN RFIAAD+LQK+IML +LA+W+N TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNLRFIAADTLQKIIMLFLLALWSNLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_007045128.1| Auxin efflux carrier family protein isoform 5 [Theobroma cacao]
 gb|EOY00960.1| Auxin efflux carrier family protein isoform 5 [Theobroma cacao]
Length=542

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AGJ95053.1| PIN1a [Glycine max]
Length=561

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML  LA+W N TK GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIIMLFALAIWTNLTKTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28331.1| PIN-like protein, partial [Trochodendron aralioides]
Length=590

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWQDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRFIAAD+LQK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLVVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_001267499.1| uncharacterized protein LOC100791394 [Glycine max]
 gb|AGJ95057.1| PIN1b [Glycine max]
 gb|KHN15990.1| Auxin efflux carrier component 3 [Glycine soja]
Length=634

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY+VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYMVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML  LA+W N TK GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIIMLFALAIWTNLTKTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_007045126.1| Auxin efflux facilitator isoform 3 [Theobroma cacao]
 gb|EOY00958.1| Auxin efflux facilitator isoform 3 [Theobroma cacao]
Length=609

 Score =   348 bits (892),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_011038656.1| PREDICTED: auxin efflux carrier component 7 [Populus euphratica]
Length=639

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VL+AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W NFTKNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLIALGIWTNFTKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LTAMYGNYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AAM54033.1|AF515434_1 PIN1-like auxin transport protein [Populus tremula x Populus 
tremuloides]
Length=640

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VL+AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W NFTKNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLIALGIWTNFTKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LTAMYGTYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_002314810.2| PIN1-like family protein [Populus trichocarpa]
 gb|EEF00981.2| PIN1-like family protein [Populus trichocarpa]
Length=634

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VL+AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W NFTKNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLIALGIWTNFTKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG+YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASI+ FKV+SD
Sbjct  121  LTAMYGKYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIISFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28335.1| PIN-like protein, partial [Euptelea pleiosperma]
Length=638

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VLTAV+PLYVAMILAY SVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWKDLYTVLTAVVPLYVAMILAYCSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML +L +W NFT+NG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLGILGIWTNFTRNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGE+SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEFSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_007045125.1| Auxin efflux facilitator isoform 2 [Theobroma cacao]
 gb|EOY00957.1| Auxin efflux facilitator isoform 2 [Theobroma cacao]
Length=649

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_002312436.1| PIN1-like family protein [Populus trichocarpa]
 gb|EEE89803.1| PIN1-like family protein [Populus trichocarpa]
Length=649

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VL+AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY+MNFRFIAAD+LQK+IML  L +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYSMNFRFIAADTLQKIIMLFALGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMY +YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYDDYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CDY40380.1| BnaA02g26940D [Brassica napus]
Length=562

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQKVIML +L +WA+ TK GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKVIMLVLLGLWASLTKKGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGVEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KJB15455.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=540

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CDY63826.1| BnaC02g47640D [Brassica napus]
Length=563

 Score =   344 bits (882),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML +L +WA+ TK GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVLLGLWASLTKKGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGVEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_011023284.1| PREDICTED: auxin efflux carrier component 3-like [Populus euphratica]
Length=649

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VL+AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY+MNFRFIAAD+LQK+IML  L +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYSMNFRFIAADTLQKIIMLFALGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMY +YSGSLMVQVVVLQCI+WYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYDDYSGSLMVQVVVLQCIVWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AAP59843.1| PIN1-like protein [Populus tomentosa]
Length=619

 Score =   345 bits (886),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI W+DLY VL+AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MICWNDLYNVLSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNF+FIAAD+LQK+IML  L +W NFTKNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   TNDPYAMNFKFIAADTLQKIIMLIALGIWTNFTKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LTAMYGTYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KJB15458.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=609

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KJB15460.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=577

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KHN43027.1| Auxin efflux carrier component 3 [Glycine soja]
Length=609

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW D Y V++AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  LA+W NF+ NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FK++SD
Sbjct  121  LIAMYGEYSGKLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKIDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KHG04074.1| Auxin efflux carrier component 3 -like protein [Gossypium arboreum]
Length=631

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK++ML VL +W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLLMLFVLGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_001267527.1| uncharacterized protein LOC100802247 [Glycine max]
 gb|AGJ95070.1| PIN3b [Glycine max]
Length=666

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW D Y V++AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML  LA+W NF+ NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   LNNPYAMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGLLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KJB15456.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=630

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009129244.1| PREDICTED: auxin efflux carrier component 4 [Brassica rapa]
Length=599

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML +L +WA+ TK GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLVLLGLWASLTKKGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKVESD
Sbjct  121  LIAMYGVEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETGASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006605369.1| PREDICTED: uncharacterized protein LOC100802247 isoform X2 [Glycine 
max]
Length=654

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW D Y V++AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML  LA+W NF+ NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   LNNPYAMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGLLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006605368.1| PREDICTED: uncharacterized protein LOC100802247 isoform X1 [Glycine 
max]
Length=664

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW D Y V++AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK+IML  LA+W NF+ NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   LNNPYAMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGLLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_007153407.1| hypothetical protein PHAVU_003G032500g [Phaseolus vulgaris]
 gb|ESW25401.1| hypothetical protein PHAVU_003G032500g [Phaseolus vulgaris]
Length=635

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLT+V+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYTVLTSVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMNFRFIAAD+LQK+IML  L +W N TK GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNFRFIAADTLQKIIMLFALTLWTNLTKTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_007045124.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
 gb|EOY00956.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
Length=697

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYSVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML VL +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLFVLGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_003529411.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Glycine 
max]
Length=665

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW D Y V++AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  LA+W NF+ NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FK++SD
Sbjct  121  LIAMYGEYSGKLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKIDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>dbj|BAD05032.1| putative auxin transport protein [Pisum sativum]
Length=617

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT+ DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITFKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPY MNFRFIAAD+LQK+IML  L++W  FTKNG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYQMNFRFIAADTLQKIIMLFALSLWTKFTKNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSG+LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDYSGTLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>dbj|BAH23798.1| putative auxin transport facilitator protein [Pisum sativum]
Length=617

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT+ DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITFKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPY MNFRFIAAD+LQK+IML  L++W  FTKNG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYQMNFRFIAADTLQKIIMLFALSLWTKFTKNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSG+LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDYSGTLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AAQ14258.1|AF247005_1 auxin efflux carrier [Momordica charantia]
Length=634

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITGKDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRF+AAD+LQK+IMLA L VWANFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFVAADTLQKIIMLAALTVWANFTKNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG  SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LQAMYGGNSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KJB15454.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=645

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_001276316.1| uncharacterized protein LOC100785146 [Glycine max]
 gb|AGJ95054.1| PIN3a [Glycine max]
Length=650

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW D Y V++AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  LA+W NF+ NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FK++SD
Sbjct  121  LIAMYGEYSGKLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKIDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KJB15457.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=637

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006583898.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Glycine 
max]
Length=662

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW D Y V++AVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWGDFYTVMSAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  LA+W NF+ NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   MNNPYEMNFRFIAADTLQKIIMLFALAIWTNFSANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FK++SD
Sbjct  121  LIAMYGEYSGKLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKIDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KJB15459.1| hypothetical protein B456_002G179000 [Gossypium raimondii]
Length=648

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYTVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIMLFALGLWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSG LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGMLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KEH40559.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=523

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  L++W  FTKNG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYQMNFRFIAADTLQKIIMLVALSLWTLFTKNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>emb|CDY41467.1| BnaA08g20690D [Brassica napus]
Length=584

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLY AMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYFAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYA+N RFIAAD+LQK+IML +L +WANFT +GSLEWSITIFSLSTLP+TLVMGIPL
Sbjct  61   TNNPYAINLRFIAADTLQKLIMLTLLTLWANFTHSGSLEWSITIFSLSTLPDTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYGEYS SLMVQVVVLQCI+WYT+LLFLFEYRGAK+LIMEQFPETAASIV FKV SD
Sbjct  121  LTAMYGEYSCSLMVQVVVLQCIVWYTILLFLFEYRGAKILIMEQFPETAASIVSFKVHSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_004498307.1| PREDICTED: auxin efflux carrier component 3-like [Cicer arietinum]
Length=633

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAM+LAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITLKDLYTVLTAVVPLYVAMLLAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPY MNFRFIAAD+LQK+IML  L++W NFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNNPYQMNFRFIAADTLQKIIMLFGLSLWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQ+VVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV SD
Sbjct  121  LIAMYGDYSGSLMVQIVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVGSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>dbj|BAO49658.1| putative auxin efflux carrier protein [Vigna angularis]
Length=636

 Score =   344 bits (882),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMNFRFIAAD+LQK++ML  L +W N TK GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNFRFIAADTLQKIMMLFALTLWTNLTKTGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28330.1| PIN-like protein, partial [Trochodendron aralioides]
Length=538

 Score =   340 bits (872),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W D Y VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWKDFYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY+MNFRFIAAD+LQK+IML VL +W NFTKNGSL+W ITIFSLSTLPNTL+MGIPL
Sbjct  61   MNDPYSMNFRFIAADTLQKIIMLVVLFIWTNFTKNGSLDWVITIFSLSTLPNTLIMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRSAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>gb|KFK33369.1| hypothetical protein AALP_AA5G004800 [Arabis alpina]
Length=605

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK+IML +LA+WAN TK+G+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIIMLFLLALWANLTKSGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKV+SD
Sbjct  121  LIAMYGIEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETGASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009356144.1| PREDICTED: auxin efflux carrier component 3-like [Pyrus x bretschneideri]
Length=659

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 175/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  L +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG     SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV
Sbjct  121  LIAMYGHKIPESGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKV  180

Query  656  ESDVVSLDG  682
            +SDVVSLDG
Sbjct  181  DSDVVSLDG  189



>gb|KFK33370.1| hypothetical protein AALP_AA5G004800 [Arabis alpina]
Length=604

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK+IML +LA+WAN TK+G+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIIMLFLLALWANLTKSGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG  +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPET ASIV FKV+SD
Sbjct  121  LIAMYGIEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETGASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_008243361.1| PREDICTED: auxin efflux carrier component 3-like [Prunus mume]
Length=662

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 175/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  L +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG     SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV
Sbjct  121  LIAMYGHKIPESGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKV  180

Query  656  ESDVVSLDG  682
            +SDVVSLDG
Sbjct  181  DSDVVSLDG  189



>ref|XP_007226967.1| hypothetical protein PRUPE_ppa002528mg [Prunus persica]
 gb|EMJ28166.1| hypothetical protein PRUPE_ppa002528mg [Prunus persica]
Length=662

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 175/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  L +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG     SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV
Sbjct  121  LIAMYGHKIPESGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKV  180

Query  656  ESDVVSLDG  682
            +SDVVSLDG
Sbjct  181  DSDVVSLDG  189



>emb|CDX91695.1| BnaC08g06140D [Brassica napus]
Length=571

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAVIPLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVIPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY +N RFIAAD+LQK+IML +L +WANFT++GSLEWSITIFSLSTLP+TLVMGIPL
Sbjct  61   TNNPYTINIRFIAADTLQKLIMLTLLTLWANFTRSGSLEWSITIFSLSTLPDTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYGEYS SLMVQVVVLQCIIW T+LLFLFEYRGAK+LIMEQFPETAASIV FKV SD
Sbjct  121  LTAMYGEYSCSLMVQVVVLQCIIWNTVLLFLFEYRGAKILIMEQFPETAASIVSFKVHSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_008454788.1| PREDICTED: auxin efflux carrier component 7-like [Cucumis melo]
Length=628

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAVIPLYVAMILAYGSVRWW+IF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITGKDLYTVLTAVIPLYVAMILAYGSVRWWRIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +WANFTKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLVALTIWANFTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG  SGSLMVQVVV+QCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LQAMYGGNSGSLMVQVVVMQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_004505266.1| PREDICTED: auxin efflux carrier component 3-like [Cicer arietinum]
Length=653

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VL AV+PLYVAMILAY SVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWGDLYTVLAAVVPLYVAMILAYSSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAM+FRFIAAD+LQK+IML  L++W NFT NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   INNPYAMDFRFIAADTLQKIIMLFALSIWTNFTANGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG+LM+QVVVLQCI+WYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGEYSGTLMIQVVVLQCIVWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AAM55299.1| auxin efflux carrier protein [Medicago truncatula]
 gb|KEH40560.1| auxin efflux carrier family transporter [Medicago truncatula]
Length=621

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  L++W  FTKNG+LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYQMNFRFIAADTLQKIIMLVALSLWTLFTKNGNLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGDYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>dbj|BAH47610.1| auxin:hydrogen symporter/transporter [Zinnia violacea]
Length=605

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT HD Y V+ A++PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITAHDFYTVMAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML VL +WA F KNGSLEW ITIFS+STLPNTLVMGIPL
Sbjct  61   LNNPYQMNFRFIAADTLQKIIMLVVLGLWAGFGKNGSLEWMITIFSVSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG+Y+GSLMVQVVV+QCIIWYTLLLFLFEYRGAK+LIMEQFPETA SIV FKVESD
Sbjct  121  LIAMYGDYAGSLMVQVVVMQCIIWYTLLLFLFEYRGAKILIMEQFPETAGSIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_008389216.1| PREDICTED: auxin efflux carrier component 3-like [Malus domestica]
Length=660

 Score =   342 bits (877),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 175/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRFIAAD+LQK+IML  L +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG     SGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV
Sbjct  121  LIAMYGHKIPESGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKV  180

Query  656  ESDVVSLDG  682
            +SDVVSLDG
Sbjct  181  DSDVVSLDG  189



>gb|AIF28356.1| PIN-like protein, partial [Posidonia australis]
Length=419

 Score =   334 bits (857),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW+DLY VL AV+PLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWNDLYTVLAAVVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK+IM  VL VW   T++G+++W ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIIMFVVLTVWVGVTRSGTIDWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG Y+GSLMVQVVVLQCIIWYT+LLFLFEYR AKMLIMEQFPETAASIV FKVESD
Sbjct  121  LIAMYGSYAGSLMVQVVVLQCIIWYTILLFLFEYRAAKMLIMEQFPETAASIVSFKVESD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_002526018.1| Auxin efflux carrier component, putative [Ricinus communis]
 gb|EEF36358.1| Auxin efflux carrier component, putative [Ricinus communis]
Length=646

 Score =   341 bits (875),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITGKDLYTVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK+IML  L +W N TKNGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNLRFIAADTLQKIIMLVALGLWTNLTKNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMY +Y+GSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYDKYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009110124.1| PREDICTED: auxin efflux carrier component 7-like [Brassica rapa]
Length=586

 Score =   339 bits (870),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDL  VLTAVIPLY AMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLCTVLTAVIPLYFAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYA+N RFIAAD+LQK+IML +L +WANFT +GSLEWSITIFSLSTLP+TLVMGIPL
Sbjct  61   TNNPYAINLRFIAADTLQKLIMLTLLTLWANFTHSGSLEWSITIFSLSTLPDTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYGEYS SLMVQVVVLQCI+WYT+LLFLFEYRGAK+LIMEQFPETAASIV FKV SD
Sbjct  121  LTAMYGEYSCSLMVQVVVLQCIVWYTILLFLFEYRGAKILIMEQFPETAASIVSFKVHSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|KCW86214.1| hypothetical protein EUGRSUZ_B02902 [Eucalyptus grandis]
Length=636

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 177/192 (92%), Gaps = 6/192 (3%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VL+AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIA
Sbjct  1    MITWHDLYTVLSAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+ YAMN RFIAAD+LQK+IMLAVLA+WANFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNLRFIAADTLQKLIMLAVLALWANFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYG------EYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVE  646
            L AMYG      + +G LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV 
Sbjct  121  LEAMYGPGASKRDDAGGLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVS  180

Query  647  FKVESDVVSLDG  682
            FKVESDVVSLDG
Sbjct  181  FKVESDVVSLDG  192



>gb|AIF28374.1| PIN-like protein, partial [Cunninghamia lanceolata]
Length=254

 Score =   327 bits (839),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISAKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN +FIAAD+LQK+IML VL +W  FT++GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   GNNPYTMNMKFIAADTLQKLIMLFVLGMWTTFTRSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP TAASIV FKV+SD
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFPHTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010044176.1| PREDICTED: auxin efflux carrier component 4-like [Eucalyptus 
grandis]
 gb|KCW86213.1| hypothetical protein EUGRSUZ_B02902 [Eucalyptus grandis]
Length=657

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 177/192 (92%), Gaps = 6/192 (3%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VL+AV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFIA
Sbjct  1    MITWHDLYTVLSAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+ YAMN RFIAAD+LQK+IMLAVLA+WANFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   KNDIYAMNLRFIAADTLQKLIMLAVLALWANFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYG------EYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVE  646
            L AMYG      + +G LMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV 
Sbjct  121  LEAMYGPGASKRDDAGGLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVS  180

Query  647  FKVESDVVSLDG  682
            FKVESDVVSLDG
Sbjct  181  FKVESDVVSLDG  192



>ref|XP_010672758.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=683

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VL A++PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNP+ MN  FIAAD+LQKVIML +LA+W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPWEMNLHFIAADTLQKVIMLVLLALWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010672759.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=677

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VL A++PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYTVLAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNP+ MN  FIAAD+LQKVIML +LA+W N T+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPWEMNLHFIAADTLQKVIMLVLLALWTNLTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG YSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LIAMYGPYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010260501.1| PREDICTED: auxin efflux carrier component 4-like [Nelumbo nucifera]
Length=644

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VL A++PLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISWKDLYTVLAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNF FIAAD+LQK+IML VL +WANFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYKMNFHFIAADTLQKIIMLVVLGIWANFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMY + +GSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP+TA SIV FKV+SD
Sbjct  121  LIAMYDKNAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPDTAGSIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28368.1| PIN-like protein, partial [Nageia nagi]
Length=276

 Score =   327 bits (837),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTP+QCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISAKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPEQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNF+FIAAD+LQKVIML VL +W +FTK+GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFKFIAADTLQKVIMLFVLGIWTSFTKSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG  SGSLMVQVVVLQCIIWYTL+LFLFEYRGAKMLIMEQFP TA SIV FKV+SD
Sbjct  121  LKAMYGGDSGSLMVQVVVLQCIIWYTLMLFLFEYRGAKMLIMEQFPTTAGSIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_004140432.1| PREDICTED: auxin efflux carrier component 7 [Cucumis sativus]
 gb|KGN50836.1| hypothetical protein Csa_5G284520 [Cucumis sativus]
Length=629

 Score =   338 bits (867),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAVIPLYVAMILAYGSVRWW+IF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITGKDLYTVLTAVIPLYVAMILAYGSVRWWRIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +WANFTKNGSLE  ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLVALTIWANFTKNGSLESMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG  SGSLMVQVVV+QCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LQAMYGGNSGSLMVQVVVMQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28377.1| PIN-like protein, partial [Amentotaxus argotaenia]
Length=526

 Score =   335 bits (858),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISAKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNF+FIAAD+LQK+IML VL +W  FTK+GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFKFIAADTLQKIIMLFVLGIWTTFTKSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP TAASIV FKV+SD
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFPHTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28378.1| PIN-like protein, partial [Taxus baccata]
Length=362

 Score =   329 bits (843),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISAKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +N+PY MNF+FIAAD+LQKVIML VL +W  FT++GSL W ITIFSLSTLPNTLVMGIPL
Sbjct  61   SNDPYTMNFKFIAADTLQKVIMLFVLGIWTTFTRSGSLGWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP TAASIV FKV+SD
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFPHTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009339666.1| PREDICTED: auxin efflux carrier component 3-like [Pyrus x bretschneideri]
Length=664

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 173/193 (90%), Gaps = 7/193 (4%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+IML  L +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY-------SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV  643
            LIAMYG           SLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV
Sbjct  121  LIAMYGHKYRHKRPDPASLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIV  180

Query  644  EFKVESDVVSLDG  682
             FKV+SDVVSLDG
Sbjct  181  SFKVDSDVVSLDG  193



>dbj|BAJ10462.1| auxin efflux facilitator [Cucumis sativus]
Length=629

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY V TAVIPLYVAMILAYGSVRWW+IF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITGKDLYTVFTAVIPLYVAMILAYGSVRWWRIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+IML  L +WANFTKNGSLE  ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIMLVALTIWANFTKNGSLESMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG  SGSLMVQVVV+QCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV+SD
Sbjct  121  LQAMYGGNSGSLMVQVVVMQCIIWYTLLLFLFEYRGAKILIMEQFPETAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28371.1| PIN-like protein, partial [Chamaecyparis lawsoniana]
Length=367

 Score =   328 bits (840),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISPKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MN +FIAAD+LQK+IML VL +W  FT++GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNLKFIAADTLQKLIMLFVLGIWTTFTRSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP TAASIV FKV+SD
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFPHTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006849750.1| PREDICTED: auxin efflux carrier component 7 [Amborella trichopoda]
 gb|ERN11331.1| hypothetical protein AMTR_s00024p00250140 [Amborella trichopoda]
Length=669

 Score =   337 bits (863),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWKDLYKVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+IML VLA+W N T+ G LEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIMLFVLALWTNLTRAGCLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMY EYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFP+TA SIV  KV+SD
Sbjct  121  LIAMYDEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPDTAGSIVSLKVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>ref|XP_010274646.1| PREDICTED: auxin efflux carrier component 4-like [Nelumbo nucifera]
Length=645

 Score =   336 bits (861),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VL A++PLYVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWGDLYTVLAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNF FIAAD+LQK+IM+ VL +WANFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNNPYKMNFHFIAADTLQKIIMIVVLGIWANFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMY   +G+LMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP+TA SIV FK++SD
Sbjct  121  LIAMYNPEAGNLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPDTAGSIVSFKIDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28366.1| PIN-like protein, partial [Prumnopitys andina]
Length=332

 Score =   325 bits (834),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTP+QCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISPKDLYTVLTAVVPLYVAMILAYGSVKWWKIFTPEQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNF+FIAAD+LQKVIML VL +W  FTK+GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFKFIAADTLQKVIMLFVLGIWTTFTKSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG  SGSLMVQVVVLQCIIWYTL+LFLFEYRGAKMLIMEQFP  A SIV FKV+SD
Sbjct  121  LKAMYGGASGSLMVQVVVLQCIIWYTLMLFLFEYRGAKMLIMEQFPTNAGSIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28364.1| PIN-like protein, partial [Keteleeria evelyniana]
Length=463

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VL AV+PLYVAMILAYGSV+WWKIFTP+QCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISAKDLYNVLVAVVPLYVAMILAYGSVKWWKIFTPEQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNF+FIAAD+LQKVIML VL +W NFT++GS EW ITIFS+STLPNTLVMGIPL
Sbjct  61   GNNPYTMNFKFIAADTLQKVIMLVVLGLWTNFTRSGSPEWMITIFSVSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG +SG LMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP+TAASIV FKV+SD
Sbjct  121  LKAMYGGFSGDLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009357915.1| PREDICTED: auxin efflux carrier component 3 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357993.1| PREDICTED: auxin efflux carrier component 3-like isoform X1 [Pyrus 
x bretschneideri]
Length=638

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 176/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRF+AAD+LQK+IML  L++W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFVAADTLQKIIMLFALSLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FK+
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKL  180

Query  656  ESDVVSLDG  682
            +SDVVSLDG
Sbjct  181  DSDVVSLDG  189



>ref|XP_009357924.1| PREDICTED: auxin efflux carrier component 3 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009358002.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Pyrus 
x bretschneideri]
Length=636

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 176/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRF+AAD+LQK+IML  L++W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFVAADTLQKIIMLFALSLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FK+
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKL  180

Query  656  ESDVVSLDG  682
            +SDVVSLDG
Sbjct  181  DSDVVSLDG  189



>ref|XP_008339560.1| PREDICTED: auxin efflux carrier component 3 isoform X1 [Malus 
domestica]
Length=636

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 175/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRFIAAD+LQK+IML  L +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FK+
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKL  180

Query  656  ESDVVSLDG  682
            +SDVVSLDG
Sbjct  181  DSDVVSLDG  189



>ref|XP_008339561.1| PREDICTED: auxin efflux carrier component 3 isoform X2 [Malus 
domestica]
Length=583

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 175/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRFIAAD+LQK+IML  L +W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLFALGLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FK+
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKL  180

Query  656  ESDVVSLDG  682
            +SDVVSLDG
Sbjct  181  DSDVVSLDG  189



>gb|AIF28299.1| PIN-like protein, partial [Papaver somniferum]
Length=374

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY V TAV+PLYVAM+LAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITGTDLYHVFTAVVPLYVAMVLAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPY MN RFIAADSLQK+I+L VLA W+ F+ NGSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYTMNLRFIAADSLQKIIVLVVLAFWSRFSANGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI+EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIVEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  ILSLDG  186



>ref|XP_009357931.1| PREDICTED: auxin efflux carrier component 3 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009358009.1| PREDICTED: auxin efflux carrier component 3-like isoform X3 [Pyrus 
x bretschneideri]
Length=583

 Score =   332 bits (852),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 176/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+WHDLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGIN FVAIFAVPLLSFHFI+
Sbjct  1    MISWHDLYNVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINSFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRF+AAD+LQK+IML  L++W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFVAADTLQKIIMLFALSLWTNFTRNGSLEWLITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG+    SGSLMVQ+VV+QCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FK+
Sbjct  121  LIAMYGKKIPESGSLMVQLVVVQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKL  180

Query  656  ESDVVSLDG  682
            +SDVVSLDG
Sbjct  181  DSDVVSLDG  189



>ref|XP_004297366.1| PREDICTED: auxin efflux carrier component 3-like [Fragaria vesca 
subsp. vesca]
Length=662

 Score =   334 bits (856),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 175/189 (93%), Gaps = 3/189 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W+DLY VLTAV+PLYVAMILAYGSVRWWKIF+ DQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISWNDLYKVLTAVVPLYVAMILAYGSVRWWKIFSTDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRFIAAD+LQK+IML  LA+W NFT+NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKIIMLFALALWTNFTRNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEY---SGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKV  655
            LIAMYG     +GSLMVQVVVLQCIIWYTLLLFLFEYRGAK+LIMEQFPETAASIV FKV
Sbjct  121  LIAMYGHQIPEAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIMEQFPETAASIVSFKV  180

Query  656  ESDVVSLDG  682
            +SDV+SLDG
Sbjct  181  DSDVMSLDG  189



>gb|KJB30812.1| hypothetical protein B456_005G161800 [Gossypium raimondii]
Length=325

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VL  VIPLYVAM +AYGSVRWWKIF+PD+CSGINRFV IFAVPLLSFHFI+
Sbjct  1    MISWGDLYTVLMVVIPLYVAMNIAYGSVRWWKIFSPDECSGINRFVTIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMN +FIAAD+LQK+IML  L +WANFT NGSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNVKFIAADTLQKLIMLFALGLWANFTTNGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYGEYSG LMVQVVVLQCIIWYTLLLFLFEY G KMLIMEQFPE AASIV FKV+SD
Sbjct  121  LIAMYGEYSGMLMVQVVVLQCIIWYTLLLFLFEYHGDKMLIMEQFPEMAASIVSFKVDSD  180

Query  665  VVSLD  679
            VVSLD
Sbjct  181  VVSLD  185



>gb|AIF28317.1| PIN-like protein, partial [Nuphar advena]
Length=349

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TA++PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITAADFYHVMTAMVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+I+LA+L VW N +K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKLIVLALLTVWTNVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAK+LI EQFP+TA SIV FKV+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKILITEQFPDTAGSIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28388.1| PIN-like protein, partial [Chamaecyparis hodginsii]
Length=544

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITWTDLYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNP+ MN RFIAADSLQK+I+L VL VWA  ++ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKIIVLVVLGVWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGAKMLIM+QFP+TAASIV FKV+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKMLIMDQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VLSLDG  186



>ref|XP_008775285.1| PREDICTED: auxin efflux carrier component 3-like isoform X2 [Phoenix 
dactylifera]
Length=509

 Score =   327 bits (839),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWW IF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRFIAAD+LQK+I+LA LA W   +  GSL W+IT+FSL+TLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKLIVLAALAAWTRLSSRGSLNWAITVFSLATLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG +SGSLMVQVVVLQCIIWYTLLLFLFEYR A++LI +QFP+TAASIV F+V+SD
Sbjct  121  LIAMYGGFSGSLMVQVVVLQCIIWYTLLLFLFEYRAARLLIADQFPDTAASIVSFRVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28430.1| PIN-like protein, partial [Amentotaxus argotaenia]
Length=347

 Score =   321 bits (823),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  140  DLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIAANNPY  319
            DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+ NNPY
Sbjct  1    DLYNVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFISTNNPY  60

Query  320  AMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPLLIAMY  499
             MN RFIAADSLQK++ L +L +W    KNGSLEW IT+FSLSTLPNTLVMGIPLL AMY
Sbjct  61   TMNLRFIAADSLQKIMTLLMLGIWTKVAKNGSLEWMITLFSLSTLPNTLVMGIPLLKAMY  120

Query  500  GEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESDVVSLD  679
            GE+SG LMVQVVVLQCIIWYTL+LFLFEYRGAK+LIMEQFP+TA SI+ F+VESDV+SLD
Sbjct  121  GEFSGDLMVQVVVLQCIIWYTLMLFLFEYRGAKLLIMEQFPDTAGSIISFRVESDVISLD  180

Query  680  G  682
            G
Sbjct  181  G  181



>gb|AIF28355.1| PIN-like protein, partial [Talbotia elegans]
Length=199

 Score =   315 bits (808),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VL+A++PLYVAMILAYGSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISWGDLYTVLSAMVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+I+LA LAVW+    +GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNFRFIAADTLQKIIVLAALAVWSCVAPSGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG ++G LMVQ+VVLQCIIWYTL+LFLFEYR A++LI++QFP+TA  IV F+V+ D
Sbjct  121  LIAMYGPFAGPLMVQIVVLQCIIWYTLMLFLFEYRAARLLIVDQFPDTAGDIVSFRVDPD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28334.1| PIN-like protein, partial [Euptelea pleiosperma]
Length=340

 Score =   319 bits (817),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  176  YVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIAANNPYAMNFRFIAADSL  355
            YVAMILAYGSVRWWKIF+PDQCSGINRFVAIFAVPLLSFHFI++N+PYAMNFRFIAAD+L
Sbjct  1    YVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFISSNDPYAMNFRFIAADTL  60

Query  356  QKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPLLIAMYGEYSGSLMVQVV  535
            QK+IML VL +W NFTKNGSLEW ITIFSLSTLPNTLVMGIPLLIAMY ++SGSLMVQVV
Sbjct  61   QKIIMLVVLGIWTNFTKNGSLEWMITIFSLSTLPNTLVMGIPLLIAMYXDFSGSLMVQVV  120

Query  536  VLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESDVVSLD  679
            VLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIV FKV+SDVVSLD
Sbjct  121  VLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVSFKVDSDVVSLD  168



>gb|AIF28308.1| PIN-like protein, partial [Maranta leuconeura]
Length=283

 Score =   316 bits (809),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WW+IF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISAGDLYHVLTAVVPLYVAMILAYGSVKWWRIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAADSLQKVI LAVLA WA  +  G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADSLQKVIALAVLAAWAKLSVRGCLEWAITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG  SGSLMVQ+VVLQCI+WYTL+LFLFE+RGA++LIMEQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGPDSGSLMVQIVVLQCIVWYTLMLFLFEFRGARLLIMEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|AIF28362.1| PIN-like protein, partial [Pseudotsuga menziesii]
Length=701

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI   DLY VL AV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MIKAADLYNVLVAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNF+FIAAD+LQK+IML VL +W NFT++GS EW ITIFS+STLPNTLVMGIPL
Sbjct  61   NNNPYTMNFKFIAADTLQKLIMLLVLGLWTNFTRSGSPEWMITIFSVSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG +SG+LMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP+TAASIV FKV+SD
Sbjct  121  LKAMYGPFSGNLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28295.1| PIN-like protein, partial [Nuphar advena]
Length=633

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITVSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQK+I+L VL VWAN ++ G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKLIVLGVLGVWANVSRRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGEYSGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP TA SIV FKV+SD
Sbjct  121  LKGMYGEYSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLITEQFPGTAGSIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|ACH91613.2| PIN-like auxin efflux carrier [Picea abies]
Length=699

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI   DLY VL AV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MIKAGDLYNVLVAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +N+PY MNF+FIAAD+LQK+IML VL +W NFT++GS EW ITIFS+STLPNTLVMGIPL
Sbjct  61   SNDPYTMNFKFIAADTLQKLIMLVVLGLWTNFTRSGSPEWMITIFSVSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG +SG+LMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFP+TAASIV FKV+SD
Sbjct  121  LKAMYGNFSGNLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_010924933.1| PREDICTED: probable auxin efflux carrier component 3a [Elaeis 
guineensis]
Length=648

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWW IF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRFIAAD+LQK+I+LA L  WA  +  GSL+W+IT+FSL+TLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKLIVLAALTAWARLSSRGSLDWAITVFSLATLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG +SGSLMVQVVVLQCIIWYTLLLFLFEYR A++LI +QFP TAASIV F+V+SD
Sbjct  121  LIAMYGGFSGSLMVQVVVLQCIIWYTLLLFLFEYRAARLLIADQFPNTAASIVSFRVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_008775284.1| PREDICTED: probable auxin efflux carrier component 3a isoform 
X1 [Phoenix dactylifera]
Length=646

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITWHDLY VLTAV+PLYVAMILAYGSVRWW IF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWHDLYTVLTAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNFRFIAAD+LQK+I+LA LA W   +  GSL W+IT+FSL+TLPNTLVMGIPL
Sbjct  61   TNDPYTMNFRFIAADTLQKLIVLAALAAWTRLSSRGSLNWAITVFSLATLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG +SGSLMVQVVVLQCIIWYTLLLFLFEYR A++LI +QFP+TAASIV F+V+SD
Sbjct  121  LIAMYGGFSGSLMVQVVVLQCIIWYTLLLFLFEYRAARLLIADQFPDTAASIVSFRVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_006339260.1| PREDICTED: auxin efflux carrier component 1-like [Solanum tuberosum]
Length=587

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITVSDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN+RFIAAD+LQKVI+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKVIVLVVLAIWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+T  SIV FK++SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTGGSIVSFKIDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VISLDG  186



>gb|AIF28369.1| PIN-like protein, partial [Manoao colensoi]
Length=649

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTP+QCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISGKDLYTVLTAVVPLYVAMILAYGSVKWWKIFTPEQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MNF+FIAAD+LQKVIML VL +W + TK+GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNFKFIAADTLQKVIMLFVLGIWTSCTKSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG  SGSLMVQVVVLQCIIWYTL+LFLFEYRGAKMLIMEQFP  AASIV FKV+SD
Sbjct  121  LKAMYGGESGSLMVQVVVLQCIIWYTLMLFLFEYRGAKMLIMEQFPNNAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28386.1| PIN-like protein, partial [Chamaecyparis lawsoniana]
Length=683

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITWTDLYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNP+ MN RFIAADSLQK+I+L VL VWA  ++ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKIIVLVVLGVWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGAKMLIM+QFP+TAASIV FKV+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKMLIMDQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VLSLDG  186



>ref|XP_009602422.1| PREDICTED: auxin efflux carrier component 1-like [Nicotiana tomentosiformis]
Length=592

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN+RFIAAD+LQKVI+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKVIVLFVLAIWSRMSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA  I+ FKV+SD
Sbjct  121  LKGMYGEASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGDIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|AIF28425.1| PIN-like protein, partial [Manoao colensoi]
Length=478

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI   DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MINGGDLYNVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMN RFIAADS+QK+I+L +L +W    KNGSLEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNLRFIAADSMQKIIILVLLGIWTKVGKNGSLEWMITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG +SG LMVQVVVLQCIIWYTL+LF+FEYRGAK+LIMEQFP+TAASI+ F+V+SD
Sbjct  121  LKAMYGSFSGDLMVQVVVLQCIIWYTLMLFMFEYRGAKLLIMEQFPDTAASIISFRVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>ref|NP_001234204.1| auxin efflux facilitator SlPIN7 [Solanum lycopersicum]
 gb|ADR30408.1| auxin efflux facilitator SlPIN7 [Solanum lycopersicum]
Length=586

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITVSDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN+RFIAAD+LQKVI+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKVIVLVVLAIWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+T  SIV FK++SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTGGSIVSFKIDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VISLDG  186



>gb|EYU18610.1| hypothetical protein MIMGU_mgv1a003446mg [Erythranthe guttata]
Length=584

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISLTDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN+RFIAAD+LQK+I+LAVLAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKLIVLAVLAVWSRTSARGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE SG+LMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TAASI+ F+V+SD
Sbjct  121  LKGMYGENSGTLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAASIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  ILSLDG  186



>gb|AIF28411.1| PIN-like protein, partial [Torreya taxifolia]
Length=279

 Score =   315 bits (806),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITAKDLYNVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NN YAMN+RFIAADSLQKVI+L VL  W  F K+GSLEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNIYAMNYRFIAADSLQKVIILLVLGTWTQFGKSGSLEWLITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG  SGSLMVQVVVLQ +IWYTL+L LFEYRGAKMLIMEQFP+TAA I+  +V+SD
Sbjct  121  LKGMYGASSGSLMVQVVVLQSVIWYTLMLVLFEYRGAKMLIMEQFPDTAAEIISLRVDSD  180

Query  665  VVSLDG  682
            +VSLDG
Sbjct  181  IVSLDG  186



>gb|AGG79241.1| auxin efflux facilitator PIN9 [Nicotiana tabacum]
Length=592

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN+RFIAAD+LQKVI+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKVIVLFVLAIWSRMSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA  I+ FKV+SD
Sbjct  121  LKGMYGEASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGDIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|AIF28415.1| PIN-like protein, partial [Juniperus scopulorum]
Length=243

 Score =   313 bits (802),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITAKDLYNVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NN YAMN+RFIAADSLQK I+L VL +WA F KNGSLEW IT+F+LSTLPNTLVMGIPL
Sbjct  61   TNNIYAMNYRFIAADSLQKGIVLLVLGIWAQFGKNGSLEWMITLFALSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQVVVLQ +IWYTL++ LFEYRGAK+LIMEQFPE+AA I   KV+SD
Sbjct  121  LKGMYGEFSGSLMVQVVVLQSVIWYTLMMVLFEYRGAKILIMEQFPESAAEITSLKVDSD  180

Query  665  VVSLDG  682
            VVSL G
Sbjct  181  VVSLHG  186



>gb|AIF28390.1| PIN-like protein, partial [Thuja plicata]
Length=680

 Score =   327 bits (838),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI W DLY V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MIGWRDLYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNP+ MN RFIAADSLQK+I+L VL VWA  ++ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKIIVLVVLGVWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLIM+QFP+TAASIV FKV+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIMDQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009803280.1| PREDICTED: auxin efflux carrier component 1-like [Nicotiana sylvestris]
Length=592

 Score =   324 bits (831),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN+RFIAAD+LQK+I+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKIIVLFVLAIWSRVSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA  I+ FKV+SD
Sbjct  121  LKGMYGEASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGDIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|AIF28376.1| PIN-like protein, partial [Thuja plicata]
Length=679

 Score =   327 bits (837),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISPKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MN +FIAAD+LQK+IML VL +W  FT++GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDPYTMNLKFIAADTLQKLIMLFVLGIWTTFTRSGSLEWMITIFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP  AASIV FKV+SD
Sbjct  121  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFPHNAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>emb|CDP06197.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   324 bits (831),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSVRWWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITITDLYHVLTAVVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQK+I+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKIIVLVVLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_011075451.1| PREDICTED: probable auxin efflux carrier component 1b isoform 
X2 [Sesamum indicum]
Length=564

 Score =   323 bits (828),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISITDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN+RFIAAD+LQK+I+LAVLAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNYRFIAADTLQKLIVLAVLAVWSRASSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|AIF28389.1| PIN-like protein, partial [Papuacedrus papuana]
Length=537

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY V+TAV+PLYVAMI+AYGSV+WWKIF+P+QCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITWRDLYHVMTAVVPLYVAMIMAYGSVKWWKIFSPEQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNP+ MN RFIAADSLQKVI+L V+  WA  ++ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKVIVLVVVGAWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI++QFP+TAASIV FKV+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIIDQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_002282220.1| PREDICTED: probable auxin efflux carrier component 1c [Vitis 
vinifera]
 emb|CAN64182.1| hypothetical protein VITISV_007800 [Vitis vinifera]
Length=604

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  D Y V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISLLDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+I+LAVLAVW+N +K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKIIVLAVLAVWSNVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGEYSGSLMVQ+VVLQCIIWYTL+LFLFEYRGAKMLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGEYSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IMSLDG  186



>ref|XP_011075450.1| PREDICTED: probable auxin efflux carrier component 1b isoform 
X1 [Sesamum indicum]
Length=595

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISITDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN+RFIAAD+LQK+I+LAVLAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYEMNYRFIAADTLQKLIVLAVLAVWSRASSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_009783366.1| PREDICTED: probable auxin efflux carrier component 1c [Nicotiana 
sylvestris]
Length=610

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            ANNPY MN RFIAAD+LQK+I+L  LA+WANF+K GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYTMNIRFIAADTLQKLIVLGALAIWANFSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FE+RGA+MLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>gb|AGG79244.1| auxin efflux facilitator PIN1b [Nicotiana tabacum]
Length=610

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            ANNPY MN RFIAAD+LQK+I+L  LA+WANF+K GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYTMNIRFIAADTLQKLIVLGALAIWANFSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FE+RGA+MLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>gb|AIF28385.1| PIN-like protein, partial [Sciadopitys verticillata]
Length=647

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI   DLY V+TAV+PLYVAMILAY SV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MINGRDLYHVMTAVVPLYVAMILAYASVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNP+ MN RFIAAD+LQK+IMLAVL +WA  ++ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   SNNPFDMNLRFIAADTLQKIIMLAVLGIWAKASRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLIM+QFP+TAASIV FKV+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIMDQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28349.1| PIN-like protein, partial [Sabal bermudana]
Length=635

 Score =   323 bits (829),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MITW DLY VLTAV+PLYVAMILAYGSVRWW IF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MITWQDLYTVLTAVVPLYVAMILAYGSVRWWGIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+I+LA L  W   +  GSL+W IT+FSL+TLPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIVLAALVAWTRLSSRGSLDWVITVFSLATLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG +SGSLMVQVVVLQCIIWYTLLLFLFEYR A++LI +QFP+TAASIV F+V+SD
Sbjct  121  LIAMYGAFSGSLMVQVVVLQCIIWYTLLLFLFEYRAARLLIADQFPDTAASIVSFRVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|NP_001234163.1| auxin efflux facilitator SlPIN1 [Solanum lycopersicum]
 gb|ADR30406.1| auxin efflux facilitator SlPIN1 [Solanum lycopersicum]
Length=611

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            ANNPYAMN RFIAAD+LQK+I+L VLAVWAN +K GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYAMNLRFIAADTLQKLIVLGVLAVWANVSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FE+RGA++LI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARLLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>gb|AIF28391.1| PIN-like protein, partial [Thujopsis dolabrata]
Length=680

 Score =   325 bits (832),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI W DLY V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MIGWTDLYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNP+ MN RFIAADSLQK+I+L VL +WA  ++ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPFKMNMRFIAADSLQKIIVLVVLGMWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLIM+QFP+TAASIV FKV+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIMDQFPDTAASIVSFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009371249.1| PREDICTED: probable auxin efflux carrier component 1b, partial 
[Pyrus x bretschneideri]
Length=587

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI++ DLY V+TAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISFTDLYHVVTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQKVI+LAVLAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKVIVLAVLAVWSRTSARGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIGEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_012083907.1| PREDICTED: probable auxin efflux carrier component 1b [Jatropha 
curcas]
 gb|KDP28042.1| hypothetical protein JCGZ_19719 [Jatropha curcas]
Length=592

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISLTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQK+I+L VLAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKIIVLVVLAVWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARILIGEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|NP_001234220.1| auxin efflux facilitator SlPIN9 [Solanum lycopersicum]
 dbj|BAJ09454.1| auxin efflux carrier [Solanum lycopersicum]
 gb|ADR30407.1| auxin efflux facilitator SlPIN9 [Solanum lycopersicum]
Length=594

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN+RFIAAD+LQK+I+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKIIVLFVLAIWSRVSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+T  SI+ FKV+SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTGGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_006362273.1| PREDICTED: auxin efflux carrier component 1-like [Solanum tuberosum]
Length=594

 Score =   322 bits (825),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN+RFIAAD+LQK+I+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYRFIAADTLQKIIVLFVLAIWSRVSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+T  SI+ FKV+SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTGGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|EYU24143.1| hypothetical protein MIMGU_mgv1a003175mg [Erythranthe guttata]
Length=603

 Score =   322 bits (825),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  D Y V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MISLGDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+I+LAVLAVWANF+K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLIVLAVLAVWANFSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SG+LMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP TA SIV   V+SD
Sbjct  121  LKGMYGDFSGNLMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFPGTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>ref|XP_006341527.1| PREDICTED: auxin efflux carrier component 1-like [Solanum tuberosum]
Length=614

 Score =   322 bits (826),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            ANNPY MN RFIAAD+LQK+I+L VLAVWAN +K GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYTMNIRFIAADTLQKLIVLGVLAVWANVSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FE+RGA++LI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARLLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>ref|XP_009614860.1| PREDICTED: probable auxin efflux carrier component 1c [Nicotiana 
tomentosiformis]
 gb|AGG79239.1| auxin efflux facilitator PIN1 [Nicotiana tabacum]
Length=610

 Score =   322 bits (825),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK+I+L  LA+WANF+K GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   GNNPYTMNIRFIAADTLQKLIVLGALAIWANFSKRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FE+RGA+MLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>ref|XP_009763717.1| PREDICTED: auxin efflux carrier component 2-like, partial [Nicotiana 
sylvestris]
Length=356

 Score =   314 bits (804),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI   D+Y VL A+IPLYVAMILAYGSVRWWKIFTPDQCSGINRFVA+FAVPLL FHFI+
Sbjct  1    MINGKDIYDVLAAIIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLGFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMN+ FIAADSLQKV++L+ L VW   TKNGSLEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNYHFIAADSLQKVVILSALFVWQAVTKNGSLEWMITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG++SG+LMVQ+VV+Q +IWYTL+LF+FEYRGAK+LI EQFPETAASI  F+VESD
Sbjct  121  LKAMYGDFSGNLMVQIVVMQSVIWYTLMLFMFEYRGAKLLIGEQFPETAASITSFRVESD  180

Query  665  VVSLDG  682
            VVSL+G
Sbjct  181  VVSLNG  186



>ref|XP_009609779.1| PREDICTED: probable auxin efflux carrier component 1b [Nicotiana 
tomentosiformis]
Length=592

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN++FIAAD+LQKVI+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYKFIAADTLQKVIVLVVLAIWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA  I+ FK++SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGDIISFKIDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>ref|XP_009785135.1| PREDICTED: probable auxin efflux carrier component 1b isoform 
X1 [Nicotiana sylvestris]
Length=591

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISLSDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN++FIAAD+LQKV++L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNYKFIAADTLQKVVVLGVLAIWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA  I+ FK++SD
Sbjct  121  LKGMYGQASGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLITEQFPDTAGDIISFKIDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VISLDG  186



>ref|XP_007028296.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
 gb|EOY08798.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
Length=594

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+I+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIVLVVLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGENSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIAEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_007028297.1| Auxin efflux carrier family protein isoform 3 [Theobroma cacao]
 gb|EOY08799.1| Auxin efflux carrier family protein isoform 3 [Theobroma cacao]
Length=595

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+I+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIVLVVLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGENSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIAEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_011084207.1| PREDICTED: probable auxin efflux carrier component 1c [Sesamum 
indicum]
Length=599

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITSSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPYAMN RFIAAD+LQK+++LA+LAVWAN +K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYAMNLRFIAADTLQKLMVLAILAVWANVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SG+LMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGDFSGALMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>gb|EPS70360.1| auxin efflux carrier [Genlisea aurea]
Length=579

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISLTDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFI AD+LQK+I+L V AVWA  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIGADTLQKLIVLCVFAVWARISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA  I+ F+V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLISEQFPDTAGDIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|KJB53043.1| hypothetical protein B456_008G290000 [Gossypium raimondii]
Length=534

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TA++PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPY MNFRFIAAD+LQK+I+L VLA+W+  +K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYTMNFRFIAADTLQKIIVLVVLAIWSKVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IMSLDG  186



>ref|XP_008362771.1| PREDICTED: probable auxin efflux carrier component 1b [Malus 
domestica]
 ref|XP_008362772.1| PREDICTED: probable auxin efflux carrier component 1b [Malus 
domestica]
Length=597

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI++ DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISFTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQKVI+L VLAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKVIVLLVLAVWSRTSARGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIGEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|AIF28354.1| PIN-like protein, partial [Talbotia elegans]
Length=616

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+W DLY VL+A++PLYVAMILAYGSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISWRDLYTVLSAMVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MNFRFIAAD+LQK+I+L+ LAVW+ F  +GSL+WSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNFRFIAADTLQKLIVLSALAVWSRFAPSGSLDWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            LIAMYG ++G LMVQ+VVLQCIIWYTL+LFLFEYR A++LI++QFP+TA  IV F+V+ D
Sbjct  121  LIAMYGPFAGPLMVQIVVLQCIIWYTLMLFLFEYRAARLLIVDQFPDTAGHIVSFRVDPD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>ref|XP_009341965.1| PREDICTED: probable auxin efflux carrier component 1b [Pyrus 
x bretschneideri]
Length=617

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI++ DLY V+TAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISFTDLYHVVTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQKVI+LAVLAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKVIVLAVLAVWSRTSARGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIGEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|KHN30345.1| Auxin efflux carrier component 1 [Glycine soja]
Length=595

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLWDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN++FIAADSLQK I+LAVL VW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYKFIAADSLQKAIVLAVLLVWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SG+LMVQ+VVLQCIIWYTL+LFLFEYRGA++LI+EQFP+TAASI+ FKV+SD
Sbjct  121  LKGMYGDASGTLMVQIVVLQCIIWYTLMLFLFEYRGARLLIVEQFPDTAASIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|NP_001267492.1| uncharacterized protein LOC100820506 [Glycine max]
 gb|AGJ95050.1| PIN10b [Glycine max]
Length=597

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLWDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN++FIAADSLQK I+LAVL VW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYKFIAADSLQKAIVLAVLLVWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SG+LMVQ+VVLQCIIWYTL+LFLFEYRGA++LI+EQFP+TAASI+ FKV+SD
Sbjct  121  LKGMYGDASGTLMVQIVVLQCIIWYTLMLFLFEYRGARLLIVEQFPDTAASIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_008345946.1| PREDICTED: auxin efflux carrier component 1-like [Malus domestica]
Length=248

 Score =   308 bits (790),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY MN RFIAAD+LQK+I+LAVL VW   +K G LEW+IT+FS+STLPNTLVMGIPL
Sbjct  61   TNDPYNMNTRFIAADTLQKLIVLAVLGVWTKVSKRGCLEWTITLFSVSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA++LI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARLLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IMSLDG  186



>ref|XP_008387342.1| PREDICTED: probable auxin efflux carrier component 1b [Malus 
domestica]
Length=598

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI++ DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISFTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQK+I+LAVLAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKIIVLAVLAVWSRTSARGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ F V+SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIGEQFPDTAGSIISFXVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|KJB46194.1| hypothetical protein B456_007G352200 [Gossypium raimondii]
Length=585

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN +FIAAD+LQK+I+L +LA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLKFIAADTLQKLIVLVLLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+YSGSLMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIAEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VLSLDG  186



>dbj|BAO49655.1| putative auxin efflux carrier protein [Vigna angularis]
Length=586

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLLDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN++FIAADSLQK I+LAVL VW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYKFIAADSLQKAIVLAVLFVWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SG+LMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI+EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGDASGTLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIVEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  ILSLDG  186



>ref|XP_007162070.1| hypothetical protein PHAVU_001G121100g [Phaseolus vulgaris]
 gb|ESW34064.1| hypothetical protein PHAVU_001G121100g [Phaseolus vulgaris]
Length=585

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLLDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN++FIAADSLQK I+LAVL VW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYKFIAADSLQKTIVLAVLFVWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SG+LMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI+EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGDASGTLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIVEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  ILSLDG  186



>gb|KJB46196.1| hypothetical protein B456_007G352200 [Gossypium raimondii]
Length=576

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN +FIAAD+LQK+I+L +LA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLKFIAADTLQKLIVLVLLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+YSGSLMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIAEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VLSLDG  186



>ref|XP_002527704.1| Auxin efflux carrier component, putative [Ricinus communis]
 gb|EEF34703.1| Auxin efflux carrier component, putative, partial [Ricinus communis]
Length=636

 Score =   321 bits (822),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D+Y VL A++PLYVAMILAYGSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITGKDIYDVLAAIVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +N+PYAMN+RFIAADSLQKV++LA L +W  F+K+GSLEW IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNDPYAMNYRFIAADSLQKVVILAALFLWQAFSKSGSLEWMITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYGE+SGSLMVQ+VVLQ +IWYTL+LF+FEYRGAK+LI EQFPETA SI  F+V+SD
Sbjct  121  LKAMYGEFSGSLMVQIVVLQSVIWYTLMLFMFEYRGAKLLISEQFPETAGSITSFRVDSD  180

Query  665  VVSLDG  682
            VVSL+G
Sbjct  181  VVSLNG  186



>ref|XP_006826885.1| PREDICTED: probable auxin efflux carrier component 1c [Amborella 
trichopoda]
 gb|ERM94122.1| hypothetical protein AMTR_s00010p00137670 [Amborella trichopoda]
Length=627

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MISLLDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            AN+PY+MNFRFIAAD+LQK+I+L VLAVW   +K G+LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   ANDPYSMNFRFIAADTLQKLIVLGVLAVWCRVSKRGTLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI EQFP+TAA+I  F V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKLLITEQFPDTAAAIKSFTVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VLSLDG  186



>ref|XP_007204212.1| hypothetical protein PRUPE_ppa003159mg [Prunus persica]
 gb|EMJ05411.1| hypothetical protein PRUPE_ppa003159mg [Prunus persica]
Length=597

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI++ DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISFTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQKVI+L  LAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKVIVLVALAVWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIGEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_008240670.1| PREDICTED: probable auxin efflux carrier component 1b [Prunus 
mume]
Length=596

 Score =   319 bits (818),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI++ DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISFTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAAD+LQKVI+L  LAVW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADTLQKVIVLVALAVWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGDASGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIGEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>emb|CDO98348.1| unnamed protein product [Coffea canephora]
Length=602

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLVDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            ANNPY MN RFIAAD+LQK+I+LAVLAVW   +K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   ANNPYTMNLRFIAADTLQKIIVLAVLAVWTKVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>ref|XP_010271843.1| PREDICTED: probable auxin efflux carrier component 1b [Nelumbo 
nucifera]
Length=608

 Score =   320 bits (819),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITGTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK++ L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIMALTVLAIWSRVSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI+EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIVEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_007028295.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
 gb|EOY08797.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
Length=702

 Score =   322 bits (825),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 190/246 (77%), Gaps = 22/246 (9%)
 Frame = +2

Query  5    LSFSEQYCFHWFREQ-----SVNH*SCITTFFSPH---------------STLLLRPRRK  124
            +SFS    FH+  ++       NH  CI + FS                 S  LL+    
Sbjct  1    MSFSCHSLFHFLTKKIPENCEKNHTKCIPSSFSCEIISGFCILALHIYLSSGFLLQ--YT  58

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  59   MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  118

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+I+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  119  TNNPYAMNLRFIAADTLQKIIVLVVLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  178

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ FKV+SD
Sbjct  179  LKGMYGENSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIAEQFPDTAGSIISFKVDSD  238

Query  665  VVSLDG  682
            ++SLDG
Sbjct  239  IISLDG  244



>gb|AGA83304.1| UML [Lotus japonicus]
Length=588

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISASDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN+RFIAADSLQK I+LAVL +W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYRFIAADSLQKTIVLAVLLIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SG+LMVQ+VVLQCIIWYTL+LFLFEYRGA++LI+EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGDASGTLMVQIVVLQCIIWYTLMLFLFEYRGARLLIVEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  ILSLDG  186



>gb|KJB46195.1| hypothetical protein B456_007G352200 [Gossypium raimondii]
 gb|KJB46197.1| hypothetical protein B456_007G352200 [Gossypium raimondii]
Length=581

 Score =   318 bits (816),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN +FIAAD+LQK+I+L +LA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLKFIAADTLQKLIVLVLLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+YSGSLMVQ+VVLQCIIWYTL+LFLFEYRGAK+LI EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGAKLLIAEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VLSLDG  186



>gb|AIF28305.1| PIN-like protein, partial [Platanus occidentalis]
Length=589

 Score =   319 bits (817),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISGTDLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN RFIAAD+LQK+I+L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNLRFIAADTLQKIIVLVVLAIWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SG+LMVQ+VVLQCIIWYTL+LFLFEYRGA++LI+EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGDSSGTLMVQIVVLQCIIWYTLMLFLFEYRGARLLIVEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>emb|CBI32787.3| unnamed protein product [Vitis vinifera]
Length=557

 Score =   318 bits (814),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI   DLY VLT+V+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MIAITDLYHVLTSVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMN+RFIAAD+LQK+I+L VLA+W+  +  G LEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYAMNYRFIAADTLQKIIVLVVLAIWSRVSSRGCLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGEYSG+LMVQ+VVLQCIIWYTL+LFLFEYRGA++LI+EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGEYSGTLMVQIVVLQCIIWYTLMLFLFEYRGARLLIVEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VISLDG  186



>gb|AIF28395.1| PIN-like protein, partial [Taxus baccata]
Length=608

 Score =   319 bits (818),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY V+TAV+PLYVAMILA+GSVRWWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITGTDLYHVMTAVVPLYVAMILAFGSVRWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK+I++ VL  WA  ++ GSLEW IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNNPYQMNLRFIAADTLQKIIVVVVLGTWAKVSRRGSLEWMITLFSLSSLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG  SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLIM+QFP+TAASI+ FKV+SD
Sbjct  121  LKGMYGASSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLIMDQFPDTAASIISFKVDSD  180

Query  665  VVSLDG  682
            VVSLDG
Sbjct  181  VVSLDG  186



>gb|AIF28304.1| PIN-like protein, partial [Platanus occidentalis]
Length=603

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITGADLYHVLTAVVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK+++L VLA+W+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKIMVLVVLAIWSRISSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LFLFEYRGA++LI EQFP+TA SI+ F+V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFLFEYRGARLLIGEQFPDTAGSIISFRVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>gb|KJB53042.1| hypothetical protein B456_008G290000 [Gossypium raimondii]
Length=604

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TA++PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFIA
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIA  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +NNPY MNFRFIAAD+LQK+I+L VLA+W+  +K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNNPYTMNFRFIAADTLQKIIVLVVLAIWSKVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IMSLDG  186



>gb|KHN08891.1| Putative auxin efflux carrier component 1c [Glycine soja]
Length=594

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLLDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPYAMN++FIAAD+LQK I+LAVL VW+  +  GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYAMNYKFIAADTLQKAIVLAVLLVWSRTSSRGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+ SG+LMVQ+VVLQCIIWYTL+LFLFEYRGA++LI+EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGDDSGTLMVQIVVLQCIIWYTLMLFLFEYRGARLLIVEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



>ref|XP_007036847.1| Auxin efflux facilitator isoform 2, partial [Theobroma cacao]
 gb|EOY21348.1| Auxin efflux facilitator isoform 2, partial [Theobroma cacao]
Length=476

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TA++PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
            +N+PY+MNFRFIAAD+LQK+I+L VLAVW   +K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   SNDPYSMNFRFIAADTLQKIIVLVVLAVWTKVSKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IMSLDG  186



>ref|XP_011660216.1| PREDICTED: auxin efflux carrier component 1-like isoform X1 [Cucumis 
sativus]
Length=618

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK+I+LAVLAVW+N +K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLIVLAVLAVWSNISKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IMSLDG  186



>ref|NP_001275530.1| auxin efflux carrier component 1-like [Cucumis sativus]
 dbj|BAC41319.1| PIN1-like auxin transport protein [Cucumis sativus]
 gb|KGN64175.1| hypothetical protein Csa_1G042820 [Cucumis sativus]
Length=617

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MIT  D Y V+TAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             NNPY MN RFIAAD+LQK+I+LAVLAVW+N +K G LEW+IT+FSLSTLPNTLVMGIPL
Sbjct  61   TNNPYTMNLRFIAADTLQKLIVLAVLAVWSNISKRGCLEWTITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG++SGSLMVQ+VVLQCIIWYTL+LF+FEYRGA+MLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGDFSGSLMVQIVVLQCIIWYTLMLFMFEYRGARMLISEQFPDTAGSIVSIHVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IMSLDG  186



>ref|XP_010263760.1| PREDICTED: probable auxin efflux carrier component 1c [Nelumbo 
nucifera]
Length=609

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI   D Y V+TA++PLYVAMILAYGSV+WWKIF+PDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MINLSDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PYAMNFRFIAAD+LQK+I+L +LAVW NF+K G LEW+IT+FSLS+LPNTLVMGIPL
Sbjct  61   TNDPYAMNFRFIAADTLQKLIVLGILAVWTNFSKRGCLEWTITLFSLSSLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYGE+SGSLMVQ+VVLQCIIWYTL+LF+FEYRGAKMLI EQFP+TA SIV   V+SD
Sbjct  121  LKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEYRGAKMLISEQFPDTAGSIVSIAVDSD  180

Query  665  VVSLDG  682
            V+SLDG
Sbjct  181  VMSLDG  186



>gb|AIF28375.1| PIN-like protein, partial [Chamaecyparis hodginsii]
Length=533

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 168/186 (90%), Gaps = 4/186 (2%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVAIFAVPLLSFHFI+
Sbjct  1    MISAKDLYSVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVAIFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+P     +FIAAD+LQK+IML VL +W  FT++GSLEW ITIFSLSTLPNTLVMGIPL
Sbjct  61   TNDP----LKFIAADTLQKLIMLFVLGIWTTFTRSGSLEWMITIFSLSTLPNTLVMGIPL  116

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L AMYG++SGSLMVQVVVLQCIIWYTLLLFLFEYR AKMLIMEQFP TAASIV FKV+SD
Sbjct  117  LKAMYGDFSGSLMVQVVVLQCIIWYTLLLFLFEYRAAKMLIMEQFPHTAASIVSFKVDSD  176

Query  665  VVSLDG  682
            VVSLDG
Sbjct  177  VVSLDG  182



>ref|XP_006482066.1| PREDICTED: probable auxin efflux carrier component 1c-like [Citrus 
sinensis]
Length=588

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  125  MITWHDLYVVLTAVIPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAIFAVPLLSFHFIA  304
            MI+  DLY VLTAV+PLYVAMILAYGSV+WWKIFTPDQCSGINRFVA+FAVPLLSFHFI+
Sbjct  1    MISATDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIS  60

Query  305  ANNPYAMNFRFIAADSLQKVIMLAVLAVWANFTKNGSLEWSITIFSLSTLPNTLVMGIPL  484
             N+PY+MNF+FI AD++QK+I+L +LA+W+  + +GSLEWSIT+FSLSTLPNTLVMGIPL
Sbjct  61   TNDPYSMNFKFILADTVQKIIVLLLLAIWSKLSSSGSLEWSITLFSLSTLPNTLVMGIPL  120

Query  485  LIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKMLIMEQFPETAASIVEFKVESD  664
            L  MYG+YSGSLMVQ+VVLQCIIWYTL+LFLFEYRGA+MLI EQFP+TA SI+ FKV+SD
Sbjct  121  LKGMYGDYSGSLMVQIVVLQCIIWYTLMLFLFEYRGARMLIAEQFPDTAGSIISFKVDSD  180

Query  665  VVSLDG  682
            ++SLDG
Sbjct  181  IISLDG  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1175390270628